BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77940_g1_i1 len=1643 path=[1:0-1642]

Length=1643
                                                                      Score     E

ref|XP_004237819.1|  PREDICTED: cytochrome P450 71A1-like               700   0.0      
ref|XP_006363444.1|  PREDICTED: cytochrome P450 71A1-like               697   0.0      
ref|XP_009591954.1|  PREDICTED: cytochrome P450 71A1-like               683   0.0      
ref|XP_006363445.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    676   0.0      
ref|XP_004237820.1|  PREDICTED: cytochrome P450 71A1-like               676   0.0      
ref|XP_006363443.1|  PREDICTED: cytochrome P450 71A1-like               671   0.0      
ref|XP_010320112.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    671   0.0      
ref|XP_004238495.1|  PREDICTED: cytochrome P450 71A1-like               663   0.0      
ref|XP_006359061.1|  PREDICTED: cytochrome P450 71A1-like               660   0.0      
ref|XP_006367943.1|  PREDICTED: cytochrome P450 71A1-like               660   0.0      
ref|XP_009626729.1|  PREDICTED: flavonoid 3'-monooxygenase-like         650   0.0      
emb|CDP21012.1|  unnamed protein product                                643   0.0      
ref|XP_006350345.1|  PREDICTED: cytochrome P450 71A1-like               641   0.0      
ref|XP_009766074.1|  PREDICTED: flavonoid 3'-monooxygenase-like         641   0.0      
ref|XP_004237821.1|  PREDICTED: cytochrome P450 71A1-like               639   0.0      
gb|ABC69388.1|  CYP92B2v2                                               639   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009605293.1|  PREDICTED: flavonoid 3'-monooxygenase-like         638   0.0      
gb|ABC69387.1|  CYP92B2v3                                               638   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69386.1|  CYP92B2v1                                               636   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006340220.1|  PREDICTED: cytochrome P450 71A1-like               634   0.0      
emb|CDP18923.1|  unnamed protein product                                629   0.0      
gb|ABC69418.1|  CYP92B3                                                 630   0.0      Nicotiana tabacum [American tobacco]
emb|CDP20032.1|  unnamed protein product                                630   0.0      
ref|XP_006355423.1|  PREDICTED: flavonoid 3'-monooxygenase-like         629   0.0      
ref|XP_004250647.1|  PREDICTED: flavonoid 3'-monooxygenase-like         625   0.0      
ref|XP_011095827.1|  PREDICTED: flavonoid 3'-monooxygenase-like         625   0.0      
ref|XP_007012628.1|  Cytochrome P450 superfamily protein isoform 1      620   0.0      
ref|XP_011070722.1|  PREDICTED: flavonoid 3'-monooxygenase-like         609   0.0      
ref|XP_006475100.1|  PREDICTED: flavonoid 3'-monooxygenase-like         607   0.0      
ref|XP_007012629.1|  Cytochrome P450 superfamily protein isoform 2      605   0.0      
ref|XP_002278462.1|  PREDICTED: flavonoid 3'-monooxygenase              603   0.0      Vitis vinifera
emb|CAN82000.1|  hypothetical protein VITISV_023195                     603   0.0      Vitis vinifera
ref|XP_004288989.1|  PREDICTED: flavonoid 3'-monooxygenase-like         603   0.0      
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               601   0.0      Vitis vinifera
ref|XP_011095838.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    595   0.0      
ref|XP_008242245.1|  PREDICTED: flavonoid 3'-monooxygenase-like         592   0.0      
gb|EYU22742.1|  hypothetical protein MIMGU_mgv1a004987mg                590   0.0      
emb|CAN77776.1|  hypothetical protein VITISV_021888                     588   0.0      Vitis vinifera
ref|XP_011095822.1|  PREDICTED: flavonoid 3'-monooxygenase-like         588   0.0      
ref|XP_007203042.1|  hypothetical protein PRUPE_ppa022777mg             588   0.0      
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             587   0.0      
ref|XP_002277926.2|  PREDICTED: flavonoid 3'-monooxygenase              587   0.0      Vitis vinifera
ref|XP_007203722.1|  hypothetical protein PRUPE_ppa019048mg             584   0.0      
ref|XP_009337219.1|  PREDICTED: flavonoid 3'-monooxygenase-like         581   0.0      
ref|XP_002516018.1|  flavonoid 3-hydroxylase, putative                  580   0.0      Ricinus communis
ref|XP_008354562.1|  PREDICTED: flavonoid 3'-monooxygenase-like         580   0.0      
ref|XP_008242247.1|  PREDICTED: flavonoid 3'-monooxygenase-like         580   0.0      
ref|XP_008337887.1|  PREDICTED: flavonoid 3'-monooxygenase-like         579   0.0      
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               578   0.0      
ref|XP_006426680.1|  hypothetical protein CICLE_v10025391mg             577   0.0      
ref|XP_008242319.1|  PREDICTED: flavonoid 3'-monooxygenase-like         577   0.0      
ref|XP_007204134.1|  hypothetical protein PRUPE_ppa023335mg             577   0.0      
ref|XP_002277972.1|  PREDICTED: flavonoid 3'-monooxygenase-like         577   0.0      Vitis vinifera
ref|XP_009359731.1|  PREDICTED: flavonoid 3'-monooxygenase-like         575   0.0      
gb|KDO65002.1|  hypothetical protein CISIN_1g010388mg                   574   0.0      
ref|XP_006465906.1|  PREDICTED: cytochrome P450 71A1-like               574   0.0      
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               574   0.0      
ref|XP_008242249.1|  PREDICTED: flavonoid 3'-monooxygenase-like         573   0.0      
ref|XP_007204846.1|  hypothetical protein PRUPE_ppa026438mg             572   0.0      
ref|XP_004288988.1|  PREDICTED: flavonoid 3'-monooxygenase-like         572   0.0      
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         572   0.0      
ref|XP_008388825.1|  PREDICTED: flavonoid 3'-monooxygenase-like         571   0.0      
ref|XP_008344040.1|  PREDICTED: flavonoid 3'-monooxygenase-like         570   0.0      
gb|KHG15722.1|  Cytochrome P450                                         569   0.0      
gb|KDP40690.1|  hypothetical protein JCGZ_24689                         568   0.0      
gb|AJD25215.1|  cytochrome P450 CYP92B28                                568   0.0      
ref|XP_009375474.1|  PREDICTED: cytochrome P450 71A1-like               568   0.0      
ref|XP_004288987.1|  PREDICTED: flavonoid 3'-monooxygenase-like         568   0.0      
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               568   0.0      
ref|XP_002521317.1|  flavonoid 3-hydroxylase, putative                  567   0.0      Ricinus communis
ref|XP_007202994.1|  hypothetical protein PRUPE_ppa019215mg             567   0.0      
ref|XP_007024645.1|  Cytochrome P450 superfamily protein                567   0.0      
ref|XP_008354460.1|  PREDICTED: flavonoid 3'-monooxygenase-like         566   0.0      
gb|AJD25216.1|  cytochrome P450 CYP92B29                                565   0.0      
gb|AGT17103.1|  flavonoid 3-monooxygenase                               565   0.0      
ref|XP_004956938.1|  PREDICTED: cytochrome P450 71A1-like               563   0.0      
ref|XP_006369135.1|  hypothetical protein POPTR_0001s16800g             563   0.0      
emb|CDP20453.1|  unnamed protein product                                559   0.0      
ref|XP_010917481.1|  PREDICTED: cytochrome P450 71A1-like               562   0.0      
ref|XP_002462455.1|  hypothetical protein SORBIDRAFT_02g025850          561   0.0      Sorghum bicolor [broomcorn]
gb|ABA01477.1|  cytochrome P450 DDWF1                                   560   0.0      Gossypium hirsutum [American cotton]
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               560   0.0      
ref|XP_008792870.1|  PREDICTED: cytochrome P450 71A1-like               560   0.0      
ref|XP_002303241.1|  hypothetical protein POPTR_0003s06460g             560   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002516270.1|  flavonoid 3-hydroxylase, putative                  560   0.0      Ricinus communis
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               559   0.0      
ref|NP_001147572.1|  flavonoid 3-monooxygenase                          559   0.0      Zea mays [maize]
ref|XP_004303697.1|  PREDICTED: flavonoid 3'-monooxygenase-like         558   0.0      
ref|XP_004238498.1|  PREDICTED: cytochrome P450 71A2-like isoform X2    556   0.0      
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               556   0.0      
gb|ADC34701.1|  flavonoid 3' hydroxylase                                556   0.0      
ref|XP_011071968.1|  PREDICTED: cytochrome P450 71A1                    555   0.0      
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               554   0.0      
ref|XP_004144428.1|  PREDICTED: flavonoid 3'-monooxygenase-like         553   0.0      
gb|ADD84653.1|  CYP92A46                                                553   0.0      Scoparia dulcis [escobilla]
ref|XP_010086796.1|  Cytochrome P450 71A1                               553   0.0      
ref|XP_008652774.1|  PREDICTED: cytochrome P450 71A1-like               553   0.0      
ref|XP_002460274.1|  hypothetical protein SORBIDRAFT_02g025840          553   0.0      Sorghum bicolor [broomcorn]
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               553   0.0      
ref|XP_006426678.1|  hypothetical protein CICLE_v10025392mg             553   0.0      
ref|XP_004956937.1|  PREDICTED: cytochrome P450 71A1-like               553   0.0      
gb|EAZ09259.1|  hypothetical protein OsI_31532                          552   0.0      Oryza sativa Indica Group [Indian rice]
gb|KHF98582.1|  Flavonoid 3',5'-hydroxylase                             551   0.0      
gb|ABG74350.1|  cytochrome P450                                         551   0.0      Capsicum chinense [bonnet pepper]
ref|XP_006465907.1|  PREDICTED: cytochrome P450 71A1-like               550   0.0      
ref|NP_001063285.1|  Os09g0441400                                       550   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09260.1|  hypothetical protein OsI_31533                          550   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            550   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               549   0.0      
ref|XP_004510480.1|  PREDICTED: flavonoid 3'-monooxygenase-like         549   0.0      
emb|CBI35858.3|  unnamed protein product                                547   0.0      
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               549   0.0      
ref|XP_006436412.1|  hypothetical protein CICLE_v10031266mg             548   0.0      
ref|XP_004168558.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    548   0.0      
ref|XP_011046010.1|  PREDICTED: flavonoid 3'-monooxygenase-like         547   0.0      
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               547   0.0      
gb|KDO48981.1|  hypothetical protein CISIN_1g010365mg                   547   0.0      
ref|XP_010239382.1|  PREDICTED: cytochrome P450 71A1-like               547   0.0      
ref|XP_003547756.2|  PREDICTED: flavonoid 3'-monooxygenase-like         548   0.0      
ref|XP_003627305.1|  Flavonoid 3',5'-hydroxylase                        546   0.0      
ref|XP_009607330.1|  PREDICTED: cytochrome P450 71A1-like               546   0.0      
ref|XP_004235547.1|  PREDICTED: cytochrome P450 71A1-like               546   0.0      
gb|AAK62346.1|  elicitor-inducible cytochrome P450                      545   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69383.1|  CYP92A2v4                                               545   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009771565.1|  PREDICTED: cytochrome P450 71A1-like               545   0.0      
ref|XP_011039208.1|  PREDICTED: cytochrome P450 71A1-like               544   0.0      
ref|XP_011036442.1|  PREDICTED: cytochrome P450 71A1-like               545   0.0      
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                543   0.0      
gb|AFK47419.1|  unknown                                                 543   0.0      
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               543   0.0      
ref|XP_006468115.1|  PREDICTED: flavonoid 3'-monooxygenase-like         543   0.0      
gb|ABC69382.1|  CYP92A2v2                                               542   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69381.1|  CYP92A2v2                                               541   0.0      Nicotiana tabacum [American tobacco]
ref|XP_003578185.1|  PREDICTED: cytochrome P450 71A1-like               541   0.0      
ref|XP_004235548.1|  PREDICTED: cytochrome P450 71A1-like               540   0.0      
ref|NP_001063284.1|  Os09g0441100                                       540   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006363446.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    537   0.0      
ref|XP_010685305.1|  PREDICTED: cytochrome P450 71A1-like               540   0.0      
ref|XP_008242317.1|  PREDICTED: flavonoid 3'-monooxygenase-like         539   0.0      
gb|AET01782.2|  cytochrome P450 family protein                          539   0.0      
ref|XP_006342921.1|  PREDICTED: cytochrome P450 71A1-like               539   0.0      
ref|XP_011035728.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    537   0.0      
gb|KDO48980.1|  hypothetical protein CISIN_1g010365mg                   537   0.0      
gb|AER39774.1|  CYP92A44-4                                              537   0.0      
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         537   0.0      
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         537   0.0      
gb|AGV54723.1|  flavonoid 3'-monooxygenase-like protein                 536   0.0      
ref|XP_011035730.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    536   0.0      
ref|XP_004148565.1|  PREDICTED: flavonoid 3'-monooxygenase-like         536   0.0      
gb|AAG44132.1|AF218296_1  cytochrome P450                               534   0.0      Pisum sativum [garden pea]
ref|XP_011035092.1|  PREDICTED: flavonoid 3'-monooxygenase-like         534   0.0      
ref|XP_003627307.1|  Flavonoid 3',5'-hydroxylase                        534   0.0      
ref|XP_008678485.1|  PREDICTED: flavonoid 3'-monooxygenase-like         533   0.0      
ref|XP_007135432.1|  hypothetical protein PHAVU_010G128900g             533   0.0      
ref|XP_006381618.1|  hypothetical protein POPTR_0006s14370g             532   0.0      
gb|AER39773.1|  CYP92A44-3                                              532   0.0      
ref|XP_002324180.2|  hypothetical protein POPTR_0018s05370g             531   0.0      Populus trichocarpa [western balsam poplar]
gb|AFW61881.1|  putative cytochrome P450 superfamily protein            533   1e-180   
ref|XP_002445595.1|  hypothetical protein SORBIDRAFT_07g022320          531   2e-180   Sorghum bicolor [broomcorn]
ref|XP_002303387.2|  hypothetical protein POPTR_0003s06510g             530   2e-180   Populus trichocarpa [western balsam poplar]
ref|XP_008344136.1|  PREDICTED: flavonoid 3'-monooxygenase-like         529   3e-180   
gb|EMS57898.1|  Flavonoid 3'-monooxygenase                              530   3e-180   
ref|XP_004165407.1|  PREDICTED: flavonoid 3'-monooxygenase-like         530   4e-180   
emb|CDP12827.1|  unnamed protein product                                530   4e-180   
ref|XP_002310738.2|  hypothetical protein POPTR_0007s11380g             528   6e-180   Populus trichocarpa [western balsam poplar]
gb|AER39771.1|  CYP92A44-1                                              529   7e-180   
ref|XP_003528553.1|  PREDICTED: flavonoid 3'-monooxygenase              529   8e-180   
ref|XP_003627306.1|  Flavonoid 3',5'-hydroxylase                        528   1e-179   
ref|XP_011015794.1|  PREDICTED: flavonoid 3'-monooxygenase-like         528   1e-179   
dbj|BAD36163.1|  putative elicitor-inducible cytochrome P450            528   2e-179   Oryza sativa Japonica Group [Japonica rice]
gb|EMT12959.1|  Flavonoid 3'-monooxygenase                              528   4e-179   
gb|EAZ09261.1|  hypothetical protein OsI_31534                          527   6e-179   Oryza sativa Indica Group [Indian rice]
emb|CDP17539.1|  unnamed protein product                                527   1e-178   
ref|XP_010064025.1|  PREDICTED: flavonoid 3'-monooxygenase-like         526   1e-178   
emb|CCP37679.1|  cytochrome P450                                        525   2e-178   
ref|XP_011036443.1|  PREDICTED: flavonoid 3'-monooxygenase-like         525   2e-178   
ref|XP_006426677.1|  hypothetical protein CICLE_v10025396mg             525   3e-178   
ref|XP_011036445.1|  PREDICTED: flavonoid 3'-monooxygenase-like         524   5e-178   
gb|AJD25214.1|  cytochrome P450 CYP92A73                                524   5e-178   
gb|AER39772.1|  CYP92A44-2                                              524   5e-178   
dbj|BAJ96250.1|  predicted protein                                      524   6e-178   
ref|XP_006465908.1|  PREDICTED: cytochrome P450 71A1-like               523   2e-177   
emb|CDP21011.1|  unnamed protein product                                520   2e-177   
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             523   3e-177   
emb|CAA64635.1|  cytochrome P450                                        522   3e-177   Nicotiana tabacum [American tobacco]
ref|XP_009771564.1|  PREDICTED: flavonoid 3'-monooxygenase-like         521   8e-177   
gb|EAZ07221.1|  hypothetical protein OsI_29466                          520   3e-176   Oryza sativa Indica Group [Indian rice]
ref|XP_006493371.1|  PREDICTED: cytochrome P450 71A1-like               520   2e-175   
ref|XP_009337217.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    517   2e-175   
ref|XP_009413866.1|  PREDICTED: cytochrome P450 71A1-like               517   3e-175   
ref|XP_006427726.1|  hypothetical protein CICLE_v10025388mg             517   3e-175   
ref|XP_006452810.1|  hypothetical protein CICLE_v10008392mg             513   8e-175   
gb|ADO16185.1|  cytochrome P450 mono-oxygenase                          516   8e-175   
ref|XP_010090165.1|  Flavonoid 3'-monooxygenase                         513   1e-174   
emb|CAA65580.1|  cytochrome P450                                        515   1e-174   Nicotiana tabacum [American tobacco]
emb|CDP17013.1|  unnamed protein product                                515   1e-174   
ref|NP_001061964.2|  Os08g0456200                                       516   2e-174   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006494828.1|  PREDICTED: cytochrome P450 71A1-like               515   2e-174   
gb|AED99875.1|  cytochrome P450                                         514   3e-174   
ref|XP_007201979.1|  hypothetical protein PRUPE_ppa004832mg             514   3e-174   
gb|EMT01785.1|  Flavonoid 3'-monooxygenase                              512   3e-173   
ref|XP_006369134.1|  hypothetical protein POPTR_0001s16790g             511   7e-173   
ref|XP_011035731.1|  PREDICTED: cytochrome P450 71A1-like               511   8e-173   
gb|KHF98584.1|  Cytochrome P450                                         509   2e-172   
ref|XP_007202840.1|  hypothetical protein PRUPE_ppa014596mg             509   4e-172   
ref|XP_008784472.1|  PREDICTED: cytochrome P450 71A2-like               518   6e-172   
emb|CDP20028.1|  unnamed protein product                                504   1e-171   
ref|XP_004956936.1|  PREDICTED: flavonoid 3'-monooxygenase-like         507   2e-171   
ref|NP_001062713.1|  Os09g0264400                                       506   1e-170   Oryza sativa Japonica Group [Japonica rice]
emb|CDP21484.1|  unnamed protein product                                503   2e-170   
ref|XP_006427644.1|  hypothetical protein CICLE_v10025378mg             505   2e-170   
gb|AGI98132.1|  cytochrome P450                                         503   5e-170   
ref|XP_002462454.1|  hypothetical protein SORBIDRAFT_02g025830          504   5e-170   Sorghum bicolor [broomcorn]
gb|EMT12610.1|  Flavonoid 3'-monooxygenase                              503   8e-170   
ref|XP_006493374.1|  PREDICTED: cytochrome P450 71A1-like               503   2e-169   
gb|AGT17101.1|  flavonoid 3-monooxygenase                               502   2e-169   
gb|AGI98131.1|  cytochrome P450 CYP92                                   502   2e-169   
gb|ABK24537.1|  unknown                                                 501   6e-169   Picea sitchensis
gb|ADD84652.1|  CYP92A45                                                501   6e-169   Scoparia dulcis [escobilla]
ref|XP_004956935.1|  PREDICTED: flavonoid 3'-monooxygenase-like         501   1e-168   
emb|CDP00858.1|  unnamed protein product                                495   2e-167   
ref|XP_002444467.1|  hypothetical protein SORBIDRAFT_07g022300          496   4e-167   Sorghum bicolor [broomcorn]
gb|KDP33920.1|  hypothetical protein JCGZ_07491                         494   4e-167   
gb|AGI97940.1|  flavonoid 3'-monooxygenase-like protein                 494   3e-166   
emb|CAN82002.1|  hypothetical protein VITISV_023197                     491   1e-165   Vitis vinifera
gb|EMT12612.1|  Flavonoid 3'-monooxygenase                              490   9e-165   
ref|XP_006477116.1|  PREDICTED: flavonoid 3'-monooxygenase-like         489   7e-164   
ref|XP_006465159.1|  PREDICTED: flavonoid 3'-monooxygenase-like         489   7e-164   
emb|CAN82001.1|  hypothetical protein VITISV_023196                     483   3e-163   Vitis vinifera
gb|KCW71321.1|  hypothetical protein EUGRSUZ_F04403                     486   4e-163   
ref|XP_006493375.1|  PREDICTED: cytochrome P450 71A1-like               485   8e-163   
ref|XP_006477121.1|  PREDICTED: flavonoid 3'-monooxygenase-like         485   3e-162   
ref|NP_001148045.1|  flavonoid 3-monooxygenase                          483   8e-162   Zea mays [maize]
ref|XP_006492022.1|  PREDICTED: flavonoid 3'-monooxygenase-like         483   1e-161   
ref|XP_003581159.2|  PREDICTED: flavonoid 3'-monooxygenase-like         485   2e-161   
gb|ACF84248.1|  unknown                                                 482   3e-161   Zea mays [maize]
ref|XP_006427648.1|  hypothetical protein CICLE_v10025417mg             480   6e-161   
emb|CDP21888.1|  unnamed protein product                                474   4e-159   
gb|KCW71322.1|  hypothetical protein EUGRSUZ_F04404                     473   3e-158   
ref|XP_004984305.1|  PREDICTED: cytochrome P450 71A1-like               474   5e-158   
gb|EMT08550.1|  Flavonoid 3'-monooxygenase                              469   3e-156   
gb|EAY85957.1|  hypothetical protein OsI_07321                          468   1e-155   Oryza sativa Indica Group [Indian rice]
ref|XP_002462453.1|  hypothetical protein SORBIDRAFT_02g025820          464   1e-154   Sorghum bicolor [broomcorn]
dbj|BAD23209.1|  putative cytochrome P450 monooxygenase                 464   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         464   4e-154   
ref|XP_002467826.1|  hypothetical protein SORBIDRAFT_01g034730          463   8e-154   Sorghum bicolor [broomcorn]
ref|XP_009413943.1|  PREDICTED: cytochrome P450 71A1-like               460   1e-153   
dbj|BAK04187.1|  predicted protein                                      462   2e-153   
ref|XP_009407098.1|  PREDICTED: cytochrome P450 71A1-like               462   2e-153   
gb|KGN58498.1|  hypothetical protein Csa_3G651820                       458   2e-153   
ref|XP_006493372.1|  PREDICTED: cytochrome P450 71A1-like               458   4e-152   
ref|XP_002467827.1|  hypothetical protein SORBIDRAFT_01g034740          458   6e-152   Sorghum bicolor [broomcorn]
gb|AAL66767.1|  cytochrome P450 monooxygenase CYP92A1                   455   6e-151   Zea mays [maize]
ref|XP_002459381.1|  hypothetical protein SORBIDRAFT_02g003780          460   9e-151   Sorghum bicolor [broomcorn]
ref|XP_009388239.1|  PREDICTED: flavonoid 3'-monooxygenase-like         451   3e-150   
ref|XP_006492016.1|  PREDICTED: cytochrome P450 71A1-like               451   4e-149   
gb|KDO38954.1|  hypothetical protein CISIN_1g048184mg                   450   5e-149   
ref|XP_002467824.1|  hypothetical protein SORBIDRAFT_01g034710          451   6e-149   Sorghum bicolor [broomcorn]
ref|NP_001151053.1|  cytochrome P450 12                                 446   2e-147   Zea mays [maize]
ref|XP_004955501.1|  PREDICTED: flavonoid 3'-monooxygenase-like         446   5e-147   
gb|EMT17908.1|  Flavonoid 3'-monooxygenase                              441   1e-146   
ref|XP_006427734.1|  hypothetical protein CICLE_v10025408mg             442   4e-146   
ref|NP_001151273.1|  flavonoid 3-monooxygenase                          442   5e-146   Zea mays [maize]
gb|ACN27918.1|  unknown                                                 441   6e-146   Zea mays [maize]
gb|KDO40461.1|  hypothetical protein CISIN_1g048667mg                   439   6e-146   
tpg|DAA40165.1|  TPA: putative cytochrome P450 superfamily protein      443   1e-145   
ref|NP_001151318.1|  flavonoid 3-monooxygenase                          442   1e-145   Zea mays [maize]
ref|XP_004955502.1|  PREDICTED: flavonoid 3'-monooxygenase-like         437   1e-143   
ref|XP_006648650.1|  PREDICTED: flavonoid 3'-monooxygenase-like         430   3e-141   
ref|NP_001146066.1|  uncharacterized protein LOC100279597               431   3e-141   Zea mays [maize]
gb|KDO46294.1|  hypothetical protein CISIN_1g015436mg                   425   1e-140   
ref|XP_003561409.2|  PREDICTED: flavonoid 3'-monooxygenase-like         427   9e-140   
ref|XP_002467849.1|  hypothetical protein SORBIDRAFT_01g035150          426   1e-139   Sorghum bicolor [broomcorn]
ref|XP_004962700.1|  PREDICTED: flavonoid 3'-monooxygenase-like         426   1e-139   
ref|XP_006427731.1|  hypothetical protein CICLE_v10025335mg             424   1e-138   
ref|XP_002461490.1|  hypothetical protein SORBIDRAFT_02g003470          421   3e-137   Sorghum bicolor [broomcorn]
tpg|DAA42609.1|  TPA: putative cytochrome P450 superfamily protein      422   4e-137   
ref|NP_001152903.1|  uncharacterized protein LOC100273153               414   1e-135   Zea mays [maize]
ref|XP_002461489.1|  hypothetical protein SORBIDRAFT_02g003460          416   2e-135   Sorghum bicolor [broomcorn]
ref|XP_004962701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         413   3e-134   
ref|XP_008652034.1|  PREDICTED: flavonoid 3'-monooxygenase-like         412   7e-134   
gb|ACG28049.1|  cytochrome P450 CYP92C5                                 411   9e-134   
ref|XP_002442357.1|  hypothetical protein SORBIDRAFT_08g018780          408   3e-132   
gb|EMT33409.1|  Flavonoid 3'-monooxygenase                              401   5e-131   
gb|AFW57306.1|  putative cytochrome P450 superfamily protein            402   5e-130   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               399   2e-129   
ref|XP_002443882.1|  hypothetical protein SORBIDRAFT_07g003720          399   8e-129   
ref|XP_008670125.1|  PREDICTED: flavonoid 3'-monooxygenase-like         395   2e-128   
ref|NP_001146388.1|  uncharacterized protein LOC100279968               395   5e-128   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   395   9e-128   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   394   2e-127   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               392   2e-126   
gb|AAL66194.1|AF386512_1  cytochrome P450                               392   2e-126   
ref|XP_002310015.1|  cytochrome P450 family protein                     391   2e-126   
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             391   3e-126   
ref|XP_004148586.1|  PREDICTED: cytochrome P450 71A1-like               386   3e-126   
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    391   4e-126   
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             391   4e-126   
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          390   4e-126   
ref|XP_002984650.1|  hypothetical protein SELMODRAFT_120910             390   6e-126   
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    390   9e-126   
ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like          390   1e-125   
gb|AJD25256.1|  cytochrome P450 CYP736A121                              389   1e-125   
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          389   2e-125   
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          389   2e-125   
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               389   2e-125   
ref|XP_002980509.1|  hypothetical protein SELMODRAFT_113134             389   4e-125   
ref|XP_002310014.1|  cytochrome P450 family protein                     388   4e-125   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          388   4e-125   
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          388   4e-125   
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             388   5e-125   
emb|CBI27805.3|  unnamed protein product                                384   7e-125   
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          388   8e-125   
ref|XP_002310007.2|  cytochrome P450 family protein                     386   2e-124   
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             386   2e-124   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          386   3e-124   
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          386   3e-124   
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          386   3e-124   
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              386   4e-124   
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          385   5e-124   
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             385   6e-124   
gb|KGN58437.1|  Flavonoid 3-hydroxylase                                 378   8e-124   
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             385   1e-123   
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          384   1e-123   
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             384   1e-123   
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      384   2e-123   
ref|XP_004299223.1|  PREDICTED: cytochrome P450 71A1-like               384   2e-123   
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                384   2e-123   
emb|CDX69984.1|  BnaA10g23330D                                          384   3e-123   
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             384   3e-123   
gb|EMT33578.1|  hypothetical protein F775_52187                         382   3e-123   
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  383   5e-123   
gb|KHN39623.1|  Flavonoid 3',5'-hydroxylase                             376   8e-123   
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             382   1e-122   
dbj|BAP15886.1|  cytochrome P450 71AU50                                 381   2e-122   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         381   2e-122   
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             382   2e-122   
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             381   2e-122   
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                382   3e-122   
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      380   5e-122   
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          380   6e-122   
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          380   7e-122   
ref|XP_007048087.1|  Cytochrome P450                                    380   9e-122   
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                380   1e-121   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               379   1e-121   
ref|XP_004301061.1|  PREDICTED: cytochrome P450 71A1-like               379   1e-121   
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      379   2e-121   
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       379   2e-121   
emb|CDP18929.1|  unnamed protein product                                370   3e-121   
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             378   4e-121   
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          378   4e-121   
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  378   4e-121   
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    378   4e-121   
ref|XP_008385983.1|  PREDICTED: cytochrome P450 CYP736A12-like          378   4e-121   
emb|CBI21489.3|  unnamed protein product                                380   5e-121   
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                378   5e-121   
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         378   6e-121   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    377   7e-121   
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          378   8e-121   
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          377   8e-121   
gb|AFK79031.1|  cytochrome P450 CYP736A54                               377   8e-121   
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          377   9e-121   
ref|XP_010099912.1|  Cytochrome P450 71A1                               377   1e-120   
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          377   1e-120   
ref|XP_010090163.1|  Flavonoid 3',5'-hydroxylase                        370   1e-120   
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          377   1e-120   
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                377   2e-120   
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              377   2e-120   
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             376   3e-120   
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             375   3e-120   
ref|XP_006348217.1|  PREDICTED: cytochrome P450 71A1-like               375   3e-120   
ref|XP_007028932.1|  Cytochrome P450 93A3                               376   4e-120   
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             375   4e-120   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          375   6e-120   
ref|XP_010094782.1|  Cytochrome P450 71A1                               375   7e-120   
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         374   8e-120   
ref|NP_001050784.2|  Os03g0650200                                       376   8e-120   
gb|ABR18406.1|  unknown                                                 375   1e-119   
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          374   2e-119   
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                374   2e-119   
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          373   2e-119   
ref|XP_004237617.1|  PREDICTED: cytochrome P450 CYP736A12-like          373   3e-119   
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         373   3e-119   
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   373   4e-119   
gb|AAX95529.1|  Putative cytochrome P450                                374   4e-119   
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               373   5e-119   
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   6e-119   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          373   6e-119   
gb|ABR18060.1|  unknown                                                 372   8e-119   
ref|XP_009607201.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   8e-119   
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                372   1e-118   
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                372   1e-118   
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             371   2e-118   
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                371   2e-118   
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                371   3e-118   
ref|XP_009372721.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   3e-118   
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               370   4e-118   
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         370   5e-118   
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                370   5e-118   
tpg|DAA45474.1|  TPA: putative cytochrome P450 superfamily protein      369   6e-118   
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   7e-118   
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like              369   1e-117   
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    369   1e-117   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              369   2e-117   
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               369   2e-117   
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          369   2e-117   
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                369   2e-117   
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                369   2e-117   
ref|XP_003596030.1|  Cytochrome P450                                    367   3e-117   
ref|XP_001751225.1|  predicted protein                                  368   3e-117   
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              368   4e-117   
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             368   5e-117   
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              381   5e-117   
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                367   5e-117   
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                367   5e-117   
ref|XP_004291274.1|  PREDICTED: cytochrome P450 71A1-like               367   6e-117   
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                367   6e-117   
gb|ABR17846.1|  unknown                                                 368   8e-117   
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                366   9e-117   
ref|XP_009378500.1|  PREDICTED: cytochrome P450 CYP736A12-like          366   1e-116   
gb|KDP24589.1|  hypothetical protein JCGZ_25505                         367   1e-116   
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             367   1e-116   
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                366   1e-116   
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       366   2e-116   
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             366   2e-116   
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             365   2e-116   
ref|XP_009770873.1|  PREDICTED: cytochrome P450 CYP736A12-like          366   2e-116   
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                365   3e-116   
ref|XP_011100884.1|  PREDICTED: cytochrome P450 CYP736A12-like          365   3e-116   
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            366   3e-116   
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              365   4e-116   
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               365   4e-116   
ref|XP_009607200.1|  PREDICTED: cytochrome P450 CYP736A12-like          365   5e-116   
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               364   6e-116   
gb|KHN29102.1|  Cytochrome P450 71A1                                    364   6e-116   
ref|XP_002988182.1|  hypothetical protein SELMODRAFT_70547              364   7e-116   
ref|XP_004236729.1|  PREDICTED: cytochrome P450 CYP736A12-like          364   9e-116   
ref|XP_010094781.1|  Cytochrome P450 71D8                               364   9e-116   
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                364   9e-116   
gb|ABV80343.1|  cytochrome P450-dependent monooxygenase                 365   1e-115   
gb|ACN40130.1|  unknown                                                 365   1e-115   
ref|XP_002963471.1|  hypothetical protein SELMODRAFT_166299             364   1e-115   
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         365   1e-115   
gb|AGC29948.1|  CYP75B65                                                363   2e-115   
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                363   2e-115   
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               363   3e-115   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          363   3e-115   
ref|XP_011075268.1|  PREDICTED: cytochrome P450 93A3-like               363   3e-115   
ref|XP_010111422.1|  Cytochrome P450 93A1                               363   4e-115   
ref|XP_009802012.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   4e-115   
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              363   4e-115   
gb|EYU24031.1|  hypothetical protein MIMGU_mgv1a004909mg                362   5e-115   
gb|AJD25177.1|  cytochrome P450 CYP75B79                                362   6e-115   
ref|XP_009586899.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   7e-115   
emb|CDP12933.1|  unnamed protein product                                362   7e-115   
ref|XP_002277107.2|  PREDICTED: cytochrome P450 93A3                    363   7e-115   
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                361   7e-115   
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             362   1e-114   
ref|XP_006354708.1|  PREDICTED: flavonoid 3'-monooxygenase-like         361   1e-114   
ref|XP_004301062.1|  PREDICTED: cytochrome P450 71A1-like               362   1e-114   
ref|XP_011100886.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   1e-114   
gb|ACN40196.1|  unknown                                                 362   2e-114   
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               361   2e-114   
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            361   2e-114   
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      361   2e-114   
ref|XP_009619292.1|  PREDICTED: cytochrome P450 93A3-like               361   3e-114   
gb|ABK25581.1|  unknown                                                 361   3e-114   
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg             360   3e-114   
ref|XP_001767909.1|  predicted protein                                  361   3e-114   
ref|XP_009797406.1|  PREDICTED: cytochrome P450 93A3-like               360   3e-114   
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         360   3e-114   
gb|EYU27291.1|  hypothetical protein MIMGU_mgv1a023536mg                360   4e-114   
ref|XP_006841358.1|  hypothetical protein AMTR_s00181p00020940          360   4e-114   
ref|XP_002275714.2|  PREDICTED: cytochrome P450 CYP736A12-like          360   4e-114   
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                360   4e-114   
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                360   5e-114   
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       360   5e-114   
gb|EYU39902.1|  hypothetical protein MIMGU_mgv1a023279mg                360   6e-114   
emb|CDP01387.1|  unnamed protein product                                359   6e-114   
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               359   7e-114   
ref|XP_010257377.1|  PREDICTED: cytochrome P450 93A2-like               360   8e-114   
ref|XP_009617817.1|  PREDICTED: cytochrome P450 CYP736A12-like          359   9e-114   
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         359   9e-114   
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                359   9e-114   
ref|XP_010537440.1|  PREDICTED: cytochrome P450 CYP736A12-like          359   1e-113   
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          360   1e-113   
ref|XP_004143568.1|  PREDICTED: cytochrome P450 71A1-like               359   1e-113   
gb|AES69199.2|  flavonoid hydroxylase                                   359   1e-113   
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                358   2e-113   
ref|XP_008440670.1|  PREDICTED: cytochrome P450 CYP736A12-like          358   2e-113   
emb|CDP19008.1|  unnamed protein product                                358   2e-113   
ref|XP_010041658.1|  PREDICTED: flavonoid 3'-monooxygenase-like         353   2e-113   
ref|XP_008460602.1|  PREDICTED: cytochrome P450 CYP736A12-like          358   2e-113   
ref|XP_009773047.1|  PREDICTED: cytochrome P450 93A3-like               358   3e-113   
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         358   3e-113   
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               357   3e-113   
ref|XP_009618794.1|  PREDICTED: cytochrome P450 93A3-like               358   3e-113   
ref|XP_010916488.1|  PREDICTED: cytochrome P450 71A1-like               358   3e-113   
emb|CDP19009.1|  unnamed protein product                                357   4e-113   
ref|XP_006363549.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    357   6e-113   



>ref|XP_004237819.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=506

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/519 (66%), Positives = 406/519 (78%), Gaps = 18/519 (3%)
 Frame = +3

Query  27    MEVFSWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSL  203
             ME+ SW F     WL A AF+ KI     +RK    PPGP+PWPIIGNLNLLGS+PH SL
Sbjct  1     MEI-SWAFIVFGSWLFAFAFVLKILNHPAKRK---LPPGPKPWPIIGNLNLLGSLPHVSL  56

Query  204   HSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMT  380
             H LSQKYG+LMLLKFGSKPV+VASSPE AK  LKTHDA+FASRP  AA  +T +N SDMT
Sbjct  57    HHLSQKYGDLMLLKFGSKPVLVASSPEMAKEILKTHDAIFASRPELAAGKYTSYNYSDMT  116

Query  381   WSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLV  560
             W+PYG  WR AR+I L+E+F+P++LDSFE++R+EE   LIS L+   G   PVLL+DHL 
Sbjct  117   WAPYGAHWRQARRIYLTEIFSPKRLDSFEHIRVEEGRTLISRLFPLSG--KPVLLKDHLP  174

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
             RFTL T++RLV  +KYY+ D  +       I L+ LQ  LD+WFLL GVIN+GDW+PWLS
Sbjct  175   RFTLRTISRLVMSDKYYNDDQSI-------ITLETLQQMLDEWFLLGGVINIGDWIPWLS  227

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKG-DENFAPKDMVDIFLQIADDPNLEA  917
               DLQGY+K+MK   + +  F NYVIEDH A  +  +E++  KDMVD  L  ADDPNL  
Sbjct  228   WFDLQGYLKQMKTLGKNFTIFFNYVIEDHKATKREIEEDYVAKDMVDTLLHFADDPNL--  285

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
             DV LT DR+MGL HD+++G  DT+AAT+EWAFQEL R P I EKA +ELDR IGRERWVE
Sbjct  286   DVKLTSDRLMGLIHDLISGATDTSAATIEWAFQELLRSPNITEKAQQELDRAIGRERWVE  345

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             E+DFS+LPYIDAIIKETFRLHPLC LLPPHYSIEDC VAGY++P+GT V +N WS+GRNS
Sbjct  346   EEDFSKLPYIDAIIKETFRLHPLCALLPPHYSIEDCNVAGYDIPKGTIVYVNAWSLGRNS  405

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
             KYWD A EF PERF+E ++DIKGQ+FALLPFGSGRRKCPGYSLGMKVVRTT+ANLLHGF 
Sbjct  406   KYWDRAQEFIPERFIENNIDIKGQNFALLPFGSGRRKCPGYSLGMKVVRTTMANLLHGFN  465

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL GD++P+DISMDE YGLTTHP  P+S  +EPRLP H
Sbjct  466   WKLGGDMRPEDISMDEIYGLTTHPNKPVSVIMEPRLPLH  504



>ref|XP_006363444.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=506

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/515 (65%), Positives = 410/515 (80%), Gaps = 17/515 (3%)
 Frame = +3

Query  39    SWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLS  215
             SW F     WLLA+AF+ K+   H +RK    PPGP+PWPIIGNLNLLGS+PH S H LS
Sbjct  4     SWVFIVFGSWLLALAFVLKLFN-HPKRK---LPPGPKPWPIIGNLNLLGSLPHVSFHHLS  59

Query  216   QKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPY  392
             +KYG+LMLLKFGSKPV+VASSPE AK  LKTHD +FASRP  AA  +T +  SDMTW+PY
Sbjct  60    KKYGDLMLLKFGSKPVLVASSPEMAKEILKTHDTIFASRPELAAGKYTSYYYSDMTWAPY  119

Query  393   GPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTL  572
             G +WR ARKI L+E+F+P++LDSFEY+R+EE   LISGL+   G   PVLL+DHL RFTL
Sbjct  120   GAYWRQARKIYLTEIFSPKRLDSFEYIRVEEGQTLISGLFPLSG--KPVLLKDHLPRFTL  177

Query  573   STMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDL  752
              T++RLV  +KYYS            I L+ LQ  LD+WF+L GVIN+GDW+PWLS  DL
Sbjct  178   RTISRLVMSDKYYSSH------ASSIITLETLQQMLDEWFILGGVINIGDWIPWLSWFDL  231

Query  753   QGYVKKMKAFREEYEKFLNYVIEDHMAM-MKGDENFAPKDMVDIFLQIADDPNLEADVAL  929
             QGYVK+MK   + +++F  YVIEDH A+  + +E++ PKDMVD  L +ADDPNLE  V L
Sbjct  232   QGYVKQMKTLGKNFKEFFKYVIEDHKAIKTQIEEDYVPKDMVDTLLHLADDPNLE--VKL  289

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
             T DR+MGL HD+++GG DT+AAT+EWAFQEL R+P I++KA +ELDR IG+ERWVEE+DF
Sbjct  290   TSDRLMGLMHDLISGGTDTSAATIEWAFQELLRRPNIMDKAHQELDRAIGKERWVEEEDF  349

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWD  1289
             S+LPYIDAIIKETFRLHPLC LLPPHYSIEDC VAGY++P+GT V +N WS+GRN KYWD
Sbjct  350   SKLPYIDAIIKETFRLHPLCALLPPHYSIEDCNVAGYDIPKGTIVYVNAWSLGRNPKYWD  409

Query  1290  NANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLD  1469
              A EF PERF+E ++DIKGQ+FALLPFGSGRR+CPGY+LGMKVVRTT+ANLLHGF WKL 
Sbjct  410   RAEEFIPERFIENNIDIKGQNFALLPFGSGRRRCPGYNLGMKVVRTTMANLLHGFNWKLA  469

Query  1470  GDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             GD++P+DISM+E YGLTTHPK P+S  +EPRLP H
Sbjct  470   GDMRPEDISMEEIYGLTTHPKKPISVIMEPRLPFH  504



>ref|XP_009591954.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana tomentosiformis]
Length=507

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/517 (65%), Positives = 401/517 (78%), Gaps = 13/517 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME+ S F   L  LLA+A + K+      ++  K PPGPR WPIIGNLNLLGS+PH+SLH
Sbjct  1     MEISSVFI-TLGCLLALAIISKVIIDQYPKR--KLPPGPRQWPIIGNLNLLGSLPHESLH  57

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              L QKYG+LM LKFGSKPV+VASSPE AK FLKTHDA FASRPA +A  +T +N SDMTW
Sbjct  58    HLLQKYGDLMFLKFGSKPVLVASSPEMAKEFLKTHDASFASRPALSAGKYTSYNYSDMTW  117

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYG FWR ARKI L+E+F P++L+SF+Y+R+EE   LIS L+   G   PV L+DHL R
Sbjct  118   APYGAFWRQARKIYLTEIFNPKRLESFKYIRVEETRTLISSLHTLSG--KPVFLKDHLPR  175

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
             FTLSTM+R+V   KYYS +    K     + L+KLQ  LD++FLL+GVINLGDWVP LS 
Sbjct  176   FTLSTMSRMVMSGKYYSDE---SKSNTSIVSLEKLQWMLDEFFLLNGVINLGDWVPLLSW  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
              D QGYVK+MKA  + + +F   V+EDH A  K  EN  PKDMVD+ LQ+ADDPNLE  V
Sbjct  233   FDSQGYVKRMKALGKSFVEFHKSVLEDHKA--KAKENSVPKDMVDVILQLADDPNLE--V  288

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LT+D +MGL HD+LAGG DT+AA VEWAFQEL R P +IEKA +EL+RVIG+ERWVEE+
Sbjct  289   KLTKDHLMGLIHDLLAGGTDTSAAAVEWAFQELLRNPKVIEKANQELNRVIGKERWVEEE  348

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             DF +LPYIDAIIKETFRLHPLCTLLPPHYSIEDC VAGY++P+GTTV +N WS+GRN KY
Sbjct  349   DFCRLPYIDAIIKETFRLHPLCTLLPPHYSIEDCNVAGYDIPKGTTVFVNAWSLGRNPKY  408

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD   EF PERFLE D+DIKGQ+F LLPF SGRR+CP YSLG+KVVRTT+ANLLHGF WK
Sbjct  409   WDRPEEFIPERFLENDIDIKGQNFTLLPFSSGRRRCPRYSLGIKVVRTTIANLLHGFNWK  468

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L G +K +DISM+E YGLTTHPK P S  +EPRL  H
Sbjct  469   LTGGMKAEDISMEEIYGLTTHPKKPTSMIMEPRLSIH  505



>ref|XP_006363445.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Solanum 
tuberosum]
Length=509

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/519 (63%), Positives = 405/519 (78%), Gaps = 15/519 (3%)
 Frame = +3

Query  27    MEVFSWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSL  203
             ME+ SW F     WLLA+AF+ KI   H +RK    PPGP+PWPIIGNLNLLGS+PH S 
Sbjct  1     MEI-SWVFIVFGSWLLALAFVLKIFN-HPKRK---LPPGPKPWPIIGNLNLLGSLPHVSF  55

Query  204   HSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMT  380
             H LSQKYG+LMLLKFGSKPV+VASSPE AK  LKTHDA+FASRP  AA  +T FN SDM 
Sbjct  56    HHLSQKYGDLMLLKFGSKPVLVASSPEMAKEILKTHDAIFASRPPLAAGKYTSFNYSDML  115

Query  381   WSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLV  560
             W+PYG +WR ARKI L+E+F+P++LDS EY+R+EE   LIS L+   G   P+LL+DHL 
Sbjct  116   WAPYGAYWRQARKIYLTEIFSPKRLDSLEYIRVEEGRTLISRLFPHSG--KPILLKDHLP  173

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
             RFTL T++R+   +KY S   +    +     L++LQ  LD+W +L GV+NLGDW+P  S
Sbjct  174   RFTLRTISRMAMSDKYCS---DQSNSDTSIATLERLQWMLDEWLVLGGVMNLGDWIPLFS  230

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAM-MKGDENFAPKDMVDIFLQIADDPNLEA  917
               DLQGYV++MKA  + + +F  YVI+DH A  M+   +F PKDMVD  L ++DDPNL  
Sbjct  231   WFDLQGYVRRMKALGKNFTQFYKYVIDDHNATKMQTTGDFVPKDMVDALLHLSDDPNL--  288

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
             +V LT DR+MGL H++LAG  DT+AAT+EW FQEL R+P II+KA +ELDR IG+ERWVE
Sbjct  289   NVQLTSDRMMGLMHNLLAGATDTSAATIEWTFQELLRRPNIIDKARQELDRAIGKERWVE  348

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             E+DFS+LPYIDAIIKE+FRLHPLC LLPPHYSIEDC VAGY++P+GT V +N WSIGRNS
Sbjct  349   EEDFSKLPYIDAIIKESFRLHPLCALLPPHYSIEDCKVAGYDIPKGTIVYVNAWSIGRNS  408

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
             KYW+ A EF PERF+E ++D+ GQ+FALLPFGSGRR+CPGYSLGMKVVRTT+ANLLHGF 
Sbjct  409   KYWERAEEFIPERFIENNIDMTGQNFALLPFGSGRRRCPGYSLGMKVVRTTMANLLHGFN  468

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL GD++P+DISM+E YGL+THPK P+S  +EPRLP H
Sbjct  469   WKLTGDMRPEDISMEEMYGLSTHPKKPISVIMEPRLPLH  507



>ref|XP_004237820.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=509

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/506 (65%), Positives = 396/506 (78%), Gaps = 13/506 (3%)
 Frame = +3

Query  63    WLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLL  242
             WL A+AF+FK    H +RK    PPGP+PWPIIGNLNLLGS+PH S H LSQKYG+LMLL
Sbjct  13    WLFALAFVFKKLN-HPKRK---LPPGPKPWPIIGNLNLLGSLPHVSFHHLSQKYGDLMLL  68

Query  243   KFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARK  419
             KFGSKPV+V SSPE AK  LKTHDA+FASRP  AA  +T FN SDMTW+PYG +W  ARK
Sbjct  69    KFGSKPVLVVSSPEMAKEILKTHDAIFASRPVLAAGKYTSFNYSDMTWAPYGAYWHQARK  128

Query  420   ILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTG  599
             I L+E+F+P+KL S EY+RIEER  LIS LY   G   P+ LRDHL RF+L T++RLV  
Sbjct  129   IYLTEIFSPKKLHSLEYIRIEERQTLISRLYPHSG--KPIFLRDHLPRFSLRTISRLVMS  186

Query  600   NKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKA  779
             +KY+S   +    +   + L++LQ  LD+WFLL+GVINLGDW+P LS  DLQGY+K+MK 
Sbjct  187   DKYFS---DQSNSDTSIVTLERLQWMLDEWFLLAGVINLGDWIPCLSWFDLQGYIKRMKD  243

Query  780   FREEYEKFLNYVIEDHMAM-MKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLT  956
               + + +F  YV++DH A+ M+   +F PKDMVD  L +A+DPN E  V LT DR+MGL 
Sbjct  244   SGKNFTQFYKYVLDDHNAIKMQKSGDFVPKDMVDALLHLANDPNRE--VQLTSDRMMGLM  301

Query  957   HDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAI  1136
             H +LAG  DT+AAT+EW FQEL R+P I+EKA  EL+R IG+ERWVEE+DFS+LPYIDAI
Sbjct  302   HSLLAGATDTSAATIEWTFQELMRRPNIMEKAHHELERAIGKERWVEEEDFSKLPYIDAI  361

Query  1137  IKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPER  1316
             IKETFRLHPLC +LPP YS EDC VAGY++P+GTTV +N WS+GRN KYWD A EF PER
Sbjct  362   IKETFRLHPLCAVLPPRYSTEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWDRAEEFIPER  421

Query  1317  FLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDIS  1496
             F+E ++DIKGQ+FALLPFGSGRRKCPGYSLGMKVVRTT+ANL+HGF WKL GD KP+DIS
Sbjct  422   FIENNIDIKGQNFALLPFGSGRRKCPGYSLGMKVVRTTMANLMHGFNWKLGGDTKPEDIS  481

Query  1497  MDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             MDE YGLTTHPK P+S  +EPRL  H
Sbjct  482   MDEIYGLTTHPKEPISLIMEPRLSLH  507



>ref|XP_006363443.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=506

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/485 (67%), Positives = 382/485 (79%), Gaps = 12/485 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGNLNLLGS+PH S H LSQKYG+LMLLKFGSKPV+VASSPE AK  LK
Sbjct  30    KVPPGPKPWPIIGNLNLLGSLPHVSFHHLSQKYGDLMLLKFGSKPVLVASSPEMAKEILK  89

Query  306   THDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THDA+FASRPA AA  +T FN SDM W+PYG  WR ARKI ++ +F+ R+LDSFEY+R+E
Sbjct  90    THDAIFASRPALAAGKYTSFNYSDMAWAPYGAHWRQARKIFMTHIFSSRRLDSFEYIRVE  149

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E   LIS L+   G   P+LLRDHL RFTL T++RLV  +KYYS            I L+
Sbjct  150   EGRTLISRLFPLSG--KPILLRDHLRRFTLRTISRLVMSDKYYSSH------ASSIITLE  201

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
              LQ  LD+WF+L GVIN+GDWVPWLS  DLQGYVK+MKA  +   +F  YVIEDH A+ +
Sbjct  202   TLQQMLDEWFILGGVINIGDWVPWLSWFDLQGYVKRMKALGKNMTEFYKYVIEDHKAIKR  261

Query  843   G-DENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
               ++   PKDMVD  L +ADDPNLE  V LT D +MGL HD++AGG DT+AAT+EWAFQE
Sbjct  262   QIEKECVPKDMVDSLLHLADDPNLE--VKLTSDSLMGLIHDLIAGGTDTSAATIEWAFQE  319

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L R+P II+KA  ELDR IGRE WVEE+DFS+LPYIDAIIKET RLHPL  LLPP YSIE
Sbjct  320   LLRRPNIIDKAHHELDRAIGREGWVEEEDFSKLPYIDAIIKETLRLHPLGALLPPRYSIE  379

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC VAGY++P+GTTV +N WS+GRN KYWD A +F PERF+E ++DIKGQ+FALLPFGSG
Sbjct  380   DCNVAGYDIPKGTTVFVNAWSLGRNPKYWDRAEDFIPERFIENNIDIKGQNFALLPFGSG  439

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RRKCPGYSLGMKVVRTT+ANLLHGF WKL GD+K +DISM+E YGLTTHP  P+S  IEP
Sbjct  440   RRKCPGYSLGMKVVRTTMANLLHGFNWKLAGDMKAEDISMEEIYGLTTHPNKPISVIIEP  499

Query  1560  RLPTH  1574
             RLP H
Sbjct  500   RLPFH  504



>ref|XP_010320112.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum lycopersicum]
Length=504

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/516 (63%), Positives = 393/516 (76%), Gaps = 17/516 (3%)
 Frame = +3

Query  33    VFSWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHS  209
             V  W F     WLLA+AF+ KI   H +RK    PPGP+PWPIIGNLNLLGS+PH+SLH 
Sbjct  2     VIPWVFLVFGSWLLALAFVIKILN-HPKRK---LPPGPKPWPIIGNLNLLGSLPHKSLHH  57

Query  210   LSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWS  386
             LSQKYG+LMLLKFGSKPV++ASSPE AK  LKTHD  FASRP  AA  + +FN SDMTW+
Sbjct  58    LSQKYGDLMLLKFGSKPVLIASSPEMAKEILKTHDISFASRPPLAAGKYISFNYSDMTWA  117

Query  387   PYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRF  566
              YGP WR  RKI L+ +  P  L+S EY+R+EER  LIS L+   G   P+LL+  L RF
Sbjct  118   SYGPHWRQTRKISLTGLLNPTTLNSLEYIRVEERQTLISRLFPLSG--KPILLKHRLARF  175

Query  567   TLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGL  746
             TL T+ RL+    Y S D  +       +  ++LQ   D+WF+LSG+IN+GDW+PWLS  
Sbjct  176   TLRTINRLIMSETYCSSDASV-------VTHERLQWMFDEWFVLSGLINIGDWIPWLSWF  228

Query  747   DLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVA  926
             DLQGYVK+MKA R+   +F  YV+EDH A  + +EN++PKDMVD  L +ADDPNLE  + 
Sbjct  229   DLQGYVKRMKALRKNMTEFYEYVLEDHKAKRQKEENYSPKDMVDAMLHLADDPNLE--IK  286

Query  927   LTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKD  1106
             LT D +MGL HD++ GG DT A T+EWAFQEL ++P I+EKA +ELDR IGRE WV+E+D
Sbjct  287   LTTDTMMGLIHDLVGGGTDTAATTIEWAFQELLKRPNIMEKAQQELDRAIGREGWVKEED  346

Query  1107  FSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYW  1286
             FS+LPYIDAIIKETFRLHPLC L+PPHYS EDC VAGY++P+GTTV +N WS+GRN KYW
Sbjct  347   FSKLPYIDAIIKETFRLHPLCALIPPHYSTEDCNVAGYDIPKGTTVYVNAWSLGRNPKYW  406

Query  1287  DNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL  1466
             D   EF PERF+E ++DIKGQ+F LLPFGSGRRKCPGYSLG+K+VRTT+ANLLHGF WKL
Sbjct  407   DRPEEFIPERFIENNIDIKGQNFGLLPFGSGRRKCPGYSLGIKIVRTTMANLLHGFDWKL  466

Query  1467  DGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              GD+KP+DISMDE YGLTTHPK P+S  +EPRLP H
Sbjct  467   AGDMKPEDISMDEIYGLTTHPKNPISLIMEPRLPLH  502



>ref|XP_004238495.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=510

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/514 (63%), Positives = 392/514 (76%), Gaps = 13/514 (3%)
 Frame = +3

Query  42    WFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             W F     WLL++ FL K    H +RK    PPGP+PWPIIGNLNL+GS+PH S H LSQ
Sbjct  5     WVFVVFGAWLLSLVFLSKKFN-HSKRK---LPPGPKPWPIIGNLNLIGSLPHVSFHHLSQ  60

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG+LMLLKFGSKPV+VASSPE AK  LKTHD +FASRP+ A   HT FN SDM W+ Y 
Sbjct  61    KYGDLMLLKFGSKPVLVASSPEMAKEILKTHDTIFASRPSLAVGKHTSFNYSDMVWASYC  120

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
              +WR ARKI L+E+F+P++LD  EYVRIEER  LIS L+   G   P+ L+DHL RFTL 
Sbjct  121   AYWRQARKIYLTEIFSPKRLDYLEYVRIEERKTLISCLFAHSG--KPIFLKDHLPRFTLR  178

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
             T+ RLV  + Y S   +    +   + L++LQ  LD+WF+L GVIN+GDW+PWLS  DLQ
Sbjct  179   TINRLVMSDNYCSD--QSNDSDTSIVTLERLQWMLDEWFILGGVINIGDWIPWLSWFDLQ  236

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMA-MMKGDENFAPKDMVDIFLQIADDPNLEADVALT  932
             GYV++MKA  +   +F  YV++DH A  ++   +F PKDMVD  L +A+DPN E  V LT
Sbjct  237   GYVRRMKALGKNMTEFYKYVLDDHNAKRIQKSGDFVPKDMVDALLHLANDPNRE--VKLT  294

Query  933   RDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFS  1112
              DR+MGL H+++AGG DT+AAT+EWAFQEL R P I+EKA +ELDR IG+E WVEE+DFS
Sbjct  295   SDRMMGLIHNLVAGGTDTSAATIEWAFQELLRSPNIMEKAQQELDRAIGKEGWVEEEDFS  354

Query  1113  QLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDN  1292
             +LPYIDAIIKETFRLHPLC LL PHYS+EDC VAGY++P+GTTV +N WS+GRN KYWD 
Sbjct  355   KLPYIDAIIKETFRLHPLCALLAPHYSLEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWDR  414

Query  1293  ANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG  1472
               EF PERF+E  +DIKGQ+FALLPFGSGRR+CPGYSLGMKVVRTT+ANLLHGF WKL G
Sbjct  415   PEEFIPERFIENGIDIKGQNFALLPFGSGRRRCPGYSLGMKVVRTTMANLLHGFNWKLAG  474

Query  1473  DLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             D+KP+ ISMDE YGLTTHPK P+S  +EPRL  H
Sbjct  475   DMKPEHISMDEIYGLTTHPKKPISVIMEPRLRLH  508



>ref|XP_006359061.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=508

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/515 (64%), Positives = 390/515 (76%), Gaps = 13/515 (3%)
 Frame = +3

Query  36    FSWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSL  212
              SW F     WLLA+AF+ KI   H +RK    PPGPRPWPIIGNLNLLGS PH SLH L
Sbjct  3     ISWVFIVFGSWLLALAFVLKIFN-HSKRKV---PPGPRPWPIIGNLNLLGSFPHVSLHHL  58

Query  213   SQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSP  389
             SQKYG+LMLLKFGSKPV++ASSPE AK  LKTHD +FASRP  AA  + ++N SDMTW+ 
Sbjct  59    SQKYGDLMLLKFGSKPVLIASSPEMAKEILKTHDTIFASRPPLAAGKYISYNYSDMTWAS  118

Query  390   YGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFT  569
             YG  WR  RKI L+E+  PR L+S EY+R+EER  LIS L+   G   P+LL+DHL  FT
Sbjct  119   YGAHWRQTRKICLTELLNPRTLNSLEYIRVEERRTLISRLFALSG--KPILLKDHLTLFT  176

Query  570   LSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLD  749
             L T+ RLV    Y S   +        +  ++LQ   D+WF+LSGVINLGDW+PWLS  D
Sbjct  177   LRTINRLVMSETYCS---DQSNSAASIVTYERLQWMFDEWFVLSGVINLGDWIPWLSWFD  233

Query  750   LQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVAL  929
             LQGYVK+MKA  +   +F  YV+EDH A  + +E++ PKDMVD  L +ADDPNLE  + L
Sbjct  234   LQGYVKRMKALGKNMTEFYEYVLEDHKAKRQTEEHYIPKDMVDAMLHLADDPNLE--IKL  291

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
             T D +MGL HDM+ GG DTTA T+EWAFQEL R+P II+KA +ELDR IGRERWVEE+DF
Sbjct  292   TTDSMMGLIHDMVGGGTDTTATTIEWAFQELLRRPNIIDKAHQELDRAIGRERWVEEEDF  351

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWD  1289
             S+LPYIDAIIKETFRLHPLC LLPPHYSI DC VAGY++P+GTT  +N WS+GRN KYWD
Sbjct  352   SKLPYIDAIIKETFRLHPLCALLPPHYSIVDCNVAGYDIPKGTTAFVNAWSLGRNPKYWD  411

Query  1290  NANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLD  1469
              A EF PERF+E ++DIKGQ+FALLPF SGRR+CPGYSLGMKVVRTT+ANLLHGF WKL 
Sbjct  412   RAEEFIPERFIENNIDIKGQNFALLPFSSGRRRCPGYSLGMKVVRTTMANLLHGFNWKLT  471

Query  1470  GDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             GD KP+DISM+E YGLT HPK P+S  +EPRL  H
Sbjct  472   GDTKPEDISMEEIYGLTVHPKKPISLIMEPRLLLH  506



>ref|XP_006367943.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=509

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/519 (64%), Positives = 406/519 (78%), Gaps = 15/519 (3%)
 Frame = +3

Query  27    MEVFSWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSL  203
             ME+ SW F     WLLA+AF+ KI   H +RK    PPGP+PWPIIGNLNLLGS+PH+SL
Sbjct  1     MEI-SWVFIVFGSWLLALAFVLKIFN-HPKRK---VPPGPKPWPIIGNLNLLGSLPHESL  55

Query  204   HSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMT  380
             H LSQKYG+LMLLKFGSKPV+VASSPE AK  LKTHD +FASRP  AA  +T FN SDM 
Sbjct  56    HHLSQKYGDLMLLKFGSKPVLVASSPEMAKEILKTHDTIFASRPPLAAGKYTGFNYSDML  115

Query  381   WSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLV  560
             W+ YG +WR ARKI L+E+F+P++LDS EY+RIEER  LIS L+   G   P+LL+DHL 
Sbjct  116   WASYGAYWRQARKICLTEIFSPKRLDSLEYIRIEERQTLISRLFPHSG--KPILLKDHLS  173

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
             RFTL T++R+   +KY S   +    +     L++LQ  LD+WF+L GV+NLGDW+P  S
Sbjct  174   RFTLRTISRMAMSDKYCS---DQSNSDTSIATLERLQWMLDEWFVLGGVMNLGDWIPLFS  230

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAM-MKGDENFAPKDMVDIFLQIADDPNLEA  917
               DLQGYVK+MKA  + + +F  YV++DH A  M+   +F PKDMVD  L +++DPNLE 
Sbjct  231   WFDLQGYVKRMKALGKNFTEFYKYVLDDHNATKMQTTGDFVPKDMVDALLHLSNDPNLE-  289

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V LT D +MGL +++LAGG  T AAT+EW FQEL R+P I++KA  ELD+ IGRERWVE
Sbjct  290   -VKLTSDHMMGLINNLLAGGTGTAAATIEWTFQELLRRPNIMDKAHHELDKAIGRERWVE  348

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             E+DFS+LPYIDAIIKE+FRLHPL  LLPPHYSIEDC VAGY++P+GTTV +NVWS+GRNS
Sbjct  349   EEDFSKLPYIDAIIKESFRLHPLGALLPPHYSIEDCNVAGYDIPKGTTVFVNVWSLGRNS  408

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
             KYWD A EF PERF+E ++D+KGQ+FALLPFGSGRR+CPGYSLGMKVVRTT+ANLLHGF 
Sbjct  409   KYWDRAEEFIPERFIENNIDVKGQNFALLPFGSGRRRCPGYSLGMKVVRTTMANLLHGFN  468

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL GD++P+DISM+E YGLTTHPK P+S  +EPRLP H
Sbjct  469   WKLAGDMRPEDISMEEIYGLTTHPKKPISVIMEPRLPLH  507



>ref|XP_009626729.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana tomentosiformis]
Length=507

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/484 (64%), Positives = 381/484 (79%), Gaps = 10/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGNLNL+GSIP +SLH+LSQKYG+LM LKFGS+PV++ASSPE AK  LK
Sbjct  31    KLPPGPKPWPIIGNLNLIGSIPRESLHNLSQKYGDLMHLKFGSRPVLIASSPEMAKEILK  90

Query  306   THDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THDA+FASRPA AA  + +FN SDM+W+PYG  W   RKI ++E+F P++LDSF+Y+R+E
Sbjct  91    THDAIFASRPALAAGKYLSFNYSDMSWAPYGAKWGQGRKIYITEIFNPKRLDSFKYIRVE  150

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E   LIS L+   G   P+ L+DHL +FTL T++R+V   KYY    E        + L+
Sbjct  151   EGRNLISRLFALSG--KPIFLKDHLPQFTLCTISRMVMSGKYYCDKSE---SNDTIVTLE  205

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             KLQ  L++WF+L GV+N+GDW+PWL+ LDLQGYVK+MKA  +   +F NYV+EDH A  K
Sbjct  206   KLQWMLEEWFILGGVVNIGDWIPWLNWLDLQGYVKRMKALEKTMVEFHNYVLEDHKA--K  263

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
               EN  P DMVD+ LQ+ADDPNLE  V LT + +MGL  D+LAGG DT+A TVEWAFQEL
Sbjct  264   AKENSHPTDMVDVLLQLADDPNLE--VKLTTNHLMGLILDLLAGGTDTSATTVEWAFQEL  321

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              R P IIEKA +ELD+ IG+ERWVEE+D SQLPYI+AIIKETFRLHPL TLL PHYSIED
Sbjct  322   MRNPKIIEKANQELDKAIGKERWVEEEDLSQLPYIEAIIKETFRLHPLTTLLAPHYSIED  381

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY++P+GTTV +N WS+GRN K WD   +F PERFLE D+DIKGQ+F LLPFGSGR
Sbjct  382   CNVAGYDIPKGTTVFVNTWSLGRNPKCWDRPEKFIPERFLENDIDIKGQNFTLLPFGSGR  441

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R+CPGYSLG+K+V+TTLANLLHGF WKL GD+KP+DISM+E YGLTTHPK P S  +EP+
Sbjct  442   RRCPGYSLGIKLVQTTLANLLHGFNWKLSGDMKPEDISMEEIYGLTTHPKKPTSMIMEPK  501

Query  1563  LPTH  1574
             L  H
Sbjct  502   LSPH  505



>emb|CDP21012.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/513 (61%), Positives = 390/513 (76%), Gaps = 11/513 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             +W   AL   +A+AFL K  T H+R K    PPGP+PWPIIGNLNLLGSIPHQSLH L Q
Sbjct  4     TWLLLALAGTVALAFLSKALT-HKRLK-LNHPPGPKPWPIIGNLNLLGSIPHQSLHLLFQ  61

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYGE+M LKFGS PV+VASSPE AK FL+THD +FASRPATAAA +T +N S M W+PYG
Sbjct  62    KYGEIMQLKFGSSPVVVASSPEMAKEFLQTHDNIFASRPATAAAKYTSYNCSGMLWAPYG  121

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P WR ARKI L+++F+P++LD FE  RIEER A IS LY   G   PV++RDHL+R +LS
Sbjct  122   PHWRQARKIYLTQIFSPKQLDFFESTRIEERRAFISRLYAQSG--KPVVMRDHLMRLSLS  179

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
             T +++V  NKY+++     + +G  +  ++ Q  +D WFLL GV N+GDW+PWL   DLQ
Sbjct  180   TASQMVLSNKYFAQ----SEGDGSLVTFEEFQEMIDTWFLLGGVFNIGDWIPWLDRFDLQ  235

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             GYVK+MK   ++++KF N+V++DH A  K +++F PKDMVDI LQ A+DP+L+  V LTR
Sbjct  236   GYVKQMKELYKKFDKFHNHVLDDHQARRKTEKDFIPKDMVDILLQYAEDPDLQ--VKLTR  293

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
             D+I GL  D+L GG DT+A+TVEWA  EL + P +IEKATEELDRVIGR++WVEE   S+
Sbjct  294   DQIKGLIQDLLVGGTDTSASTVEWAMNELLKHPHLIEKATEELDRVIGRDKWVEEAVLSK  353

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LP++ AIIKETFRLHPL TLLPPHY++EDC VAGY + +GTTV IN WS+GRNSKYWD+ 
Sbjct  354   LPFLGAIIKETFRLHPLATLLPPHYALEDCTVAGYHIAKGTTVFINTWSMGRNSKYWDSP  413

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
              EF PERFL KD+DIKG DF LLPFGSGRR CPGY L +K+V T LANLLHGF WKL   
Sbjct  414   EEFIPERFLGKDIDIKGHDFELLPFGSGRRMCPGYVLALKLVGTMLANLLHGFNWKLPHG  473

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +KP++I M+E YGL+ HP+  L+   EPRLP +
Sbjct  474   MKPEEICMEEHYGLSIHPRISLAMIPEPRLPVN  506



>ref|XP_006350345.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=502

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/484 (62%), Positives = 377/484 (78%), Gaps = 18/484 (4%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
               PPGPRPWPIIGNLNL+GS+PH+SLH+LSQKYG+LMLLKFGSKPV++ASSPE AK  LK
Sbjct  34    NVPPGPRPWPIIGNLNLIGSLPHESLHNLSQKYGDLMLLKFGSKPVLIASSPEMAKEILK  93

Query  306   THDAVFASRPA-TAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THDA+F+SRPA TA  + +FN SD++W+PYG  WR +RKI  +E+F+P++L+SFEY+R+E
Sbjct  94    THDAIFSSRPALTAGKYISFNYSDVSWAPYGAHWRQSRKIYQTEIFSPKRLESFEYIRVE  153

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             ER  LIS L+   G K  + LR HL  FTLS ++R+V    Y+  +            ++
Sbjct  154   ERRNLISRLHVLSGKK--IFLRHHLTEFTLSIISRMVMSGTYHRDE-----------SIE  200

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
              LQG LD+WF+L GVIN+GDW+PWL+ LDLQGY+K+MKA  ++  +F  YV+EDH A  K
Sbjct  201   NLQGMLDEWFILGGVINIGDWIPWLNWLDLQGYIKRMKALDKKLREFFKYVLEDHKA--K  258

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
             G E+ APKDMVD+ LQ+ DDPNLE  V +T D +MGL  D+LAGG DT+A TVEWAFQEL
Sbjct  259   GKEDSAPKDMVDVLLQLVDDPNLE--VKITTDNLMGLILDLLAGGTDTSATTVEWAFQEL  316

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              R P +IEKA EELDR IG+ RWVEE+D SQLPYI+AIIKETFRLHPL  L+PPHYSIE+
Sbjct  317   VRNPNVIEKANEELDRTIGKGRWVEEEDLSQLPYIEAIIKETFRLHPLTPLIPPHYSIEE  376

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C V GY++P+GT   +N+WS+GRN  YWD   EF PERFLE D++IKG++F +LPFGSGR
Sbjct  377   CNVVGYDIPKGTMAFVNIWSLGRNPNYWDRPQEFIPERFLENDINIKGKNFTMLPFGSGR  436

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R+CPGYSLG+K+V TTLANLLHGF W+L GD+ P++ISM E YGLTTHP+  +S  +EPR
Sbjct  437   RRCPGYSLGIKLVGTTLANLLHGFHWRLTGDINPEEISMKEIYGLTTHPEKSISMIVEPR  496

Query  1563  LPTH  1574
              P H
Sbjct  497   FPLH  500



>ref|XP_009766074.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana sylvestris]
Length=508

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/496 (61%), Positives = 381/496 (77%), Gaps = 15/496 (3%)
 Frame = +3

Query  90    KITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIV  269
             KI T  +R    K PPGP+PWPIIGNLNLLG IPHQS   LS+KYGELMLLKFGSKPV+V
Sbjct  21    KIIT-SRRLVNSKLPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSKPVLV  79

Query  270   ASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTP  446
             ASS E AK FLK HDA FASRP  A   +T +N  DMTW+PYGP+WR AR+I L+E+FTP
Sbjct  80    ASSAEMAKQFLKIHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNEIFTP  139

Query  447   RKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWE  626
             ++LDSFEY+R+EER  LIS L    G   P  L+DHL RF+L +MTR+V  NKY+ +   
Sbjct  140   KRLDSFEYIRVEERQTLISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGES--  195

Query  627   LGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFL  806
                    ++ ++ LQ  +D WFLL+G  N+GDW+PWLS LDLQGYVK+MKA +  ++KF 
Sbjct  196   -------TVRVEDLQHLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFH  248

Query  807   NYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDT  986
             N V++DH A    ++NF PKDMVD+ L++A+DPNLE  V LT D + GL  D+L GG D+
Sbjct  249   NIVLDDHRAKKNEEKNFVPKDMVDVLLKMAEDPNLE--VKLTNDCVKGLMQDLLTGGTDS  306

Query  987   TAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPL  1166
               A V+WAFQEL R+P +IEKATEELDRV+G+ERWVEEKD SQL YI+AI+KET RLHPL
Sbjct  307   LTAAVQWAFQELLRQPRVIEKATEELDRVVGKERWVEEKDCSQLSYIEAILKETLRLHPL  366

Query  1167  CTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKG  1346
              T+L PH +IEDC VAGY++ +GTTVL+NVW+IG++ KYWD + EF PERFLEKD+D+ G
Sbjct  367   GTMLAPHCAIEDCNVAGYDIQKGTTVLVNVWTIGKDPKYWDRSEEFLPERFLEKDIDMDG  426

Query  1347  QDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTH  1526
              +FA LPFGSGRR+CPGYSLG+KV+R TLAN+LHGF WKL   +KP+DIS++E YGLTTH
Sbjct  427   HNFAFLPFGSGRRRCPGYSLGLKVIRATLANMLHGFNWKLPEGMKPEDISVEEHYGLTTH  486

Query  1527  PKFPLSYTIEPRLPTH  1574
             PK P+   +EPRL ++
Sbjct  487   PKLPVPVILEPRLSSN  502



>ref|XP_004237821.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=496

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/503 (62%), Positives = 376/503 (75%), Gaps = 12/503 (2%)
 Frame = +3

Query  69    LAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKF  248
             + I+F+ KI   H +RK    PPGP+PWPIIGNLN L S PH+SLH LSQKYG+LMLLKF
Sbjct  3     ICISFVIKILN-HPKRKL---PPGPKPWPIIGNLNHLSSFPHKSLHHLSQKYGDLMLLKF  58

Query  249   GSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKIL  425
             GSKPV++ SSPE A+  LKTHD +FASRP  AA  + ++N SDMTW+ YG  WR  RKI 
Sbjct  59    GSKPVLIVSSPEMAEEILKTHDMIFASRPPLAAIKYFSYNYSDMTWASYGAHWRQGRKIS  118

Query  426   LSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNK  605
             L+E+  PR L+S E +R+EER  LIS L++  G   P+LL+DHL  FTL T+ R +    
Sbjct  119   LTELLNPRTLNSLEDIRVEERKTLISRLFNLSG--KPILLKDHLTLFTLRTINRSIMSKT  176

Query  606   YYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFR  785
             Y S   +    +   I  ++LQ  LD+WFLL GVIN+GDW+PWL+ LDLQGY+K+ KA  
Sbjct  177   YCS---DQSNSDTSIITHERLQWMLDEWFLLGGVINIGDWIPWLNWLDLQGYIKRTKALG  233

Query  786   EEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDM  965
             +   +F  YV+EDH A  + +EN+ PKDMVD  LQ+ADDPNLE  + LT D IMGL HD+
Sbjct  234   KNMTEFYEYVLEDHKAKRQTEENYIPKDMVDAMLQLADDPNLE--IKLTTDSIMGLIHDL  291

Query  966   LAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKE  1145
             + GG DT A  +EWAFQEL R P I+EKA +ELDR IGRERWVEE+DFS+LPYIDAIIKE
Sbjct  292   VGGGTDTAATMIEWAFQELLRSPNIMEKAQQELDRAIGRERWVEEEDFSKLPYIDAIIKE  351

Query  1146  TFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLE  1325
             +FRLHPLC +LPP YS EDC VAGY++P+GTTV +N WS+GRN KYWD   EF PERF+E
Sbjct  352   SFRLHPLCAMLPPRYSTEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWDRPEEFIPERFIE  411

Query  1326  KDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDE  1505
               +DIKGQ+FALLPFGSGRRKCPG SLGMKVVRTT+ANLLHGF WKL GD++ +DISMDE
Sbjct  412   NGIDIKGQNFALLPFGSGRRKCPGNSLGMKVVRTTMANLLHGFNWKLGGDMRSEDISMDE  471

Query  1506  AYGLTTHPKFPLSYTIEPRLPTH  1574
               GLTTH K P+S   EPRL  H
Sbjct  472   ISGLTTHLKNPISLITEPRLSLH  494



>gb|ABC69388.1| CYP92B2v2 [Nicotiana tabacum]
Length=508

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 379/495 (77%), Gaps = 15/495 (3%)
 Frame = +3

Query  90    KITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIV  269
             KI T  +R    K PPGP+PWPIIGNLNLLG IPHQS   LS+KYGELMLLKFGS+PV+V
Sbjct  21    KIITC-RRPVNRKIPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLV  79

Query  270   ASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTP  446
             ASS E AK FLK HDA FASRP  A   +T +N  DMTW+PYGP+WR AR+I L+++FTP
Sbjct  80    ASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQIFTP  139

Query  447   RKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWE  626
             ++LDSFEY+R+EER ALIS L    G   P  L+DHL RF+L +MTR+V  NKY+ +   
Sbjct  140   KRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGES--  195

Query  627   LGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFL  806
                    ++ ++ LQ  +D WFLL+G  N+GDW+PWLS LDLQGYVK+MKA +  ++KF 
Sbjct  196   -------TVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFH  248

Query  807   NYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDT  986
             N V++DH A    ++NF PKDMVD+ L++A+DPNLE  V LT D + GL  D+L GG D+
Sbjct  249   NIVLDDHRAKKNAEKNFVPKDMVDVLLKMAEDPNLE--VKLTNDCVKGLMQDLLTGGTDS  306

Query  987   TAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPL  1166
               A V+WAFQEL R+P +IEKATEELDR++G+ERWVEEKD SQL Y++AI+KET RLHPL
Sbjct  307   LTAAVQWAFQELLRQPRVIEKATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHPL  366

Query  1167  CTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKG  1346
              T+L PH +IEDC VAGY++ +GTT L+NVW+IGR+ KYWD A EF PERFLE D+D+ G
Sbjct  367   GTMLAPHCAIEDCNVAGYDIQKGTTFLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMDG  426

Query  1347  QDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTH  1526
              +FA LPFGSGRR+CPGYSLG+KV+R TLAN+LHGF WKL   +KP+DIS++E YGLTTH
Sbjct  427   HNFAFLPFGSGRRRCPGYSLGLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTTH  486

Query  1527  PKFPLSYTIEPRLPT  1571
             PKFP+   +E RL +
Sbjct  487   PKFPVPVILESRLSS  501



>ref|XP_009605293.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana tomentosiformis]
Length=508

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 379/495 (77%), Gaps = 15/495 (3%)
 Frame = +3

Query  90    KITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIV  269
             KI T  +R    K PPGP+PWPIIGNLNLLG IPHQS   LS+KYGELMLLKFGS+PV+V
Sbjct  21    KIITC-RRPVNRKIPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLV  79

Query  270   ASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTP  446
             ASS E AK FLK HDA FASRP  A   +T +N  DMTW+PYGP+WR AR+I L+++FTP
Sbjct  80    ASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQIFTP  139

Query  447   RKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWE  626
             ++LDSFEY+R+EER ALIS L    G   P  L+DHL RF+L +MTR+V  NKY+ +   
Sbjct  140   KRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGES--  195

Query  627   LGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFL  806
                    ++ ++ LQ  +D WFLL+G  N+GDW+PWLS LDLQGYVK+MKA +  ++KF 
Sbjct  196   -------TVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFH  248

Query  807   NYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDT  986
             N V++DH A    ++NF PKDMVD+ L++A+DPNLE  V LT D + GL  D+L GG D+
Sbjct  249   NIVLDDHRAKKNAEKNFVPKDMVDVLLKMAEDPNLE--VKLTNDCVKGLMQDLLTGGTDS  306

Query  987   TAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPL  1166
               A V+WAFQEL R+P +IEKATEELDR++G+ERWVEEKD SQL Y++AI+KET RLHPL
Sbjct  307   LTAAVQWAFQELLRQPRVIEKATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHPL  366

Query  1167  CTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKG  1346
              T+L PH +IEDC VAGY++ +GTTVL+NVW+IGR+ KYWD A EF PERFLE D+D+ G
Sbjct  367   GTMLAPHCAIEDCNVAGYDIQKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMDG  426

Query  1347  QDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTH  1526
              +FA LPF SGRR+CPGYSLG+KV+R TLAN+LHGF WKL   +KP+DIS++E YGLTTH
Sbjct  427   HNFAFLPFSSGRRRCPGYSLGLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTTH  486

Query  1527  PKFPLSYTIEPRLPT  1571
             PKFP+   +E RL +
Sbjct  487   PKFPVPVILESRLSS  501



>gb|ABC69387.1| CYP92B2v3 [Nicotiana tabacum]
Length=508

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 379/495 (77%), Gaps = 15/495 (3%)
 Frame = +3

Query  90    KITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIV  269
             KI T  +R    K PPGP+PWPIIGNLNLLG IPHQS   LS+KYGELMLLKFGS+PV+V
Sbjct  21    KIITC-RRPVNRKIPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLV  79

Query  270   ASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTP  446
             ASS E AK FLK HDA FASRP  A   +T +N  DMTW+PYGP+WR AR+I L+++FTP
Sbjct  80    ASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLNQIFTP  139

Query  447   RKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWE  626
             ++LDSFEY+R+EER ALIS L    G   P  L+DHL RF+L +MTR+V  NKY+ +   
Sbjct  140   KRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGES--  195

Query  627   LGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFL  806
                    ++ ++ LQ  +D WFLL+G  N+GDW+PWLS LDLQGYVK+MKA +  ++KF 
Sbjct  196   -------TVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKFH  248

Query  807   NYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDT  986
             N V++D  A    ++NF PKDMVD+ L++A+DPNLE  V LT D + GL  D+L GG D+
Sbjct  249   NIVLDDRRAKKNAEKNFVPKDMVDVLLKMAEDPNLE--VKLTNDCVKGLMQDLLTGGTDS  306

Query  987   TAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPL  1166
               A V+WAFQEL R+P +IEKATEELDR++G+ERWVEEKD SQL Y++AI+KET RLHPL
Sbjct  307   LTAAVQWAFQELLRRPRVIEKATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHPL  366

Query  1167  CTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKG  1346
              T+L PH +IEDC VAGY++ +GTTVL+NVW+IGR+ KYWD A EF PERFLE D+D+ G
Sbjct  367   GTMLAPHCAIEDCNVAGYDIQKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMDG  426

Query  1347  QDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTH  1526
              +FA LPFGSGRR+CPGYSLG+KV+R TLAN+LHGF WKL   +KP+DIS++E YGLTTH
Sbjct  427   HNFAFLPFGSGRRRCPGYSLGLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTTH  486

Query  1527  PKFPLSYTIEPRLPT  1571
             PKFP+   +E RL +
Sbjct  487   PKFPVPVILESRLSS  501



>gb|ABC69386.1| CYP92B2v1 [Nicotiana tabacum]
Length=509

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 380/496 (77%), Gaps = 16/496 (3%)
 Frame = +3

Query  90    KITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIV  269
             KI T  +R    K PPGP+PWPIIGNLNLLG IPHQS   LS+KYGELMLLKFGS+PV+V
Sbjct  21    KIITC-RRPVNRKIPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGSRPVLV  79

Query  270   ASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARK-ILLSEVFT  443
             ASS E AK FLK HDA FASRP  A   +T +N  DMTW+PYGP+WR AR+ I L+++FT
Sbjct  80    ASSAEMAKQFLKVHDANFASRPMLAGGKYTSYNYCDMTWAPYGPYWRQARRRIYLNQIFT  139

Query  444   PRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDW  623
             P++LDSFEY+R+EER ALIS L    G   P  L+DHL RF+L +MTR+V  NKY+ +  
Sbjct  140   PKRLDSFEYIRVEERQALISQLNSLAG--KPFFLKDHLSRFSLCSMTRMVLSNKYFGES-  196

Query  624   ELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKF  803
                     ++ ++ LQ  +D WFLL+G  N+GDW+PWLS LDLQGYVK+MKA +  ++KF
Sbjct  197   --------TVRVEDLQYLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRTFDKF  248

Query  804   LNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGED  983
              N V++DH A    ++NF PKDMVD+ L++A+DPNLE  V LT D + GL  D+L GG D
Sbjct  249   HNIVLDDHRAKKNAEKNFVPKDMVDVLLKMAEDPNLE--VKLTNDCVKGLMQDLLTGGTD  306

Query  984   TTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHP  1163
             +  A V+WAFQEL R+P +IEKATEELDR++G+ERWVEEKD SQL Y++AI+KET RLHP
Sbjct  307   SLTAAVQWAFQELLRQPRVIEKATEELDRIVGKERWVEEKDCSQLSYVEAILKETLRLHP  366

Query  1164  LCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIK  1343
             L T+L PH +IEDC VAGY++ +GTTVL+NVW+IGR+ KYWD A EF PERFLE D+D+ 
Sbjct  367   LGTMLAPHCAIEDCNVAGYDIQKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLENDIDMD  426

Query  1344  GQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTT  1523
             G +FA LPFGSGRR+CPGYSLG+KV+R TLAN+LHGF WKL   +KP+DIS++E YGLTT
Sbjct  427   GHNFAFLPFGSGRRRCPGYSLGLKVIRVTLANMLHGFNWKLPEGMKPEDISVEEHYGLTT  486

Query  1524  HPKFPLSYTIEPRLPT  1571
             HPKFP+   +E RL +
Sbjct  487   HPKFPVPVILESRLSS  502



>ref|XP_006340220.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=504

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/484 (62%), Positives = 374/484 (77%), Gaps = 16/484 (3%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
               PPGPRPWPIIGNLNL+GS+PH+SLH+LSQKYG+LMLLKFGSKPVI+ASSPE AK  LK
Sbjct  34    NVPPGPRPWPIIGNLNLIGSLPHESLHTLSQKYGDLMLLKFGSKPVIIASSPEMAKEILK  93

Query  306   THDAVFASRPA-TAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THDA+F+SRPA TA  + +FN SD++W+PYG  WR +RKI  +E+F+P++L+SF+Y+ +E
Sbjct  94    THDAIFSSRPALTAGKYISFNYSDVSWAPYGAHWRQSRKIYQTEIFSPKRLESFKYIHVE  153

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             ER  LIS L+   G +    LR HL  FTLST++R+V    Y+          G SI  +
Sbjct  154   ERRNLISSLHVLSGKQ--FFLRHHLTEFTLSTISRMVMSGTYH---------RGESI--E  200

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
              LQG LD+WF+L GVIN+GDW+PWL+ LDLQGY+K+MKA  ++  +F  YV+EDH    K
Sbjct  201   NLQGMLDEWFILGGVINIGDWIPWLNWLDLQGYIKRMKALDKKLREFFKYVLEDHHHKAK  260

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
             G E+  PKDMVD+ LQ+ DDPNLE  V +T D +MGL  D+LAGG DT+A TVEWAFQEL
Sbjct  261   GKEDCVPKDMVDVLLQLVDDPNLE--VKITTDNLMGLILDLLAGGTDTSATTVEWAFQEL  318

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              R P +IEKA EELDR IG+ RWVEE+D SQLPYI+AIIKETFRLHPL  L+PPHYSIE+
Sbjct  319   MRNPNMIEKANEELDRTIGKGRWVEEEDLSQLPYIEAIIKETFRLHPLAPLIPPHYSIEE  378

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY+VP+GT V +N+WS+GRN  YWD   EF  ERFLE D++IKG +F +LPFGSGR
Sbjct  379   CNVAGYDVPKGTMVFVNIWSLGRNPNYWDRPEEFILERFLENDINIKGNNFTMLPFGSGR  438

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R+CPGYS  +K+V T LANLLHGF W+L  D+KP++ISM E YGLTTHP+ P+S  +EPR
Sbjct  439   RRCPGYSFEIKLVGTALANLLHGFNWRLTCDIKPEEISMKEIYGLTTHPEKPISMIMEPR  498

Query  1563  LPTH  1574
             LP H
Sbjct  499   LPLH  502



>emb|CDP18923.1| unnamed protein product, partial [Coffea canephora]
Length=483

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/490 (61%), Positives = 382/490 (78%), Gaps = 11/490 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             +W   AL  ++A+AFL K +T H+R K    PPGP+PWPIIGNLNLLGSIPHQSLH LSQ
Sbjct  4     TWLLLALAGIVALAFLSKPST-HKRLK-LNHPPGPKPWPIIGNLNLLGSIPHQSLHLLSQ  61

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG +M LKFGS PV+VASSPE AK FL+THD  FASRPATAA  +T +N SDMTW+PYG
Sbjct  62    KYGAIMQLKFGSSPVVVASSPEMAKEFLQTHDVNFASRPATAAGKYTSYNCSDMTWAPYG  121

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             PFWR ARK+ L+++F P++LD FE +RIEER A IS LY   G   PV++RDHL+R TLS
Sbjct  122   PFWRQARKLYLTQIFNPKRLDFFESIRIEERRAFISRLYALSG--KPVVMRDHLMRLTLS  179

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
             +  ++V  NKY+++     + +G  +  ++ Q  +D WF L GV N+GDW+PWL   DLQ
Sbjct  180   SACQMVLSNKYFAQ----SEGDGSLVTFEEFQEMIDTWFWLGGVFNIGDWIPWLDRFDLQ  235

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             GY+K+MK   +++++F N+V++DH A  K +++F PKDMVDI LQ A+DP+L+  V LTR
Sbjct  236   GYIKQMKELYKKFDRFHNHVLDDHQARRKTEKDFIPKDMVDILLQYAEDPDLQ--VKLTR  293

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
             D+I GL  D+LAGG DT+A TVEWA  EL + P +I KA EELDRVIG+++WVEE DFS+
Sbjct  294   DQIKGLIQDLLAGGTDTSATTVEWAMNELLKHPRLIRKAAEELDRVIGKDKWVEEADFSK  353

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LP+++AIIKET RLHPL TLL P Y+IEDC VAGY + +GTTV IN WSIGRNSKYWD+ 
Sbjct  354   LPFLEAIIKETLRLHPLATLLAPRYAIEDCTVAGYHIAKGTTVFINTWSIGRNSKYWDSP  413

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
              EF PERFLEKD+D+KGQ+FALLPFGSGRR+CPGY+LG+K+VR+TLANLLHGF WKL   
Sbjct  414   EEFIPERFLEKDIDMKGQNFALLPFGSGRRRCPGYNLGIKLVRSTLANLLHGFNWKLPHG  473

Query  1476  LKPKDISMDE  1505
             +KP++I M+E
Sbjct  474   MKPEEICMEE  483



>gb|ABC69418.1| CYP92B3 [Nicotiana tabacum]
Length=508

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/513 (58%), Positives = 394/513 (77%), Gaps = 12/513 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             SW   AL  LL + FL K   +H  R+    PPGP+PWPI+GN++LLGS PH+SLH L++
Sbjct  4     SWVVLALTGLLTLVFLSKF--LHSPRRKQNLPPGPKPWPIVGNIHLLGSTPHRSLHELAK  61

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             +YG+LMLLKFGS+ V++ SSP+ A+ FLKT+DA++ASRP  AA  +T +N  DMTW+ YG
Sbjct  62    RYGDLMLLKFGSRNVLILSSPDMAREFLKTNDAIWASRPELAAGKYTAYNYCDMTWARYG  121

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             PFWR AR+I L+E+F P++LDSFEY+RIEER  LIS L+  V +  P+LLRDHL R+TL+
Sbjct  122   PFWRQARRIYLNEIFNPKRLDSFEYIRIEERHNLISRLF--VLSGKPILLRDHLTRYTLT  179

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
             +++R V   KY+S+       +   I LK+LQ  LD WFLL+GVIN+GDW+PWL+ LDLQ
Sbjct  180   SISRTVLSGKYFSE----SPGQNSMITLKQLQDMLDKWFLLNGVINIGDWIPWLAFLDLQ  235

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             GYVK+MK     ++KF N+V++DH A  +G++NF P+DMVD+ LQ A+DPNLE  V LT 
Sbjct  236   GYVKQMKELHRNFDKFHNFVLDDHKAN-RGEKNFVPRDMVDVLLQQAEDPNLE--VKLTN  292

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
             D + GL  D+LAGG DT+A TVEWAF EL R+P I++KA +ELD VI ++RWV+EKD++Q
Sbjct  293   DCVKGLMQDLLAGGTDTSATTVEWAFYELLRQPKIMKKAQQELDLVISQDRWVQEKDYTQ  352

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LPYI++IIKET RLHP+ T+LPP  ++EDC VAGY++P+GT +++N WSIGRNS++W++ 
Sbjct  353   LPYIESIIKETLRLHPVSTMLPPRIALEDCHVAGYDIPKGTILIVNTWSIGRNSQHWESP  412

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
              EF PERF  K++ + GQ FALLPFG+GRRKCPGYSLG++++R TLANLLHGF W+L   
Sbjct  413   EEFLPERFEGKNIGVTGQHFALLPFGAGRRKCPGYSLGIRIIRATLANLLHGFNWRLPNG  472

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             + P+DISM+E YGL THPK  L   +EPRLP H
Sbjct  473   MSPEDISMEEIYGLITHPKVALDVMMEPRLPNH  505



>emb|CDP20032.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/499 (61%), Positives = 386/499 (77%), Gaps = 11/499 (2%)
 Frame = +3

Query  81    FLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKP  260
             FL K++T H+R K    PPGP+PWPIIGNLNLLGS PHQSLH LSQKYGE+M LKFGS P
Sbjct  18    FLSKVST-HKRLK-LNHPPGPKPWPIIGNLNLLGSNPHQSLHLLSQKYGEIMQLKFGSSP  75

Query  261   VIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEV  437
             V+VASSPE AK FL+THD +FASRP TAAA +T +N S M W+PYGP WR ARKI L+++
Sbjct  76    VVVASSPEMAKEFLQTHDNIFASRPTTAAAKYTSYNCSGMLWAPYGPHWRQARKICLTQI  135

Query  438   FTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSK  617
             F+P++LD +E +RIEER A +S LY   G   PVLLRDHL+RFTLS   ++V  NKY+++
Sbjct  136   FSPKRLDRYESIRIEERHAFMSRLYALSG--KPVLLRDHLIRFTLSAACQMVLSNKYFAQ  193

Query  618   DWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYE  797
                  + +G  +  ++LQ  +D WF L GV N+GDW+PWL   DLQG VK+MK   ++++
Sbjct  194   ----SEGDGSVVTFEELQEMIDTWFSLGGVFNIGDWIPWLDRFDLQGCVKQMKELYKKFD  249

Query  798   KFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGG  977
             +F N+V++DH A  K +++F PKDMVDI LQ A+DP+L+  V LT D++ GL  D+LAGG
Sbjct  250   RFHNHVLDDHRAKRKTEKDFIPKDMVDILLQYAEDPDLQ--VKLTGDQMKGLILDLLAGG  307

Query  978   EDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRL  1157
              DT+A+TVEWA  EL + P +IEKATEELDRVIGR++WVEE DFS+LP+++AIIKETFRL
Sbjct  308   TDTSASTVEWAMNELLKHPHLIEKATEELDRVIGRDKWVEEADFSKLPFLEAIIKETFRL  367

Query  1158  HPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVD  1337
             HP+ TLLPPH++IED  VAGY +P+GT V IN  SIGRNSKYWD+  EF PER+LEKD+D
Sbjct  368   HPIATLLPPHHAIEDGTVAGYHIPKGTVVFINTRSIGRNSKYWDSPEEFMPERYLEKDID  427

Query  1338  IKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGL  1517
             +KGQ+FALLPFGSGRR CPGY L +K+V T LANLLHGF WKL   +KP++I M+E YG 
Sbjct  428   MKGQNFALLPFGSGRRMCPGYVLALKLVGTMLANLLHGFNWKLPHGMKPEEICMEELYGF  487

Query  1518  TTHPKFPLSYTIEPRLPTH  1574
              THP+ P++   EPRLP +
Sbjct  488   ITHPRTPVAMIPEPRLPVN  506



>ref|XP_006355423.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=500

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/510 (60%), Positives = 382/510 (75%), Gaps = 19/510 (4%)
 Frame = +3

Query  48    FQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYG  227
             F AL  L+ +AFL KITT  +R    K PPGP+PWPIIGNLNLLG IPHQS   LS+KYG
Sbjct  4     FLALAGLVVLAFLCKITT-SRRPVNRKLPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYG  62

Query  228   ELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFW  404
             ELMLLKFGS+PV+VASS E AK FLK HDA FASRP  A   +T +N  DMTW+PYGP+W
Sbjct  63    ELMLLKFGSRPVLVASSAEMAKQFLKIHDANFASRPLLAGGKYTSYNYCDMTWAPYGPYW  122

Query  405   RHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMT  584
             R AR+I L+E+FTP++LDSFEY+R+EER   IS L    G   P  L+DHL RF+L +MT
Sbjct  123   RQARRIYLNEIFTPKRLDSFEYIRVEERQTFISQLNSLAG--KPFFLKDHLSRFSLCSMT  180

Query  585   RLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYV  764
             R+V  NKY+ +          ++ ++ LQ  +D WFLL+G  N+GDW+PWLS LDLQGYV
Sbjct  181   RMVLSNKYFGES---------TVRVEDLQHLVDQWFLLNGAFNIGDWIPWLSLLDLQGYV  231

Query  765   KKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRI  944
             K+MKA +  ++KF N V++DH A     +N   KDMVD+ LQ+A DP LE  V LT D +
Sbjct  232   KQMKALKRSFDKFHNIVLDDHRA----KKNAEKKDMVDVLLQMAQDPTLE--VKLTDDCV  285

Query  945   MGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPY  1124
              GL  D+L GG D+  A V+WAFQEL R+P +I+KA +ELD+V+G+ERWVEE+D SQL Y
Sbjct  286   KGLMQDLLTGGTDSLTAAVQWAFQELLRQPRVIDKAIQELDQVVGKERWVEERDCSQLLY  345

Query  1125  IDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEF  1304
             I+AI+KET RLHPL T+L PH +IEDC VAGY++ +GTTVL+NVW+IGR+ KYWD A EF
Sbjct  346   IEAILKETLRLHPLGTMLAPHCAIEDCNVAGYDIEKGTTVLVNVWTIGRDPKYWDRAEEF  405

Query  1305  CPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKP  1484
              PERFLEKD+D+ G +F+ LPFGSGRR+CPGYSLG+KV+R TLAN+LHGF WKL   +  
Sbjct  406   LPERFLEKDIDMDGHNFSFLPFGSGRRRCPGYSLGLKVIRATLANMLHGFIWKLPQGMNT  465

Query  1485  KDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             + IS++E YGLTTHPKFP+   +EPRL +H
Sbjct  466   ESISVEEHYGLTTHPKFPVPVILEPRLSSH  495



>ref|XP_004250647.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum lycopersicum]
Length=501

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/501 (59%), Positives = 377/501 (75%), Gaps = 18/501 (4%)
 Frame = +3

Query  75    IAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGS  254
             +AFL K++T  +R    K PPGP+PWPIIGNLNLLG IPHQS   LS+KYGELMLLKFGS
Sbjct  13    LAFLCKVSTC-RRPVNRKLPPGPKPWPIIGNLNLLGPIPHQSFDLLSKKYGELMLLKFGS  71

Query  255   KPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLS  431
             +PV+VASS E AK FLK HDA FASRP  A   +T +N  DMTW+PYGP+WR AR+I L+
Sbjct  72    RPVLVASSAEMAKQFLKIHDANFASRPLLAGGKYTSYNYCDMTWAPYGPYWRQARRIYLN  131

Query  432   EVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYY  611
             E+FTP++L+SFEY+R+EER   IS L    G      L+DHL RF+L +MTR+V  NKY+
Sbjct  132   EIFTPKRLESFEYIRVEERQTFISQLNSLAGKT--FFLKDHLSRFSLCSMTRMVLSNKYF  189

Query  612   SKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREE  791
              +          ++ ++ LQ  +D WFLL+G  N+GDW+PWLS LDLQGYVK+MKA +  
Sbjct  190   GES---------TVRVEDLQHLVDQWFLLNGAFNIGDWIPWLSFLDLQGYVKQMKALKRT  240

Query  792   YEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLA  971
             ++KF N V++DH A       F PKDMVD+ LQ+A DPNLE  V LT D + GL  D+L 
Sbjct  241   FDKFHNIVLDDHRAKKNA---FVPKDMVDVLLQMAQDPNLE--VKLTDDCVKGLMQDLLT  295

Query  972   GGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETF  1151
             GG D+  A V+WAFQEL R+P +I+KA +ELD+V+G+ERWVEE+D SQL YI+AI+KET 
Sbjct  296   GGTDSLTAAVQWAFQELLRQPRVIDKAIQELDQVVGKERWVEERDCSQLSYIEAILKETL  355

Query  1152  RLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKD  1331
             RLHPL T+L PH +IEDC VAGY++ +GTTVL+NVW+IGR+ KYWD A EF PERFLEKD
Sbjct  356   RLHPLGTMLAPHCAIEDCKVAGYDIEKGTTVLVNVWTIGRDPKYWDRAQEFLPERFLEKD  415

Query  1332  VDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAY  1511
             +D+ G +F+ LPFGSGRR+CPGYSLG+KV+R TLAN+LHGF WKL   +  + +S++E Y
Sbjct  416   IDMDGHNFSFLPFGSGRRRCPGYSLGLKVIRATLANMLHGFNWKLPQGVNTESVSVEEQY  475

Query  1512  GLTTHPKFPLSYTIEPRLPTH  1574
             GLTTHPKFP+   +EPRL +H
Sbjct  476   GLTTHPKFPVPVILEPRLSSH  496



>ref|XP_011095827.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=513

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/482 (62%), Positives = 374/482 (78%), Gaps = 9/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWP+IGNLNL+GSIPHQSLH LSQKYG++M LKFG  PV+VASSPE AK FL+ H
Sbjct  38    PPGPKPWPVIGNLNLVGSIPHQSLHFLSQKYGDIMQLKFGKFPVVVASSPEMAKQFLRVH  97

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D VFASRPA AA  +T +N SDMTW+PYGPFWR ARKI LSEVF+ +KL+S E++RIEER
Sbjct  98    DTVFASRPALAAGKYTSYNYSDMTWAPYGPFWRQARKIYLSEVFSAKKLESLEHIRIEER  157

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
                ++ LY   G   PV+LR+HL R+TLS ++R+V  +KY+S+     + +   + L +L
Sbjct  158   HNFLARLYSLSG--KPVVLREHLSRYTLSNISRMVLSSKYFSE----SEHDKSVVKLDEL  211

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             Q  LD+WFLL+GV N+GDW+PWLS LDLQGYVK+MKA  +++++F NYVI+DH   M  +
Sbjct  212   QEMLDEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALYKKFDRFHNYVIDDHQTRMATE  271

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             ++ AP D+VD  LQ+A+DPNLE  V LTRD + GL  D+LAGG DT+A T+EWA  EL +
Sbjct  272   KDSAPGDVVDALLQLAEDPNLE--VKLTRDGVKGLLQDLLAGGTDTSATTIEWAIHELLK  329

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
              P +IEKA EEL+RVIGR RWVEE DF  LPYIDAII E+ RLHPL T L PHY++EDC 
Sbjct  330   HPHVIEKAKEELNRVIGRNRWVEENDFPNLPYIDAIIMESMRLHPLATFLAPHYAMEDCK  389

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++ +GTT+LIN WSIGR+   WD  NEF PERF+ K++D+ G +FALLPFGSGRR+
Sbjct  390   VAGYDISKGTTILINTWSIGRDPNSWDAPNEFLPERFVGKEIDLTGSNFALLPFGSGRRR  449

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGY+LG+K+VRT LANLLHGF  KL   ++P+DI M E YGLTTHPK PL+  +EP LP
Sbjct  450   CPGYNLGLKIVRTILANLLHGFDLKLVDGMRPEDICMKELYGLTTHPKKPLAIIMEPILP  509

Query  1569  TH  1574
              +
Sbjct  510   KN  511



>ref|XP_007012628.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY30247.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
Length=512

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/513 (58%), Positives = 386/513 (75%), Gaps = 9/513 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             SWF  A+ WL ++AFL +I T   RR   K PPGP+PWPIIGNLNL+ S+PHQSLH LSQ
Sbjct  4     SWFVVAITWLASLAFLSRIFT--SRRNQLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQ  61

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG LM LKFGS PV+VASS + AK FLK HD  FASRP TAA  HT +N  ++TW+PYG
Sbjct  62    KYGPLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYG  121

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR  RKI L+E+F+ ++L+SFEY+R+EE  A +S LY   G   PV+L++HL R TLS
Sbjct  122   PYWRQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFSG--KPVVLKEHLSRATLS  179

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G KY+S+  +  + E   + LK+ Q  LD+ FLL+GV+N+GDW+PWL  LDLQ
Sbjct  180   VISRIVLGKKYFSESDD--QLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQ  237

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             GY+K+MKA +++ ++F  +V  +H +  K  ++F P+DMVD+ LQ+ADDP++  DV L+ 
Sbjct  238   GYLKRMKALKKKLDRFHEHVFNEHKSKKKELKDFVPQDMVDLLLQLADDPDI--DVKLSY  295

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
             D + G T D++AGG DT+A TVEWA  EL ++P +I+KATEELDRVIGRERWVEEKD  Q
Sbjct  296   DGVRGFTQDLVAGGTDTSATTVEWAISELIKQPQLIKKATEELDRVIGRERWVEEKDIPQ  355

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LPYIDAI+KET R HP+  +L PH ++EDC+VAGY++ +GTTV IN WS+GR+   W+  
Sbjct  356   LPYIDAIMKETMRKHPVAVMLAPHLALEDCLVAGYDIRKGTTVFINTWSMGRDPSLWEEP  415

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
              +F PERFL K +D+KGQ F LLPFGSGRR CPGYSLG+K++R++LANLLHGF WKL  +
Sbjct  416   EDFRPERFLGKKIDVKGQHFELLPFGSGRRMCPGYSLGLKMIRSSLANLLHGFNWKLPDN  475

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              K +D+SM+E YGL T  KFPL   +EPRLP H
Sbjct  476   TKAEDLSMEEVYGLATPRKFPLVAVLEPRLPLH  508



>ref|XP_011070722.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=504

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 369/496 (74%), Gaps = 10/496 (2%)
 Frame = +3

Query  42    WFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQK  221
             W   AL ++  + FL KI  I++R    K PPGP+PWPIIGNLNL+GS+PHQSLH LSQK
Sbjct  5     WPLFALVYVALLTFLSKI--IYKRCPERKLPPGPKPWPIIGNLNLIGSLPHQSLHLLSQK  62

Query  222   YGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGP  398
             YGE+M LKFG  PV+VASSPE AK FLK HD  FA RPA AA  +T FN SDM W+ YGP
Sbjct  63    YGEIMQLKFGKFPVVVASSPEMAKQFLKVHDMAFAGRPALAAGKYTGFNYSDMAWASYGP  122

Query  399   FWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLST  578
             FWR ARKI L +VF+ +KL+SFE +R+E+R    S L+   G   PV+L+DHL R TLST
Sbjct  123   FWRQARKIFLIQVFSAKKLESFEDIRVEKRRNFFSRLHSLSG--KPVVLKDHLFRHTLST  180

Query  579   MTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQG  758
             M+R+V G+KY+S   E    +   + L  LQ  LD+WFLL+GV N+GDW+PWLS LDLQG
Sbjct  181   MSRMVLGSKYFS---ESEDDKSSIVKLDDLQAMLDEWFLLNGVFNIGDWIPWLSFLDLQG  237

Query  759   YVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRD  938
             YVK+MKA  + Y+KF NYVI+DH      D++  P+D+VD+ LQ A+DP+L  DV LTRD
Sbjct  238   YVKRMKALYKRYDKFHNYVIDDHQTRRAKDKDSIPRDVVDVLLQQAEDPDL--DVKLTRD  295

Query  939   RIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQL  1118
              I GL H++LAGG DT AAT+EWA  ++ + P +I KA EELDRVIGR RWVEE DFS+L
Sbjct  296   HIKGLLHNLLAGGTDTAAATIEWAIHDILKNPRVIGKAKEELDRVIGRNRWVEEDDFSRL  355

Query  1119  PYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNAN  1298
             PYIDAII E+ RLHPL T L PH ++EDC VAGY++ +GT +LIN WSIGR+   WD   
Sbjct  356   PYIDAIIMESMRLHPLGTFLIPHSAMEDCKVAGYDISKGTMILINTWSIGRDPNSWDAPE  415

Query  1299  EFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDL  1478
             EF PERFL K +DI G +FALLPFGSGRR+CPGY LG+K+VRT LANLLHGF  KL  D+
Sbjct  416   EFLPERFLGKAIDITGSNFALLPFGSGRRRCPGYDLGLKMVRTMLANLLHGFNLKLVDDM  475

Query  1479  KPKDISMDEAYGLTTH  1526
             +P+D+ M+E+YGLTTH
Sbjct  476   RPEDVCMEESYGLTTH  491



>ref|XP_006475100.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=509

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/490 (58%), Positives = 374/490 (76%), Gaps = 10/490 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             RR+A K P GP+PWPIIGNLNL+G +PHQSLH LSQKYG++M LKFGS PV+VA+S E A
Sbjct  25    RRRALKFPAGPKPWPIIGNLNLIGPLPHQSLHKLSQKYGQIMQLKFGSFPVVVAASAEMA  84

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K FL+THD +F+SRP TAA  HT +N  ++TW+PYGP+WR  RK+ LSE+F+ ++L+S++
Sbjct  85    KQFLQTHDHIFSSRPQTAAGKHTTYNYLNLTWAPYGPYWRQGRKLYLSELFSSKRLESYQ  144

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R+EE  A IS LY   G   P++L++HL R TLS ++R V G KY+S+     K E  
Sbjct  145   YIRVEEYRAFISRLYALSG--KPIVLKEHLSRVTLSIISRTVLGKKYFSE----SKAEDS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              + L++ Q  LD+ FLL+GV+N+GDW+PWL  LDLQGYVK+MKA ++++++F ++V ++H
Sbjct  199   IVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKRMKALKKKFDRFHDHVFDEH  258

Query  828   MAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
              A  KG+ ++F PKDMVD+ LQ+ADDPNL  DV L  D + G T D++AGG DT+A TVE
Sbjct  259   KANRKGNLKDFVPKDMVDLLLQMADDPNL--DVKLNYDSVRGFTQDLIAGGTDTSATTVE  316

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  EL ++P +I+KATEE+DRV+GR+RWVEEKD  QLPYIDAI+KET R HP+  LL P
Sbjct  317   WAMSELMKRPDLIKKATEEIDRVVGRQRWVEEKDIPQLPYIDAIMKETMRKHPVAVLLAP  376

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
             H ++EDC VA +++ +GT V IN WSIGR+   WD   EF PERFL+K  D+KGQ F LL
Sbjct  377   HLALEDCTVASFDIRKGTRVFINTWSIGRDPSVWDKPEEFRPERFLDKAFDVKGQHFELL  436

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PFGSGRR CPGYSLG+K+++++LAN+LHGF WKL   +KP+ ISMDE YGL T  KFPL 
Sbjct  437   PFGSGRRMCPGYSLGVKMIKSSLANMLHGFNWKLPAHMKPEHISMDEVYGLATIRKFPLV  496

Query  1545  YTIEPRLPTH  1574
               +EPRLP H
Sbjct  497   AVVEPRLPLH  506



>ref|XP_007012629.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY30248.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
Length=539

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/540 (55%), Positives = 386/540 (71%), Gaps = 36/540 (7%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             SWF  A+ WL ++AFL +I T   RR   K PPGP+PWPIIGNLNL+ S+PHQSLH LSQ
Sbjct  4     SWFVVAITWLASLAFLSRIFT--SRRNQLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQ  61

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG LM LKFGS PV+VASS + AK FLK HD  FASRP TAA  HT +N  ++TW+PYG
Sbjct  62    KYGPLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYG  121

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR  RKI L+E+F+ ++L+SFEY+R+EE  A +S LY   G   PV+L++HL R TLS
Sbjct  122   PYWRQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFSG--KPVVLKEHLSRATLS  179

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G KY+S+  +  + E   + LK+ Q  LD+ FLL+GV+N+GDW+PWL  LDLQ
Sbjct  180   VISRIVLGKKYFSESDD--QLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQ  237

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             GY+K+MKA +++ ++F  +V  +H +  K  ++F P+DMVD+ LQ+ADDP++  DV L+ 
Sbjct  238   GYLKRMKALKKKLDRFHEHVFNEHKSKKKELKDFVPQDMVDLLLQLADDPDI--DVKLSY  295

Query  936   DRIMGLTH---------------------------DMLAGGEDTTAATVEWAFQELFRKP  1034
             D + G T                            D++AGG DT+A TVEWA  EL ++P
Sbjct  296   DGVRGFTQKKEKKRAFCFAPLLLDDNFSCFVNRDQDLVAGGTDTSATTVEWAISELIKQP  355

Query  1035  WIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVA  1214
              +I+KATEELDRVIGRERWVEEKD  QLPYIDAI+KET R HP+  +L PH ++EDC+VA
Sbjct  356   QLIKKATEELDRVIGRERWVEEKDIPQLPYIDAIMKETMRKHPVAVMLAPHLALEDCLVA  415

Query  1215  GYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCP  1394
             GY++ +GTTV IN WS+GR+   W+   +F PERFL K +D+KGQ F LLPFGSGRR CP
Sbjct  416   GYDIRKGTTVFINTWSMGRDPSLWEEPEDFRPERFLGKKIDVKGQHFELLPFGSGRRMCP  475

Query  1395  GYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             GYSLG+K++R++LANLLHGF WKL  + K +D+SM+E YGL T  KFPL   +EPRLP H
Sbjct  476   GYSLGLKMIRSSLANLLHGFNWKLPDNTKAEDLSMEEVYGLATPRKFPLVAVLEPRLPLH  535



>ref|XP_002278462.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
Length=509

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/517 (56%), Positives = 389/517 (75%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  SW   AL WL ++A L K+ +     K    PPGP PWPIIGNLNL+G +PH+SLH
Sbjct  1     MEAPSWVVLALAWLASVALLSKVFSFRPPHKQ-NLPPGPTPWPIIGNLNLIGHLPHRSLH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTW  383
              LSQKYG++M L+FGS PV+VASS E AK FLKT+D +FASRP TAA  + T+N S++TW
Sbjct  60    KLSQKYGQIMELRFGSFPVVVASSSEMAKQFLKTNDHLFASRPHTAAGKYITYNYSNITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR  RKI L+E+F+ ++L S+EY+R+EER A IS LY   G   PV+L++HL R
Sbjct  120   APYGPYWRQGRKIFLTELFSSKRLASYEYIRVEERQAFISRLYALSG--KPVMLKEHLSR  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              TL  ++R+V G KY+S ++E G+     + +++ Q  L + FLL+GV+N+GDW+PW++ 
Sbjct  178   VTLGVISRIVLGEKYFS-EFESGRS---MLTVEECQKMLGELFLLNGVLNIGDWIPWIAF  233

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MKA R+++++F ++V+E H A  +  E+F  KDMVD+ L++ADDP++E  V
Sbjct  234   LDLQGYVKRMKALRDKFDRFYDHVLEKHRARREA-EDFVAKDMVDMLLRLADDPDVE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LT D I G T D++AGG DT+A T+EWA  E+ R+P I +KATEELDRVIGR+RWVEEK
Sbjct  291   KLTTDGIKGFTQDLIAGGTDTSATTLEWAMSEVLRQPNIAKKATEELDRVIGRDRWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D +QLPYIDAI+KET RLHP+  LL PH +++DC VAGY++ RGT VL+N WSIGR+   
Sbjct  351   DIAQLPYIDAIVKETMRLHPIVVLLAPHLALQDCNVAGYDIRRGTRVLVNTWSIGRDPNI  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD   EF PERFL K +D+KGQ F LLPFGSGRR CPGYSLG+K+++++LAN+LHGF WK
Sbjct  411   WDAPEEFRPERFLGKAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANMLHGFHWK  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L  D+K ++++M+E +GLTT  K PL   +EPRL  H
Sbjct  471   LPWDMKTEELNMEEVFGLTTPRKVPLVAVMEPRLQNH  507



>emb|CAN82000.1| hypothetical protein VITISV_023195 [Vitis vinifera]
Length=509

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/517 (56%), Positives = 389/517 (75%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  SW   AL WL ++A L K+ +     K    PPGP PWPIIGNLNL+G +PH+SLH
Sbjct  1     MEAPSWVVLALAWLASVALLSKVFSFRPPHKQ-NLPPGPTPWPIIGNLNLIGHLPHRSLH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTW  383
              LSQKYG++M L+FGS PV+VASS E AK FLKT+D +FASRP TAA  + T+N S++TW
Sbjct  60    KLSQKYGQIMELRFGSFPVVVASSSEMAKQFLKTNDHLFASRPXTAAGKYITYNYSNITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR  RKI L+E+F+ ++L S+EY+R+EER A IS LY   G   PV+L++HL R
Sbjct  120   APYGPYWRQGRKIFLTELFSSKRLASYEYIRVEERQAFISRLYALSG--KPVMLKEHLSR  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              TL  ++R+V G KY+S ++E G+     + +++ Q  L + FLL+GV+N+GDW+PW++ 
Sbjct  178   VTLGVISRIVLGEKYFS-EFESGRS---MLTVEECQKMLGELFLLNGVLNIGDWIPWIAF  233

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MKA R+++++F ++V+E H A  +  E+F  KDMVD+ L++ADDP++E  V
Sbjct  234   LDLQGYVKRMKALRDKFDRFYDHVLEKHRARREA-EDFVAKDMVDMLLRLADDPDVE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LT D I G T D++AGG DT+A T+EWA  E+ R+P I +KATEELDRVIGR+RWVEEK
Sbjct  291   KLTTDGIKGFTQDLIAGGTDTSATTLEWAMSEVLRQPNIAKKATEELDRVIGRDRWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D +QLPYIDAI+KET RLHP+  LL PH +++DC VAGY++ RGT VL+N WSIGR+   
Sbjct  351   DIAQLPYIDAIVKETMRLHPIVVLLAPHLALQDCNVAGYDIRRGTRVLVNTWSIGRDPNI  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD   EF PERFL K +D+KGQ F LLPFGSGRR CPGYSLG+K+++++LAN+LHGF WK
Sbjct  411   WDAPEEFRPERFLGKAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANMLHGFHWK  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L  D+K ++++M+E +GLTT  K PL   +EPRL  H
Sbjct  471   LPWDMKTEELNMEEVFGLTTPRKVPLVAVMEPRLXNH  507



>ref|XP_004288989.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/519 (55%), Positives = 375/519 (72%), Gaps = 11/519 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLL--AIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQS  200
             ME  SW    L  ++   + FL K       +   K PPGP+PWPIIGNLNL+G +PHQS
Sbjct  1     MESLSWAISTLAVVIFATLTFLSKTLFPKSHKLNLKFPPGPKPWPIIGNLNLIGPLPHQS  60

Query  201   LHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDM  377
             LH LSQ YG +M LKFGS PV++ASSPE AK   KTHD VFASRP TAA  +T +N  ++
Sbjct  61    LHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQISKTHDHVFASRPQTAAGKYTTYNYLNI  120

Query  378   TWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHL  557
             TW+P+GP+WR  RK  LSE+F  ++LDSFEY+R+EE  A +S L    G   PV L++HL
Sbjct  121   TWAPHGPYWRQGRKFYLSELFNSKRLDSFEYIRVEENRAFLSRLCALSG--KPVTLKEHL  178

Query  558   VRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWL  737
              R TLS ++R+V G KY+S    + + E   + L + Q  LD+ FLL+GV+N+GDW+PWL
Sbjct  179   SRLTLSIISRIVLGKKYFS----VSESETSIVTLNEFQEMLDELFLLNGVLNIGDWIPWL  234

Query  738   SGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEA  917
                DLQGYVK+MKA ++++++F ++V  +H A  +G + + PKD+VD+ L++ADDPN+E 
Sbjct  235   ELFDLQGYVKRMKALKKKFDRFHDHVFGEHRANKEGVKEYVPKDLVDVLLKLADDPNIE-  293

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V L  D + G T D++AGG DT+A TVEWA  EL ++P +IEKATEELDRVIGRERWVE
Sbjct  294   -VKLNYDSVKGFTQDLIAGGTDTSATTVEWAMSELMKQPHLIEKATEELDRVIGRERWVE  352

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             EKD +QLPYIDAI+KET R HP+  +L PH ++EDC V GY++ +GT V IN WSIGRNS
Sbjct  353   EKDIAQLPYIDAIMKETMRKHPVAVMLAPHLALEDCNVEGYDIRKGTRVFINTWSIGRNS  412

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
               W+   EF PERFL   +D+KG ++ LLPFGSGRR CPGYSLG+K++R+++AN+LHGF 
Sbjct  413   SVWEAPEEFKPERFLGNTIDVKGHNYELLPFGSGRRMCPGYSLGLKLIRSSIANMLHGFN  472

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL  ++KP+D+SMDE YGL T  KFPL   +EPRLP H
Sbjct  473   WKLPENMKPEDLSMDEVYGLATPRKFPLVAVVEPRLPNH  511



>ref|XP_002273390.1| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera]
Length=511

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/517 (55%), Positives = 380/517 (74%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  +W      WL  +A +   T + +RRK    PPGP+PWPIIGNLNL+G++PH+S+H
Sbjct  1     MESGTWASYVAAWLATVALILLSTHLRRRRK-LNLPPGPKPWPIIGNLNLIGALPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LSQKYG +M L+FGS PV+V SS   AKLFLKTHD  FASRP TAA  +T +N SD+TW
Sbjct  60    ELSQKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ L E+F+ R+L+S+EY+R+EE  +L+S LY    + +PV L+DHL  
Sbjct  120   SPYGPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQ--SNSPVDLKDHLST  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY  ++ E     G  +  ++ +  LD+ FLLSGV+N+GD +PW+  
Sbjct  178   VSLNVISRMVLGKKYLDENVE-----GSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK   +++++FL +V+++H A  KG EN+  KDMVD+ LQ ADDP LE  V
Sbjct  233   LDLQGYVKRMKVLSKKFDRFLEHVLDEHNARRKGVENYVAKDMVDVLLQFADDPTLE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   T D++AGG +++A TVEWA  EL RKP + +KATEELDRVIG+ERWVEEK
Sbjct  291   KLERHGVKAFTQDLIAGGTESSAVTVEWAISELLRKPELFDKATEELDRVIGKERWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPY+D I+KET R+HP+  +L P +S ED  +A Y++P+ T VL+NVW+IGR+ + 
Sbjct  351   DIPNLPYLDTIVKETMRMHPVAPMLVPRFSREDIKIADYDIPKDTRVLVNVWTIGRDPEI  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD  NEF PERF+ K++D+KGQDF LLPFG+GRR CPGYSLG+KV++++LANLLHGFKWK
Sbjct  411   WDQPNEFIPERFIGKNIDVKGQDFELLPFGTGRRMCPGYSLGLKVIQSSLANLLHGFKWK  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L GD+KP D+SM+E +GL+T  K PL    EPRLP H
Sbjct  471   LPGDMKPGDLSMEEIFGLSTPKKIPLVAMAEPRLPAH  507



>ref|XP_011095838.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Sesamum 
indicum]
Length=509

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/492 (58%), Positives = 366/492 (74%), Gaps = 9/492 (2%)
 Frame = +3

Query  102   IHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSP  281
             + +R      PPGP+PWP+IGNLNLLGSIPH+SLH LSQKYG++M LKFG  PV+VASSP
Sbjct  24    VFRRHPKPNLPPGPKPWPVIGNLNLLGSIPHRSLHLLSQKYGDIMQLKFGKFPVVVASSP  83

Query  282   ETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLD  458
             E AK FLK HD VFASRPA AA  +T +N SDMTW+PYGPFWR ARKI LSEVF+ +KL+
Sbjct  84    EMAKQFLKVHDTVFASRPALAAGKYTSYNYSDMTWAPYGPFWRQARKIYLSEVFSAKKLE  143

Query  459   SFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKP  638
             S+E++RIEER   ++ LY   G   PV+LR HL R+ LS+++R+V  +KY+S+     + 
Sbjct  144   SWEHIRIEERHNFLARLYSLSG--KPVILRPHLYRYNLSSISRMVLSSKYFSE----SEH  197

Query  639   EGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVI  818
             +   + L +LQ  +++WFLL+GV N+GDW+PWLS LDLQGYVK+MKA +++ +KF +YVI
Sbjct  198   DKSVVKLDELQEMVEEWFLLNGVFNIGDWIPWLSFLDLQGYVKRMKALQKKLDKFFSYVI  257

Query  819   EDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAAT  998
              DH   +  +++    D+VD  LQ+A+DPNLE  V LT DRI GL   ++  G DT A  
Sbjct  258   NDHQTRIATEKDPVQGDVVDALLQLAEDPNLE--VKLTSDRIKGLLQGLVGAGTDTAATI  315

Query  999   VEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLL  1178
             +EW   EL + P +IEK  EELDRVIGR RWVEE D S LPYIDAII E+ RLHPL T+L
Sbjct  316   IEWTIHELVKNPHVIEKGKEELDRVIGRNRWVEENDSSNLPYIDAIIMESMRLHPLSTIL  375

Query  1179  PPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFA  1358
              PHY++EDC VAGY++ +GT +LIN WSIGR+   WD  NEF PERF+ K++D  G +FA
Sbjct  376   APHYAMEDCKVAGYDISKGTAILINTWSIGRDPNSWDAPNEFLPERFVGKEIDPTGSNFA  435

Query  1359  LLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFP  1538
             LLPFGSGRR+CPGY+LG+K+VRTT ANLLHGF +KL   ++PKD+ M+E YGLT  PK P
Sbjct  436   LLPFGSGRRRCPGYNLGLKLVRTTFANLLHGFNFKLVDGMRPKDVCMEELYGLTAPPKEP  495

Query  1539  LSYTIEPRLPTH  1574
             L+  +EP LP +
Sbjct  496   LALIMEPILPKN  507



>ref|XP_008242245.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=510

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/484 (57%), Positives = 361/484 (75%), Gaps = 8/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGNLNL+G +PHQS H LSQ YG +M LKFGS PV++ASSPE AKLFLK
Sbjct  32    KYPPGPKPWPIIGNLNLIGPLPHQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKLFLK  91

Query  306   THDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
              HD +FASRP TAA  + T++  ++TW+PYGP+WR  RKI LSE+F+ R+L+SFEY+R+E
Sbjct  92    IHDHIFASRPQTAAGKYLTYDHLNVTWAPYGPYWRQGRKIFLSELFSARRLESFEYIRVE  151

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E  A +S LY   G K  ++L++HL R TLS M+R+V G +Y+     + K E   + LK
Sbjct  152   ESHAFVSRLYALSGKK--IMLKEHLSRLTLSIMSRIVFGKEYFG----VSKFESSIMSLK  205

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             + Q  LD+ FLLSGV N+GDW+PWL  LDLQGYVK+MKA  ++ ++F  +V+++H    +
Sbjct  206   EFQDTLDELFLLSGVFNIGDWIPWLKFLDLQGYVKRMKALTKKLDRFYEFVLDEHKTKKE  265

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
             G E F  +DMVD+ L++ DDPN + +V LT D +  +T D +AGG DT+A T+EWA  EL
Sbjct  266   GVEEFVSEDMVDLLLRLVDDPN-DLEVKLTNDSVKAITQDSVAGGTDTSATTLEWAMSEL  324

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              ++P +IEKAT+ELD+VIGRERWVEEKD   LPY DAI+KET R HP+  +LPPH ++ED
Sbjct  325   IKQPNLIEKATQELDKVIGRERWVEEKDLENLPYTDAIMKETMRKHPVVAMLPPHLALED  384

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY++ +GT V +N WS+GR+ K WD  +EF PERFL K +D+KGQ F  LPFGSGR
Sbjct  385   CNVAGYDICKGTLVFVNTWSMGRDPKLWDAPDEFRPERFLGKAIDVKGQSFEFLPFGSGR  444

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R CPGYSLG+KV+R+ LAN+LHGF WKL  ++K +D+ M+E YGL T  KFPL   +EPR
Sbjct  445   RMCPGYSLGLKVIRSCLANMLHGFNWKLSENVKKEDLGMEEVYGLLTPRKFPLVAVVEPR  504

Query  1563  LPTH  1574
             LP H
Sbjct  505   LPIH  508



>gb|EYU22742.1| hypothetical protein MIMGU_mgv1a004987mg [Erythranthe guttata]
Length=501

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/504 (59%), Positives = 370/504 (73%), Gaps = 23/504 (5%)
 Frame = +3

Query  75    IAFLFK-ITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFG  251
             IAF+ K I+ + Q R+   TPPGP+PWPIIGNLNL+G IPHQS H LS+KYGE+M LKFG
Sbjct  15    IAFISKTISKLRQPRR--NTPPGPKPWPIIGNLNLIGPIPHQSFHFLSRKYGEIMQLKFG  72

Query  252   SKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILL  428
               PV+VASSPE AK FL+ HD VFA+RP  AA  +T +N SDMTW+PYGP WR ARKI L
Sbjct  73    KYPVVVASSPEMAKQFLRVHDTVFATRPPLAAGKYTAYNYSDMTWAPYGPQWRLARKIYL  132

Query  429   SEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKY  608
             SEVF+ +K++SFE+VRIEE   L+S L    G  +PV+LRDHL+ +T+S   R++ G KY
Sbjct  133   SEVFSAKKIESFEHVRIEETRNLVSRLRSVSG--DPVVLRDHLMHYTVSATCRMILGKKY  190

Query  609   YSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFRE  788
             +  D E  K          LQ  LD+WFLL+G   + DW+PWL  LDLQGYVK+MK    
Sbjct  191   FC-DSEDDK-------FVTLQDMLDEWFLLNGAFVISDWIPWLKFLDLQGYVKRMKTLYN  242

Query  789   EYEKFLNYVIEDHMAMMKGDENFAPKD--MVDIFLQIADDPNLEADVALTRDRIMGLTHD  962
               + F NYVI+DH    KG      KD  +VD  L++ADDPNLE  V LTRD + GL  D
Sbjct  243   RLDNFHNYVIDDHQTRQKGAAAEEEKDFTLVDKLLKMADDPNLE--VKLTRDCVKGLLQD  300

Query  963   MLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIK  1142
             +LAGG DT+AATVEWA  E+ R+P II+KA EELDRVIGR+RWVEE DFSQLPY++AII 
Sbjct  301   LLAGGTDTSAATVEWALCEILRQPRIIKKAKEELDRVIGRKRWVEENDFSQLPYVEAIIM  360

Query  1143  ETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFL  1322
             E+ RLHPL TLL PHY+I+DC VAG+++ +GTTVLIN WSIGR+ K WD+  EF PERFL
Sbjct  361   ESMRLHPLATLLAPHYAIDDCKVAGFDISKGTTVLINTWSIGRDPKSWDSPEEFLPERFL  420

Query  1323  EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMD  1502
              K+ D+ G +FALLPFGSGRR+CPGY+LG+K+VRT LANLLHGF+++L      +D+ ++
Sbjct  421   GKETDMLGSNFALLPFGSGRRRCPGYNLGLKMVRTMLANLLHGFEFQL-----AEDVCLE  475

Query  1503  EAYGLTTHPKFPLSYTIEPRLPTH  1574
             E YGLTTHPK PL   +EP LP+ 
Sbjct  476   EMYGLTTHPKKPLVVVMEPTLPSQ  499



>emb|CAN77776.1| hypothetical protein VITISV_021888 [Vitis vinifera]
Length=500

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/517 (55%), Positives = 374/517 (72%), Gaps = 22/517 (4%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  +W      WL  +A +   T + +RRK    PPGP+PWPIIGNLNL+G++PH+S+H
Sbjct  1     MESGTWASYVAAWLATVALILLSTHLRRRRK-LNLPPGPKPWPIIGNLNLIGALPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LSQKYG +M L+FGS PV+V SS   AKLFLKTHD  FASRP TAA  +T +N SD+TW
Sbjct  60    ELSQKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ L E+F+ R+L+S+EY+R+EE  +L+S LY    + +PV L+DHL  
Sbjct  120   SPYGPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQ--SNSPVDLKDHLST  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY  ++ E     G  +  ++ +  LD+ FLLSGV+N+GD +PW+  
Sbjct  178   VSLNVISRMVLGKKYLDENVE-----GSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK           +V+++H A  KG EN+  KDMVD+ LQ A+DP LE  V
Sbjct  233   LDLQGYVKRMK-----------HVLDEHNARRKGVENYVAKDMVDVLLQFAEDPTLE--V  279

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   T D++AGG +++A TVEWA  EL RKP + EKATEELDRVIG+ERWVEEK
Sbjct  280   KLERHGVKAFTQDLIAGGTESSAVTVEWAISELLRKPELFEKATEELDRVIGKERWVEEK  339

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPY+D I+KET R+HP+  +L P +S ED  +AGY++P+ T VL+NVW+IGR+ + 
Sbjct  340   DIPNLPYLDTIVKETMRMHPVAPMLVPRFSREDIKIAGYDIPKDTRVLVNVWTIGRDPEI  399

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD  NEF PERF+ K++D+KGQDF LLPFG+GRR CPGYSLG+KV++++LANLLHGFKWK
Sbjct  400   WDQPNEFIPERFIGKNIDVKGQDFELLPFGTGRRMCPGYSLGLKVIQSSLANLLHGFKWK  459

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L GD+KP D+SM+E +GL+T  K PL    EPRLP H
Sbjct  460   LPGDMKPGDLSMEEIFGLSTPKKIPLVAMAEPRLPAH  496



>ref|XP_011095822.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=513

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/484 (58%), Positives = 360/484 (74%), Gaps = 9/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWP+IGNL+L+GS PH+S H LSQKYG++M LK+G  PV+VASSPE AK FL+
Sbjct  36    KFPPGPKPWPVIGNLHLVGSHPHRSFHVLSQKYGDIMQLKYGKFPVVVASSPEMAKQFLR  95

Query  306   THDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
              HD VFASRPA AA  +T F+ SD+TW+PYGP WR ARKI LSEVF  +KL+SFEY+RIE
Sbjct  96    LHDKVFASRPALAAGKYTSFDYSDVTWAPYGPHWRQARKIYLSEVFNAKKLESFEYIRIE  155

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             ER  L+S L+   G   PV+L+DHL R++LS ++R+V G+ Y S+      P    + L 
Sbjct  156   ERRNLLSRLHSLSG--KPVVLKDHLSRYSLSIISRMVFGDGYISE----SGPNKSIVTLD  209

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             +L   LD+WFLL+GV N GDW+PWL+ LDLQG VKKMK   ++ ++FLNYVI+DH     
Sbjct  210   ELHELLDEWFLLNGVFNFGDWIPWLNFLDLQGCVKKMKGLYQKLDRFLNYVIDDHQTRRA  269

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
               ++    D VD+ LQ+A+D NLE  + LTRDRI GL  D+L GG DT + T+EWA  E+
Sbjct  270   IGKDSIQGDAVDMLLQLAEDDNLE--IKLTRDRIKGLIQDLLGGGADTASTTLEWAIHEI  327

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              R P +IEKA  ELDRVIGR RWVEE+D S+LPYID II E+ RLHPL TLL PHY++ED
Sbjct  328   LRNPRVIEKAKVELDRVIGRNRWVEEEDTSKLPYIDGIIMESMRLHPLGTLLIPHYAMED  387

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY++ +GTT+LIN WS+GRN   WD   EF PERFL+KD D+ G +F+LLPFGSGR
Sbjct  388   CKVAGYDISKGTTILINTWSMGRNPNIWDAPEEFLPERFLDKDFDVTGGNFSLLPFGSGR  447

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R+CPGY+LG+K+VR TLANLLHGF W L   ++P+D+S++E YGL T PK P++  + P 
Sbjct  448   RRCPGYNLGLKMVRPTLANLLHGFNWNLVDGMRPEDVSVEEFYGLATQPKKPVTIIMNPA  507

Query  1563  LPTH  1574
             LP H
Sbjct  508   LPDH  511



>ref|XP_007203042.1| hypothetical protein PRUPE_ppa022777mg [Prunus persica]
 gb|EMJ04241.1| hypothetical protein PRUPE_ppa022777mg [Prunus persica]
Length=510

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 362/484 (75%), Gaps = 8/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGNLNL+G +PHQS H LSQ YG +M L FGS PV++ASSPE AKLFLK
Sbjct  32    KYPPGPKPWPIIGNLNLIGPLPHQSFHKLSQTYGPIMQLNFGSFPVVIASSPEMAKLFLK  91

Query  306   THDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
              HD VFASRP TAA  + T++  ++TW+PYGP+WR  RKI LSE+F+ R+L+SFEY+R+E
Sbjct  92    IHDHVFASRPQTAAGKYLTYDHLNVTWAPYGPYWRQGRKIFLSELFSSRRLESFEYIRVE  151

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E  A +S LY   G +  ++L++HL R TLS M+R+V G +Y+     + K E   + LK
Sbjct  152   ESHAFVSRLYALSGKQ--IMLKEHLSRLTLSIMSRIVFGKEYFG----VSKFESSVMSLK  205

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             + Q  LD+ FLLSGV N+GDW+PWL+ LDLQGYVK+MKA  ++ ++F  +V+++H    +
Sbjct  206   EFQDTLDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKLDRFYEFVLDEHKTKKE  265

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
             G E F  +DMVD+ L++ DDPN + +V LT D +  +T D +AGG DT+A T+EWA  EL
Sbjct  266   GVEEFVSEDMVDLLLRLVDDPN-DLEVKLTYDSVKAITQDSVAGGTDTSATTLEWAMSEL  324

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              ++P +I+KAT+ELDRVIGRERWVEEKD   LPYIDAI+KET R HP+  +LPPH ++ED
Sbjct  325   IKQPNLIKKATQELDRVIGRERWVEEKDLENLPYIDAIMKETMRKHPVVAMLPPHLALED  384

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY++ +GT V +N WS+GR+   WD  +EF PERF+ K +D+KGQ F  LPFGSGR
Sbjct  385   CNVAGYDICKGTLVFVNTWSMGRDPTLWDAPDEFRPERFIGKAIDVKGQSFEFLPFGSGR  444

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R CPGYSLG+KV+R+ LAN+LHGF WKL  ++K +D+SM+E YGL T  KFPL   +EPR
Sbjct  445   RMCPGYSLGLKVIRSCLANMLHGFNWKLSENVKKEDLSMEEVYGLLTPRKFPLVAVVEPR  504

Query  1563  LPTH  1574
             LP +
Sbjct  505   LPIY  508



>ref|XP_007215252.1| hypothetical protein PRUPE_ppa004436mg [Prunus persica]
 gb|EMJ16451.1| hypothetical protein PRUPE_ppa004436mg [Prunus persica]
Length=510

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/518 (54%), Positives = 373/518 (72%), Gaps = 14/518 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  SW   A  WL A+  +     +  R+     PPGP+PWPIIGNLNL+  +PH+S+H
Sbjct  1     MESISWVAYAAAWLGALVLILLSRRLRHRK--LNLPPGPKPWPIIGNLNLISQLPHRSIH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             +L+QKYG +M LKFGS PV+V SS + AK FLKTHD  FA RP  AA  HT +N SD+TW
Sbjct  59    ALAQKYGPIMQLKFGSHPVVVGSSVDMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ + E+F+ R+L+S+EY+R EE  AL+ GL+++  T   +LL+DHL  
Sbjct  119   SPYGPYWRQARKMCVMELFSARRLESYEYIRKEEMNALLRGLFESSNTN--ILLKDHLST  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY  +       E   +   + +  LD+ FLLSGV+N+GD +PWL  
Sbjct  177   VSLNVISRMVLGKKYTDES------EDSIVSPDEFKKMLDELFLLSGVLNIGDSIPWLDF  230

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK-GDENFAPKDMVDIFLQIADDPNLEAD  920
             LDLQGY+K+MK   ++ ++FL +V++ H+A  K G E+F  KDMVD+ LQ+ADDPNLE  
Sbjct  231   LDLQGYIKRMKTLSKKLDRFLEHVLDVHIAKRKAGGEDFVAKDMVDVLLQLADDPNLE--  288

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L R  +   T D++AGG +++A TVEWA  EL RKP + +KATEELDRVIGRERWVEE
Sbjct  289   VKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLRKPEVFKKATEELDRVIGRERWVEE  348

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
              D   LPY+DAI KET RLHP+  +L P  + EDC VAGY++P+GT +L++VW+IGR+ +
Sbjct  349   NDIVNLPYVDAIAKETMRLHPVAPMLVPRLAREDCQVAGYDIPKGTRILVSVWTIGRDPQ  408

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              WD+  EFCPERFL KD+D+KGQDF LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W
Sbjct  409   LWDSPEEFCPERFLGKDIDVKGQDFELLPFGSGRRMCPGYSLGIKVIQASLANLLHGFTW  468

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +L  +LK +D++M+E +GL+T  K+PL    EPRLP H
Sbjct  469   RLPDNLKEEDLNMEEIFGLSTPKKYPLVAVCEPRLPPH  506



>ref|XP_002277926.2| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
Length=508

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/483 (58%), Positives = 372/483 (77%), Gaps = 12/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +PH SLH LSQKYG++M L+FGS PV+VASSPE AK FLKT+
Sbjct  34    PPGPKPWPIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEMAKQFLKTN  93

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D +FASRP TAA  +T +N S++TW+PYGP+WR  RKI  +E+F+ ++L+S+EY+++EER
Sbjct  94    DHLFASRPQTAAGKYTAYNYSNITWAPYGPYWRQGRKIYHTELFSWKRLESYEYIQVEER  153

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              A IS LY   G   PV+L++HL R TLS ++R+V G KY+++  E G+     + +K+ 
Sbjct  154   RAFISRLYALSG--KPVMLKEHLSRVTLSVISRIVLGEKYFNES-ESGRS---IVTVKEF  207

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK-G  845
             Q  LD+ FLL+GV+N+GDW+PW++ LDLQGYVK+MK  R+++++F ++V+E H A  + G
Sbjct  208   QEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKVLRDKFDRFHDHVLEKHRARREVG  267

Query  846   DENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELF  1025
             D  F  KDMVD+ L++ADDP+L+  V LT D I G T D++AGG DT+A T+EWA  E+ 
Sbjct  268   D--FVVKDMVDMLLRLADDPDLQ--VKLTTDGIKGFTQDLIAGGTDTSATTLEWAMSEVL  323

Query  1026  RKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDC  1205
             R+P I  KATEELDRVIGR RWVEEKD  QLPYIDAI+KET RLHP+  LL PH ++ DC
Sbjct  324   RQPNIANKATEELDRVIGRNRWVEEKDIPQLPYIDAIVKETMRLHPVAVLLAPHLALHDC  383

Query  1206  IVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRR  1385
              VAGY++ +GT VLIN WSIGR+   WD   EF PERFL K +D+KGQ+F LLPFGSGRR
Sbjct  384   NVAGYDIRKGTRVLINTWSIGRDPNLWDAPEEFRPERFLGKAIDVKGQNFELLPFGSGRR  443

Query  1386  KCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
              CPGYSLG+K++R++LAN+LHGF WKL GD+K ++++M+E +GL T  K PL   +EPRL
Sbjct  444   MCPGYSLGLKMIRSSLANMLHGFHWKLPGDMKAEELNMEEVFGLATPRKVPLVAVMEPRL  503

Query  1566  PTH  1574
             P H
Sbjct  504   PNH  506



>ref|XP_007203722.1| hypothetical protein PRUPE_ppa019048mg [Prunus persica]
 gb|EMJ04921.1| hypothetical protein PRUPE_ppa019048mg [Prunus persica]
Length=509

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/517 (54%), Positives = 378/517 (73%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  S+    L  +  +A + KI     + +  K PPGP+PWPIIGNLN +G +PHQSLH
Sbjct  1     MEAISYAILTLALVATLALVSKI--FFPQSQKLKFPPGPKPWPIIGNLNHIGPLPHQSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LSQ YG +M LKFGS PV++ASS E A+ FL+THD +FASRP TAA  +T +N S++TW
Sbjct  59    KLSQIYGPIMQLKFGSYPVVIASSAEMARQFLRTHDHIFASRPQTAAGKYTTYNYSNLTW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +P+GP+WR  RKI LS +F+ + LDS EY+R+EE  A +S L    G   P +L++HL R
Sbjct  119   APHGPYWRQGRKIYLSHLFSSKILDSVEYIRVEENRAFLSRLCALSG--KPTMLKEHLSR  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              TL+ ++R+V G KY+S      + E   + L++ Q  LD+ FLL+GV+N+GDW+PW+  
Sbjct  177   LTLTIISRIVLGKKYFSVS----ESESSIVTLEEFQEMLDELFLLNGVLNIGDWIPWVQF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
              DLQG+VK+MKA ++++++F ++V ++H A  +G ++F PKDMVD+ LQ+A+DP++E  V
Sbjct  233   FDLQGFVKRMKALKKKFDRFHDHVFDEHRAKKEGVKDFVPKDMVDLLLQLAEDPDIE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L  D + G T D++AGG DT+A TVEWA  EL ++P +IEKATEELDRVIGR RWVEEK
Sbjct  291   KLNYDSVKGFTQDLIAGGTDTSATTVEWAMSELMKQPLLIEKATEELDRVIGRGRWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D  QLPYI+AI+KET R HP+  +L PH ++EDC V GY++ +GT V IN WS+GR    
Sbjct  351   DIPQLPYIEAIMKETMRKHPVAVMLAPHLALEDCNVGGYDICKGTRVFINTWSMGREPSQ  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD  +EF P+RFL + +D+KGQ+F LLPFGSGRR CPGYSLG+K++R++LANLLHGF WK
Sbjct  411   WDAPDEFNPDRFLGRSIDVKGQNFELLPFGSGRRMCPGYSLGLKMIRSSLANLLHGFNWK  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L G++KP+D+SM+E +GL T  KFPL   +EPRLP H
Sbjct  471   LPGNMKPEDLSMEEVFGLATPRKFPLVAVVEPRLPAH  507



>ref|XP_009337219.1| PREDICTED: flavonoid 3'-monooxygenase-like [Pyrus x bretschneideri]
Length=514

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/509 (54%), Positives = 368/509 (72%), Gaps = 9/509 (2%)
 Frame = +3

Query  54    ALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
              L  L  +A + K  T+  + K  K PPGP+PWPIIGNLNL+G +PHQSLH LSQ YG +
Sbjct  11    TLACLATLALVSK--TLFPQLKKQKFPPGPKPWPIIGNLNLIGPLPHQSLHKLSQTYGPI  68

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRH  410
             M L+FGS+PV+VASSPE AK FLKTHD VF+SRP TAA  + T++  ++TWSPYGP+WR 
Sbjct  69    MQLRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPPTAAGKYLTYDYQNVTWSPYGPYWRQ  128

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RKI L E+F+ ++L+SFEY+R++E  A  S LY    + NP++L++HL R  LS M+R 
Sbjct  129   GRKIFLYELFSSKRLESFEYIRVDENRAFTSRLYAIAKSGNPIVLKEHLSRLNLSIMSRT  188

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G  Y+S    + + EG  + L++ Q  +D+ F+LSGV N+GDW+PWL+ LDLQGY+K+
Sbjct  189   VLGKDYFS----VAEYEGSIMSLEEFQDMIDELFVLSGVFNIGDWIPWLNFLDLQGYIKR  244

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             MKA +++  +F ++V+ +H A  +G E F PKDMVD+ LQ+ D  + + +V L  D I  
Sbjct  245   MKAIQKKINRFYDFVLNEHKARKEGVEEFVPKDMVDLLLQLVDGSS-DLEVKLNYDSIKA  303

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
                D++AGG DT+A  +EWA  EL ++P +I+KATEELDRVIGRERWVEEKD +QLPYID
Sbjct  304   FIQDLIAGGTDTSATVLEWAMSELIKQPNLIKKATEELDRVIGRERWVEEKDLAQLPYID  363

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET R HP   +LPPH ++E+  VAGY+V +GT V +N WS+GR+ K W+   EF P
Sbjct  364   AIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTVVFVNTWSMGRDPKLWEEPEEFRP  423

Query  1311  ERFL-EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPK  1487
              RFL    +D++GQ F LLPFGSGRR CPGY LG+K++RT LAN+LHGF WKL G++K +
Sbjct  424   GRFLGNTGIDLQGQSFELLPFGSGRRMCPGYKLGLKMIRTCLANMLHGFNWKLPGNVKVE  483

Query  1488  DISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             D+ M+E +GL T  KFPL   +EPRLP H
Sbjct  484   DLGMEETFGLVTPRKFPLVAVMEPRLPVH  512



>ref|XP_002516018.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF46438.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=521

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/508 (55%), Positives = 368/508 (72%), Gaps = 8/508 (2%)
 Frame = +3

Query  69    LAIAFLFKI-TTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +A  FL K+ T+ H   ++   PPGP+PWPIIGN NL+G +PHQSLH LSQK+G +M LK
Sbjct  14    VAFFFLSKLFTSRHYYNRSLNLPPGPKPWPIIGNFNLIGHLPHQSLHKLSQKFGPIMQLK  73

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS PV++ SS E AK  L+T+D +FASRP TAA  +T +N S++TW+PYG +WR  RKI
Sbjct  74    FGSYPVVIVSSAEMAKQILRTNDHIFASRPQTAAGKYTTYNYSNVTWAPYGAYWRQGRKI  133

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGN  602
              L E+F+ ++LDS+  +R+EE  A +S ++    T  P+LL+DHL R TLS ++R+V G 
Sbjct  134   YLHELFSSKRLDSYHDIRVEEMRAFVSRIHTLSVTGKPILLKDHLSRATLSIISRIVLGK  193

Query  603   KYY----SKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             KY+      +            L + Q  LD+ FLL+GV+N+GDW+PWL+ LDLQGYVK+
Sbjct  194   KYFITESESESLSESETSVITTLGEFQKILDELFLLNGVMNIGDWIPWLAFLDLQGYVKR  253

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             MKA + ++++F ++V+ +H A     +NF PKDMVD+ LQ+ADDP LE  V L  D + G
Sbjct  254   MKALKVKWDRFHDHVLGEHKAKKAEVKNFVPKDMVDLLLQLADDPELE--VKLNNDSVKG  311

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
                D++AGG DT+A TVEWA  EL ++P +I+KATEELDRVIG+ERWVEEKD  QLPYID
Sbjct  312   FIQDLIAGGTDTSATTVEWAMSELLKQPSLIKKATEELDRVIGKERWVEEKDIPQLPYID  371

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET R HP+  +L PHY++ED  V G+++ +GTTV IN WSIGR+   WD+  EF P
Sbjct  372   AIMKETMRKHPVAVMLAPHYALEDAKVNGHDIAKGTTVFINTWSIGRDPLLWDDPEEFRP  431

Query  1311  ERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKD  1490
             ERFL K +D+KGQ F LLPFGSGRR CPGYSLG+K+++++LANLLHGF WKL  D+KP+D
Sbjct  432   ERFLGKAIDVKGQSFELLPFGSGRRMCPGYSLGLKMIQSSLANLLHGFNWKLPDDMKPED  491

Query  1491  ISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +SMDE YGL T  KFPL    EPRLP +
Sbjct  492   LSMDEVYGLATPRKFPLVAVTEPRLPIN  519



>ref|XP_008354562.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/519 (54%), Positives = 372/519 (72%), Gaps = 10/519 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKIT-TIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSL  203
             ME FS    A+  L  +A L  ++ T+  + K  K  PGP+PWPIIGNLNL+G +PHQSL
Sbjct  1     MEYFSC--AAILTLACLATLALVSKTLFPQLKKQKFLPGPKPWPIIGNLNLIGPLPHQSL  58

Query  204   HSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMT  380
             H LSQ YG +M L+FGS+PV+VASSPE AK FLKTHD VF+SRP TAA  + T++  ++T
Sbjct  59    HKLSQIYGPIMQLRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVT  118

Query  381   WSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLV  560
             WSPYGP+WR  RKI L E+F+ ++L+SFEY+R +E  A  S LY    + NP++L++HL 
Sbjct  119   WSPYGPYWRQGRKIFLYELFSSKRLESFEYIRADENRAFTSRLYAIAKSGNPIVLKEHLS  178

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
             R  LS M+R V G  Y+S    + + EG  + LK+ Q  +D+ F+L+GV N+GDW+PWL+
Sbjct  179   RLNLSIMSRTVLGKDYFS----VAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLN  234

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
              LDLQGY+K+MKA +++  +F ++V+ +H A  +G E F PKDMVD+ LQ+ D  N + +
Sbjct  235   FLDLQGYIKRMKAMQKKINRFYDFVLNEHKAQKEGVEEFVPKDMVDLLLQLVDGSN-DLE  293

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L  D I   T D++AGG DT+A  +EWA  EL ++P +I+KATEELDRVIGRERWVEE
Sbjct  294   VKLNYDSIKAFTQDLIAGGTDTSATNLEWAMSELIKQPXLIKKATEELDRVIGRERWVEE  353

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD  QLPYIDAI+KET R HP   +LPPH ++E+  VAGY+V +GT V +N WS+GR+ K
Sbjct  354   KDLXQLPYIDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTXVFVNTWSMGRDXK  413

Query  1281  YWDNANEFCPERFL-EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
              W+    F PERFL    +D++GQ F LLPFGSGRR CPGY LG+ ++RT LAN+LHGF 
Sbjct  414   LWEEPEXFRPERFLGNXGIDLQGQSFELLPFGSGRRMCPGYKLGLXMIRTCLANMLHGFN  473

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL G++K +D+ M+EAYG+ T  KFPL   ++PRLP H
Sbjct  474   WKLPGNVKVEDLGMEEAYGMXTTRKFPLVAVMDPRLPVH  512



>ref|XP_008242247.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=529

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/484 (57%), Positives = 357/484 (74%), Gaps = 8/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGNLNLLG +PHQSLH LSQ YG +M LKFGS PV+VASSPE  K F K
Sbjct  51    KLPPGPKPWPIIGNLNLLGPLPHQSLHKLSQTYGPVMQLKFGSYPVVVASSPEMTKQFSK  110

Query  306   THDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THD +FASRP TAA  + T++  ++TW+PYGP+WR  RKI L+E+F+ ++L+SF Y+R+E
Sbjct  111   THDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLTELFSSKRLESFRYIRVE  170

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E  A  S LY   G    V+L++HL R  LS M+R+V G +Y+S    L   E   + LK
Sbjct  171   ENRAFASRLYALSG--KAVVLKEHLSRLNLSIMSRIVLGKEYFS----LTDFESSIMSLK  224

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             + Q  LD+ FLL+GV N+GDW+PWL  LDLQGYVK+MKA +++ ++F  +V+ +H A  +
Sbjct  225   EFQDMLDELFLLNGVSNIGDWIPWLDFLDLQGYVKRMKAVKKKMDRFYEFVLHEHKARKE  284

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
             G + F  KDMVD+ LQ+ DDPN + +V LT D I   T D++AGG DT+A+ +EWA  EL
Sbjct  285   GVQEFVAKDMVDLLLQLVDDPN-DLEVKLTYDSIKAFTQDLIAGGTDTSASLLEWAMSEL  343

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              ++P +IEKATEELDRVIG+ERWVEEKD   LPY+DAI+KET R HP   +LPPH ++ED
Sbjct  344   IKQPNLIEKATEELDRVIGKERWVEEKDLENLPYMDAIMKETMRKHPAVVMLPPHLALED  403

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY+V +GT VL+N+WS+GR+   WD  +EF PERFL K +D+KGQ F LLPFGSGR
Sbjct  404   CNVAGYDVRKGTLVLVNLWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFELLPFGSGR  463

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R CPGYSLG+K++ + LAN+LHGF WKL  ++K +D+ M+E YGL T  KFPL    EPR
Sbjct  464   RMCPGYSLGLKMIGSCLANVLHGFNWKLPENVKVEDLGMEEVYGLVTPRKFPLVAVTEPR  523

Query  1563  LPTH  1574
             LP H
Sbjct  524   LPIH  527



>ref|XP_008337887.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=509

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/484 (55%), Positives = 363/484 (75%), Gaps = 9/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWP+IGNLNL+G +PHQSLH LSQ YG +M L FGS PV++ASS E A+ FLK
Sbjct  32    KLPPGPKPWPVIGNLNLIGPLPHQSLHKLSQTYGPIMKLMFGSYPVVIASSAEMARQFLK  91

Query  306   THDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THD +FASRP TAA  +T +N  ++TW+P+GP+WR  RKI LS +F+ + LDS EY+R+E
Sbjct  92    THDHIFASRPETAAGKYTTYNYKNLTWAPHGPYWRQGRKIYLSHLFSSKVLDSVEYIRVE  151

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E  A +S L    G   P +L++HL R TLS ++R+V G KY+S    + + E   + L+
Sbjct  152   ENRAFLSRLCAVSG--KPTMLKEHLSRLTLSIISRIVLGKKYFS----VSESETSIVSLE  205

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             + Q  LD+ FLL+GV+N+GDW+PW   LDLQGYVK+MKA ++++++F ++V+++H A MK
Sbjct  206   EFQEMLDELFLLNGVLNIGDWIPWAQCLDLQGYVKRMKALKKKFDRFHDHVLDEHKANMK  265

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
               ++F  KDMVD+ +Q+A+DP++E  V L  D + G T D++AGG DT+A TVEWA  EL
Sbjct  266   EVKDFVSKDMVDLLMQLAEDPDIE--VKLNYDSVKGFTQDLIAGGTDTSATTVEWAMSEL  323

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              ++P +IEKATEELD VIGRERWVEEKD +QL YIDAI+KET R+HP+  +L PH ++ED
Sbjct  324   MKQPHLIEKATEELDIVIGRERWVEEKDIAQLHYIDAIMKETMRMHPVAVMLAPHLALED  383

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY++ +GT V IN WS+GR+   W+ A EF P+RFL K +D+KGQ+F LLPFGSGR
Sbjct  384   CNVAGYDICKGTRVFINTWSMGRDPSQWNAAEEFNPDRFLGKAIDVKGQNFELLPFGSGR  443

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R CPG+SLG+K++R++LANLLHGF WKL  +   +D+ M+E +GL T  KFPL   +EPR
Sbjct  444   RMCPGFSLGLKMIRSSLANLLHGFNWKLPDNATTEDLVMEEVFGLATPRKFPLVAVLEPR  503

Query  1563  LPTH  1574
             LP H
Sbjct  504   LPLH  507



>ref|XP_010273844.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=509

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/495 (54%), Positives = 367/495 (74%), Gaps = 11/495 (2%)
 Frame = +3

Query  93    ITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVA  272
             I + H RR+    PPGP+PWPIIGNLNL+G +PH+S+H LS+KYG +M L+FGS+P++V 
Sbjct  21    ILSGHFRRRRANLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIMQLRFGSRPIVVG  80

Query  273   SSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPR  449
             SS E AK FLK HD  FASRP  AA  +T +N SD+TWSPYGP+WR ARK+ L E+F+ +
Sbjct  81    SSVEMAKQFLKIHDITFASRPKMAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSVK  140

Query  450   KLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWEL  629
             +L+S+EY+R+EE  A++ GLY + G   P++L+DHL   +L+ ++R+V G KY  +    
Sbjct  141   RLESYEYIRVEELRAVLKGLYASSG--KPIVLKDHLSTLSLNVISRMVLGKKYTDES---  195

Query  630   GKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLN  809
                E   +   + +  LD+ FLL+GV+N+GD++PW+  LDLQGYVK+MK   ++++KFL 
Sbjct  196   ---ETSIVTPGEFKKMLDELFLLNGVVNIGDYIPWIDFLDLQGYVKRMKILSKKFDKFLE  252

Query  810   YVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTT  989
             +VI++H A  +G E +  KDMVD+ LQ+ADDP LE  V L R+ + G T D++AGG +++
Sbjct  253   HVIDEHNARRQGVEGYVAKDMVDVLLQLADDPTLE--VKLHREGVKGFTQDLIAGGTESS  310

Query  990   AATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLC  1169
             A TVEWA  EL ++P + +KATEELDRVIGRERWVEEKD  QLPYI AI+KET R+HP+ 
Sbjct  311   AVTVEWAISELLKRPEMFKKATEELDRVIGRERWVEEKDIPQLPYIQAIVKETMRMHPVA  370

Query  1170  TLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQ  1349
              +L P +S EDC +AGY++P GT V +N W+IGR+   WD  +EF P+RF+ +D+D+KGQ
Sbjct  371   PMLVPRFSREDCEIAGYDIPAGTEVFVNTWTIGRDPTLWDAPDEFRPDRFIGRDIDVKGQ  430

Query  1350  DFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHP  1529
             DF LLPFGSGRR CPGYSLG+KV++ +LANLL GF W L   +KP++++M+E +GL+T  
Sbjct  431   DFELLPFGSGRRMCPGYSLGLKVIQASLANLLQGFTWNLPDKMKPENLNMEEIFGLSTPK  490

Query  1530  KFPLSYTIEPRLPTH  1574
             K PL   +EPRLPTH
Sbjct  491   KIPLVAVVEPRLPTH  505



>ref|XP_006426680.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
 gb|ESR39920.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
Length=512

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/513 (53%), Positives = 374/513 (73%), Gaps = 12/513 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             SW      WL  +A +  + ++  RR+    PPGP+PWPIIGNL+L+GS+PH+S+H+LS+
Sbjct  7     SWVSYLTAWLATLALV--LLSVRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSE  64

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG +M LKFGS PV+V SS E AK+ LKTHD +FA RP TAA  +T FN SD+TWSPYG
Sbjct  65    KYGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYG  124

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARK+ L E+F+ ++L+SFEY+R++E   L+S LY+  G   P++L+DHL   +L+
Sbjct  125   PYWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLSDLSLA  182

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G  Y  K     + E   +  ++ +  LD+ FLL+GV+++GD +PWL  LDLQ
Sbjct  183   VISRMVLGKNYTDK-----QQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQ  237

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             G +K+MKA  ++++KFL +V+++H A  KG EN+  KDMVD+ LQ+ADDP+LE  V + R
Sbjct  238   GNIKRMKALAKKFDKFLEHVLDEHNARRKGVENYVAKDMVDVLLQLADDPSLE--VKIER  295

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
               +   T D++AGG +++A TVEWA  EL +KP I EKATEELDRVIG+ERWVEEKD   
Sbjct  296   HGVKAFTQDLIAGGTESSAVTVEWAISELIKKPEIFEKATEELDRVIGKERWVEEKDIVN  355

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LP+IDAI+KET RLHP+   L P  + EDC VAGY++P+GT VL++VW+IGR+   W+  
Sbjct  356   LPFIDAIVKETMRLHPVAPFLVPRAAREDCKVAGYDIPKGTRVLVSVWAIGRDPSLWEKP  415

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
             NEF PERF+ K +D+KG DF LLPFG+GRR CPGYSLG+KV++ +LANLLHGF WKL G+
Sbjct  416   NEFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFAWKLPGN  475

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +  ++++M+E +GL+T  KFPL     PRL  H
Sbjct  476   MSNEELNMEEIFGLSTPRKFPLEVLAHPRLSPH  508



>ref|XP_008242319.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=508

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/482 (56%), Positives = 355/482 (74%), Gaps = 8/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +P+QS H LSQ YG +M LKFGS PV++ASSPE AK FLKTH
Sbjct  32    PPGPKPWPIIGNLNLIGRLPNQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQFLKTH  91

Query  312   DAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D +FASRP TA   + T+   ++TW+PYGP+WR ARKI L+E+F+ +KL+SF+Y+R+EE 
Sbjct  92    DHIFASRPQTAVGKYLTYGYLNVTWAPYGPYWRQARKIFLTELFSSKKLESFQYIRVEEN  151

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              A IS LY   G    V+L++HL R TLS M+R+V G +Y+     + K E   +  K+ 
Sbjct  152   RAFISRLYALSG--KAVVLKEHLSRLTLSIMSRIVFGKEYFG----MSKFESSIMSFKEF  205

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             Q   D+ FLLSGV N+GDW+PWL+ LDLQGYVK+MKA  ++ ++F  +V+++H A  +G 
Sbjct  206   QDTSDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKLDRFYEFVLDEHKARKEGV  265

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             E F   DMVD+ L++ADDPN + +V LT D +  LT D++ GG DT+A  +EW   EL +
Sbjct  266   EKFVAGDMVDLLLRLADDPN-DLEVKLTYDSVKALTQDLITGGSDTSANILEWTMSELVK  324

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             +P +I+KATEELDRVIG+ERWVEEKD   LPYIDAI+KET R HP+  +LPP  ++EDC 
Sbjct  325   QPNLIKKATEELDRVIGKERWVEEKDLENLPYIDAIMKETMRKHPVVAMLPPRLALEDCN  384

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++ +GT V +N WS+GR+   WD  +EF PERFL K +D+KGQ F  LPFGSGRR 
Sbjct  385   VAGYDIYKGTIVFVNAWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFEFLPFGSGRRM  444

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV+R+ LAN+LHGF WKL  ++K +D+ M+E YGL T  KFPL   +EPRLP
Sbjct  445   CPGYSLGLKVIRSCLANMLHGFNWKLPENMKTEDLDMEEVYGLITSRKFPLLAIVEPRLP  504

Query  1569  TH  1574
              H
Sbjct  505   IH  506



>ref|XP_007204134.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
 gb|EMJ05333.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
Length=508

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/482 (56%), Positives = 356/482 (74%), Gaps = 8/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +P+QS H LSQ YG +M LKFGS PV++ASSPE AK FLKTH
Sbjct  32    PPGPKPWPIIGNLNLIGRLPNQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQFLKTH  91

Query  312   DAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D +FASRP TA   + T+   ++TW+PYGP+WR ARKI L+E+F+ +KL+SF+Y+R+EE 
Sbjct  92    DHIFASRPQTAVGKYLTYGYLNVTWAPYGPYWRQARKIFLTELFSSKKLESFQYIRVEEN  151

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              A IS LY   G    V+L++HL R TLS M+R+V G +Y+     + K E   +  K+ 
Sbjct  152   RAFISRLYALSG--KAVVLKEHLSRLTLSIMSRIVFGKEYFG----MSKSESSIMSFKEF  205

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             Q   D+ FLLSGV N+GDW+PWL+ LDLQGYVK+MKA  ++ + F  +V+++H A  +G 
Sbjct  206   QDTSDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKVDHFYEFVLDEHKARKEGV  265

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             E F  +DMVD+ L++ADDPN + +V LT D +  LT D++ GG DT+A T+EW   EL +
Sbjct  266   EKFVAEDMVDLLLRLADDPN-DLEVKLTYDSVKALTQDLITGGSDTSANTLEWTMSELIK  324

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             +P +I+KATEELDRVIG+ERWVEEKD   LPYIDAI+KET R HP+  +LPP  ++EDC 
Sbjct  325   QPNLIKKATEELDRVIGKERWVEEKDLENLPYIDAIMKETMRKHPVVAMLPPRLALEDCN  384

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++ +GT V +N WS+GR+   WD  ++F PERFL K +D+KGQ F  LPFGSGRR 
Sbjct  385   VAGYDICKGTIVFVNTWSMGRDPTLWDAPDDFRPERFLGKAIDVKGQSFEFLPFGSGRRM  444

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV+R+ LAN+LHGF WKL  ++K +D+ M+E YGL T  KFP+   +EPRLP
Sbjct  445   CPGYSLGLKVIRSCLANMLHGFNWKLPENMKTEDLDMEEVYGLITPRKFPILAIVEPRLP  504

Query  1569  TH  1574
              H
Sbjct  505   IH  506



>ref|XP_002277972.1| PREDICTED: flavonoid 3'-monooxygenase-like [Vitis vinifera]
Length=509

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/490 (56%), Positives = 373/490 (76%), Gaps = 12/490 (2%)
 Frame = +3

Query  114   RKAYKT--PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPET  287
             R A+K   PPGP+PW IIGNLNL+G +PH SLH LSQKYG++M L+FGS PV+VASSPE 
Sbjct  27    RPAHKQNLPPGPKPWRIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEM  86

Query  288   AKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSF  464
             A+ FLKT+D +FASRP TAA  +T +N S++TW+PYGP WR  RKI  +E+F+ ++L+S 
Sbjct  87    ARQFLKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPCWRQGRKIFHTELFSWKRLESC  146

Query  465   EYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEG  644
             EY+R+EER A +S LY   G   PV+L+DHL R TLS ++R+V G KY+++  E G+   
Sbjct  147   EYIRVEERRAFVSRLYALSG--KPVMLKDHLSRVTLSVISRIVLGEKYFNES-ESGRS--  201

Query  645   YSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIED  824
               + +++ Q  LD+ FLL+GV+N+GDW+PW++ LDLQGYVK+MKA R+++++  ++VIE 
Sbjct  202   -IVTVEEFQEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKALRDKFDRLFDHVIEK  260

Query  825   HMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
             H A  +   +F  KDMVD+ L++ADDP+LE  V L  D + GLT D+LAGG DT+A T+E
Sbjct  261   HRARREA-ADFVAKDMVDMLLRLADDPDLE--VKLGTDGVKGLTLDLLAGGTDTSATTME  317

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  E+ R+P I  KATEELDRVIGR+RWVEEKD  QLPYIDAI+KET RLHP+  LL P
Sbjct  318   WAMSEILRQPSIATKATEELDRVIGRDRWVEEKDIPQLPYIDAIVKETMRLHPVAVLLAP  377

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
             H +++DC V+GY++ +GT VL+N WSIGR+   WD   EF PERFL K +D+ GQ+F LL
Sbjct  378   HLALQDCNVSGYDIRKGTRVLVNAWSIGRDPNIWDAPEEFRPERFLGKAIDVNGQNFELL  437

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PFGSGRR C GY LG+K+++++L+N+LHGF WKL GD+K ++++M+E +GLTT  K PL 
Sbjct  438   PFGSGRRMCVGYRLGLKMIQSSLSNMLHGFHWKLPGDMKTEELNMEEVFGLTTPRKVPLV  497

Query  1545  YTIEPRLPTH  1574
               +EPRLP+H
Sbjct  498   AVMEPRLPSH  507



>ref|XP_009359731.1| PREDICTED: flavonoid 3'-monooxygenase-like [Pyrus x bretschneideri]
Length=509

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/484 (55%), Positives = 363/484 (75%), Gaps = 9/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGNL+L+G +PHQSLH LSQKYG +M L FGS PV++ASS E A+ FLK
Sbjct  32    KLPPGPKPWPIIGNLSLIGPLPHQSLHKLSQKYGPIMKLMFGSYPVVIASSAEMARQFLK  91

Query  306   THDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THD +FASRP TAA  +T +N  ++TW+P+GP+WR  RKI LS +F+ + LDS EY+R+E
Sbjct  92    THDHIFASRPETAAGKYTTYNYKNLTWAPHGPYWRQGRKIYLSHLFSSKVLDSVEYIRVE  151

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E  A +S L    G   P +L++HL R TLS ++R+V G KY+S    + + E   + L+
Sbjct  152   ENRAFLSRLCAVSG--KPTMLKEHLSRLTLSIISRIVLGKKYFS----VSESETSIVSLE  205

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             + Q  L++ FLL+GV+N+GDW+PW   LDLQGYVK+MKA ++++++F ++V+++H A M 
Sbjct  206   EFQEMLNELFLLNGVLNIGDWIPWAQCLDLQGYVKRMKALKKKFDRFHDHVLDEHKANMN  265

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
               ++F  KDMVD+ +Q+A+DP++E  V L  D + G T D++AGG DT+A TVEWA  EL
Sbjct  266   EVKDFVSKDMVDLLMQLAEDPDIE--VKLNYDSVKGFTQDLIAGGTDTSATTVEWAMSEL  323

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              ++P +IEKATEELD VIGRERWVEEKD +QL YIDAI+KET R+HP+  +L PH ++ED
Sbjct  324   MKQPHLIEKATEELDIVIGRERWVEEKDIAQLHYIDAIMKETMRMHPVAVMLAPHLALED  383

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY++ +GT V IN WS+GR+   W+   EF P+RFL K +D+KGQ+F LLPFGSGR
Sbjct  384   CNVAGYDICKGTRVFINTWSMGRDPSQWNAPEEFNPDRFLGKAIDVKGQNFELLPFGSGR  443

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R CPGYSLG+K++R++LANLLHGF WKL  +   +D+SM+E +GL T  KFPL   +EPR
Sbjct  444   RMCPGYSLGLKMIRSSLANLLHGFNWKLPDNATTEDLSMEEVFGLATPRKFPLVAVLEPR  503

Query  1563  LPTH  1574
             LP +
Sbjct  504   LPLY  507



>gb|KDO65002.1| hypothetical protein CISIN_1g010388mg [Citrus sinensis]
Length=512

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/513 (53%), Positives = 373/513 (73%), Gaps = 12/513 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             SW      WL  +A +  + ++  RR+    PPGP+PWPIIGNL+L+GS+PH+S+H+LS+
Sbjct  7     SWVSYLTAWLATLALV--LLSVRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSE  64

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG +M LKFGS PV+V SS E AK+ LKTHD +FA RP TAA  +T FN SD+TWSPYG
Sbjct  65    KYGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYG  124

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARK+ L E+F+ ++L+SFEY+R++E   L+S LY+  G   P++L+DHL   +L+
Sbjct  125   PYWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLSDLSLA  182

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G  Y  K     + E   +  ++ +  LD+ FLL+GV+++GD +PWL  LDLQ
Sbjct  183   VISRMVLGKNYTDK-----QQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQ  237

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             G +K+MKA  ++++KFL +V+++H A  KG EN+  KDMVD+ LQ+ADDP+LE  V + R
Sbjct  238   GNIKRMKALAKKFDKFLEHVLDEHNARRKGVENYVAKDMVDVLLQLADDPSLE--VKIER  295

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
               +   T D++AGG +++A TVEWA  EL +KP I EKA EELDRVIG+ERWVEEKD   
Sbjct  296   HGVKAFTQDLIAGGTESSAVTVEWAISELIKKPEIFEKAIEELDRVIGKERWVEEKDIVN  355

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LP+IDAI+KET RLHP+   L P  + EDC VAGY++P+GT VL++VW+IGR+   W+  
Sbjct  356   LPFIDAIVKETMRLHPVAPFLVPRAAREDCNVAGYDIPKGTRVLVSVWAIGRHPSLWEKP  415

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
             NEF PERF+ K +D+KG DF LLPFG+GRR CPGYSLG+KV++ +LANLLHGF WKL G+
Sbjct  416   NEFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFAWKLPGN  475

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +  ++++M+E +GL+T  KFPL     PRL  H
Sbjct  476   MSNEELNMEEIFGLSTPRKFPLEVLAHPRLSPH  508



>ref|XP_006465906.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=512

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/513 (53%), Positives = 373/513 (73%), Gaps = 12/513 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             SW      WL  +A +  + ++  RR+    PPGP+PWPIIGNL+L+GS+PH+S+H+LS+
Sbjct  7     SWASYLTAWLATLALV--LLSVRLRRRKLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSE  64

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG +M LKFGS PV+V SS E AK+ LKTHD +FA RP TAA  +T FN SD+TWSPYG
Sbjct  65    KYGPIMQLKFGSFPVVVGSSVEMAKVVLKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYG  124

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARK+ L E+F+ ++L+SFEY+R++E   L+S LY+  G   P++L+DHL   +L+
Sbjct  125   PYWRQARKMCLMELFSAKRLESFEYIRVQELKLLLSRLYELSG--KPIMLKDHLSDLSLA  182

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G  Y  K     + E   +  ++ +  LD+ FLL+GV+++GD +PWL  LDLQ
Sbjct  183   VISRMVLGKNYTDK-----QQENEIVTPQEFKAMLDELFLLNGVLDIGDSIPWLGFLDLQ  237

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             G +K+MKA  ++++KFL +V+++H A  KG EN+  KDMVD+ LQ+ADDP+LE  V + R
Sbjct  238   GNIKRMKALAKKFDKFLEHVLDEHNARRKGVENYVAKDMVDVLLQLADDPSLE--VKIER  295

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
               +   T D++AGG +++A TVEWA  EL +KP I EKA EELDRVIG+ERWVEEKD   
Sbjct  296   HGVKAFTQDLIAGGTESSAVTVEWAISELIKKPEIFEKAIEELDRVIGKERWVEEKDIVN  355

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LP+IDAI+KET RLHP+   L P  + EDC VAGY++P+GT VL++VW+IGR+   W+  
Sbjct  356   LPFIDAIVKETMRLHPVAPFLVPRAAREDCNVAGYDIPKGTRVLVSVWAIGRHPSLWEKP  415

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
             NEF PERF+ K +D+KG DF LLPFG+GRR CPGYSLG+KV++ +LANLLHGF WKL G+
Sbjct  416   NEFYPERFIGKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGFAWKLPGN  475

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +  ++++M+E +GL+T  KFPL     PRL  H
Sbjct  476   MSNEELNMEEIFGLSTPRKFPLEVLAHPRLSPH  508



>ref|XP_008228182.1| PREDICTED: cytochrome P450 71A1-like [Prunus mume]
Length=510

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/490 (54%), Positives = 363/490 (74%), Gaps = 12/490 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R +    PPGP+PWPIIGNLNL+  +PH+S+H+L+ KYG +M LKFGS PV+V SS + A
Sbjct  27    RHRKLNLPPGPKPWPIIGNLNLISQLPHRSIHALAHKYGPIMQLKFGSHPVVVGSSVDMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K FLKTHD  FA RP  AA  HT +N +D+TWSPYGP+WR ARK+ + E+F+ ++L+S+E
Sbjct  87    KAFLKTHDVTFAGRPKFAAGKHTTYNYTDITWSPYGPYWRQARKMCVMELFSAKRLESYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  AL+ GL+++  T   +LL+DHL   +L+ ++R+V G KY  +       E  
Sbjct  147   YIRKEEMNALLRGLFESSNTN--ILLKDHLSTVSLNVISRMVLGKKYTDES------EDS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +   + +  LD+ FLLSGV+N+GD +PWL  LDLQGY+K+MKA  ++ ++FL +V+++H
Sbjct  199   IVSPDEFKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRMKALSKKLDRFLEHVLDEH  258

Query  828   MAMMK-GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
             +A  K G E+F  KDMVD+ LQ+ADDP+LE  V L R  +   T D++AGG +++A TVE
Sbjct  259   IAKRKAGGEDFVAKDMVDVLLQLADDPDLE--VKLERHGVKAFTQDLIAGGTESSAVTVE  316

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  EL +KP + +KATEELDRVIGRERWVEE D   LPY+DAI KET RLHP+  +L P
Sbjct  317   WAISELLKKPEVFKKATEELDRVIGRERWVEENDIVNLPYVDAIAKETMRLHPVAPMLVP  376

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
               + EDC VAGY++P+GT +L++VW+IGR+ + WDN  EFCP+RFL KD+D+KGQDF LL
Sbjct  377   RLAREDCQVAGYDIPKGTRILVSVWAIGRDPQLWDNPEEFCPDRFLGKDIDVKGQDFELL  436

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PFGSGRR CPGYSLG+KV++ +LANLLHGF W+L  +LK +D++M+E +GL+T  K+PL 
Sbjct  437   PFGSGRRMCPGYSLGIKVIQASLANLLHGFTWRLPDNLKEEDLNMEEIFGLSTPKKYPLV  496

Query  1545  YTIEPRLPTH  1574
                EPRLP H
Sbjct  497   AVCEPRLPPH  506



>ref|XP_008242249.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=510

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/508 (56%), Positives = 369/508 (73%), Gaps = 11/508 (2%)
 Frame = +3

Query  54    ALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
              L  L  +AFL KI  I  +    K PPGP+PWPI+GNLNL+G +PHQ LH LSQ YG L
Sbjct  11    TLACLATLAFLSKI--IFSQSHKPKAPPGPKPWPILGNLNLMGPLPHQCLHKLSQTYGPL  68

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRH  410
             M LKFGS PV++ASS E AK FLKTHD VFASRP TAA  + T+N  ++TW+P+GP+WR 
Sbjct  69    MQLKFGSYPVVIASSAEMAKQFLKTHDHVFASRPQTAAGKYLTYNYRNITWAPFGPYWRQ  128

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RKI +SE+F+ ++L SFEY+R+EE  A  S  Y   G   PV+L++H+ R TLST++R+
Sbjct  129   GRKIFMSELFSSKRLASFEYIRVEEIRAFTSRFYALSG--KPVILKEHISRLTLSTVSRI  186

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G +Y+S+   +      ++ L + Q  LD+   LSGV+N+GDW+PWL   DLQGYVK+
Sbjct  187   VLGKEYFSESQFVTS----TVTLGEFQDMLDELVCLSGVLNIGDWIPWLKFFDLQGYVKQ  242

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             MKA +++++ F +Y++++H A  K + NF PKDMVD+ LQ+ DDP+LE  V L RD + G
Sbjct  243   MKALKKKFDLFHDYILDEHKARKKEETNFVPKDMVDLLLQLVDDPDLE--VKLNRDSVKG  300

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
              T D++AGG DT+A  +EWA  EL R+P +IEKATEELDRVIGRERWVEEKD   LPYID
Sbjct  301   FTQDLIAGGTDTSATNLEWAMSELIRQPHLIEKATEELDRVIGRERWVEEKDLENLPYID  360

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET R HP+  +L PH +++DC V GY++ +GT V IN WSIGR+   WD   EF P
Sbjct  361   AIMKETMRKHPVVAMLAPHLALDDCKVEGYDICKGTRVFINTWSIGRDPSLWDAPEEFNP  420

Query  1311  ERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKD  1490
             ERFL K +D+KGQ F LLPFGSGRR CPGY LG+K++R +LAN+LHGF WKL  ++KP+D
Sbjct  421   ERFLGKAIDVKGQSFELLPFGSGRRMCPGYGLGLKMIRCSLANMLHGFNWKLPENIKPED  480

Query  1491  ISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +SM+E  GL+T  KFPL   +EPRLP H
Sbjct  481   LSMEEVAGLSTPRKFPLVAVMEPRLPIH  508



>ref|XP_007204846.1| hypothetical protein PRUPE_ppa026438mg [Prunus persica]
 gb|EMJ06045.1| hypothetical protein PRUPE_ppa026438mg [Prunus persica]
Length=510

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/508 (56%), Positives = 370/508 (73%), Gaps = 11/508 (2%)
 Frame = +3

Query  54    ALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
              L  L  +AFL KI  I  +    K+PPGP+PWPI+GNLNL+G +PHQ LH LSQ YG L
Sbjct  11    TLACLATLAFLSKI--IFSQSHKPKSPPGPKPWPILGNLNLMGPLPHQCLHKLSQTYGPL  68

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRH  410
             M LKFGS PV++ASS E AK FLKTHD VFASRP TAA  + T+N  ++TW+P+GP+WR 
Sbjct  69    MQLKFGSYPVVIASSAEMAKQFLKTHDHVFASRPQTAAGKYLTYNYRNITWAPFGPYWRQ  128

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RKI +SE+F+ ++L+SFEY+R+EE  A  S  Y   G   PV+L++H+ R TLST++R+
Sbjct  129   GRKIFMSELFSSKRLESFEYIRVEEIRAFTSRFYALSG--KPVMLKEHISRLTLSTVSRI  186

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G +Y+S+   +      ++ L++ Q  LD+   LSGV+N+GDW+PWL   DLQGYVK+
Sbjct  187   VLGKEYFSESQFVTS----TMTLREFQDMLDELVCLSGVLNIGDWIPWLKFFDLQGYVKQ  242

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             MKA +++++ F +Y++++H A  K + NF PKDMVD+ LQ+ DDP+LE  V L RD + G
Sbjct  243   MKALKKKFDLFHDYILDEHKARKKEETNFVPKDMVDLLLQLVDDPDLE--VKLNRDSVKG  300

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
              T D++AGG DT+A  +EWA  EL R+P +I KATEELDRVIGRERWVEEKD   LPYID
Sbjct  301   FTQDLIAGGTDTSATNLEWAMSELIRQPHLIGKATEELDRVIGRERWVEEKDLENLPYID  360

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET R HP+  +L PH ++EDC V GY++ +GT V IN WSIGR+   WD   EF P
Sbjct  361   AIMKETMRKHPVVAMLAPHLALEDCKVEGYDICKGTRVFINTWSIGRDPSLWDAPEEFNP  420

Query  1311  ERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKD  1490
             ERFL K +D+KGQ F LLPFGSGRR CPGY LG+K++R +LAN+LHGF WKL  ++KP+D
Sbjct  421   ERFLGKAIDVKGQSFELLPFGSGRRMCPGYGLGLKMIRCSLANMLHGFNWKLPENMKPED  480

Query  1491  ISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             + M+E  GL+T  KFPL   +EPRLP H
Sbjct  481   LCMEEVAGLSTPRKFPLVAVMEPRLPIH  508



>ref|XP_004288988.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/510 (56%), Positives = 364/510 (71%), Gaps = 11/510 (2%)
 Frame = +3

Query  54    ALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLL-GSIPHQSLHSLSQKYGE  230
              L WL  +A + K      ++   K PPGP+PWPIIGNLNL+ G +PH+SLH LSQ YG 
Sbjct  11    TLSWLFLLALVSKFFFSQLQKLKLKFPPGPKPWPIIGNLNLINGPLPHRSLHKLSQTYGP  70

Query  231   LMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWR  407
             LM LKFGS PV+VASS E AK FLKT D VFASRP TAA  + T+N  ++T SP+GP+WR
Sbjct  71    LMQLKFGSYPVVVASSAEMAKQFLKTLDHVFASRPRTAAGKYITYNYLNITSSPHGPYWR  130

Query  408   HARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTR  587
               RKI LSE+F+ ++L+SF Y+R+EE  A IS LY   G  NPV+L++ L R TLS MTR
Sbjct  131   QGRKIFLSELFSSKRLESFAYIRVEETRAFISRLYALSG--NPVMLKEQLSRLTLSIMTR  188

Query  588   LVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVK  767
              V G +Y+ ++ E  +     + L++ Q  LD+ FLL GV N+GDW+PWL  LDLQGYVK
Sbjct  189   SVMGKEYF-REPEFQRS---VMKLEEFQDMLDELFLLHGVFNIGDWIPWLEVLDLQGYVK  244

Query  768   KMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIM  947
             +MK  +++ E F +YV+++H A  +G +++  KDMVD  LQ+ DDP+LE  V LT D + 
Sbjct  245   RMKDLKKKSEPFYDYVLDEHKAASQGRKDYVAKDMVDSLLQLVDDPDLE--VKLTVDSVK  302

Query  948   GLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYI  1127
                 D++AGG DT+A T+EWA  EL ++P +I +ATEELDRVIGR+RWVEE D  QLPYI
Sbjct  303   AFIQDLIAGGTDTSATTLEWAMSELIKQPNLIVRATEELDRVIGRDRWVEEDDIPQLPYI  362

Query  1128  DAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFC  1307
             DAI+KET R HP+  LLPPH ++EDC V G+++ RGT V IN WSIGR+S  W+   EF 
Sbjct  363   DAIMKETMRKHPVVVLLPPHLALEDCKVGGFDIRRGTRVFINTWSIGRDSSVWEAPEEFN  422

Query  1308  PERFL-EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKP  1484
             PERFL  K +D+KGQ F LLPFGSGRR CPGYSLG+KV+ + LAN+LHGF WKL  ++K 
Sbjct  423   PERFLGNKAIDVKGQSFELLPFGSGRRMCPGYSLGLKVIGSCLANMLHGFNWKLPENMKI  482

Query  1485  KDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +D+ MDEA GL TH KF L   +EPRLP H
Sbjct  483   EDLGMDEACGLVTHRKFSLVAVMEPRLPIH  512



>ref|XP_004303698.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/482 (57%), Positives = 356/482 (74%), Gaps = 12/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +PH S+H+LSQKYG +M LKFGS PV+V SS E AK FLKTH
Sbjct  35    PPGPKPWPIIGNLNLIGHLPHLSIHTLSQKYGPIMQLKFGSFPVVVGSSVEMAKAFLKTH  94

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  FA RP  AA  HT +N SD+TWSPYGP+WR ARK+ + E+F+ ++L+S+EY+R EE 
Sbjct  95    DVTFAGRPKFAAGKHTTYNYSDITWSPYGPYWRQARKMCIMELFSNKRLESYEYIRREEM  154

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              AL+ GLY++  T   VLL+DHL   +L+ ++R+V G KY          E   +   + 
Sbjct  155   GALLRGLYESSNTN--VLLKDHLSTVSLNVISRMVLGKKYTDDS------EDAIVSPDEF  206

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLLSGV+N+GD +PWL  LDLQGY+K+MKA  ++ ++FL +V+++H+   K  
Sbjct  207   KKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRMKALSKKLDRFLEHVLDEHIENKKA-  265

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             + F   DMVD+ LQ+ADDPNLE  V L R  +   T D++AGG +++A TVEWA  EL R
Sbjct  266   KGFVATDMVDVLLQLADDPNLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLR  323

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I +KATEELDRVIGRERWVEEKD   LP+IDAI KET RLHP+  +L P  + EDC 
Sbjct  324   KPEIFKKATEELDRVIGRERWVEEKDIVNLPFIDAIAKETMRLHPVAPMLVPRLAREDCQ  383

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++P+ T VL++VW+IGR+   W+N +EFCPERF+ KD+D+KGQDF LLPFGSGRR 
Sbjct  384   VAGYDIPKDTRVLVSVWTIGRDPNLWENPDEFCPERFIGKDIDVKGQDFELLPFGSGRRM  443

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV+ T+LANLLHGF W+L   +K +D++M+E +GL+T  KFPL    EPRLP
Sbjct  444   CPGYSLGIKVIHTSLANLLHGFTWRLPDGMKKEDLNMEEIFGLSTPKKFPLVAVAEPRLP  503

Query  1569  TH  1574
              H
Sbjct  504   AH  505



>ref|XP_008388825.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/518 (54%), Positives = 371/518 (72%), Gaps = 8/518 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME FS         LA   L   T   Q +K  K PPGP+PWPIIGNLNL+G +PHQSLH
Sbjct  1     MEYFSCAVILTXACLATLALVSKTLFPQLKKR-KFPPGPKPWPIIGNLNLIGPLPHQSLH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTW  383
              LSQ YG +M L+FGS+PV+VA+SPE AK FLKTHD VF+SRP TAA  + T++  ++TW
Sbjct  60    KLSQTYGPIMQLRFGSRPVVVATSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR  RKI L E+F+ ++L+SFEY+R +E  A  S L     + NP++L++HL R
Sbjct  120   SPYGPYWRQGRKIFLYELFSSKRLESFEYIRADEIRAFTSRLCAIAKSGNPIVLKEHLSR  179

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
               LS M+R V G  Y+S    + + EG  + LK+ Q  +D+ F+LSGV N+GDW+PWL+ 
Sbjct  180   LNLSIMSRTVLGKDYFS----VAEYEGSIMSLKEFQDMIDELFVLSGVFNIGDWIPWLNF  235

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGY+K+MKA +++ ++F ++V+ +H A  +G E F PKDMVD+ LQ+ D  N + +V
Sbjct  236   LDLQGYIKRMKAIKKKVDRFYDFVLNEHKAQKEGVEEFVPKDMVDLLLQLVDGSN-DLEV  294

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L  D I   T D++AGG DT+A  +EWA  EL ++P +I+KATEELDRVIGRERWVEEK
Sbjct  295   KLNYDSIKAFTQDLIAGGTDTSATNLEWAMSELIKQPNLIKKATEELDRVIGRERWVEEK  354

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D +QLPYIDAI+KET R HP   +LPPH ++E+  VAGY+V +GT V +N WS+GR+ K 
Sbjct  355   DLAQLPYIDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTIVFVNTWSMGRDPKL  414

Query  1284  WDNANEFCPERFL-EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
             W+   EF PERFL    +D++GQ F LLPFGSGRR CPGY LG+K++RT LAN+LHGF W
Sbjct  415   WEEPEEFRPERFLGNTGIDLQGQSFELLPFGSGRRMCPGYKLGLKMIRTCLANMLHGFXW  474

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             KL G++K +D+ M+EAYGL T  KFPL   +EPRLP H
Sbjct  475   KLPGNVKVEDLGMEEAYGLVTTRKFPLVAVMEPRLPVH  512



>ref|XP_008344040.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/519 (54%), Positives = 374/519 (72%), Gaps = 10/519 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKIT-TIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSL  203
             ME FS    A+  L  +A L  ++ T+  + K  K  PGP+PWPIIGNLNL+G +PHQSL
Sbjct  1     MEYFSC--AAILTLACLATLALVSKTLFPQLKKQKFXPGPKPWPIIGNLNLIGPLPHQSL  58

Query  204   HSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMT  380
             H LSQ YG +M L+FGS+PV+VASSPE AK FLKTHD VF+SRP TAA  + T++  ++T
Sbjct  59    HKLSQIYGPIMQLRFGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVT  118

Query  381   WSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLV  560
             WSPYGP+WR  RKI L E+F+ ++L+SFEY+R +E  A  S LY    + NP++L++HL 
Sbjct  119   WSPYGPYWRQGRKIFLYELFSSKRLESFEYIRADENRAFTSRLYAIAKSGNPIVLKEHLS  178

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
             R  LS M+R V G  Y+S    + + EG  + LK+ Q  +D+ F+L+GV N+GDW+PWL+
Sbjct  179   RLNLSIMSRTVLGKDYFS----VAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLN  234

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
              LDLQGY+K+MKA +++  +F ++V+ +H A  +G E F PKDMVD+ LQ+ D  N + +
Sbjct  235   FLDLQGYIKRMKAMQKKINRFYDFVLNEHKAQKEGVEEFVPKDMVDLLLQLVDGSN-DLE  293

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L  D I   T D++AGG DT+A  +EWA  EL ++P +I+KATEELDRVIGRERWVEE
Sbjct  294   VKLNYDSIKAFTQDLIAGGTDTSATNLEWAMSELIKQPNLIKKATEELDRVIGRERWVEE  353

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD  QLPYIDAI+KET R HP   +LPPH ++E+  VAGY+V +GT V +N WS+GR+ K
Sbjct  354   KDLEQLPYIDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTVVFVNTWSMGRDPK  413

Query  1281  YWDNANEFCPERFL-EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
              W+   EF PERFL    +D++GQ F LLPFGSGRR CPGY LG++++RT LAN+LHGF 
Sbjct  414   LWEEPEEFRPERFLGNTGIDLQGQSFXLLPFGSGRRMCPGYKLGLRMIRTCLANMLHGFN  473

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL G++K +D+ M+EAYGL T  KFPL   +EPRLP H
Sbjct  474   WKLPGNVKVEDLGMEEAYGLVTTRKFPLVAVMEPRLPVH  512



>gb|KHG15722.1| Cytochrome P450 [Gossypium arboreum]
Length=511

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/517 (52%), Positives = 368/517 (71%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  SW    + WL  +A +        RRK    PPGP+PWP+IGNL+L+GS+PH+S+H
Sbjct  1     MESPSWVSYLIAWLATLALILLSLRFRPRRK-LNLPPGPKPWPVIGNLDLIGSLPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             SLSQKYG LM LKFGS PV+VASS E AK FLKTHD +FA RP  AA  +T +N SD+TW
Sbjct  60    SLSQKYGPLMQLKFGSFPVVVASSVEMAKAFLKTHDVIFAGRPKIAAGEYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ ++E+F+ ++L+S+EY+R EE   L+ G Y++ G   P++L+DHL  
Sbjct  120   SPYGPYWRQARKMCMTELFSAKRLESYEYIRREEMKLLLKGFYESSGV--PIVLKDHLSD  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY       G  E   +  K+ +  LD+ FLL+GV+++GD +PWL  
Sbjct  178   LSLNVISRMVFGKKYTE-----GTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLRF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQG +K+MKA  ++++KFL +V+++H A  +  +++  KDMVD+ LQ+ADDPNL  DV
Sbjct  233   LDLQGNIKRMKALSKKFDKFLEHVLDEHNARRRDVKDYIAKDMVDVLLQLADDPNL--DV  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   + D++AGG +++A TVEWA  E+ +KP I  KATEELDRVIGRERWVEE+
Sbjct  291   KLERHGVKAFSQDLIAGGTESSAVTVEWAISEMLKKPEIFAKATEELDRVIGRERWVEER  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPYID+I KET RLHP+  +L P  + EDC V GY++ +GT  L+NVW+IGR+   
Sbjct  351   DIVNLPYIDSIAKETMRLHPVAPMLVPRMTREDCQVDGYDILKGTRALVNVWTIGRDPTV  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WDN NEF PERF++K +D+KG DF LLPFG+GRR CPGY LG+KV++ +LANLLHGF WK
Sbjct  411   WDNPNEFFPERFIDKTIDVKGHDFQLLPFGAGRRMCPGYPLGIKVIQASLANLLHGFTWK  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L G++   D+ M+E +GL+T  K PL     P+LP H
Sbjct  471   LPGNMTKDDLDMEEIFGLSTPKKCPLQAVAVPKLPLH  507



>gb|KDP40690.1| hypothetical protein JCGZ_24689 [Jatropha curcas]
Length=511

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/482 (56%), Positives = 360/482 (75%), Gaps = 9/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+ WPIIGNLNL+GS+PH+SLHSLS+KYG +M LKFGS PV+V SS E AK  LKTH
Sbjct  34    PPGPKSWPIIGNLNLIGSLPHRSLHSLSEKYGPIMQLKFGSFPVVVGSSVEMAKTILKTH  93

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  FA RP TAA  +T FN SD+TWSPYGP+WR ARK+ + E+F+ ++L+S+EY+R+EE 
Sbjct  94    DVNFAGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKMCVMELFSAKRLESYEYIRVEEL  153

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              +L+  L+ + G  N + ++DHL   +L+ ++R+V G KY  K+    + E   +  ++ 
Sbjct  154   RSLLKTLFLSSG--NAINVKDHLSDLSLNVISRMVLGKKYTVKN----ENENEIVTPEEF  207

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLL+GV+++GD +PWL+ LDLQG +K+MK   +++ +FL +V+++H +  KG 
Sbjct  208   KEMLDELFLLNGVLDIGDSIPWLAFLDLQGNIKRMKVLSKKFNRFLEHVLDEHESRRKGV  267

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             EN+  KDMVDI LQ+A+DPNLE  V L R+ + G T DM+AGG +++A TVEWA  EL R
Sbjct  268   ENYVAKDMVDILLQLAEDPNLE--VKLERNGVKGFTQDMIAGGTESSAVTVEWALSELLR  325

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I +KATEELDRVIGRERWVEEKD   LP+I+AI KET RLHP+  +L P    ED  
Sbjct  326   KPEIFKKATEELDRVIGRERWVEEKDIVNLPFIEAIAKETMRLHPVAPMLVPRQCREDTQ  385

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             +AGY++ +GT VL+NVW+IGR+   WDN NEFCPERF+ K +D+KG DF LLPFG+GRR 
Sbjct  386   IAGYDIQKGTRVLVNVWTIGRDPTIWDNPNEFCPERFIGKAIDVKGHDFELLPFGAGRRM  445

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGY LG+KV++ +LANLL GF WKL G+LK +D++M+E +GL+T  KFPL    EPRLP
Sbjct  446   CPGYPLGIKVIQASLANLLQGFNWKLPGNLKKEDLNMEEIFGLSTPKKFPLVAVAEPRLP  505

Query  1569  TH  1574
              H
Sbjct  506   FH  507



>gb|AJD25215.1| cytochrome P450 CYP92B28 [Salvia miltiorrhiza]
Length=501

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/483 (56%), Positives = 354/483 (73%), Gaps = 17/483 (4%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNLLGSIPHQSLH LSQKYGE+MLLK G  PV+VASSP+ A+ FLK H
Sbjct  32    PPGPKPWPIIGNLNLLGSIPHQSLHHLSQKYGEIMLLKLGKFPVVVASSPKMAEQFLKVH  91

Query  312   DAVFASRPATAAA--HHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEE  485
             DA FASRP   AA  H +++ SD+++SPYGP+WR ARKIL+SE+   +KLD FE +R+E 
Sbjct  92    DAAFASRPPALAAGKHISYDNSDVSFSPYGPYWREARKILMSELLGTKKLDQFEQIRVEA  151

Query  486   RMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKK  665
             R +  S L    G   PV+LR+HL R+ +ST+ R+V  N+Y          +   I    
Sbjct  152   RRSFFSRLKALSG--KPVVLREHLSRYIMSTICRMVMTNEYVG--------DSSIIDDGG  201

Query  666   LQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKG  845
             +   + DWF+L+GV N+GDW+PWL  LDLQGYV++MKAFR++ + F  YVI+DH+A  + 
Sbjct  202   MAEMMRDWFVLTGVFNIGDWIPWLGPLDLQGYVRRMKAFRKKSDSFFGYVIDDHIARRR-  260

Query  846   DENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELF  1025
               + A KD VD  L +A+DPN  A + LTRD +  L  +++ GG DT+  TVEWA  E+F
Sbjct  261   --DGADKDFVDALLDLAEDPN--AQLHLTRDSLKSLIMNVVLGGPDTSITTVEWALHEMF  316

Query  1026  RKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDC  1205
             R+P I E+A  ELD VIGR+RWVEE DF+QLPY+DAII ETFRLHP+ TLL PHY+I+DC
Sbjct  317   RQPRIFERARAELDAVIGRDRWVEENDFTQLPYVDAIIMETFRLHPIATLLAPHYAIQDC  376

Query  1206  IVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRR  1385
              VAGY + +GT++LIN WSIGR+   WD A EF PERF+ K  D+ G +FALLPFGSGRR
Sbjct  377   NVAGYNISKGTSILINTWSIGRDPNTWDAAEEFLPERFMGKQTDMTGGNFALLPFGSGRR  436

Query  1386  KCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
              CP Y+LG+K+VRTTLANLLHGF+ +L+  ++ +D+S++E YGL T+PK P+S  ++P L
Sbjct  437   ICPAYNLGLKIVRTTLANLLHGFEVELEEGMRAEDVSLEEQYGLATNPKHPVSIIVKPTL  496

Query  1566  PTH  1574
             P H
Sbjct  497   PAH  499



>ref|XP_009375474.1| PREDICTED: cytochrome P450 71A1-like [Pyrus x bretschneideri]
Length=509

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/483 (55%), Positives = 356/483 (74%), Gaps = 12/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +PH+S+H LSQKYG +M LKFGS PV+V SS E AK FLKTH
Sbjct  33    PPGPKPWPIIGNLNLIGHLPHRSVHELSQKYGPIMQLKFGSYPVVVGSSVEMAKAFLKTH  92

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  FA RP  AA  HT +N SD+TWS YGP+WR ARK+ + E+F+ ++L+S+EY+R EE 
Sbjct  93    DVTFAGRPKFAAGKHTTYNYSDITWSQYGPYWRQARKMCIMELFSNKRLESYEYIRREEM  152

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              AL+ GLYD+  + + +LL+DHL   +L+ ++R+V G KY  +       E   +     
Sbjct  153   SALLKGLYDS--SNSNILLKDHLSTVSLNVISRMVLGKKYTDET------EDSIVSPDDF  204

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLLSGV+N+GD +PWL  LDLQGY+K+MK   ++ ++FL +V+++H+A  +  
Sbjct  205   KKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRMKTLSKKMDRFLEHVLDEHIARREAS  264

Query  849   -ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELF  1025
              ++F  KDMVD+ LQ+ADDP LE  V L R  +   T D++AGG +++A TVEWA  EL 
Sbjct  265   GKDFVAKDMVDVLLQLADDPGLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAIAELL  322

Query  1026  RKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDC  1205
             RKP + +KA EELDRVIGR RWVEEKD   LPY+DAI KET RLHP+  +L P  + EDC
Sbjct  323   RKPEVFKKAVEELDRVIGRGRWVEEKDIVNLPYVDAIAKETMRLHPVAPMLVPRQATEDC  382

Query  1206  IVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRR  1385
              +AGY++P+GT  L++VW+IGR+ + WDN  EFCPER L KD+D+KGQDF LLPFGSGRR
Sbjct  383   QIAGYDIPKGTRALVSVWTIGRDPELWDNPEEFCPERLLGKDIDVKGQDFELLPFGSGRR  442

Query  1386  KCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
              CPGYSLG+KV++++LANLLHGF W+L  ++K +D+SM+E +GL+T  KFPL    EPRL
Sbjct  443   MCPGYSLGIKVIQSSLANLLHGFTWRLPDNMKKEDLSMEEIFGLSTPKKFPLVAVCEPRL  502

Query  1566  PTH  1574
             P H
Sbjct  503   PPH  505



>ref|XP_004288987.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/510 (54%), Positives = 360/510 (71%), Gaps = 12/510 (2%)
 Frame = +3

Query  54    ALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
              L  L  +A LF +  +  R++  K+PPGP+PW IIGNLNL+G IPHQSLH LSQ YG +
Sbjct  11    TLVCLATLALLFNLV-LFPRKEVLKSPPGPKPWLIIGNLNLIGPIPHQSLHKLSQTYGPI  69

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRH  410
             M LKFGS PV++ASS E AK FLK HD VFASRP TAA  + T+N  D+TW+PYG +W  
Sbjct  70    MHLKFGSHPVVIASSAEMAKQFLKHHDHVFASRPQTAAGKYLTYNYLDVTWAPYGDYWSQ  129

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RKI ++E+F+ ++L+SFEY+R+EE  A +S L    G   PV+L++ + R TL+T++R+
Sbjct  130   GRKIFITELFSSKRLESFEYIRVEEIRAFLSRLCALSG--KPVILKEQISRLTLTTVSRI  187

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G  Y+S+       +   + LK  Q  LD+   LSGV+N+GDW+PWL  LDLQGY KK
Sbjct  188   VLGKDYFSQT----DIQTSVVTLKGFQDMLDELVSLSGVLNIGDWIPWLKFLDLQGYEKK  243

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             M   + + + F +Y++ +H A MKG ENF PKDMVD+ L++ D+P+LE  V LT D + G
Sbjct  244   MMDLKRKLDSFHDYILAEHKAKMKGVENFVPKDMVDLLLKLVDNPDLE--VKLTLDGVKG  301

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
              T D++AGG DT+A  +EWA  EL ++P +I  ATEELDRVIGRERWVEEKD   LPYID
Sbjct  302   FTQDLIAGGTDTSATNLEWAMSELIKQPHLIRNATEELDRVIGRERWVEEKDLENLPYID  361

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET R HP+ ++L PH ++EDC V GY + +GT V +N WSIGR+   WD   EF P
Sbjct  362   AIMKETMRKHPVVSMLAPHLALEDCNVKGYHISKGTRVFVNTWSIGRDPLLWDAPEEFNP  421

Query  1311  ERFL--EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKP  1484
             +RFL   K +D+KGQ F LLPFGSGRR CPGY LG+K++R +LAN+LHGF WKL   +K 
Sbjct  422   DRFLLRNKGIDVKGQSFELLPFGSGRRMCPGYGLGLKMIRCSLANMLHGFNWKLPQSMKL  481

Query  1485  KDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +D+SM+E  GL+T  KFPL   +EPRLP H
Sbjct  482   EDLSMEEVSGLSTPRKFPLVAVVEPRLPIH  511



>ref|XP_009341741.1| PREDICTED: cytochrome P450 71A1-like [Pyrus x bretschneideri]
Length=510

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/508 (54%), Positives = 367/508 (72%), Gaps = 18/508 (4%)
 Frame = +3

Query  63    WLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLL  242
             WL A+A +     +  R+     PPGP+PWPIIGNLNL+  +PH+S+H L+ KYG +M L
Sbjct  13    WLGALALILLSRRLRHRK--LNLPPGPKPWPIIGNLNLISHLPHRSVHELALKYGPIMQL  70

Query  243   KFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARK  419
             KFGS PV+V SS E AK FLKTHD  FA RP  AA  HT +N SD+TWSPYGP+WR ARK
Sbjct  71    KFGSYPVVVGSSVEMAKAFLKTHDVTFAGRPKFAAGKHTTYNYSDITWSPYGPYWRQARK  130

Query  420   ILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTG  599
             + ++E+F+ ++L+S+EY+R EE  AL+ GLYD+  + + VLL+DHL   +L+ ++R+V G
Sbjct  131   MCITELFSNKRLESYEYIRREEMSALLKGLYDS--SNSNVLLKDHLSTVSLNVISRMVLG  188

Query  600   NKYY--SKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKM  773
              KY   +KD  +   E         +  LD+ FLLSGV+N+GD +PWL  LDLQGY+K+M
Sbjct  189   KKYTDETKDAIVSPDE--------FKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRM  240

Query  774   KAFREEYEKFLNYVIEDHMAMMK-GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             K   ++ + FL +V+++H+   + G ++F  KDMVD+ LQ+ADDPNLE  V L R  +  
Sbjct  241   KTLSKKLDMFLEHVLDEHITKREAGGKDFVAKDMVDVLLQLADDPNLE--VKLERHGVKA  298

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
              T D++AGG +++A TVEWA  EL RKP I +KA EELDRVIGRERWVEEKD   LPY+D
Sbjct  299   FTQDLIAGGTESSAVTVEWAISELLRKPEIFKKAAEELDRVIGRERWVEEKDIVNLPYVD  358

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI KET RLHP+  +L P  + EDC VAGY++P+GT  L++VW+IGR+ + WDN  EF P
Sbjct  359   AIAKETMRLHPVAPMLVPRQTREDCQVAGYDIPKGTRALVSVWTIGRDPELWDNPEEFFP  418

Query  1311  ERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKD  1490
             ERFL KD+D+KGQDF LLPFGSGRR CPGYSLG+KV++++LANLLHGF W++  ++K +D
Sbjct  419   ERFLGKDIDVKGQDFELLPFGSGRRMCPGYSLGIKVIQSSLANLLHGFTWRMPYNMKKED  478

Query  1491  ISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +SM+E +GL+T  K PL    EPRLP H
Sbjct  479   LSMEEVFGLSTPKKTPLVAVCEPRLPPH  506



>ref|XP_002521317.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF40985.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/520 (54%), Positives = 372/520 (72%), Gaps = 17/520 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  +W   A  WL  +A    + +   RR+    PPGP+PWPIIGNLNL+G++PH+SLH
Sbjct  1     METPTWVAYASVWLATVAL--ILLSRRLRRRKLNLPPGPKPWPIIGNLNLIGALPHRSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             SLSQ YG +M LKFGS PV+V SS E AK  LKTHD  FA RP  AA  +T +N SD+TW
Sbjct  59    SLSQTYGPIMQLKFGSFPVVVGSSVEMAKAILKTHDVAFAGRPKIAAGKYTTYNYSDITW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARK+ + E+F+ ++L+S+EY+RIEE   L+  ++ + G  NP+ L+DHL  
Sbjct  119   SPYGAYWRQARKMCVMELFSAKRLESYEYIRIEELRLLLKSMFLSSG--NPINLKDHLTD  176

Query  564   FTLSTMTRLVTGNKYYSKDW---ELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPW  734
              +L+ ++R+V G KY  K     E+  PE +       +  LD+ FLL+GV+++GD + W
Sbjct  177   LSLNVISRMVLGKKYTVKSENVDEIVTPEEF-------KEMLDELFLLNGVLDIGDSISW  229

Query  735   LSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLE  914
             L+ LDLQGY+K+MK   +++++FL +V+++H A  K  +N   KDMVD+ LQ+ADDPNLE
Sbjct  230   LAFLDLQGYIKRMKTVSKKFDRFLEHVLDEHDARRKRVDNHVAKDMVDVLLQLADDPNLE  289

Query  915   ADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWV  1094
               + L R+ + G T D++AGG +++A TVEWA  EL RKP I  KATEELDRVIGRERWV
Sbjct  290   --IKLERNGVKGFTQDLIAGGTESSAVTVEWAISELLRKPEIFGKATEELDRVIGRERWV  347

Query  1095  EEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRN  1274
             EEKD   LP+I AIIKET RLHP+  +L P    ED  VAGY++P GT VL+NVW+IGR+
Sbjct  348   EEKDIVNLPFIYAIIKETMRLHPVAPMLVPRQCREDTKVAGYDIPEGTRVLVNVWTIGRD  407

Query  1275  SKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGF  1454
                WDN +EFCPERF+ K +D+KG DF LLPFG+GRR CPGY LG+KV++ +LANLLHGF
Sbjct  408   PSIWDNPDEFCPERFIGKTIDVKGCDFELLPFGAGRRMCPGYPLGIKVIQASLANLLHGF  467

Query  1455  KWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             KWKL GD+K +D++M+E +GL+T  KFPL    EPRLP+H
Sbjct  468   KWKLPGDMKIEDLNMEEIFGLSTPKKFPLVVVAEPRLPSH  507



>ref|XP_007202994.1| hypothetical protein PRUPE_ppa019215mg [Prunus persica]
 gb|EMJ04193.1| hypothetical protein PRUPE_ppa019215mg [Prunus persica]
Length=509

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/484 (57%), Positives = 356/484 (74%), Gaps = 8/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGNLNLLG +PHQSLH LSQ YG +M LKFGS PV+VASSPE  K FLK
Sbjct  31    KLPPGPKPWPIIGNLNLLGPLPHQSLHKLSQTYGPIMQLKFGSYPVVVASSPEMTKQFLK  90

Query  306   THDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THD +FASRP TAA  + T++  ++TW+PYGP+WR  RKI L E+F+P++L+SF Y+R+E
Sbjct  91    THDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLMELFSPKRLESFRYIRVE  150

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E  A  S LY   G    V+L++HL R +LS M+R+V G +Y+S    L   E   + LK
Sbjct  151   ENRAFASRLYALSG--KAVVLKEHLSRLSLSIMSRIVLGKEYFS----LTDFESSIMSLK  204

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             + Q  LD+ FLL+GV N+GDW+PWL  LDLQGYVK+MK  +++ + F  +V+ +H A  +
Sbjct  205   EFQDMLDELFLLNGVFNIGDWIPWLDFLDLQGYVKRMKVVKKKMDWFYEFVLHEHKARKE  264

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
             G + F  KDMVD+ LQ+ DDPN + +V LT D I   T D++AGG DT+A+ +EWA  EL
Sbjct  265   GVKEFVAKDMVDLLLQLVDDPN-DLEVKLTYDSIKAFTQDVIAGGTDTSASVLEWAMSEL  323

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              ++P +IEKATEELDRVIG+ERWVEEKD   LPY+DAI+KET R HP   +LPPH ++ED
Sbjct  324   IKQPNLIEKATEELDRVIGKERWVEEKDLENLPYMDAIMKETMRKHPAVVMLPPHLALED  383

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY+V +GT V +N+WS+GR+   WD  +EF PERFL K +D+KGQ F LLPFGSGR
Sbjct  384   CNVAGYDVRKGTLVFVNIWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFELLPFGSGR  443

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R CPGYSLG+K++ + LAN+LHGF WKL  ++K +D+ M+E YGL T  KFPL    EPR
Sbjct  444   RMCPGYSLGLKMIGSCLANMLHGFNWKLPENVKVEDLGMEEVYGLVTPRKFPLVVVTEPR  503

Query  1563  LPTH  1574
             LP H
Sbjct  504   LPIH  507



>ref|XP_007024645.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY27267.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=511

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/517 (52%), Positives = 373/517 (72%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  SW      WL  IA +       +RR+    PPGP+PWPIIGNLNL+GS+PH+S+H
Sbjct  1     METPSWASYLAAWLATIALVLLSLR-LRRRRKLNLPPGPKPWPIIGNLNLIGSLPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             +LSQKYG +M L+FGS PVIV SS E AK  L+THD  FA RP  AA  +T +N SD+TW
Sbjct  60    ALSQKYGPIMQLRFGSFPVIVGSSVEMAKAILRTHDVAFAGRPKIAAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ L+E+F+ ++L+S+EY+R EE   L+ GL +  G+  P+ L+DHL  
Sbjct  120   SPYGPYWRQARKMCLTELFSAKRLESYEYIRREEMNLLLKGLCNLSGS--PICLKDHLSS  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY       G  E   +  K+ +  LD+ FLL+GV+++GD +PWLS 
Sbjct  178   LSLNVISRMVLGKKYTE-----GTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLSF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGY+K+MKA  +++++FL +V+++H A  KG +++  KDMVD+ LQ+ADDP+L  DV
Sbjct  233   LDLQGYIKRMKALSKKFDRFLEHVLDEHNARRKGVKDYVAKDMVDVLLQLADDPHL--DV  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   + D++AGG +++A TVEWA  EL +KP I  KATEELDRVIGR+RWVEE 
Sbjct  291   KLERHGVKAFSQDLIAGGTESSAVTVEWAISELLKKPEIFAKATEELDRVIGRDRWVEEN  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D + LPY+++I KET RLHP+  +L P  + EDC +AGY++P+ T VL+NVW+IGR+   
Sbjct  351   DIANLPYVNSIAKETMRLHPVAPMLVPRLAREDCQLAGYDIPKDTRVLVNVWTIGRDPTL  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WDN +EFCP+RF+ K +D+KG DF LLPFG+GRR CPGY LG+KV++ +LANLLHGF WK
Sbjct  411   WDNPDEFCPDRFIGKAIDVKGHDFELLPFGAGRRMCPGYPLGIKVIQASLANLLHGFTWK  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L G++  +D++M+E +GL+T  KFPL    +PRLP H
Sbjct  471   LPGNMAKEDLNMEEIFGLSTPKKFPLEAVAQPRLPLH  507



>ref|XP_008354460.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=514

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/518 (54%), Positives = 368/518 (71%), Gaps = 8/518 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME FS         LA   L   T   Q +K  K PPGP+PWPIIGNLNL+G +PHQSLH
Sbjct  1     MEYFSCAVILTXACLATLALVSKTLFPQLKKR-KFPPGPKPWPIIGNLNLIGPLPHQSLH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTW  383
              LSQ YG +M L+FGS+PV+VA+SPE AK FLKTHD VF+SRP TAA  + T++  ++TW
Sbjct  60    KLSQXYGPIMQLRFGSRPVVVATSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQNVTW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR  RKI L E+F+ ++L+SFEY+R +E  A  S L     + NP++L++HL R
Sbjct  120   SPYGPYWRQGRKIFLYELFSSKRLESFEYIRADEXRAFTSRLXAIAKSGNPIVLKEHLSR  179

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
               LS M+R V G  Y+S    + + EG  + LK+ Q  +D+ F+L+GV N+GDW+PWL+ 
Sbjct  180   LNLSIMSRTVLGKDYFS----VAEYEGSIMSLKEFQDMIDELFVLNGVFNIGDWMPWLNF  235

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGY+K+MKA +++  +F ++V+ +H A  +G E F PKDMVD+ LQ+ D  N + +V
Sbjct  236   LDLQGYIKRMKAMQKKINRFYDFVLNEHKAQKEGVEEFVPKDMVDLLLQLVDGSN-DLEV  294

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L  D I   T D++AGG DT+A  +EWA  EL ++P +I+KATEELDRVIGRERWVEEK
Sbjct  295   KLNYDSIKAFTQDLIAGGTDTSATNLEWAMSELIKQPNLIKKATEELDRVIGRERWVEEK  354

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D  QLPYIDAI+KET R HP   +LPPH ++E+  VAGY+V +GT V +N WS+GR+ K 
Sbjct  355   DLEQLPYIDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTVVFVNTWSMGRDPKL  414

Query  1284  WDNANEFCPERFL-EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
             W+   EF PERFL    +D++GQ F LLPFGSGRR CPGY LG+ ++RT LAN+LHGF W
Sbjct  415   WEEPEEFRPERFLGNTGIDLQGQSFXLLPFGSGRRMCPGYKLGLXMIRTCLANMLHGFXW  474

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             KL G++K +D+ M+EAYGL T  KFPL   +EPRLP H
Sbjct  475   KLPGNVKVEDLGMEEAYGLVTTRKFPLVAVMEPRLPVH  512



>gb|AJD25216.1| cytochrome P450 CYP92B29 [Salvia miltiorrhiza]
Length=509

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/516 (54%), Positives = 368/516 (71%), Gaps = 21/516 (4%)
 Frame = +3

Query  57    LPWLL-------AIAFLFKITTIHQRRKAYKT-PPGPRPWPIIGNLNLLGSIPHQSLHSL  212
             +PWLL       A AF+ KI      R   K  PPGP+PWPIIGNLNLLGS PH+SLH L
Sbjct  3     IPWLLLGLISAAAAAFISKIIKSRGWRPEQKLLPPGPKPWPIIGNLNLLGSTPHRSLHHL  62

Query  213   SQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSP  389
             SQKYGE+MLLK G  PV+VASSPE AK FL+ HDA FASRP  AA  +T +N  D+ W+P
Sbjct  63    SQKYGEIMLLKLGKFPVVVASSPEMAKQFLRVHDASFASRPLLAAGKYTSYNYRDLVWAP  122

Query  390   YGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFT  569
             +GP+WR AR+I  SEVF+ +KL+ +  VR +E    +S L     +   ++L+DHL R++
Sbjct  123   HGPYWRQARRIYTSEVFSAKKLELYHQVRADEMHNFLSAL-----SGKTLVLKDHLSRYS  177

Query  570   LSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLD  749
             LST+ R+++ ++Y+S+    G P    + +  L   +D+WF+LSGV+N+GDW+PWL+  D
Sbjct  178   LSTIWRMISRDEYFSES-NGGNP---VLNMDDLHEMVDEWFMLSGVVNIGDWIPWLAPFD  233

Query  750   LQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDEN-FAPKDMVDIFLQIADDPNLEADVA  926
             LQGYVKKMKA   + + F NYVI+DH+A     ++ FAP D VD+ LQ+A+   LE  V 
Sbjct  234   LQGYVKKMKALNNKMDSFYNYVIDDHLARRAAQKHQFAPTDFVDVLLQMAEAGQLE--VE  291

Query  927   LTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKD  1106
             LTRD +  L  +++ G  DT+A T+EWA  E+ R+P IIEKA EEL+RVIGR RWV E D
Sbjct  292   LTRDCVKALIQNLIVGSMDTSATTIEWAVHEILRQPHIIEKAKEELNRVIGRNRWVGEDD  351

Query  1107  FSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYW  1286
                LPY++A++ ETFRLHP+ T+L PHY+I+DC VAGY + +GTTV INVWSIGR +  W
Sbjct  352   LGGLPYLEAVVTETFRLHPVGTMLAPHYAIQDCNVAGYNISKGTTVFINVWSIGRQAGAW  411

Query  1287  DNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL  1466
             D+  EF PERFL +++D+ G DFALLPFGSGRR CPGY+LG+KVVRTTLANLLHGF  KL
Sbjct  412   DSPEEFLPERFLGREIDMLGGDFALLPFGSGRRVCPGYNLGLKVVRTTLANLLHGFDMKL  471

Query  1467  DGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
                ++P+D+S++E YGL+THPK  L+  +EP LP H
Sbjct  472   VDGMRPEDVSLEEEYGLSTHPKHRLALLMEPTLPPH  507



>gb|AGT17103.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=519

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/518 (52%), Positives = 366/518 (71%), Gaps = 6/518 (1%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME+ +W    L  +LA   L K   + +RR+ Y  PPGP+PWPIIGNLNL+G++PH+S+H
Sbjct  1     MELPTWA-SFLGVVLATVMLLK-AILGRRRRVYNLPPGPKPWPIIGNLNLMGALPHRSIH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS+KYG LM L+FGS PV+V SS + AK FLKTHD VF  RP TAA  +T +N  D+TW
Sbjct  59    ELSRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARK+ L+E+F+ ++L+S+EY+R  E  AL+  L+ A G+   V+L+DHL  
Sbjct  119   SPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDHLST  178

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ +TR+V G KY  KD             ++ +  LD+ FLL+GV+N+GD +PWL  
Sbjct  179   VSLNVITRMVLGKKYLDKDEVASAGSVTMTTPEEFKWMLDELFLLNGVLNIGDSIPWLDW  238

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
             +DLQGY+K+MK   + +++FL +V+E+H    ++  ++F  KDMVD+ LQIADDP LE  
Sbjct  239   MDLQGYIKRMKKLSKMFDRFLEHVVEEHNQRRLREGKDFVAKDMVDVLLQIADDPTLE--  296

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L R+ +   T D++AGG +++A TVEWA  EL +KP +I KATEELDRVIGR RWV E
Sbjct  297   VELNRESVKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIVKATEELDRVIGRGRWVTE  356

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD   LPY+DAI+KET RLHP+  +L P  S ED  VAGY++P GT VL++VWSIGR+  
Sbjct  357   KDIPSLPYVDAIVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPA  416

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              WD   EF PERFL   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W
Sbjct  417   LWDAPEEFMPERFLSSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSW  476

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              L   +  +++SM+E +GL+T  KFPL   +EP+LP H
Sbjct  477   SLPYGVTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAH  514



>ref|XP_004956938.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/507 (53%), Positives = 365/507 (72%), Gaps = 9/507 (2%)
 Frame = +3

Query  66    LLAIAFLFK-ITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLL  242
             +LA   L K I   H+RR+AY  PPGP+PWPIIGNL+L+G++PH+S+H LS+KYG LM L
Sbjct  13    VLATVMLLKAIVGRHRRRRAYNLPPGPKPWPIIGNLDLVGALPHRSIHELSRKYGPLMQL  72

Query  243   KFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARK  419
             +FGS PV+V SS + AK FLKTHD VF  RP TAA  +T +N  D+TWSPYG +WR ARK
Sbjct  73    QFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYGAYWRQARK  132

Query  420   ILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTG  599
             + L+E+F+ ++L+S+EY+R  E  AL+  L+   G+   V+L+D+L   +L+ +TR+V G
Sbjct  133   MCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGCAVMLKDYLSTVSLNVITRMVLG  192

Query  600   NKYYSKDWELGKPEGYSIPL-KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
              KY  K+   G   G S+   ++ +  LD+ FLL+GV+N+GD +PWL  +DLQGY+K+MK
Sbjct  193   KKYLDKEVAAG---GSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMK  249

Query  777   AFREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL +V+E+H    ++  ++F  KDMVD+ LQIADDP LE  V L R+ +   
Sbjct  250   KLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLE--VELNRESVKAF  307

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
             T D++AGG +++A TVEWA  EL +KP +  KATEELDRVIGR RWV EKD  QLPY+DA
Sbjct  308   TQDLIAGGTESSAVTVEWAISELLKKPEVFAKATEELDRVIGRGRWVTEKDIPQLPYVDA  367

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET RLHP+  +L P  S ED  VAGY++P GT VL++VWSIGR+   WD   EF PE
Sbjct  368   IVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPTLWDAPEEFMPE  427

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDI  1493
             RFL   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W L   L  +++
Sbjct  428   RFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSWSLPDGLTKEEL  487

Query  1494  SMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             SM+E +GL+T  KFPL   +EP+LP H
Sbjct  488   SMEEIFGLSTPRKFPLEAVVEPKLPAH  514



>ref|XP_006369135.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
 gb|ERP65704.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
Length=511

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/514 (51%), Positives = 371/514 (72%), Gaps = 11/514 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             +W   A  WL  ++ +   + +  RR+  K PPGP+PWPIIGNLNL+G +PH+SLH+LSQ
Sbjct  3     TWVSYAFAWLATVSLILLASRL--RRRKLKLPPGPKPWPIIGNLNLIGELPHRSLHALSQ  60

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG +M ++FGS PV+V SS E AK  LKTHD +F+ RP TAA  +T +N SD+TWSPYG
Sbjct  61    KYGPIMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYG  120

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARK+ L E+F+ ++L+S+EY+R+EE  AL+  L+ + G   P+ L+DHL   +L+
Sbjct  121   PYWRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLHKSSG--RPINLKDHLTDVSLN  178

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G KY  K  E    E   +  ++ +  LD+ FLL+GV+++GD +PW++ LDLQ
Sbjct  179   VISRMVLGKKYTVKSSE---NEKEIVTPEEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQ  235

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKG-DENFAPKDMVDIFLQIADDPNLEADVALT  932
             GY+K+MK   ++++KF+ +V+++H +  K  DEN+ PKDMVD+ LQ+A DPNLE  V L 
Sbjct  236   GYIKRMKVLSKKFDKFMEHVLDEHESRRKTEDENWEPKDMVDVLLQLASDPNLE--VKLE  293

Query  933   RDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFS  1112
             R  +   + D++AGG +++A TVEWA  E+ RKP + EKA+EELDRVIGRERWVEEKD  
Sbjct  294   RHGVKAFSQDLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEKDMV  353

Query  1113  QLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDN  1292
              LPYI AI KE  RLHP+  +L P  + ED  V GY++ +G+ VL+NVW+IGR+ K WD 
Sbjct  354   NLPYIYAIAKEVMRLHPVAPMLVPREAREDINVNGYDIKKGSRVLVNVWTIGRDPKVWDK  413

Query  1293  ANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG  1472
              +EFCPERF+   +D++G D+ LLPFG+GRR CPGY LG+KV++ TL+NLLHGFKW+L  
Sbjct  414   PDEFCPERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPD  473

Query  1473  DLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              ++ +++SM+E +GL+T  K+PL    EPRLP H
Sbjct  474   GVRKEELSMEEIFGLSTPKKYPLVAVAEPRLPAH  507



>emb|CDP20453.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/430 (62%), Positives = 338/430 (79%), Gaps = 9/430 (2%)
 Frame = +3

Query  288   AKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSF  464
             AK FLKTHD +FASRP TAA  +T +N SD++W+PYGP WR ARKI LS++F+ + LDSF
Sbjct  2     AKEFLKTHDDIFASRPTTAAGKYTSYNCSDVSWAPYGPHWRQARKIYLSQIFSQKPLDSF  61

Query  465   EYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEG  644
             E +RIEER A IS LY   G   PV++RDHL+R TLST +++V  NKY+++  E    +G
Sbjct  62    ESIRIEERRAFISRLYALSG--KPVVMRDHLMRLTLSTASQMVLSNKYFAQSEE----DG  115

Query  645   YSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIED  824
               +  ++ Q  +D WFLL GV N+GDW+PWL   DLQGY+K+MK   +++++F N+V++D
Sbjct  116   SLVTFEEFQEMIDTWFLLGGVFNIGDWIPWLDRFDLQGYIKQMKELDKKFDRFHNHVLDD  175

Query  825   HMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
             H A  K +++F P DMVDI LQ A+DP+L   V LTRD+I GL  D+LA G DT+A+TVE
Sbjct  176   HQAKRKTEKDFIPTDMVDILLQYAEDPDLR--VKLTRDQIKGLIQDLLAAGTDTSASTVE  233

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  EL + P +IEKATEELDRVIGR++WVEE DFS+LP+++AIIKETFRLHP+ TLLPP
Sbjct  234   WAMNELLKHPRLIEKATEELDRVIGRDKWVEEADFSKLPFLEAIIKETFRLHPITTLLPP  293

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
             HY+IED  VAGY +P+GTTVLIN WSIGRNSKYWD+  EF PERFLEKDVD+KGQ+FALL
Sbjct  294   HYAIEDGTVAGYHIPKGTTVLINTWSIGRNSKYWDSPEEFMPERFLEKDVDMKGQNFALL  353

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PFGSGRR+CPGY+LG+K+VR+ LANLLHGF WKL   +KP++I M+E YGLTTHP+ PL+
Sbjct  354   PFGSGRRRCPGYNLGLKLVRSMLANLLHGFNWKLPHGMKPEEICMEELYGLTTHPRTPLA  413

Query  1545  YTIEPRLPTH  1574
                EPRLP +
Sbjct  414   MIPEPRLPVN  423



>ref|XP_010917481.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=511

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/518 (52%), Positives = 370/518 (71%), Gaps = 13/518 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  S        L +I FL + +   +RR+    PPGP+PWPIIGNLNL+ S+PH+SLH
Sbjct  1     MESPSLVVSLAAILASILFLLR-SLFGRRRRKLNLPPGPKPWPIIGNLNLISSLPHRSLH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             +LSQKYG LM L FGS PVIVA+S + AKL LKTHD  F  RP TAA  +T +N SD+TW
Sbjct  60    ALSQKYGPLMHLYFGSFPVIVAASVDVAKLVLKTHDVTFCGRPKTAAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             S YGP+WR ARK+ + E+F+ ++LDS+EY+R+EE   L+  L+++ G    V L+DHL  
Sbjct  120   SQYGPYWRQARKMCIMELFSAKRLDSYEYIRVEEVKNLLRDLFNSAGRS--VNLKDHLSN  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY      L K EG  +  ++ +  LD+ FLL+GV+N+GD +PWL  
Sbjct  178   VSLNVISRMVLGKKY------LVKSEGAIVSPEEFKAMLDELFLLNGVMNIGDSIPWLGF  231

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEAD  920
             LDLQGY+K+MK   +++++FL +V+++H    + + ENF   DMVD+ LQ+ADDP+LE  
Sbjct  232   LDLQGYIKRMKKVGKKFDRFLEHVLDEHNERRRREGENFVAMDMVDVLLQLADDPSLE--  289

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L R  +   T D++AGG +++A TVEWA  EL ++P I +KATEELDRVIGRERWVEE
Sbjct  290   VKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLKRPEIFKKATEELDRVIGRERWVEE  349

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             K+   LPYI+AI+KET R+HP+  LL P  S EDC +AGY++  GT VL+NVW+IGR+  
Sbjct  350   KEVHNLPYIEAIVKETMRMHPVAPLLVPRMSREDCNIAGYDILAGTRVLVNVWTIGRDPT  409

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              WD+  EF PERF+  ++D+KGQDF LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W
Sbjct  410   IWDSPEEFRPERFIGSNIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAW  469

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +L   +K +D+SM+E +GL+T  K PL   ++P+LP H
Sbjct  470   RLPDGMKVEDLSMEEIFGLSTPKKVPLEVVVQPKLPAH  507



>ref|XP_002462455.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
 gb|EER98976.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
Length=517

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/518 (52%), Positives = 364/518 (70%), Gaps = 8/518 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME+ +W    L  +LA   L K     + R+ Y  PPGP+PWPIIGNLNL+G++PH+S+H
Sbjct  1     MELPTWA-SFLGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLNLMGALPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS+KYG LM L+FGS PV+V SS + AK FLKTHD VF  RP TAA  +T +N  D+TW
Sbjct  60    ELSRKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARK+ L+E+F+ ++L+S+EY+R  E  AL+  L+ A G+   V+L+D+L  
Sbjct  120   SPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDYLST  179

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ +TR+V G KY  K+       G     ++ +  LD+ FLL+GV+N+GD +PWL  
Sbjct  180   VSLNVITRMVLGKKYLDKE---EAAAGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDW  236

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
             +DLQGY+K+MK   + +++FL +V+E+H    ++  + F  KDMVD+ LQIADDP LE  
Sbjct  237   MDLQGYIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLE--  294

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L R+ +   T D++AGG +++A TVEWA  EL +KP +I KATEELDRVIGR RWV E
Sbjct  295   VELNRESVKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTE  354

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD   LPY+DA++KET RLHP+  LL P  S ED  VAGY++P GT VL++VWSIGR+  
Sbjct  355   KDMPSLPYVDAVVKETMRLHPVAPLLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPA  414

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              WD   EF PERFL   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W
Sbjct  415   LWDAPEEFMPERFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAW  474

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              L   +  +++SM+E +GL+T  KFPL   +EP+LP H
Sbjct  475   SLPDGVTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAH  512



>gb|ABA01477.1| cytochrome P450 DDWF1 [Gossypium hirsutum]
Length=497

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/488 (53%), Positives = 359/488 (74%), Gaps = 10/488 (2%)
 Frame = +3

Query  114   RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAK  293
             R+    PPGP+PWP+IGNL+L+GS+PH+S+H+LSQKYG LM LKFGS PV+VASS E AK
Sbjct  15    RRKLNFPPGPKPWPVIGNLDLIGSLPHRSIHALSQKYGPLMQLKFGSFPVVVASSVEMAK  74

Query  294   LFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEY  470
              FLKTHD +FA RP  AA  +T +N SD+TWSPYGP+WR ARK+ ++E+F+ ++L+S+EY
Sbjct  75    AFLKTHDVIFAGRPKIAAGEYTTYNYSDITWSPYGPYWRQARKMCMTELFSAKRLESYEY  134

Query  471   VRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYS  650
             +R EE   L+ GLY++ G   P++L+D L   +L+ ++R+V G KY       G  E   
Sbjct  135   IRREEMKLLLKGLYESSGV--PIVLKDRLSDLSLNVISRMVFGKKYTE-----GTGENEI  187

Query  651   IPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHM  830
             +  K+ +  LD+ FLL+GV+++GD +PWL  LDLQG +K+MKA  ++++KFL +V+++H 
Sbjct  188   VTPKEFKEMLDELFLLNGVLDIGDSIPWLRFLDLQGNIKRMKALSKKFDKFLEHVLDEHN  247

Query  831   AMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWA  1010
             A  +  +++A KDMVD+ LQ+ADDPNL  DV L R  +   + D++AGG +++A TVEWA
Sbjct  248   ARRRDVKDYAAKDMVDVLLQLADDPNL--DVKLERHGVKAFSQDLIAGGTESSAVTVEWA  305

Query  1011  FQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHY  1190
               E+ +KP I  KAT ELDRVIGRERWVEE+D   LPYID+I KET RLHP+  +L P  
Sbjct  306   ISEMLKKPEIFAKATGELDRVIGRERWVEERDTVNLPYIDSIAKETMRLHPVAPMLVPRM  365

Query  1191  SIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPF  1370
             + EDC V GY++ +GT  L+NVW+IGR+   WDN NEFCPERF++K +D+KG DF LLPF
Sbjct  366   TREDCQVDGYDILKGTRALVNVWTIGRDPTVWDNPNEFCPERFIDKTIDVKGHDFQLLPF  425

Query  1371  GSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYT  1550
             G+GRR CPGY LG+KV++ +LANLLHGF WKL G++  +++ M+E +GL+T  K PL   
Sbjct  426   GAGRRMCPGYPLGIKVIQASLANLLHGFTWKLPGNMTKENLDMEEIFGLSTPKKCPLQAV  485

Query  1551  IEPRLPTH  1574
               P+LP H
Sbjct  486   AVPKLPLH  493



>ref|XP_008342571.1| PREDICTED: cytochrome P450 71A1-like [Malus domestica]
Length=511

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/485 (55%), Positives = 360/485 (74%), Gaps = 16/485 (3%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+  +PH+S+H L+ KYG +M LKFGS PV+V SS E AK FLKTH
Sbjct  35    PPGPKPWPIIGNLNLISHLPHRSVHELALKYGPIMQLKFGSYPVVVGSSVEMAKAFLKTH  94

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  FA RP  AA  HT +N SD+TWSPYGP+WR ARK+ ++E+F+ ++L+S+EY+R EE 
Sbjct  95    DVTFAGRPKFAAGKHTTYNYSDITWSPYGPYWRQARKMCITELFSNKRLESYEYIRREEM  154

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYY--SKDWELGKPEGYSIPLK  662
              AL+ GLYD+  + + VLL+DHL   +L+ ++R+V G KY   +KD  +   E       
Sbjct  155   SALLKGLYDS--SNSNVLLKDHLSTVSLNVISRMVLGKKYTDETKDAIVSPDE-------  205

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
               +  LD+ FLLSGV+N+GD +PWL  LDLQGY+K+MK   ++ ++FL +V+++H+   +
Sbjct  206   -FKKMLDELFLLSGVLNIGDSIPWLDFLDLQGYIKRMKTLSKKLDRFLEHVLDEHITKRE  264

Query  843   -GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
              G ++F  KDMVD+ LQ+ADDPNLE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  265   VGGKDFVAKDMVDVLLQLADDPNLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISE  322

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L RKP + +KA EELDRVIGR+RWVEEKD  +LPY+DAI KET RLHP+  +L P  + E
Sbjct  323   LLRKPDLFKKAAEELDRVIGRDRWVEEKDIVKLPYVDAIAKETMRLHPVAPMLVPRQTRE  382

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC VAGY++P+GT  L++VW+IGR+ + WDN  +F PERFL KD+D+KGQDF LLPFGSG
Sbjct  383   DCQVAGYDIPKGTRALVSVWTIGRDPELWDNPEQFFPERFLGKDIDVKGQDFELLPFGSG  442

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY+LG+KV++++LANLLHGF W+L  ++K +D+SM+E +GL+T  K PL    EP
Sbjct  443   RRMCPGYNLGIKVIQSSLANLLHGFTWRLPYNMKKEDLSMEEVFGLSTPKKTPLVAVCEP  502

Query  1560  RLPTH  1574
             RLP H
Sbjct  503   RLPPH  507



>ref|XP_008792870.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=511

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/509 (52%), Positives = 366/509 (72%), Gaps = 12/509 (2%)
 Frame = +3

Query  54    ALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
             +L  +LA   LF  +   +RR++   PPGP+PWPIIGNLNL+ S+PH+SLH+LSQKYG L
Sbjct  9     SLAAILASILLFLKSLFGRRRRSLNLPPGPKPWPIIGNLNLISSLPHRSLHALSQKYGPL  68

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             + L FGS PVIVA+S + AKL LK+HD  F  RP  AA  +T +N SD+TWS YGP+WR 
Sbjct  69    IHLYFGSFPVIVAASVDMAKLVLKSHDVSFCGRPKIAAGKYTTYNYSDITWSQYGPYWRQ  128

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
             ARK+ + E+F+ R+LDS+EY+R+EE   L+  L+ + G+  PV L+DHL   +L+ ++R+
Sbjct  129   ARKMCIMELFSARRLDSYEYIRVEEVKNLLRDLFKSSGS--PVSLKDHLSNVSLNVISRM  186

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G KY      L + EG  +  ++ +  LD+ FLL+GV+N+GD +PWL  LDLQGY+K+
Sbjct  187   VLGKKY------LDRSEGAIVSPEEFKAMLDELFLLNGVMNIGDSIPWLDFLDLQGYIKR  240

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIM  947
             MK    ++++FL +V+++H    + + ENF   DMVD+ L++ADDPNLE  V L R  + 
Sbjct  241   MKKISRKFDRFLEHVLDEHNERRRREGENFVAVDMVDVLLELADDPNLE--VKLERRGVK  298

Query  948   GLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYI  1127
               T D++AGG +++A TVEWA  EL ++P I +KATEELDRVIGR+RWVEEK+   LPYI
Sbjct  299   AFTQDLIAGGTESSAVTVEWAISELLKRPEIFKKATEELDRVIGRDRWVEEKEVHNLPYI  358

Query  1128  DAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFC  1307
             +AI+KET R+HP+  +L P  S EDC +AGY++P GT VL+NVW+IGR+   WD+  EF 
Sbjct  359   EAIVKETMRMHPVAPMLVPRLSREDCNIAGYDIPAGTRVLVNVWTIGRDPTVWDSPEEFR  418

Query  1308  PERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPK  1487
             PERF+   +D+KG DF LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W+L    K +
Sbjct  419   PERFIGSKIDVKGHDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGTKLE  478

Query  1488  DISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             D+SM+E +GL+T  K PL   +EP+LP H
Sbjct  479   DLSMEEIFGLSTPRKVPLEAVVEPKLPAH  507



>ref|XP_002303241.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
 gb|EEE78220.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
Length=512

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/517 (51%), Positives = 366/517 (71%), Gaps = 10/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  +W   A  WL  ++ +   + +  RR+    PPGP+ WPIIGNLNL+G +PH+SLH
Sbjct  1     METPTWMSYAFAWLATVSLILLASRL--RRRKLNPPPGPKSWPIIGNLNLIGELPHRSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             +LSQKYG LM +KFGS PV+V SS E AK  LKTHD +F+ RP TAA  +T +N SD+TW
Sbjct  59    ALSQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ L E+F+ ++L+S+EY+R+EE  AL+  L  + G   P+ L+DHL  
Sbjct  119   SPYGPYWRQARKMCLMELFSAKRLESYEYIRVEELRALLKTLNKSSG--RPINLKDHLAD  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY  K  E    E   +  ++ +  LD+ FLL+GV+++GD +PW++ 
Sbjct  177   VSLNVISRMVLGKKYTVKSSE---NEKEIVTPEEFKEMLDELFLLNGVLDIGDSIPWIAF  233

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGY+K+MK   ++++KF+ +V+++H A  K D+N+ PKDMVD+ LQ+A DPNLE  +
Sbjct  234   LDLQGYIKRMKTLSKKFDKFMEHVLDEHEARRKEDKNWEPKDMVDVLLQLASDPNLE--I  291

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   + D++AGG +++A TVEW   E+ RKP + EKATEELDRVIGRERWVEEK
Sbjct  292   KLERHGVKAFSQDLIAGGTESSAVTVEWGISEILRKPEVFEKATEELDRVIGRERWVEEK  351

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPYI AI KE  RLHP+  +L P  + ED  + GY++ +G+ VL+NVW+IGR+ K 
Sbjct  352   DMVNLPYIYAIAKEVMRLHPVAPMLVPRAAREDININGYDIKKGSRVLVNVWTIGRDPKV  411

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD  +EF PERF+   +D++G D+ LLPFG+GRR CPGY LG+KV++ TL+NLLHGFKW+
Sbjct  412   WDKPDEFFPERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWR  471

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L    K  D++MDE +GL+T  K+PL    EPRLP H
Sbjct  472   LPDGQKKDDLNMDEIFGLSTPKKYPLVAVAEPRLPAH  508



>ref|XP_002516270.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF46272.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=521

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/516 (51%), Positives = 364/516 (71%), Gaps = 9/516 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITT-IHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLS  215
             SW   A+ WL     LF     I     + K PPGP+PWPIIGNLNL+G +PH+SLH L+
Sbjct  9     SWILSAMAWLAGAGLLFLAKLFISHHHSSLKLPPGPKPWPIIGNLNLIGPLPHRSLHKLA  68

Query  216   QKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPY  392
             Q+YG +M L+FGS PV+VASS E AK  LKT+D +FASRP  AA  +T +N S++ W+PY
Sbjct  69    QQYGHIMQLRFGSFPVVVASSAEMAKQILKTNDEIFASRPKFAAGKYTAYNYSNVLWAPY  128

Query  393   GPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTL  572
             G +WR  RK+ L+E+F  ++L S+EY+R+EE    +SG++    +   VLL+DHL  +TL
Sbjct  129   GEYWRQGRKLYLNELFNSKRLQSYEYIRVEEMHNFLSGVHSLSCSGKAVLLKDHLSHYTL  188

Query  573   STMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDL  752
             S ++R+V G KY S + E    +   +  ++ Q  LD+ F L+GV ++GDW+PWL  LDL
Sbjct  189   SILSRIVLGKKYSSAESE---SQTNIVTPEEFQEMLDELFSLNGVFHIGDWIPWLDFLDL  245

Query  753   QGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD--ENFAPKDMVDIFLQIADDPNLEADVA  926
             QGYVK+MKA + ++++F ++VI +H    KG   E+ APK++VD  LQ+AD+P+L  D+ 
Sbjct  246   QGYVKRMKALKIKFDRFHDHVISEHRIKRKGALLEDSAPKNIVDHMLQLADNPDL--DIK  303

Query  927   LTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKD  1106
             L  D + G + +++ GG+DT AA VEWA  EL + P +++KAT+ELDRV+G++RWVEEKD
Sbjct  304   LNTDSVKGFSQEIIGGGKDTAAAAVEWAMSELMKHPNLVKKATDELDRVVGKQRWVEEKD  363

Query  1107  FSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYW  1286
                LPYIDAI+KET R HP+ T+L P  + +DC V GY++ +G+ V+IN WS+GR+   W
Sbjct  364   IPNLPYIDAIMKETMRKHPVGTMLAPRLATKDCKVGGYDILKGSRVVINTWSMGRDPSIW  423

Query  1287  DNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL  1466
             D   EF PERFL+K +D+KGQ F LLPFGSGRR CPGYSLG+K++R+ LANLLHGF WKL
Sbjct  424   DEPEEFRPERFLDKTIDVKGQSFELLPFGSGRRMCPGYSLGLKMIRSCLANLLHGFNWKL  483

Query  1467  DGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
               ++KP+D+SMDE YGL T  K PL    EPRLP H
Sbjct  484   PDNMKPEDLSMDEVYGLATLRKSPLVAVAEPRLPLH  519



>ref|XP_008460308.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=508

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 355/481 (74%), Gaps = 11/481 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWP+IGNL+L+GS+PHQS+H LS+KYG +M L+FGS PV+V SS E AK+FLKT 
Sbjct  33    PPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLKTQ  92

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F SRP TAA  +T +N SD+TWS YGP+WR ARK+ L E+F+ R+LDS+EY+R EE 
Sbjct  93    DLNFVSRPKTAAGKYTTYNYSDITWSQYGPYWRQARKMCLMELFSARRLDSYEYIRKEEM  152

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              AL+  +Y + G    + ++D+L   +L+ ++R+V G KY  +       E   +   + 
Sbjct  153   NALLREIYKSCG--EVIKIKDYLSTVSLNVISRMVLGKKYTDES------ENGIVSPDEF  204

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLLSGV+N+GD +PW+  LDLQGYVK+MKA  +++++FL +V+++H    KG 
Sbjct  205   KKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLEHVLDEHNERRKGV  264

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             E++  KDMVD+ LQ+ADDP+LE  V L R  +   T D++AGG +++A TVEWA  EL +
Sbjct  265   EDYVAKDMVDVLLQLADDPDLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAMSELLK  322

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I  KA EELDRVIG+ERWVEEKD   LPYIDAI KET RLHP+  +L P  + EDC 
Sbjct  323   KPEIFNKAREELDRVIGKERWVEEKDIINLPYIDAIAKETMRLHPVAPMLVPRMTREDCQ  382

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             +AGY++ +GT V +NVW+IGR+   W+N  EF PERF+ K++D+KGQDF LLPFGSGRR 
Sbjct  383   IAGYDIVKGTRVFVNVWTIGRDPTVWENPLEFKPERFMGKNIDVKGQDFELLPFGSGRRM  442

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV++++LANLLHGF WKL GD+K +D++MDE +GL+T  KFPL    EPRL 
Sbjct  443   CPGYSLGLKVIQSSLANLLHGFTWKLSGDMKNEDLNMDEVFGLSTPKKFPLDVVAEPRLS  502

Query  1569  T  1571
             +
Sbjct  503   S  503



>ref|NP_001147572.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG27961.1| flavonoid 3-monooxygenase [Zea mays]
 tpg|DAA40166.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/505 (52%), Positives = 359/505 (71%), Gaps = 5/505 (1%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +LA   L K  T  + R+ Y  PPGP+PWPIIGNL+L+G++PH+S+H LS+KYG LM L+
Sbjct  13    VLATVMLLKALTGRRSRRMYNLPPGPKPWPIIGNLDLVGALPHRSIHELSRKYGPLMQLR  72

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS PV+V SS + AK FLKTHD VF  RP TAA  +T +N  D+TWSPYG +WR ARK+
Sbjct  73    FGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYGAYWRQARKM  132

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGN  602
              L+E+F+ ++L+S+EY+R +E  AL+  L+ A  +   V+L+D+L   +L+ +TR+V G 
Sbjct  133   CLTELFSAKRLESYEYIRADEVRALLRDLHAASSSGRAVMLKDYLSTVSLNVITRMVLGK  192

Query  603   KYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAF  782
             KY  K+ E     G     ++ +  LD+ FLL+GV+N+GD +PWL  +DLQGY+K+MK  
Sbjct  193   KYLDKE-EAAAAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMKKL  251

Query  783   REEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTH  959
              + +++FL +V+E+H    ++  + F  KDMVD+ LQIADDP LE  V L R+ +   T 
Sbjct  252   SKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLE--VELDRESVKAFTQ  309

Query  960   DMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAII  1139
             D++AGG +++A TVEWA  EL +KP +I KATEELDRVIGR RWV EKD   LPY+DAI+
Sbjct  310   DLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMPSLPYVDAIV  369

Query  1140  KETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERF  1319
             KET RLHP+  LL P  + ED  VAGY++P GT VL++VWSIGR+   WD   EF PERF
Sbjct  370   KETMRLHPVAPLLVPRLAREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAPEEFMPERF  429

Query  1320  LEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISM  1499
             L   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W L   +  ++ SM
Sbjct  430   LGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPDGVTKEEFSM  489

Query  1500  DEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +E +GL+T  KFPL   +EP+LP H
Sbjct  490   EEIFGLSTPRKFPLEAVVEPKLPAH  514



>ref|XP_004303697.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/482 (55%), Positives = 355/482 (74%), Gaps = 12/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +PH+SLH LSQKYG +M L+FGS PV+V SS E AK FLKTH
Sbjct  34    PPGPKPWPIIGNLNLMGHLPHRSLHELSQKYGPIMQLRFGSFPVVVGSSAEMAKAFLKTH  93

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D   A RP  AA  +T +N S++TWSPYGP+WR ARK+ L E+F+ ++L+S+EY+R EE 
Sbjct  94    DVAVADRPKIAAGKYTTYNYSNITWSPYGPYWRQARKMCLMELFSAKRLESYEYIRKEEM  153

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              AL+ GLY +  T   +LL+ HL   +L+ ++R+V G KY  +       E   +   + 
Sbjct  154   NALLRGLYKSSNTN--ILLKAHLSDLSLNVISRMVLGKKYTDES------ENAIVRPDEF  205

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLL+GV+N+GD +PWL+ LDLQGY+K+MKA  +++++FL +V+++H++  K  
Sbjct  206   KKMLDELFLLTGVLNIGDSIPWLNFLDLQGYIKRMKALSKKFDRFLEHVLDEHISNSKA-  264

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
              +F   DMVD+ LQ+A DPNLE  V L R  +   + D+LAGG +++A TVEW   E+ R
Sbjct  265   PDFVATDMVDVLLQLAADPNLE--VKLERHGVKAFSQDLLAGGTESSAMTVEWGMSEVLR  322

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I +KATEELDRVIGRERWVEEKD   LPYIDAI KET RLHP+  LL P  + EDC 
Sbjct  323   KPEIFKKATEELDRVIGRERWVEEKDIVNLPYIDAIAKETMRLHPVAPLLVPRLAREDCQ  382

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             +AGY++ +GT V++++W+IGR+ KYWDN  EF PERF+ KD+D+KGQDF LLPFGSGRR 
Sbjct  383   IAGYDITKGTRVIVSIWAIGRDPKYWDNPLEFSPERFIGKDIDVKGQDFELLPFGSGRRM  442

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG K++++++ANLLHGF W+   ++K +D+SM+E +GL+T  KFPL    EPRLP
Sbjct  443   CPGYSLGHKLIQSSIANLLHGFNWRFPDNMKKEDLSMEEIFGLSTPRKFPLIAVTEPRLP  502

Query  1569  TH  1574
              H
Sbjct  503   AH  504



>ref|XP_004238498.1| PREDICTED: cytochrome P450 71A2-like isoform X2 [Solanum lycopersicum]
Length=445

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/515 (55%), Positives = 345/515 (67%), Gaps = 74/515 (14%)
 Frame = +3

Query  33    VFSWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHS  209
             V  W F     WLLA+AF+ KI   H +RK    PPGP+PWPIIGNLNLLGS+PH+SLH 
Sbjct  2     VIPWVFLVFGSWLLALAFVIKILN-HPKRK---LPPGPKPWPIIGNLNLLGSLPHKSLHH  57

Query  210   LSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHTFNRSDMTWSP  389
             LSQKYG+LMLLKFGSKPV                  + AS P  A         D++++ 
Sbjct  58    LSQKYGDLMLLKFGSKPV------------------LIASSPEMAK--EILKTHDISFAS  97

Query  390   YGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFT  569
               P                                        +    P+LL+  L RFT
Sbjct  98    RPP----------------------------------------LAAGKPILLKHRLARFT  117

Query  570   LSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLD  749
             L T+ RL+    Y S D  +       +  ++LQ   D+WF+LSG+IN+GDW+PWLS  D
Sbjct  118   LRTINRLIMSETYCSSDASV-------VTHERLQWMFDEWFVLSGLINIGDWIPWLSWFD  170

Query  750   LQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVAL  929
             LQGYVK+MKA R+   +F  YV+EDH A  + +EN++PKDMVD  L +ADDPNLE  + L
Sbjct  171   LQGYVKRMKALRKNMTEFYEYVLEDHKAKRQKEENYSPKDMVDAMLHLADDPNLE--IKL  228

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
             T D +MGL HD++ GG DT A T+EWAFQEL ++P I+EKA +ELDR IGRE WV+E+DF
Sbjct  229   TTDTMMGLIHDLVGGGTDTAATTIEWAFQELLKRPNIMEKAQQELDRAIGREGWVKEEDF  288

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWD  1289
             S+LPYIDAIIKETFRLHPLC L+PPHYS EDC VAGY++P+GTTV +N WS+GRN KYWD
Sbjct  289   SKLPYIDAIIKETFRLHPLCALIPPHYSTEDCNVAGYDIPKGTTVYVNAWSLGRNPKYWD  348

Query  1290  NANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLD  1469
                EF PERF+E ++DIKGQ+F LLPFGSGRRKCPGYSLG+K+VRTT+ANLLHGF WKL 
Sbjct  349   RPEEFIPERFIENNIDIKGQNFGLLPFGSGRRKCPGYSLGIKIVRTTMANLLHGFDWKLA  408

Query  1470  GDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             GD+KP+DISMDE YGLTTHPK P+S  +EPRLP H
Sbjct  409   GDMKPEDISMDEIYGLTTHPKNPISLIMEPRLPLH  443



>ref|XP_011079634.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=507

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/487 (53%), Positives = 363/487 (75%), Gaps = 10/487 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             RR+    PPGP+PWP+IGNLNL+G +PH+SLH LSQKYG L+ L+FGS PV+V SS E A
Sbjct  24    RRRKLNLPPGPKPWPVIGNLNLIGPLPHRSLHQLSQKYGPLLHLQFGSFPVVVGSSVEMA  83

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLKT D  FASRP TAA  +T +N SD+TWSPYGP+WR ARK+ L E+F+ ++L+S+E
Sbjct  84    KVFLKTMDVTFASRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYE  143

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R+EE  +L+  L+ + G    VLL+D+L   +L+ ++R+V G +Y  KD      E  
Sbjct  144   YIRVEEMNSLLKSLFKSSGQS--VLLKDYLSTVSLNVISRMVLGKRYLDKD-----NENA  196

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GVIN+GD +PW+S LDLQGYVK+MK   +++++FL +V+++H
Sbjct  197   VVSPEEFKKMLDELFLLNGVINVGDLIPWISFLDLQGYVKRMKIVSKKFDRFLEHVLDEH  256

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                 +  E +  +DMVD+ L++A+DP LE  V L R  +   T D+LAGG +++A TVEW
Sbjct  257   EERRRRVEGYVSRDMVDVLLELAEDPTLE--VKLERHGVKAFTQDLLAGGTESSAVTVEW  314

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEEL+RVIG+ +WV+EKD   LPYI+AI+KET RLHP+  LL P 
Sbjct  315   AIAELLKKPEIFKKATEELNRVIGQNKWVQEKDIPNLPYIEAIVKETMRLHPVAPLLVPR  374

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
             +S EDC VAGY++ +GT VL+NVW+IGR+   W+N  EFCPERF+ K +D+KGQDF LLP
Sbjct  375   FSREDCKVAGYDIKKGTQVLVNVWTIGRDPSLWENPTEFCPERFIGKAIDVKGQDFELLP  434

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FGSGRR CPGY+LG+KV++++LANLLHGF W+L   ++P+D++M+E +GL+T  K PL  
Sbjct  435   FGSGRRMCPGYNLGLKVIQSSLANLLHGFNWELPDHMRPEDLNMEEIFGLSTPRKIPLVA  494

Query  1548  TIEPRLP  1568
              ++PRLP
Sbjct  495   VVKPRLP  501



>gb|ADC34701.1| flavonoid 3' hydroxylase [Actinidia chinensis]
Length=511

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/483 (54%), Positives = 352/483 (73%), Gaps = 12/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+GS+PH+SLH LSQ+YG +M L+FGS PV+V SS   AK FLKT 
Sbjct  35    PPGPKPWPIIGNLNLIGSLPHRSLHDLSQQYGPIMHLRFGSFPVVVGSSVAAAKTFLKTM  94

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  FASRP TAA  HT +N SD+TWSPYG +WR ARK+ L+E+F+ ++L+S+EY+RIEE 
Sbjct  95    DVTFASRPKTAAGKHTTYNYSDITWSPYGAYWRQARKMCLTELFSTKRLESYEYIRIEEM  154

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
              +LI  +Y + GT  P++++D+L   +L+ ++R+V G +Y      L   E   +  +  
Sbjct  155   RSLIKEIYQSAGT--PIMIKDNLSTVSLNVISRMVLGRRY------LDASESSVVTPEDF  206

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLL+GV N+GD +PW+  LDLQG VK+MK   ++++KFL +V+++H    + +
Sbjct  207   KKMLDELFLLNGVFNIGDSIPWIDFLDLQGNVKRMKVVAKKFDKFLEHVLDEHNEKRREE  266

Query  849   E-NFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELF  1025
                F  KDMVD+ LQ+ADDPNL  D+ L R  +   T D+LAGG +++A TVEWA  EL 
Sbjct  267   GVGFVAKDMVDVLLQLADDPNL--DIKLERHGVKAFTQDLLAGGTESSAVTVEWAISELL  324

Query  1026  RKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDC  1205
             +KP I + ATEELDRVIG+ RWVEEKD   LPYI+AI+KET R+HP+  +L P  + EDC
Sbjct  325   KKPKIFKMATEELDRVIGKSRWVEEKDIPNLPYIEAIVKETMRMHPVAPMLVPRLTREDC  384

Query  1206  IVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRR  1385
              V GY++  GT VL+NVW+IGR+ + WD  NEFCPERF+ K +D+KGQDF LLPFGSGRR
Sbjct  385   QVDGYDIQEGTRVLVNVWTIGRDPELWDEPNEFCPERFIGKSIDVKGQDFELLPFGSGRR  444

Query  1386  KCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
              CPGYSLG+KV++ +LANLLHGF W L  ++K  D++MDE +GL+T  K PL+   EPRL
Sbjct  445   MCPGYSLGLKVIQASLANLLHGFTWNLPANMKVDDLNMDEIFGLSTPRKVPLATVAEPRL  504

Query  1566  PTH  1574
             P H
Sbjct  505   PPH  507



>ref|XP_011071968.1| PREDICTED: cytochrome P450 71A1 [Sesamum indicum]
Length=507

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/499 (52%), Positives = 358/499 (72%), Gaps = 11/499 (2%)
 Frame = +3

Query  75    IAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGS  254
             + F++ +  I +RRK    PPGP+PWP+IGNLNL+GS+PH+SLH LSQKYG LM L+FGS
Sbjct  13    LVFVYVLAKILRRRK-LNLPPGPKPWPVIGNLNLIGSLPHKSLHELSQKYGPLMHLQFGS  71

Query  255   KPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLS  431
              PV+V SS E AK+ LKT D  F+SRP TAA  +T +N SD+TWSPYGP+ + ARK+ L+
Sbjct  72    CPVVVGSSVEMAKVILKTMDVNFSSRPRTAAGKYTTYNYSDITWSPYGPYLKQARKMCLT  131

Query  432   EVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYY  611
             E+F+ ++L+S+EY+R+EE  +++  LY + G   P+ L+D+L   TLS ++R+V G KY 
Sbjct  132   ELFSNKRLESYEYIRVEEINSMLKSLYKSSG--QPIFLKDYLSTVTLSVISRMVLGKKYL  189

Query  612   SKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREE  791
              KD      E   + L + +  LD+   L+GVIN+GD +PWLS  DLQGYVK+MK   ++
Sbjct  190   DKD-----NENAVVSLDEFKKMLDELIYLNGVINVGDVIPWLSFFDLQGYVKRMKIVSKK  244

Query  792   YEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLA  971
              ++FL +V+++H    +  E +  +DMVD+ L+ A+DP LE  V + R  +  LT D+LA
Sbjct  245   LDRFLEHVLDEHQERRRKVEGYVSRDMVDVLLEQAEDPTLE--VKMERHNVKALTQDLLA  302

Query  972   GGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETF  1151
             GG +++A TVEWA  EL +KP I +KATEE+DRVIG+ RWV+EKD   LPY++AI+KET 
Sbjct  303   GGTESSAVTVEWAISELLKKPEIFKKATEEIDRVIGQNRWVQEKDMPNLPYVEAIVKETM  362

Query  1152  RLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKD  1331
             RLHP+  LL P    EDC VAGY++ +GT V +N W+IG +   W+N  +FCPERF+EK 
Sbjct  363   RLHPVAPLLMPRLVREDCKVAGYDIKKGTQVFVNTWTIGTDPSLWENPTDFCPERFIEKA  422

Query  1332  VDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAY  1511
             +D KG DF  LPFGSGRR CP YSLGM+V+ ++LANLLHGF WKL   ++P+D++M+E +
Sbjct  423   IDAKGHDFQFLPFGSGRRMCPAYSLGMRVISSSLANLLHGFNWKLPNKMRPEDLNMEEIF  482

Query  1512  GLTTHPKFPLSYTIEPRLP  1568
             GL+T  KFPL+   EPRLP
Sbjct  483   GLSTPRKFPLAAVAEPRLP  501



>ref|XP_010033730.1| PREDICTED: cytochrome P450 71A1-like [Eucalyptus grandis]
 gb|KCW53529.1| hypothetical protein EUGRSUZ_J02808 [Eucalyptus grandis]
Length=509

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 350/482 (73%), Gaps = 11/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+GS+PH+SLH L++ YG LM ++FGS PV+V SS E A+ FLKTH
Sbjct  34    PPGPKPWPIIGNLNLIGSLPHRSLHELTKTYGPLMQVQFGSFPVVVGSSVEMARAFLKTH  93

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F+ RP TAA  +T +N SD+TWSPYGP+WR ARK+ + E+F+ ++L+S+EY+R EE 
Sbjct  94    DVTFSGRPKTAAGKYTTYNYSDITWSPYGPYWRQARKLCIMELFSAKRLESYEYIRTEEL  153

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
             M+L+  LY + G +  + L+DHL   +L+ ++R+V G KY  +       E   +   + 
Sbjct  154   MSLLGSLYVSRGAQ--LTLKDHLTDLSLNVISRMVLGKKYTEET------ENSIVKPDEF  205

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLL+G +N+GD +PWL  LDLQGY+K+MKA  +++++FL +V+++H    +G 
Sbjct  206   KKMLDELFLLNGALNIGDSIPWLDFLDLQGYIKRMKALSKKFDRFLEHVLDEHDERRRGV  265

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
              N+  KDMVD+ LQ ADDPNL  DV L R  + G T D++AGG +++A TVEWA  EL +
Sbjct  266   PNYVAKDMVDVLLQFADDPNL--DVKLERKGVKGFTQDLIAGGTESSAVTVEWAISELLK  323

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             +P I +KATEELDRVIGR+RWV EKD + LPYIDAI KET RLHP+  +L P  + EDC 
Sbjct  324   RPEIFKKATEELDRVIGRDRWVSEKDIANLPYIDAIAKETMRLHPVAPMLVPRMAREDCN  383

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             + GY++P+GT +L+ VW+IGR+ K WD   EF PERFLE D D+KGQ F LLPFGSGRR 
Sbjct  384   INGYDIPKGTRILVLVWTIGRDPKIWDAPEEFRPERFLEHDFDVKGQSFELLPFGSGRRM  443

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV++ +LANLLHGF WKL   +  +D+ M+E +GL+T  K PL    EPRLP
Sbjct  444   CPGYSLGLKVIQASLANLLHGFNWKLPEGMSNEDLDMEEIFGLSTPKKIPLVAVAEPRLP  503

Query  1569  TH  1574
              H
Sbjct  504   EH  505



>ref|XP_004144428.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=503

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/481 (55%), Positives = 353/481 (73%), Gaps = 11/481 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWP+IGNL+L+GS+PHQS+H LS+KYG +M L+FGS PV+V SS E AK+FLKT 
Sbjct  28    PPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLKTQ  87

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F SRP TAA  +T ++ S++TWS YGP+WR ARK+ L E+F+ R+LDS+EY+R EE 
Sbjct  88    DLNFVSRPKTAAGKYTTYDYSNITWSQYGPYWRQARKMCLMELFSARRLDSYEYIRKEEM  147

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
               LI  +Y + G    + ++D+L   +L+ ++R+V G KY       G   G   P  + 
Sbjct  148   NGLIREIYKSCG--EVIKVKDYLFAVSLNVISRMVLGKKYTD-----GSENGIVSP-DEF  199

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLLSGV+N+GD +PW+  LDLQGYVK+MKA  +++++FL  V+++H    KG 
Sbjct  200   KKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLERVLDEHNERRKGV  259

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             EN+  KDMVD+ LQ+ADDP+LE  V L R  I   T D++AGG +++A TVEWA  EL +
Sbjct  260   ENYVAKDMVDVLLQLADDPDLE--VKLERHGIKAFTQDLIAGGTESSAVTVEWAISELLK  317

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I  KA EELDRVIGRERWVEEKD   LPYIDAI KET RLHP+  +L P  + ED  
Sbjct  318   KPEIFNKAREELDRVIGRERWVEEKDIVNLPYIDAIAKETMRLHPVAPMLVPRMAREDSQ  377

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             +AGY++ +GT VL+NVW+IGR+   W++  EF PERF+ K++D+KGQDF LLPFGSGRR 
Sbjct  378   IAGYDIAKGTRVLVNVWTIGRDPTVWEDPLEFKPERFMGKNIDVKGQDFELLPFGSGRRM  437

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGY+LG+KV++++LANLLHGF WKL GD+K +D++MDE +GL+T  KFPL    EPRL 
Sbjct  438   CPGYNLGLKVIQSSLANLLHGFTWKLSGDMKIEDLNMDEVFGLSTPKKFPLDVVAEPRLS  497

Query  1569  T  1571
             +
Sbjct  498   S  498



>gb|ADD84653.1| CYP92A46 [Scoparia dulcis]
Length=507

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/484 (55%), Positives = 344/484 (71%), Gaps = 11/484 (2%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWPIIGN++L+GSIPHQSLH LSQKYGELMLLKFG  PV+VA+SPE AK FLK
Sbjct  32    KHPPGPKPWPIIGNMHLIGSIPHQSLHYLSQKYGELMLLKFGKFPVVVAASPEMAKQFLK  91

Query  306   THDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
              +D  FASRPA AA  +T FN SD+TW+PYGP+WR ARKI L+EV   + + ++E+VR+E
Sbjct  92    IYDTSFASRPALAAGKYTSFNYSDLTWAPYGPYWRQARKIYLTEVLNAKAIKTYEHVRME  151

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             ER    S L+   G    ++LR+ L R+TLSTM+ ++ G   +      G   G ++ L 
Sbjct  152   ERRTFFSRLHSLSGKS--IVLREQLCRYTLSTMSNVIFGRLVFDSHEAKG---GNAVKLD  206

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             +LQ  LDDWF   G +NLGDW+PWL+ +D QGYVK+MKA   ++++F   V   H+A   
Sbjct  207   ELQAMLDDWFFFGGALNLGDWIPWLNYIDPQGYVKRMKALNRKFDRFYTSVFSHHLA---  263

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
               +  APK  +D  L +  DPNL  DV LT + + GL  D+LAGG DT+A TVEWA  EL
Sbjct  264   NRDPSAPKIPLDSLLGMPGDPNL--DVKLTEENVKGLLMDLLAGGTDTSATTVEWAVHEL  321

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              R P +  K  EE+DRV+GR RWVEE+DF QL Y+DA+IKE+ RLHPL T L PH ++ED
Sbjct  322   LRHPHVYSKVKEEIDRVVGRNRWVEEEDFPQLTYLDAVIKESMRLHPLATFLAPHCAMED  381

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
               +AGY++ +GT +L+N WS+GR+ K WDN  +F PERFL +D+DI G +FALLPFGSGR
Sbjct  382   INIAGYDISKGTMILVNTWSLGRDPKVWDNPEKFSPERFLVEDIDILGSNFALLPFGSGR  441

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R+CPGY LG+K+VR+TL+NL+HGF W+L   +  KD+ M+E YGLTT PK  L   +EP 
Sbjct  442   RRCPGYKLGLKLVRSTLSNLVHGFNWRLPEGMTVKDVCMEELYGLTTRPKISLEIILEPS  501

Query  1563  LPTH  1574
             LP H
Sbjct  502   LPLH  505



>ref|XP_010086796.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB23806.1| Cytochrome P450 71A1 [Morus notabilis]
Length=514

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/519 (52%), Positives = 366/519 (71%), Gaps = 12/519 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  +W   A  WL  IA    + +   RR+    PPGP+PWPIIGNLNL+G +PH+S++
Sbjct  1     MEGPTWVSYAAAWLATIAL--ILLSRRLRRRKLNLPPGPKPWPIIGNLNLIGPLPHRSIY  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LSQKYG +M L FGS PV+V SS E AK+FLKTHD  F  RP  AA  +T +N S++TW
Sbjct  59    DLSQKYGPIMQLWFGSFPVVVGSSVEMAKIFLKTHDLTFVGRPKIAAGKYTTYNYSNITW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ L E+F+ R+LDS+EY+R EE  AL+  L++   T+  VLL+D L  
Sbjct  119   SPYGPYWRQARKMCLMELFSARRLDSYEYIRREEMRALLKALFEFSKTEKLVLLKDQLST  178

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G  Y       G      +   + +  LD+ FLLSGV+N+GD +PWL  
Sbjct  179   VSLNVISRMVLGKNYTD-----GSDPNAVVSPDEFKKMLDELFLLSGVLNIGDSIPWLDF  233

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAP--KDMVDIFLQIADDPNLEA  917
             LDLQGY+K+MKA  +++++FL +V+++H    KG +++ P  +DMVD+ LQ+ADDP LE 
Sbjct  234   LDLQGYIKRMKALSKKWDRFLEHVLDEHNERRKGVKDYVPHAQDMVDVLLQLADDPTLE-  292

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V L R  +   T D++AGG +++A TVEWA  EL +KP I +KATEELDRVIGRERWVE
Sbjct  293   -VKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLKKPEIFKKATEELDRVIGRERWVE  351

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             EKD   LPYIDAI KET RLHP+  +L P + ++D  + GY++P+ T VL++VW+IGR+ 
Sbjct  352   EKDIVNLPYIDAIAKETMRLHPVAPMLVPRFCLDDIKINGYDIPKDTRVLVSVWAIGRDP  411

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
               WDN NEF PERF+ KDVD+KGQ+F LLPFGSGRR CPGYSLG+KV++++LANLLHGF 
Sbjct  412   SLWDNPNEFVPERFIGKDVDVKGQNFELLPFGSGRRMCPGYSLGLKVIQSSLANLLHGFT  471

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             W L  ++K +D+ M+E +GL+T  K PL    EPRLP H
Sbjct  472   WNLPPNMKREDLDMNEIFGLSTPKKIPLVAVAEPRLPPH  510



>ref|XP_008652774.1| PREDICTED: cytochrome P450 71A1-like [Zea mays]
 tpg|DAA61659.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=517

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/518 (52%), Positives = 363/518 (70%), Gaps = 8/518 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME+ +W    L  +LA   L K     + R+ Y  PPGP+PWPIIGNL+L+G++PH+S+H
Sbjct  1     MELPTWA-SFLGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLDLVGALPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS+KYG LM L+FGS PV+V SS + AK FLKTHD VF  RP TAA  +T +N  D+TW
Sbjct  60    ELSRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARK+ L+E+F+ ++L+S+EY+R  E   L+  L+ A G+   V+L+D+L  
Sbjct  120   SPYGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRVLLRDLHSASGSGRAVMLKDYLST  179

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ +TR+V G KY   D E       + P ++ +  LD+ FLL+GV+N+GD +PWL  
Sbjct  180   VSLNVITRMVLGKKYL--DREEAAAGAVTTP-EEFKWMLDELFLLNGVLNIGDSIPWLDW  236

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
             +DLQGY+K+MK   + +++FL +V+E+H    +   + F  KDMVD+ LQIADDP LE  
Sbjct  237   MDLQGYIKRMKKLSKMFDRFLEHVVEEHHQRRLSEGKGFVAKDMVDVLLQIADDPTLE--  294

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L R+ +   T D++AGG +++A TVEWA  EL +KP +I KATEELDRVIGR RWV E
Sbjct  295   VELDRESVKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTE  354

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD   LPY+DAI+KET RLHP+  +L P  S ED  VAGY++P GT VL++VWSIGR+  
Sbjct  355   KDIPSLPYVDAIVKETMRLHPVAPMLVPRLSREDTAVAGYDIPAGTRVLVSVWSIGRDPA  414

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              WD   EF PERFL   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W
Sbjct  415   LWDAPEEFMPERFLGSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAW  474

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              L   +  +++SM+E +GL+T  KFPL   ++P+LP H
Sbjct  475   SLPDGVTMEELSMEEIFGLSTPRKFPLEAVVQPKLPAH  512



>ref|XP_002460274.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
 gb|EER96795.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
Length=518

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/506 (53%), Positives = 359/506 (71%), Gaps = 8/506 (2%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQR-RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLL  242
             +LA   L K     +R R+ Y  PPGP+PWPIIGNLNL+G++PH+S+H LS+KYG LM L
Sbjct  13    VLATVMLLKAIIGRRRSRRVYNLPPGPKPWPIIGNLNLVGALPHRSIHELSRKYGPLMQL  72

Query  243   KFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARK  419
             +FGS PV+V SS + AK FLKTHD VF  RP TAA  +T +N  D+TWSPYG +WR ARK
Sbjct  73    RFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYGAYWRQARK  132

Query  420   ILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTG  599
             + L+E+F+ ++L+S+EY+R  E  AL+  L  A G+   V+L+D+L   +L+ +TR+V G
Sbjct  133   MCLTELFSVKRLESYEYIRAAEVRALLRDLNSASGSGRAVMLKDYLSTVSLNVITRMVLG  192

Query  600   NKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKA  779
              KY   D E       + P ++ +  LD+ FLL+GV+N+GD +PWL  +DLQGY+K+MK 
Sbjct  193   KKYL--DREEAAAGSVTTP-EEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMKK  249

Query  780   FREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLT  956
               + +++FL +V+E+H    ++  + F  KDMVD+ LQIADDP LE  V L R+ +   T
Sbjct  250   LGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLE--VELDRESVKAFT  307

Query  957   HDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAI  1136
              D++AGG +++A TVEWA  EL +KP +I KATEELDRVIGR RWV EKD   LPY+DA+
Sbjct  308   QDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMPSLPYVDAV  367

Query  1137  IKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPER  1316
             +KET RLHP+  LL P  + ED  VAGY++P GT VL++VWSIGR+   WD   EF PER
Sbjct  368   VKETMRLHPVAPLLVPRLAREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAPEEFMPER  427

Query  1317  FLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDIS  1496
             FL   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W L   +  +++S
Sbjct  428   FLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPDGVTKEELS  487

Query  1497  MDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             M+E +GL+T  KFPL   +EP+LP H
Sbjct  488   MEEIFGLSTPRKFPLEAVVEPKLPAH  513



>ref|XP_008463991.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=514

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/482 (54%), Positives = 353/482 (73%), Gaps = 10/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWP+IGNL+L+GS+PHQS+H LS+KYG +M L+FGS PV+V SS E AK+FLKT 
Sbjct  37    PPGPKPWPVIGNLHLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLKTQ  96

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F SRP TAA  +T +N SD+TWS YGP+WR ARK+ L E+F+ R+LDS+EY+R EE 
Sbjct  97    DLNFVSRPKTAAGKYTTYNYSDITWSQYGPYWRQARKMCLMELFSARRLDSYEYIRKEEM  156

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
               L+  +Y + G    + ++D+L   +L+ ++R+V G KY  +  E G      +   + 
Sbjct  157   NGLVREIYKSCG--EVIKVKDYLSTVSLNVISRMVLGKKYTDESSENG-----IVSPDEF  209

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLLSGV+N+GD +PW+  LDLQGYVK+MKA  +++++FL +V+++H    KG 
Sbjct  210   KKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLEHVLDEHNERRKGV  269

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             +N+  KDMVD+ LQ+ADDPNLE  V L R  +   T D++AGG +++A TVEWA  EL +
Sbjct  270   QNYVAKDMVDVLLQLADDPNLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLK  327

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
              P I  KA EEL+ VIG+ERWVEEKD   LPYI+AI KET RLHP+  +L P  + EDC 
Sbjct  328   NPEIFNKAIEELNEVIGKERWVEEKDIVNLPYINAIAKETMRLHPVAPMLVPRMAREDCQ  387

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             +AGY++ +GT VL+NVW+IGR+   W N + F P+RF+E  +D+KGQDF LLPFGSGRR 
Sbjct  388   IAGYDIAKGTRVLVNVWTIGRDPTVWRNPHAFDPDRFMESSIDVKGQDFELLPFGSGRRM  447

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV++++LANLLHGF WKL GD++ +D++M+E +GL+T  K+PL    EPRLP
Sbjct  448   CPGYSLGLKVIQSSLANLLHGFNWKLPGDMEKEDLNMEEIFGLSTPKKYPLDAVAEPRLP  507

Query  1569  TH  1574
              H
Sbjct  508   PH  509



>ref|XP_006426678.1| hypothetical protein CICLE_v10025392mg [Citrus clementina]
 gb|ESR39918.1| hypothetical protein CICLE_v10025392mg [Citrus clementina]
Length=512

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 356/482 (74%), Gaps = 10/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNL+L+GS+PH+SLH+LS+KYG +M LKFGS PV+V SS E AK+ LKT 
Sbjct  36    PPGPKPWPIIGNLHLIGSLPHRSLHALSEKYGPIMQLKFGSFPVVVGSSAEMAKVILKTQ  95

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             DA+F+ RP TAA  +T FN SD+TWSPYGP+WR ARKI   E+F+ ++L+SFEY+R++E 
Sbjct  96    DALFSGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKICSMELFSVKRLESFEYIRVQEL  155

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
                ++ LY++ G   P +L+DHL   +L+ ++R+V G KY  K  E        +  ++ 
Sbjct  156   NLFLNRLYESFG--KPTILKDHLSDLSLAIISRMVLGKKYTDKQLE-----NEVVTPQEF  208

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
                +D+ F+L+GV+++GD +PWL  LDLQG +KKMKA  + ++KFL +V+++H A  KG 
Sbjct  209   TAMVDELFMLNGVLDVGDSIPWLGFLDLQGNIKKMKALAKRFDKFLEHVLDEHDARRKGV  268

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             EN+  KDMVD+ LQ+ADDP LE  V + R  + G T D++AGG +++A TVEWA  EL +
Sbjct  269   ENYVAKDMVDVLLQLADDPTLE--VKIERHGVKGFTQDLIAGGTESSAVTVEWAISELMK  326

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I  KATEELDRVIG+ERWVEEKD   LP+IDA++KET RLHP+   L P  + +D  
Sbjct  327   KPEIFNKATEELDRVIGKERWVEEKDIVNLPFIDAVVKETMRLHPVGAFLVPRAARKDSK  386

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++ +GT VL++VW+IGR+   W+N NEF PERF+ K +D+KG DF LLPFG+GRR 
Sbjct  387   VAGYDIQKGTRVLVSVWAIGRDPGLWENPNEFYPERFIGKSIDVKGHDFELLPFGAGRRM  446

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV++T+LANLLHGF WKL G+++ ++++M+E +GL+T  K PL     PRL 
Sbjct  447   CPGYSLGLKVIQTSLANLLHGFAWKLPGNMRNEELNMEETFGLSTPRKIPLEVLAHPRLS  506

Query  1569  TH  1574
              H
Sbjct  507   PH  508



>ref|XP_004956937.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/507 (53%), Positives = 364/507 (72%), Gaps = 9/507 (2%)
 Frame = +3

Query  66    LLAIAFLFK-ITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLL  242
             +LA   L K I    +RR+AY  PPGP+PWPIIGNL+L+G++PH+S+H LS+KYG LM L
Sbjct  13    VLATVMLLKAIVGRRRRRRAYNLPPGPKPWPIIGNLDLMGALPHRSIHELSRKYGPLMQL  72

Query  243   KFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARK  419
             +FGS PV+V SS + AK FLKTHD VF  RP TAA  +T +N  D+TWSPYG +WR ARK
Sbjct  73    QFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYGAYWRQARK  132

Query  420   ILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTG  599
             + L+E+F+ ++L+S+EY+R  E  AL+  L+   G+   V+L+D+L   +L+ +TR+V G
Sbjct  133   MCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGRAVMLKDYLSTVSLNVITRMVLG  192

Query  600   NKYYSKDWELGKPEGYSIPL-KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
              KY  K+   G   G S+   ++ +  LD+ FLL+GV+N+GD +PWL  +DLQGY+K+MK
Sbjct  193   KKYLDKEVAAG---GSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMK  249

Query  777   AFREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL +V+E+H    ++  ++F  KDMVD+ LQIADDP LE  V L R+ +   
Sbjct  250   KLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLE--VELNRESVKAF  307

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
             T D++AGG +++A TVEWA  EL +KP +  KATEELDRVIGR RWV EKD  QLPY+DA
Sbjct  308   TQDLIAGGTESSAVTVEWAISELLKKPEVFAKATEELDRVIGRGRWVTEKDIPQLPYVDA  367

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET RLHP+  +L P  S ED  VAGY++P GT VL++VWSIGR+   WD   +F PE
Sbjct  368   IVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPTLWDTPEQFMPE  427

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDI  1493
             RFL   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W L   L  +++
Sbjct  428   RFLGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPDGLTKEEL  487

Query  1494  SMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +M+E +GL+T  KFPL   +EP+LP H
Sbjct  488   NMEEIFGLSTPRKFPLEAVVEPKLPAH  514



>gb|EAZ09259.1| hypothetical protein OsI_31532 [Oryza sativa Indica Group]
Length=514

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/512 (52%), Positives = 362/512 (71%), Gaps = 16/512 (3%)
 Frame = +3

Query  60    PWLLAIAF-----LFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKY  224
             PW   +A      LF  T + + R+ Y  PPGP+PWP+IGNLNL+G++PH+S+H+LS+KY
Sbjct  7     PWASFVAVVLATVLFLKTVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKKY  66

Query  225   GELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPF  401
             G LM L+FGS PV+V SS E AK FLKTHD VF  RP TAA  HT +N SD+TWSPYG +
Sbjct  67    GPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGAY  126

Query  402   WRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTM  581
             WR ARK+ L+E+F+ ++L+S+EY+R EE  AL+  L+ A G    V+L+D+L   +L+ +
Sbjct  127   WRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAAG--GVVVLKDYLSTVSLNVI  184

Query  582   TRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGY  761
             TR+V G KY  KD       G     ++ +  LD+ FLL+GV+N+GD +PWL  LDLQGY
Sbjct  185   TRMVLGKKYLDKD-----AGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGY  239

Query  762   VKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRD  938
             +K+MK   + +++FL +V+++H    + + E+F  KDMVD+ LQ AD+PNLE  V L R+
Sbjct  240   IKRMKKLGKMFDRFLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLE--VKLKRE  297

Query  939   RIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQL  1118
              +   T D++AGG +++A TVEWA  EL +KP +  KATEELDRV+GR RWV EKD   L
Sbjct  298   GVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSL  357

Query  1119  PYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNAN  1298
              Y+DAI+KET RLHP+  +L P  S ED  V GY++P GT VL++VW+IGR+ K WD   
Sbjct  358   TYVDAIVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPE  417

Query  1299  EFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDL  1478
             EF PERF+   +D+KGQDF LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W+L   +
Sbjct  418   EFMPERFIGNKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGV  477

Query  1479  KPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
               + +SM+E +GL+T  KFPL   +EP+LP H
Sbjct  478   TREQLSMEEIFGLSTPRKFPLEAVVEPKLPAH  509



>gb|KHF98582.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/517 (50%), Positives = 365/517 (71%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  SW      WL A   L  ++   +R +    PPGP+PWPIIGNLNL+GS+PHQS+H
Sbjct  1     METTSWIAYLTAWL-ATLALILLSLHLRRCRKLNLPPGPKPWPIIGNLNLIGSLPHQSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             +LSQKYG +M LKFGS P++VASS E AK  LKT+DA+F+ RP TAA  +T +N SD+TW
Sbjct  60    ALSQKYGPIMQLKFGSFPIVVASSVEMAKAILKTNDAIFSDRPKTAAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             S YGP+WR ARK+ L+E+F+ ++L+S+EY+R EER  L+  LY++ GT+  ++L++HL+ 
Sbjct  120   SSYGPYWRQARKMCLTELFSAKRLESYEYIRKEERNLLLKRLYESSGTQ--IVLKEHLLS  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
               L+ ++R+V G KY       G  +   +   +    L++ F L+GV+++GD +PWLS 
Sbjct  178   LNLNVISRMVFGKKYTE-----GTGKNEIVTPNEFNEMLNELFFLNGVLDIGDSIPWLSF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGY+K+MKA  +++++FL +V+++H A  K  +++  KDMVD+ LQ++++PNLE  V
Sbjct  233   LDLQGYIKRMKALSKKFDRFLEHVLDEHNARRKRVKDYVAKDMVDVLLQLSEEPNLE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   + D++A G D++A TVEWA  EL RKP I+ KA EELD+VIGRE+WV EK
Sbjct  291   KLERHGVKAFSQDIIAAGTDSSAVTVEWAITELLRKPEILAKAMEELDKVIGREQWVGEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPYI +I KE  RLHP+  +L PH + +DC +AGY++P+GT  L+N+W+IGR+   
Sbjct  351   DIGNLPYIKSIAKEAMRLHPVAPMLVPHVASQDCEIAGYDIPKGTRALVNIWTIGRDPNL  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD  NEF P+RF+ K +D+KG DF LLPFGSGRRKCPGY L +KV++ +LAN+LHGF WK
Sbjct  411   WDKPNEFWPDRFIGKSIDVKGHDFELLPFGSGRRKCPGYPLAIKVIQASLANILHGFNWK  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L       D++M+E +GL+T  K PL    EPRLP H
Sbjct  471   LPAKTTKDDLNMEELFGLSTSKKHPLVVVAEPRLPLH  507



>gb|ABG74350.1| cytochrome P450 [Capsicum chinense]
Length=509

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/487 (53%), Positives = 356/487 (73%), Gaps = 11/487 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R+K    PPGP+PWPIIGNL+L+G++PH+S+H LS KYG ++ L+FGS PV+V SS E A
Sbjct  27    RQKKLNLPPGPKPWPIIGNLHLMGNLPHRSIHELSVKYGPILQLQFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  HT +N SD+TWSPYG +WR AR++ L+E+F+ ++LDS+E
Sbjct  87    KIFLKSMDINFVGRPKTAAGKHTTYNYSDITWSPYGSYWRQARRMCLTELFSAKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE   ++  L    G   P+LL+D+L   +L+ ++R+V G +Y      L + +  
Sbjct  147   YIRAEELHLILRNLNKLSG--KPILLKDYLTTLSLNVISRMVLGKRY------LDESKNS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD +PWL  +DLQGYVK+MK   ++++KFL +V+++H
Sbjct  199   IVTPEEFKKMLDELFLLNGVLNIGDSIPWLGFMDLQGYVKRMKVLSKKFDKFLEHVLDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                 K  EN+  KDMVD+ LQ+ADDP+LE  + L R  +   T D+LAGG +++A TVEW
Sbjct  259   NVRRKAVENYVAKDMVDVLLQLADDPSLE--IKLERHGVKAFTQDLLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL ++P II+KATEELDRVIG+ RWV+EKD   LPYI+A++KET RLHP+  +L P 
Sbjct  317   AISELLKRPDIIKKATEELDRVIGQNRWVQEKDIPNLPYIEAVVKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                EDC VAGY+V +GT VL++VW+IGR+   WD    F PERFLEK +D+KG DF LLP
Sbjct  377   ECREDCKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEAFEPERFLEKSIDVKGHDFELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGYSLG+KV++ +LANLLHGFKW L  ++ P+D++M+E +GL+T  KFPLS 
Sbjct  437   FGAGRRMCPGYSLGLKVIQASLANLLHGFKWSLPDNMTPEDLNMEEIFGLSTPKKFPLSA  496

Query  1548  TIEPRLP  1568
              IEPRLP
Sbjct  497   MIEPRLP  503



>ref|XP_006465907.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=512

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 356/482 (74%), Gaps = 10/482 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNL+L+GS+PH+SLH+LS+KYG +M LKFGS PV+V SS E AK+ LKT 
Sbjct  36    PPGPKPWPIIGNLHLIGSLPHRSLHALSEKYGPIMQLKFGSFPVVVGSSAEMAKVILKTQ  95

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             DA+F+ RP TAA  +T FN SD+TWSPYGP+WR ARKI   E+F+ ++L+SFEY+R++E 
Sbjct  96    DALFSGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKICSMELFSVKRLESFEYIRVQEL  155

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
                ++ LY++ G   P +L+DHL   +L+ ++R+V G KY  K  E        +  ++ 
Sbjct  156   NLFLNRLYESFG--KPTILKDHLSDLSLAIISRMVLGKKYTDKQLE-----NEVVTPQEF  208

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
                +D+ F+L+GV+++GD +PWL  LDLQG +KKMKA  ++++KFL +V+++H A  KG 
Sbjct  209   TAMVDELFMLNGVLDVGDSIPWLGFLDLQGNIKKMKALAKKFDKFLEHVLDEHDARRKGV  268

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             EN+  KDMVD+ LQ+ADDP LE  V + R  + G T D++AGG +++A TVEWA  EL +
Sbjct  269   ENYVAKDMVDVLLQLADDPTLE--VKIERHGVKGFTQDLIAGGTESSAVTVEWAISELMK  326

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I  KATEELDRVIG+ERWVEEKD   LP+IDAI+KET RLHP+   L P  + +D  
Sbjct  327   KPEIFNKATEELDRVIGKERWVEEKDIVNLPFIDAIVKETMRLHPVGAFLVPRAARKDSK  386

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++ +GT VL++VW+IGR+   W+N  EF PERF+ K +D+KG DF LLPFG+GRR 
Sbjct  387   VAGYDIQKGTRVLVSVWAIGRDPGLWENPIEFYPERFIGKSIDVKGHDFELLPFGAGRRM  446

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGYSLG+KV++T+LANLLHGF WKL G+++ ++++M+E +GL+T  K PL     PRL 
Sbjct  447   CPGYSLGLKVIQTSLANLLHGFAWKLPGNMRNEELNMEETFGLSTPRKIPLEVLAHPRLS  506

Query  1569  TH  1574
              H
Sbjct  507   PH  508



>ref|NP_001063285.1| Os09g0441400 [Oryza sativa Japonica Group]
 dbj|BAD36161.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38066.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF25199.1| Os09g0441400 [Oryza sativa Japonica Group]
Length=514

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/499 (53%), Positives = 357/499 (72%), Gaps = 11/499 (2%)
 Frame = +3

Query  84    LFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPV  263
             LF    + + R+ Y  PPGP+PWP+IGNLNL+G++PH+S+H+LS+KYG LM L+FGS PV
Sbjct  20    LFLKAVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKKYGPLMYLRFGSFPV  79

Query  264   IVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVF  440
             +V SS E AK FLKTHD VF  RP TAA  HT +N SD+TWSPYG +WR ARK+ L+E+F
Sbjct  80    VVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGAYWRQARKMCLTELF  139

Query  441   TPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKD  620
             + ++L+S+EY+R EE  AL+  L+ A G    V+L+D+L   +L+ +TR+V G KY  KD
Sbjct  140   SAKRLESYEYIRGEEVRALLRDLHGAAG--GVVVLKDYLSTVSLNVITRMVLGKKYLDKD  197

Query  621   WELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEK  800
                    G     ++ +  LD+ FLL+GV+N+GD +PWL  LDLQGY+K+MK   + +++
Sbjct  198   -----AGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYIKRMKKLGKMFDR  252

Query  801   FLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGG  977
             FL +V+++H    + + E+F  KDMVD+ LQ AD+PNLE  V L R+ +   T D++AGG
Sbjct  253   FLEHVVDEHNERRRREGESFVAKDMVDVLLQFADNPNLE--VKLKREGVKAFTQDLIAGG  310

Query  978   EDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRL  1157
              +++A TVEWA  EL +KP +  KATEELDRV+GR RWV EKD   L Y+DAI+KET RL
Sbjct  311   TESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLTYVDAIVKETMRL  370

Query  1158  HPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVD  1337
             HP+  +L P  S ED  V GY++P GT VL++VW+IGR+ K WD   EF PERF+   +D
Sbjct  371   HPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEEFMPERFIGNKID  430

Query  1338  IKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGL  1517
             +KGQDF LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W+L   +  + +SM+E +GL
Sbjct  431   VKGQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVTREQLSMEEIFGL  490

Query  1518  TTHPKFPLSYTIEPRLPTH  1574
             +T  KFPL   +EP+LP H
Sbjct  491   STPRKFPLEAVVEPKLPAH  509



>gb|EAZ09260.1| hypothetical protein OsI_31533 [Oryza sativa Indica Group]
Length=518

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/517 (51%), Positives = 362/517 (70%), Gaps = 8/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME   W       L  I    +   +   R+ Y  PPGP+PWPIIGNLNL+GS+PH+S+H
Sbjct  1     MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH  60

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             SLS+KYG LM L+FGS PV+V SS E AK FLKTHD VFA RP TAA  HT +N SDMTW
Sbjct  61    SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW  120

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARK+ L+E+F+ ++++S+E++R EE  AL+  L+ A G    V L+D+L  
Sbjct  121   SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASG--RVVALKDYLSA  178

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY  ++  + + E  + P ++ +  +D+ FLL+GV+++GD +PWL  
Sbjct  179   ASLNVISRMVLGKKYLERE-VVHEGEVVTTP-ERFRWMIDELFLLNGVLDIGDSIPWLGW  236

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
             LDLQGY+++MK   + +++FL YV+++H   M +  E+F  KDMVD  L +A DP+LE  
Sbjct  237   LDLQGYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDALLNVASDPSLE--  294

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V  +RD +   T D++AGG ++++ATV+WA  EL RKP +  KATEELDRV+GR RWV E
Sbjct  295   VKFSRDSVKAFTQDLIAGGTESSSATVDWAIAELLRKPEVFAKATEELDRVVGRGRWVTE  354

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD   LPYIDAI+KET R+HP+  +L P  S ED  V GY++P GT VL+ VWSIGR+ K
Sbjct  355   KDIPSLPYIDAIMKETMRMHPVAPMLAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPK  414

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              WD   EF PERF+   +D+KGQDF LLPFGSGRR CPGYSLG++V++ +LANLLHGF W
Sbjct  415   LWDAPEEFMPERFIGSKIDVKGQDFELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAW  474

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPT  1571
             +L   +  + +SM+E +GL+T  KFPL   +EP+LP 
Sbjct  475   RLPDGMTKEQLSMEEIFGLSTPRKFPLEVVVEPKLPA  511



>dbj|BAD36162.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38067.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
Length=518

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/517 (51%), Positives = 362/517 (70%), Gaps = 8/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME   W       L  I    +   +   R+ Y  PPGP+PWPIIGNLNL+GS+PH+S+H
Sbjct  1     MEFLLWVSYLTITLATILLFLRTLILRHNRRVYNLPPGPKPWPIIGNLNLMGSLPHRSIH  60

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             SLS+KYG LM L+FGS PV+V SS E AK FLKTHD VFA RP TAA  HT +N SDMTW
Sbjct  61    SLSKKYGPLMHLRFGSFPVVVGSSVEMAKFFLKTHDVVFADRPKTAAGKHTTYNYSDMTW  120

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARK+ L+E+F+ ++++S+E++R EE  AL+  L+ A G    V L+D+L  
Sbjct  121   SPYGAYWRQARKVCLAELFSAKRIESYEHIRREEVRALLRDLHAASG--RVVALKDYLSA  178

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY  ++  + + E  + P ++ +  +D+ FLL+GV+++GD +PWL  
Sbjct  179   ASLNVISRMVLGKKYLERE-VVHEGEVVTTP-ERFRWMIDELFLLNGVLDIGDSIPWLGW  236

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDH-MAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
             LDLQGY+++MK   + +++FL YV+++H   M +  E+F  KDMVD+ L +A DP+LE  
Sbjct  237   LDLQGYIRRMKKLSKMFDQFLEYVLDEHENRMCREGESFVAKDMVDVLLNVASDPSLE--  294

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V  +RD +   T D++AGG ++++ATV+WA  EL RKP +  K TEELDRV+GR RWV E
Sbjct  295   VKFSRDSVKAFTQDLIAGGTESSSATVDWAIAELLRKPEVFAKVTEELDRVVGRGRWVTE  354

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD   LPYIDAI+KET R+HP+  +L P  S ED  V GY++P GT VL+ VWSIGR+ K
Sbjct  355   KDIPSLPYIDAIMKETMRMHPVAPMLAPRLSREDTSVDGYDIPAGTRVLVGVWSIGRDPK  414

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              WD   EF PERF+   +D+KGQDF LLPFGSGRR CPGYSLG++V++ +LANLLHGF W
Sbjct  415   LWDAPEEFMPERFIGSKIDVKGQDFELLPFGSGRRMCPGYSLGLRVIQVSLANLLHGFAW  474

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPT  1571
             +L   +  + +SM+E +GL+T  KFPL   +EP+LP 
Sbjct  475   RLPDGMTKEQLSMEEIFGLSTPRKFPLEVVVEPKLPA  511



>ref|XP_009401319.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/511 (51%), Positives = 365/511 (71%), Gaps = 16/511 (3%)
 Frame = +3

Query  60    PWLLAIAFLFKIT---TIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGE  230
             PW++    +  I     +  RR+    PPGPR WPIIGNLNL+GS+PH+SLH+LSQKYG 
Sbjct  5     PWVMCSTIILVIVFLRALAGRRRKLNLPPGPRAWPIIGNLNLIGSLPHRSLHALSQKYGP  64

Query  231   LMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWR  407
             +M L+FGS PV+V SS E AK FLKTHD  F SRP TAA  +T +N SD+TWSPYGP+WR
Sbjct  65    IMYLRFGSFPVVVGSSVEMAKFFLKTHDVSFVSRPKTAAGKYTTYNYSDITWSPYGPYWR  124

Query  408   HARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTR  587
              ARK+ L E+F+ ++L+S+EY+R+EE  AL+  L+ + G    VLL+DHL   +L+ ++R
Sbjct  125   QARKMCLLELFSAKRLESYEYIRVEEVRALLRDLFRSSG--GIVLLKDHLSTVSLNVISR  182

Query  588   LVTGNKYYSKDWELGKPEGYSI-PLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYV  764
             +V G KY      L + E  +I   ++ +  LD+ FLL+GV+N+GD +PWL GLDLQGY+
Sbjct  183   MVLGKKY------LDRTEVAAIVSPEEFKEMLDELFLLNGVMNIGDSIPWLDGLDLQGYI  236

Query  765   KKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDR  941
             ++MK   +++++FL +V+++H    + + E F  +DMVD+ LQ+ADDPNL  DV L R  
Sbjct  237   RRMKKLSKKFDRFLEHVLDEHNERRQREGEGFVARDMVDVLLQLADDPNL--DVKLERHG  294

Query  942   IMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLP  1121
             +   T D++AGG +++A TVEWA  EL  +P ++EKATEELDRV+GR RWVEE+D S+LP
Sbjct  295   VKAFTQDLIAGGTESSAVTVEWAISELLMRPEVLEKATEELDRVVGRGRWVEERDVSRLP  354

Query  1122  YIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANE  1301
             Y++AI+KET RLHP+  +L P  S E   V GY++P G  VL++VW+IGR+   WD   E
Sbjct  355   YVEAIVKETMRLHPVAPMLVPRLSREHTTVDGYDIPAGARVLVSVWAIGRDPSVWDAPEE  414

Query  1302  FCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLK  1481
             F PERF+   +D+KG DF LLPFG+GRR CPGYSLG+KV++ +LANLLHGF+W+L   +K
Sbjct  415   FRPERFVGSQIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQLSLANLLHGFEWRLPAGMK  474

Query  1482  PKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              +++SM+E +GL+T  K PL   ++P+L  H
Sbjct  475   AEELSMEEIFGLSTPRKVPLEVVVKPKLSAH  505



>ref|XP_004510480.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=511

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/485 (52%), Positives = 357/485 (74%), Gaps = 11/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGN NL+G +PHQS+H L+QKYG +M L+FGSKPVIV S+ + A+ FL
Sbjct  33    YNLPPGPKPWPIIGNFNLIGPLPHQSIHGLTQKYGPMMYLRFGSKPVIVGSTVKIAQAFL  92

Query  303   KTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  +A  +T +N SD+TWS YGP+WR AR++ L E+F+ ++L+S+EY+R 
Sbjct  93    KTHDAALAGRPNLSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIRK  152

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E   L+ GL+++      +LL+DHL   +L+ ++R+V G KY      L + E   I  
Sbjct  153   QELRVLLHGLFNS--KNKTILLKDHLTTLSLNVISRMVLGKKY------LEETENAIISP  204

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
              + +  LD+ FLL+GV+N+GD++PW+  LDLQGYVK+MK   +++++F+ +V+E+H+   
Sbjct  205   DEFKKMLDELFLLNGVLNIGDFIPWIHFLDLQGYVKRMKTLGKKFDRFMEHVLEEHIERR  264

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             K  ++F  KDMVD+ LQ+ADDP+LE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  265   KNVKDFVAKDMVDVLLQLADDPDLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISE  322

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L ++P I +KAT+ELD+VIG++RWVEEKD   LPY+ AI KET RLHP+  +L P  + E
Sbjct  323   LVKRPEIFKKATDELDKVIGKDRWVEEKDIVNLPYVYAIAKETMRLHPVAPMLVPRQARE  382

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC V GY++P+G+ +L+N W+IGR+S  W+N  EF PERFL+KD+D+KG DF LLPFG+G
Sbjct  383   DCNVDGYDIPKGSLILVNTWTIGRDSNIWENPYEFMPERFLDKDIDVKGHDFELLPFGAG  442

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++++LANLLHG+ WKL  ++K +D++M+E +GL+T  K PL   +EP
Sbjct  443   RRMCPGYPLGIKVIQSSLANLLHGYNWKLPNNVKKEDLNMEEVFGLSTPKKIPLQVVVEP  502

Query  1560  RLPTH  1574
             RLP H
Sbjct  503   RLPHH  507



>emb|CBI35858.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/517 (52%), Positives = 355/517 (69%), Gaps = 45/517 (9%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  +W      WL  +A +   T + +RRK    PPGP+PWPIIGNLNL+G++PH+S+H
Sbjct  1     MESGTWASYVAAWLATVALILLSTHLRRRRK-LNLPPGPKPWPIIGNLNLIGALPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTW  383
              LSQKYG +M L+FGS PV+V SS   AKLFLKTHD  FASRP TAA  + T+N SD+TW
Sbjct  60    ELSQKYGPIMQLRFGSFPVVVGSSVAMAKLFLKTHDVTFASRPKTAAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARK+ L E+F+ R+L+S+EY+R+EE  +L+S LY    + +PV L+DHL  
Sbjct  120   SPYGPYWRQARKMCLMELFSARRLESYEYIRVEETKSLLSSLYKQ--SNSPVDLKDHLST  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY  ++      EG  +  ++ +  LD+ FLLSGV+N+GD +PW+  
Sbjct  178   VSLNVISRMVLGKKYLDEN-----VEGSIVTPEEFKKMLDELFLLSGVLNIGDSIPWIDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK   +++++FL +V+++H A  KG EN+  KDMVD+ LQ ADDP LE  V
Sbjct  233   LDLQGYVKRMKVLSKKFDRFLEHVLDEHNARRKGVENYVAKDMVDVLLQFADDPTLE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   T D++AGG +++A TVEWA  EL RKP + +KATEELDRVIG+ERWVEEK
Sbjct  291   KLERHGVKAFTQDLIAGGTESSAVTVEWAISELLRKPELFDKATEELDRVIGKERWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPY+D I+KET R+HP+  +L                                   
Sbjct  351   DIPNLPYLDTIVKETMRMHPVAPML----------------------------------I  376

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WD  NEF PERF+ K++D+KGQDF LLPFG+GRR CPGYSLG+KV++++LANLLHGFKWK
Sbjct  377   WDQPNEFIPERFIGKNIDVKGQDFELLPFGTGRRMCPGYSLGLKVIQSSLANLLHGFKWK  436

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L GD+KP D+SM+E +GL+T  K PL    EPRLP H
Sbjct  437   LPGDMKPGDLSMEEIFGLSTPKKIPLVAMAEPRLPAH  473



>ref|XP_006665048.1| PREDICTED: cytochrome P450 71A1-like [Oryza brachyantha]
Length=517

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/505 (52%), Positives = 360/505 (71%), Gaps = 9/505 (2%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +LA   L K     + R+ Y  PPGP+PWP+IGNLNL+G++PH+S+H LS++YG +M L+
Sbjct  15    VLATVLLLK-AVFGRGRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHELSKRYGPIMSLR  73

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS PV+V SS E AK FLKTHD VF  RP TAA  +T +N SD+TWS YG +WR ARK+
Sbjct  74    FGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKYTTYNYSDITWSSYGAYWRQARKM  133

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGN  602
              L+E+F+ ++L+S+EY+R EE  AL+  L+ A G    V+L+D+L   +L+ +TR+V G 
Sbjct  134   CLTELFSAKRLESYEYIRAEEVSALLRDLHGAAG--GVVMLKDYLSTVSLNVITRMVLGK  191

Query  603   KYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAF  782
             KY  K  E     G     ++ +  LD+ FLL+GV+N+GD +PWL  LDLQGY+K+MK  
Sbjct  192   KYLDK--ETTAQNGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYIKRMKKL  249

Query  783   REEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTH  959
              + +++FL +V+++H    + + ++F  KDMVD+ LQ ADDPNLE  V L R+ +   T 
Sbjct  250   SKMFDRFLEHVVDEHNERRRLEGQSFVAKDMVDVLLQFADDPNLE--VKLKREGVKAFTQ  307

Query  960   DMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAII  1139
             D++AGG +++A TVEWA  EL +KP +  +ATEELDRVIGR+RWV EKD   LPYIDAI+
Sbjct  308   DLIAGGTESSAVTVEWALSELLKKPEVFTRATEELDRVIGRDRWVTEKDIPNLPYIDAIV  367

Query  1140  KETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERF  1319
             KET R+HP+  +L P  S ED  + GY++P GT VL++VWSIGR+ K WD   EF PERF
Sbjct  368   KETMRMHPVAPMLVPRLSREDTSIDGYDIPAGTRVLVSVWSIGRDPKLWDAPEEFMPERF  427

Query  1320  LEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISM  1499
             +   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGFKW+L   +  K++SM
Sbjct  428   IGNKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFKWRLPDGMTRKNLSM  487

Query  1500  DEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +E +GL+T  KFPL   +EP+L  H
Sbjct  488   EEIFGLSTPRKFPLEAIVEPKLSAH  512



>ref|XP_006436412.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
 gb|ESR49652.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
Length=512

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/489 (53%), Positives = 354/489 (72%), Gaps = 13/489 (3%)
 Frame = +3

Query  114   RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAK  293
             R+    PPGP PWPIIGNLNL+GS+PH+S+HSLSQKYG +M L+FGS PV+V SS E AK
Sbjct  31    RRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLRFGSFPVVVGSSVEMAK  90

Query  294   LFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEY  470
             LFLKTHDA FASRP TAA  +T +N SDM W+ YGP+WR ARKI L E+F+P++L+SFE+
Sbjct  91    LFLKTHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKIFLIEIFSPKRLESFEF  150

Query  471   VRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSK-DWELGKPEGY  647
             +R++E    + GLY +  +  PV L+DHL + +L+ ++R+V G  Y  + + +   P+ Y
Sbjct  151   IRVQEIKKFLFGLYKS--SAKPVHLKDHLSKLSLNVISRMVLGKNYTEETEQDFVTPQEY  208

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
             +  L++L       F L+GV+ +GD +PWL  LDLQG++K+MKA  ++ ++F   V+ +H
Sbjct  209   TEMLQEL-------FYLNGVLEIGDSIPWLGFLDLQGHIKRMKALMKKLDRFYELVLHEH  261

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
              A  K    F   DMVD+ LQ+ADDP LE    L RD++  L  D+LAGG +++  T+EW
Sbjct  262   NAKRKSSTGFVASDMVDVLLQLADDPTLE--FKLERDQVKALIQDLLAGGTESSTVTLEW  319

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KAT+ELDRVIGR R VEEKD   LPYIDAI+KET RLHP+  +L P 
Sbjct  320   AISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYIDAIVKETMRLHPVAPMLVPR  379

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
             ++ E+C VAGY++P+ T VL+NVW+IGR+   W+N NEF PERF  K++D+KG DF LLP
Sbjct  380   FARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRPERFFGKEIDVKGHDFELLP  439

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY LG+KV++T+L+NLL  F+WKL GD+K +D+ M+E++GL+T  K PL  
Sbjct  440   FGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKEDLDMEESFGLSTPKKIPLLV  499

Query  1548  TIEPRLPTH  1574
               +PRLP H
Sbjct  500   VPQPRLPIH  508



>ref|XP_004168558.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Cucumis sativus]
Length=508

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 352/481 (73%), Gaps = 11/481 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWP+IGNL+L+GS+PHQS+H LS+KYG +M L+FGS PV+V SS E AK+FLKT 
Sbjct  33    PPGPKPWPLIGNLDLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIFLKTQ  92

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F SRP TAA  +T ++ S++TWS YGP+WR ARK+ L E+F+ ++LDS+EY+R EE 
Sbjct  93    DLNFVSRPKTAAGKYTTYDYSNITWSQYGPYWRQARKMCLMELFSAKRLDSYEYIRKEEM  152

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
               L+  +Y + G    + ++D+L   +L+ ++R+V G KY       G   G   P  + 
Sbjct  153   NGLLGEIYKSCG--EVIKVKDYLSTVSLNVISRMVXGKKYTD-----GSENGIVSP-DEF  204

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLLSGV+N+GD +PW+  LDLQGYVK+MKA  +++++FL  V+++H    KG 
Sbjct  205   KKMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKALSKKFDRFLERVLDEHNERRKGV  264

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             EN+  KDMVD+ LQ+ADDP+LE  V L R  +   T D++AGG +++A TVEWA  EL +
Sbjct  265   ENYVAKDMVDVLLQLADDPDLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLK  322

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP I  KA EELDRVIGRERWVEEKD   LPYIDAI KET RLHP+  +L P  + ED  
Sbjct  323   KPEIFNKAREELDRVIGRERWVEEKDIVNLPYIDAIAKETMRLHPVAPMLVPRMAREDSQ  382

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             +AGY++ +GT VL+NVW+IGR+   W++  EF PERF+ K++D+KGQDF LLPFGSGRR 
Sbjct  383   IAGYDIAKGTRVLVNVWTIGRDPTVWEDPLEFKPERFMGKNIDVKGQDFELLPFGSGRRM  442

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPGY+ G+KV++++LANLLHGF WKL GD+K +D++MDE +GL+T  KFPL    EPRL 
Sbjct  443   CPGYNHGLKVIQSSLANLLHGFTWKLSGDMKIEDLNMDEVFGLSTPKKFPLDVVAEPRLS  502

Query  1569  T  1571
             +
Sbjct  503   S  503



>ref|XP_011046010.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 357/517 (69%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M+ FS     L W+ A+ +L K+      R     PPGP+PWPIIGN +LLG +PHQSLH
Sbjct  1     MDAFSLVVFVLAWVFALLYLPKV--FKSWRNPLNLPPGPKPWPIIGNFDLLGPLPHQSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS KYG+ M L+FGS PV V SS + AK  LKT+D +FASRP TAA  +T +  SD+ W
Sbjct  59    QLSLKYGKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR  RKI L+E+F+ ++L+S+EY+R+EE       LY   G    + L+D+L  
Sbjct  119   APYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLYRNCGKS--IELKDYLSH  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
             +TLS ++R+V G KY+S      + E   + L++ Q  LD+ FLL+GV+N+GDW+PWL  
Sbjct  177   YTLSIISRIVLGKKYFSA----SESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK  +  +++F ++VI++H A  K  +N+ PKDMVD+ LQ+ADDP LE  V
Sbjct  233   LDLQGYVKRMKELKVRFDRFHDHVIDEHNAKRKATKNWQPKDMVDLLLQLADDPELE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LTRD I GLT D++AGG DT A   +W+  EL +KP + ++ T+ELDRVIGR+RWVEEK
Sbjct  291   KLTRDNIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVIGRDRWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D  QLPYI+AI+KE  R+HP   +L PH +++D  V GY++P+GT + IN WS+GR+   
Sbjct  351   DIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTWSMGRDPDL  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             W++  +F PERF  K +DIKG +F LLPFGSGRR CPGY LG K++  +LAN+LHGF W+
Sbjct  411   WEDPEDFRPERFFGKGIDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWE  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L   +KP+D+  DE +GL T  K+P     +PRLP H
Sbjct  471   LPPGMKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLH  507



>ref|XP_010932407.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=513

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/483 (54%), Positives = 351/483 (73%), Gaps = 12/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWP+IGNLNL+GS+PH+SLH+LS KYG LM L FGS PVIVASS + AKL LKTH
Sbjct  37    PPGPKPWPVIGNLNLIGSLPHRSLHALSHKYGPLMHLYFGSFPVIVASSVDMAKLILKTH  96

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F  RP TAA  +T +N S++TWS YG +WR ARK+ + E+F+ R+LDS+EY+R+EE 
Sbjct  97    DVTFCGRPKTAAGRYTTYNYSNITWSQYGAYWRQARKMCVMELFSARRLDSYEYIRVEEA  156

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
               L+  L+++ G   PV L+DHL   +L+ ++R+V G KY      L + E   +  ++ 
Sbjct  157   KNLLRDLFNSSG--RPVNLKDHLSNVSLNVISRMVLGKKY------LDESEDAVVSPEEF  208

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  LD+ FLL+GV+N+GD +PWL  LDLQGY+++MK   +++++FL +V+++H    + +
Sbjct  209   KAMLDELFLLNGVMNIGDSMPWLDFLDLQGYIRRMKKLGKKFDRFLEHVVDEHNERRRRE  268

Query  849   -ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELF  1025
              E F  +DMVD+ LQ+ADDP LE  V L R  +   T DM+AGG +++A TVEWA  EL 
Sbjct  269   GEKFVARDMVDVLLQLADDPTLE--VKLERRGVKAFTQDMIAGGTESSAMTVEWAISELL  326

Query  1026  RKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDC  1205
             ++P I +KATEELDRVIGR RWVEEK+   LPYI+AIIKET R+HP+  +L P    EDC
Sbjct  327   KRPEIFKKATEELDRVIGRHRWVEEKELHHLPYIEAIIKETMRMHPVAPMLVPRQCREDC  386

Query  1206  IVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRR  1385
              VAGY++P GT VL+NVW+IGR+   WD   EF PERF+   +D+KGQDF LLPFGSGRR
Sbjct  387   NVAGYDIPAGTRVLVNVWTIGRDPTIWDAPEEFRPERFIGSTIDVKGQDFELLPFGSGRR  446

Query  1386  KCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
              CPGYSLG+KV++ +LANLLHGF W+L   +K +D+SM+E +GL+T  K PL   +EP+L
Sbjct  447   MCPGYSLGLKVIQVSLANLLHGFAWRLPDGMKVEDLSMEEIFGLSTPRKVPLEVVVEPKL  506

Query  1566  PTH  1574
             P H
Sbjct  507   PVH  509



>gb|KDO48981.1| hypothetical protein CISIN_1g010365mg [Citrus sinensis]
Length=512

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/489 (53%), Positives = 353/489 (72%), Gaps = 13/489 (3%)
 Frame = +3

Query  114   RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAK  293
             R+    PPGP PWPIIGNLNL+GS+PH+S+HSLSQKYG +M L+FGS PV+V SS E AK
Sbjct  31    RRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLRFGSFPVVVGSSVEMAK  90

Query  294   LFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEY  470
             LFLK HDA FASRP TAA  +T +N SDM W+ YGP+WR ARKI L E+F+P++L+SFE+
Sbjct  91    LFLKIHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKIFLIEIFSPKRLESFEF  150

Query  471   VRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSK-DWELGKPEGY  647
             +R++E    + GLY +  +  PV L+DHL + +L+ ++R+V G  Y  + + +   P+ Y
Sbjct  151   IRVQEIKKFLFGLYKS--SAKPVHLKDHLSKLSLNVISRMVLGKNYTEETEQDFVTPQEY  208

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
             +  L++L       F L+GV+ +GD +PWL  LDLQG++K+MKA  ++ ++F   V+ +H
Sbjct  209   TEMLQEL-------FYLNGVLEIGDSIPWLGFLDLQGHIKRMKALMKKLDRFYELVLHEH  261

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
              A  K    F   DMVD+ LQ+ADDP LE    L RD++  L  D+LAGG +++  T+EW
Sbjct  262   NAKRKSSTGFVASDMVDVLLQLADDPTLE--FKLERDQVKALIQDLLAGGTESSTVTLEW  319

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KAT+ELDRVIGR R VEEKD   LPYIDAI+KET RLHP+  +L P 
Sbjct  320   AISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYIDAIVKETMRLHPVAPMLVPR  379

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
             ++ E+C VAGY++P+ T VL+NVW+IGR+   W+N NEF PERF  K++D+KG DF LLP
Sbjct  380   FARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRPERFFGKEIDVKGHDFELLP  439

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY LG+KV++T+L+NLL  F+WKL GD+K +D+ M+E++GL+T  K PL  
Sbjct  440   FGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKEDLDMEESFGLSTPKKIPLLV  499

Query  1548  TIEPRLPTH  1574
               +PRLP H
Sbjct  500   VPQPRLPIH  508



>ref|XP_010239382.1| PREDICTED: cytochrome P450 71A1-like [Brachypodium distachyon]
Length=522

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/499 (53%), Positives = 359/499 (72%), Gaps = 12/499 (2%)
 Frame = +3

Query  99    TIHQRRKA----YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVI  266
             TIH+RR+     Y  PPGP+PWPIIGNLNL+G++PH S+H+L+++YG LM L+FGS PV+
Sbjct  23    TIHRRRRGNQRTYNLPPGPKPWPIIGNLNLIGTLPHHSIHALAKQYGPLMQLRFGSFPVV  82

Query  267   VASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFT  443
             V SS + AK FLKTHDAVF  RP TAA  HT +N SD+TWSPYG +WR ARK+ L+E+F+
Sbjct  83    VGSSVDMAKFFLKTHDAVFIDRPKTAAGKHTGYNYSDITWSPYGAYWRQARKMCLTELFS  142

Query  444   PRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDW  623
              ++L+S+EY+R EE  AL+ GL++A G    V L+D+L   +L+ +TR+V G K Y +D 
Sbjct  143   AKRLESYEYIRSEEMRALLCGLHEASGLGRVVKLKDYLSTLSLNVITRMVMG-KRYQQDN  201

Query  624   ELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKF  803
             E+    G    L++L+  LD+ FLL GV+ +GD +PWL  LDLQGY+K+MK   + +++F
Sbjct  202   EVADQGGSVTTLEELKSMLDELFLLEGVLVIGDSIPWLRWLDLQGYIKRMKKLSKVFDRF  261

Query  804   LNYVIEDH--MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGG  977
             L +V+++H    +++G ++F   DMVD+ L++A DPNLE  V L R  +  +T D++AG 
Sbjct  262   LEHVVDEHNERRLLEG-QSFKATDMVDVLLEVASDPNLE--VKLNRYGVKAITQDLMAGP  318

Query  978   EDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRL  1157
             E T+A TVEWA  E+ +KP +  KATEELDRV+GR RWV EKD   LPY++AI+KET R+
Sbjct  319   E-TSATTVEWAVSEILKKPDVFGKATEELDRVVGRGRWVTEKDIRSLPYVEAIVKETLRM  377

Query  1158  HPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVD  1337
             HP   LL P  S ED  VAGY++P GT VL+N W+I R+   WD   EF PERFL   +D
Sbjct  378   HPGSPLLSPRLSREDASVAGYDIPAGTRVLVNAWTIARDPALWDAPEEFMPERFLGSKID  437

Query  1338  IKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGL  1517
             +KGQDF LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W+L   +  +++SM+E +GL
Sbjct  438   VKGQDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGVTKEELSMEEIFGL  497

Query  1518  TTHPKFPLSYTIEPRLPTH  1574
             +T  KFPL    EP+LP H
Sbjct  498   STPRKFPLEVVAEPKLPGH  516



>ref|XP_003547756.2| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=536

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/485 (52%), Positives = 351/485 (72%), Gaps = 11/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGNLNL+GS+PHQS+H+LS+ YG +M + FGS PV+V SS + AK  L
Sbjct  58    YNLPPGPKPWPIIGNLNLIGSLPHQSIHALSKTYGPIMHVWFGSNPVVVGSSVDMAKAIL  117

Query  303   KTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  AA  +T +N SD+TWS YGP+WR AR++ L E+F+ ++L+ +EY+R 
Sbjct  118   KTHDATLAGRPKFAAGKYTTYNYSDITWSQYGPYWRQARRMCLMELFSAKRLEEYEYIRK  177

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E   L++ L+++      +LL+DHL   +L+ ++R+V G KY      L + E   +  
Sbjct  178   QELRGLLNELFNSANKT--ILLKDHLSNLSLNVISRMVLGKKY------LEESENAVVSP  229

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
                +  LD+ FLL+GV N+GD++PW+  LDLQGY+K+MKA  ++++ F+ +V+++H+   
Sbjct  230   DDFKKMLDELFLLNGVYNIGDFIPWMDFLDLQGYIKRMKALSKKFDMFMEHVLDEHIERK  289

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             KG E++  KDMVD+ LQ+A+DP LE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  290   KGVEDYVAKDMVDVLLQLAEDPTLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAITE  347

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L R+P I +KATEELDRVIGRERWVEEKD   LPY++AI KE  RLHP+  +L P  + E
Sbjct  348   LLRRPEIFKKATEELDRVIGRERWVEEKDIVNLPYVNAIAKEAMRLHPVAPMLVPRLARE  407

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC V GY++P+GT VL+NVW+IGR+   WDN  EF PERFL K++D+KG D+ LLPFG+G
Sbjct  408   DCQVGGYDIPKGTQVLVNVWTIGRDPSIWDNPTEFQPERFLTKEIDVKGHDYELLPFGAG  467

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++ +LANLLHGF W+L  ++K +D++MDE +GL+T  K PL   +EP
Sbjct  468   RRMCPGYPLGLKVIQASLANLLHGFNWRLPDNVKNEDLNMDEIFGLSTPKKIPLETVVEP  527

Query  1560  RLPTH  1574
             RLP H
Sbjct  528   RLPHH  532



>ref|XP_003627305.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
 gb|ABC59081.1| cytochrome P450 monooxygenase CYP92A29 [Medicago truncatula]
 gb|AET01781.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=512

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/485 (52%), Positives = 353/485 (73%), Gaps = 11/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGNLNL+GS+PHQSLH L+QKYG +M L FGSKPVIV ++ E AK FL
Sbjct  34    YNLPPGPKPWPIIGNLNLIGSLPHQSLHGLTQKYGPIMHLYFGSKPVIVGATVELAKSFL  93

Query  303   KTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  +A  +T +N SD+TWS YGP+WR AR++ L E+F+ ++L+S+EY+R 
Sbjct  94    KTHDATLAGRPKLSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIRK  153

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E    +  L+++      +L++DHL   +L+ ++R+V G KY      L K +   I  
Sbjct  154   QEMHDFLHKLFNS--KNKTILVKDHLSTLSLNVISRMVLGKKY------LEKTDNAVISP  205

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
              + +  LD+ FLL+G++N+GD++PW+  LDLQGYVK+MK   +++++F+ +V+E+H+   
Sbjct  206   DEFKKMLDELFLLNGILNIGDFIPWIHFLDLQGYVKRMKTLSKKFDRFMEHVLEEHIERR  265

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             K  +++  KDMVD+ LQ+A+DPNLE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  266   KNVKDYVAKDMVDVLLQLAEDPNLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISE  323

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L RKP I +KATEELDRVIG++RWVEEKD + LPY+ AI KET RLHP+   L P  + E
Sbjct  324   LVRKPEIFKKATEELDRVIGKDRWVEEKDIANLPYVYAIAKETMRLHPVAPFLVPREARE  383

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC V GY++P+GT VL+N W+I R+S+ W+N  EF PERFL KD+D+KG DF LLPFG+G
Sbjct  384   DCKVDGYDIPKGTIVLVNTWTIARDSEVWENPYEFMPERFLGKDIDVKGHDFELLPFGAG  443

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++T+LANLLHGF W L  ++K +D++M+E +GL+T  K PL   +EP
Sbjct  444   RRMCPGYPLGIKVIQTSLANLLHGFNWTLPNNVKKEDLNMEEIFGLSTPKKIPLEIVVEP  503

Query  1560  RLPTH  1574
             RL  H
Sbjct  504   RLADH  508



>ref|XP_009607330.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana tomentosiformis]
Length=509

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/486 (53%), Positives = 351/486 (72%), Gaps = 11/486 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+G++PH+S+H LS KYG +M L+FG+ PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPIMQLQFGTFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  +T +N SD+TWSPYGP+WR AR++ L E+F+P++LDS+E
Sbjct  87    KVFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLMELFSPKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  L    G   P++L+D+L   +L+ ++R+V G +Y      L + E  
Sbjct  147   YIRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRY------LDESENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
                 ++ +  LD+ FLL+GV+N+GD +PW+  +DLQGYVK+MK   ++++KFL +VI++H
Sbjct  199   IATPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKFVSKKFDKFLEHVIDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                  G EN+  KDMVD+ LQ+ADDP LE  V L R  +   T DMLAGG +++A TVEW
Sbjct  259   NVRRNGVENYIAKDMVDVLLQLADDPTLE--VKLERHGVKAFTQDMLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD   LPYI+AI+KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                EDC VAGY+V +GT VL++VW+IGR+   WD    F PERF EK +D+KG DF LLP
Sbjct  377   ECREDCKVAGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPERFHEKSIDVKGHDFELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY+LG+KV++ +LANL+HGF W L  ++ P+D+ MDE +GL+T  KFPL+ 
Sbjct  437   FGAGRRMCPGYNLGLKVIQASLANLIHGFNWSLPDNMTPEDLDMDEIFGLSTPKKFPLAT  496

Query  1548  TIEPRL  1565
              IEPRL
Sbjct  497   VIEPRL  502



>ref|XP_004235547.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=506

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/519 (51%), Positives = 360/519 (69%), Gaps = 22/519 (4%)
 Frame = +3

Query  27    MEVFSW---FFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQ  197
             ME  SW   F   L  LL   +LF+        +    PPGP+PWPIIGNLNL+GS+PH+
Sbjct  1     MEGSSWTAVFLATLFVLLLSKYLFQ--------RKLNLPPGPKPWPIIGNLNLIGSLPHR  52

Query  198   SLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSD  374
             S+H LS KYG +M L+FGS PV+V SS E AK+FLKT D  F  RP TAA  +T +N SD
Sbjct  53    SIHDLSVKYGPIMQLQFGSFPVVVGSSVEMAKVFLKTMDINFVGRPKTAAGKYTTYNYSD  112

Query  375   MTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDH  554
             +TWSPYG +WR AR++ L E+F+ ++LDS+EY+R EE  +++  L    G   P+LL+D+
Sbjct  113   ITWSPYGSYWRQARRMCLMELFSAKRLDSYEYIRAEELHSILHNLKKTSG--KPILLKDY  170

Query  555   LVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPW  734
             L   +L+ ++R+V G  Y      L + +   +   + +  LD+ FLL+GV+N+GD +PW
Sbjct  171   LTTLSLNVISRMVLGKSY------LDESKNSIVTPDEFKKMLDELFLLNGVLNIGDSIPW  224

Query  735   LSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLE  914
             L  +DLQGYVK+MK   ++++KFL +V+++H       EN+  +DMVD+ LQ+ADDP LE
Sbjct  225   LDFMDLQGYVKRMKVVSKKFDKFLEHVLDEHNVRRNAVENYVAEDMVDVLLQLADDPTLE  284

Query  915   ADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWV  1094
               + L R  +   T DMLAGG +++A TVEWA  EL +KP I +KATEELDRVIG+ RWV
Sbjct  285   --IKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKKPEIFKKATEELDRVIGQNRWV  342

Query  1095  EEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRN  1274
             +EKD   LPYI+AI KET RLHP+  +L P    EDC VAGY++P+GT VL++VW+IGR+
Sbjct  343   QEKDIPNLPYIEAIAKETMRLHPVAPMLVPRECREDCKVAGYDIPKGTRVLVSVWTIGRD  402

Query  1275  SKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGF  1454
                WD    F PERFLEK +D+KG DF LLPFG+GRR CPGYSLG+KV++ +LANLLHGF
Sbjct  403   PTLWDEPEAFKPERFLEKSIDVKGHDFELLPFGAGRRMCPGYSLGLKVIQASLANLLHGF  462

Query  1455  KWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPT  1571
              W L  +  P++++M+E +GL+T  KFPLS  +EPRLP+
Sbjct  463   NWSLPDNRTPEELNMEEIFGLSTPKKFPLSTVVEPRLPS  501



>gb|AAK62346.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=509

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/486 (53%), Positives = 351/486 (72%), Gaps = 11/486 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+G++PH+S+H LS KYG +M L+FG+ PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPIMQLQFGTFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  +T +N SD+TWSPYGP+WR AR++ L E+F+ ++LDS+E
Sbjct  87    KVFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLMELFSTKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  L    G   P++L+D+L   +L+ ++R+V G +Y      L + E  
Sbjct  147   YIRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRY------LDESENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD +PW+  +DLQGYVK+MK   ++++KFL +VI++H
Sbjct  199   IVTPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKFVSKKFDKFLEHVIDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                  G EN+  KDMVD+ LQ+ADDP LE  V L R  +   T DMLAGG +++A TVEW
Sbjct  259   NVRRNGVENYIAKDMVDVLLQLADDPTLE--VKLERHGVKAFTQDMLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD   LPYI+AI+KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                EDC VAGY+V +GT VL++VW+IGR+   WD    F PERF EK +D+KG DF LLP
Sbjct  377   ECREDCKVAGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPERFHEKSIDVKGHDFELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY+LG+KV++ +LANL+HGF W L  ++ P+D+ MDE +GL+T  KFPL+ 
Sbjct  437   FGAGRRMCPGYNLGLKVIQASLANLIHGFNWSLPDNMTPEDLDMDEIFGLSTPKKFPLAT  496

Query  1548  TIEPRL  1565
              IEPRL
Sbjct  497   VIEPRL  502



>gb|ABC69383.1| CYP92A2v4 [Nicotiana tabacum]
Length=509

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/486 (53%), Positives = 352/486 (72%), Gaps = 11/486 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+G++PH+S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  +T +N SD+TWSPYGP+WR AR++ L+E+F+ ++LDS+E
Sbjct  87    KIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  L    G   P++L+D+L   +L+ ++R+V G +Y      L + E  
Sbjct  147   YIRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRY------LDESENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD +PW+  +DLQGYVK+MK   ++++KFL +VI++H
Sbjct  199   FVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                  G EN+  KDMVD+ LQ+ADDP LE  V L R  +   T DMLAGG +++A TVEW
Sbjct  259   NIRRNGVENYVAKDMVDVLLQLADDPKLE--VKLERHGVKAFTQDMLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD   LPYI+AI+KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                ED  VAGY+V +GT VL++VW+IGR+   WD    F PERF EK +D+KG D+ LLP
Sbjct  377   ECREDIKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKSIDVKGHDYELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGYSLG+KV++ +LANLLHGF W L  ++ P+D++MDE +GL+T  KFPL+ 
Sbjct  437   FGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLAT  496

Query  1548  TIEPRL  1565
              IEPRL
Sbjct  497   VIEPRL  502



>ref|XP_009771565.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana sylvestris]
Length=509

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/486 (53%), Positives = 352/486 (72%), Gaps = 11/486 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+G++PH+S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  +T +N SD+TWSPYGP+WR AR++ L+E+F+ ++LDS+E
Sbjct  87    KIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  L    G   P++L+D+L   +L+ ++R+V G +Y      L + E  
Sbjct  147   YIRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRY------LDESENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD +PW+  +DLQGYVK+MK   ++++KFL +VI++H
Sbjct  199   FVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                  G EN+  KDMVD+ LQ+ADDP LE  V L R  +   T DMLAGG +++A TVEW
Sbjct  259   NIRRNGVENYVAKDMVDVLLQLADDPKLE--VKLERHGVKAFTQDMLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD   LPYI+AI+KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                ED  VAGY+V +GT VL++VW+IGR+   WD    F PERF EK +D+KG D+ LLP
Sbjct  377   ECREDSKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKSIDVKGHDYELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGYSLG+KV++ +LANLLHGF W L  ++ P+D++MDE +GL+T  KFPL+ 
Sbjct  437   FGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLAT  496

Query  1548  TIEPRL  1565
              IEPRL
Sbjct  497   VIEPRL  502



>ref|XP_011039208.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=512

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/489 (52%), Positives = 352/489 (72%), Gaps = 9/489 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             RR+    PPGP+PWPIIGNL+L+G +PH+SL +LS+KYG LM +KFGS PV+V SS E A
Sbjct  28    RRRKLHLPPGPKPWPIIGNLDLMGELPHRSLEALSKKYGSLMQVKFGSHPVVVGSSVEMA  87

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             +  LKTHD   A RP TA+  +T +N  ++TW+ YGP+WR ARK+ L E+F+P++LD FE
Sbjct  88    RAILKTHDLSLAGRPKTASGKYTTYNYQNITWAQYGPYWRQARKLCLMELFSPKRLDQFE  147

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R+EE +  ++ L+   G   PV +RDH    + S ++RLV G KY ++  +    E  
Sbjct  148   YIRVEENLKFLNTLFQKRG--KPVSVRDHFSDLSFSVISRLVLGRKYMAESED----EKD  201

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              + LK+ +  LD+ FLL+GV+ +GD++PWL+ LDLQGY+K+MKA  ++ + F+ + +E+H
Sbjct  202   MLSLKEFKEVLDEMFLLNGVLVIGDFIPWLAFLDLQGYIKRMKAVAKKMDMFMEHALEEH  261

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
              A  KG +++ P+DM+DI LQ+ADDPNLE  V L R  +   T D++ GG +++A T EW
Sbjct  262   HARRKGLKDYEPRDMLDILLQVADDPNLE--VKLDRIGVKAFTQDLINGGTESSAVTTEW  319

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  E+ +KP I +KATEELDRVIGRERWV+E D   LP+I+AI+KET RLHP+  LL P 
Sbjct  320   ALAEIMKKPEIFDKATEELDRVIGRERWVQENDIDNLPFINAIVKETMRLHPVAPLLVPR  379

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
              + ED  +AGY++P+GT VL+N  +IGR+   WD   EFCPERF+ K VD+KG DF LLP
Sbjct  380   LAREDIQIAGYDIPKGTRVLVNASAIGRDPSIWDKPKEFCPERFIGKSVDVKGHDFELLP  439

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY LG+KV++T++ANLLHGFKWKL  ++  KD++M+E +GL+   K PL  
Sbjct  440   FGAGRRICPGYPLGLKVIQTSVANLLHGFKWKLPDNMTAKDLNMEEIFGLSAPRKVPLVA  499

Query  1548  TIEPRLPTH  1574
              +EPRLP+ 
Sbjct  500   VLEPRLPSE  508



>ref|XP_011036442.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=532

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/525 (51%), Positives = 374/525 (71%), Gaps = 10/525 (2%)
 Frame = +3

Query  3     RFDPHTLMMEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLG  182
             +++P T  ME  +W   A  WL  ++ +   + +  RR+    PPGP+PWPIIGNLNL+G
Sbjct  13    QYNPPTSKMETPTWMSYAFAWLATVSLILLASRL--RRRKLNPPPGPKPWPIIGNLNLIG  70

Query  183   SIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-  359
              +PH+SLH+LSQKYG LM +KFGS PV+V SS E AK  LKTHD +F+ RP TAA  +T 
Sbjct  71    ELPHRSLHALSQKYGPLMQVKFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTT  130

Query  360   FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPV  539
             +N SD+TWSPYGP+WR ARK+ L E+F+ ++L+S+EY+R+EE  AL+  L  + G   P+
Sbjct  131   YNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIRVEELRALLKTLNKSSG--RPI  188

Query  540   LLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLG  719
              L+DHL   +L+ ++R+V G KY  K  E  K     +  K++   LD+ FLL+GV+++G
Sbjct  189   NLKDHLADVSLNVISRMVLGKKYTVKSSENEKEIVTPVEFKEM---LDELFLLNGVLDIG  245

Query  720   DWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIAD  899
             D +PW++ LDLQGY+K+MK   ++++KF+ +V+++H A  + D+N+ PKDMVD+ LQ+A 
Sbjct  246   DSIPWIAFLDLQGYIKRMKTLSKKFDKFMEHVLDEHEARRREDKNWEPKDMVDVLLQLAS  305

Query  900   DPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIG  1079
             DPNLE  + L R  +   + D++AGG +++A TVEWA  E+ RKP + EKATEELDRVIG
Sbjct  306   DPNLE--IKLERHGVKAFSQDLIAGGTESSAVTVEWAISEILRKPEVFEKATEELDRVIG  363

Query  1080  RERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVW  1259
             RERWVEEKD   LPYI AI KE  RLHP+  +L P  + ED  + GY++ +G+ VL+NVW
Sbjct  364   RERWVEEKDMVNLPYIYAIAKEVMRLHPVAPMLVPRAAREDININGYDIKKGSRVLVNVW  423

Query  1260  SIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLAN  1439
             +IGR+ K WD  +EF PERF+   +D++G D+ LLPFG+GRR CPGY LG+KV++ TL+N
Sbjct  424   TIGRDPKVWDKPDEFFPERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSN  483

Query  1440  LLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             LLHGFKW+L    K +D++MDE +GL+T  K+PL    EPRLP H
Sbjct  484   LLHGFKWRLPDGQKKEDLNMDEIFGLSTPKKYPLVAVAEPRLPAH  528



>gb|EYU21317.1| hypothetical protein MIMGU_mgv1a004638mg [Erythranthe guttata]
Length=517

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/498 (53%), Positives = 357/498 (72%), Gaps = 15/498 (3%)
 Frame = +3

Query  93    ITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVA  272
             +  + +R K  + PPGP+PWP+IGNLNL+G +PH+SLH LSQKYG LM L+FGS P++V 
Sbjct  23    LAKLFRRPKNLRLPPGPKPWPVIGNLNLIGELPHRSLHHLSQKYGPLMHLRFGSCPIVVG  82

Query  273   SSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPR  449
             SS +TAK+FLKT DA FASRP TAA  +T +N SD+TWSPYGP+WR ARK+ L E+F+ +
Sbjct  83    SSVDTAKIFLKTMDATFASRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAK  142

Query  450   KLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWEL  629
             +L+S+EY+R+EE  +LI  +Y   G   P  L+D L   +L+ ++R+V G +Y  +    
Sbjct  143   RLESYEYIRLEEMNSLIKEVYKTAG--KPFPLKDFLSTVSLNVISRMVLGKRYLDEG---  197

Query  630   GKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLN  809
                E   +  ++ +  +D+ FLL+GV+N+GD +PWL  LDLQGYVK+MK    ++++FL 
Sbjct  198   --NENAVVSPEEFKKMIDELFLLNGVLNVGDLIPWLGFLDLQGYVKRMKIVSRKFDRFLE  255

Query  810   YVIEDHMAMMKGDENFAPK-----DMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAG  974
             +V+++H    +G +  A       DMVD+ L++A+DP LE  V L R  +   T D+LAG
Sbjct  256   HVLDEHEERRRGRKTAAEDCGGGGDMVDLLLELAEDPTLE--VKLERHGVKAFTQDLLAG  313

Query  975   GEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFR  1154
             G +++A TVEWA  E+ +KP I  KATEELDRVIG+  WV+EKD   LPYI+AIIKET R
Sbjct  314   GTESSAVTVEWAISEILKKPKIFIKATEELDRVIGQNNWVKEKDIINLPYIEAIIKETMR  373

Query  1155  LHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDV  1334
             LHP+  +L P  S EDC V GY++ +GT VL+NVW+IGR+   W N NEF PERF+ KD+
Sbjct  374   LHPVAPMLVPRMSREDCKVDGYDIEKGTQVLVNVWTIGRDPAIWVNPNEFWPERFIGKDI  433

Query  1335  DIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYG  1514
             D+KGQDF LLPFGSGRR CPGYSLG+KV++++LANLLHGF WKL  ++KP+D+ MDE +G
Sbjct  434   DVKGQDFELLPFGSGRRMCPGYSLGLKVIQSSLANLLHGFNWKLPDNMKPEDLDMDEIFG  493

Query  1515  LTTHPKFPLSYTIEPRLP  1568
             L+T  K PL   + PRLP
Sbjct  494   LSTPRKVPLVTVVGPRLP  511



>gb|AFK47419.1| unknown [Medicago truncatula]
Length=512

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/485 (52%), Positives = 352/485 (73%), Gaps = 11/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGNLNL+GS+PHQSLH L+QKYG +M L FGSKPVIV ++ E AK FL
Sbjct  34    YNLPPGPKPWPIIGNLNLIGSLPHQSLHGLTQKYGPIMHLYFGSKPVIVGATVELAKSFL  93

Query  303   KTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  +A  +T +N SD+TWS YGP+WR AR++ L E+F+ ++L+S+EY+R 
Sbjct  94    KTHDATLAGRPKLSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIRK  153

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E    +  L+++      +L++DHL   +L+ ++R+V G KY      L K +   I  
Sbjct  154   QEMHDFLHKLFNS--KNKTILVKDHLSTLSLNVISRMVLGKKY------LEKTDNAVISP  205

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
              + +  LD+ FLL+G++N+GD++PW+  LDLQGYVK+MK   +++++F+ +V+E+H+   
Sbjct  206   DEFKKMLDELFLLNGILNIGDFIPWIHFLDLQGYVKRMKTLSKKFDRFMEHVLEEHIERR  265

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             K  +++  KDMVD+ LQ+A+DPNLE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  266   KNVKDYVAKDMVDVLLQLAEDPNLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAVSE  323

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L RKP I +KATEELDRVIG++RWVEEKD + LPY+ AI KET RLHP+   L P  + E
Sbjct  324   LVRKPEIFKKATEELDRVIGKDRWVEEKDIANLPYVYAIAKETMRLHPVAPFLVPREARE  383

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC V GY++P+GT VL+N W+I R+S+ W+N  EF PE FL KD+D+KG DF LLPFG+G
Sbjct  384   DCKVDGYDIPKGTIVLVNTWTIARDSEVWENPYEFMPEGFLGKDIDVKGHDFELLPFGAG  443

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++T+LANLLHGF W L  ++K +D++M+E +GL+T  K PL   +EP
Sbjct  444   RRMCPGYPLGIKVIQTSLANLLHGFNWTLPNNVKKEDLNMEEIFGLSTPKKIPLEIVVEP  503

Query  1560  RLPTH  1574
             RL  H
Sbjct  504   RLADH  508



>ref|XP_008463992.1| PREDICTED: cytochrome P450 71A1-like [Cucumis melo]
Length=507

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/481 (53%), Positives = 350/481 (73%), Gaps = 14/481 (3%)
 Frame = +3

Query  135   PGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHD  314
             PGP+PWP+IGNLNL+G +PHQS+H LS+KYG +M L+FGS PV+V SS E AKLF KTHD
Sbjct  38    PGPKPWPLIGNLNLMGPLPHQSIHQLSKKYGPIMQLRFGSFPVVVGSSVEMAKLFFKTHD  97

Query  315   AVFASRP-ATAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERM  491
             ++F SRP  TA  H ++N S + WSPYGP+W  ARKI  +E+F+ ++LDSFEY+R EE  
Sbjct  98    SLFLSRPRITAGKHLSYNYSGILWSPYGPYWLQARKICSTELFSAKRLDSFEYMRKEEVN  157

Query  492   ALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQ  671
             ++I  +++++G   P+ L++HL   +L+ + R+V G KY          E  S+P  + +
Sbjct  158   SMIKAIHNSIG--KPIQLKNHLSTMSLNVICRMVLGKKY---------EENTSVPPNEFK  206

Query  672   GFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDE  851
               LD++FLLSGV+N+GD++P +S LDLQGYVK+MKA  +++++ L  V+++H    KG E
Sbjct  207   KMLDEFFLLSGVLNIGDYIPLISFLDLQGYVKRMKALSKKFDRLLENVLDEHNERRKGVE  266

Query  852   NFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRK  1031
              +  KD+VD+ LQ+AD+ NLE  V L R+ +  +  D++ GG  ++A TVEWA  EL +K
Sbjct  267   GYVAKDVVDVLLQLADNSNLE--VKLERNGVKAIVQDIIIGGTQSSAITVEWAMSELLKK  324

Query  1032  PWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIV  1211
             P I +KA+EELDRVIGRERWVEEKD   LPYIDAI+KET RLHP   +L P  + EDC +
Sbjct  325   PEIFDKASEELDRVIGRERWVEEKDIVNLPYIDAIVKETMRLHPAAPMLVPRMAREDCQI  384

Query  1212  AGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKC  1391
              GY + +GT V++NVW+IGR+   W N   F PERF+ KDV++KGQ+F +LPFGSGRR C
Sbjct  385   EGYHIEKGTRVVVNVWTIGRDPTVWKNPELFDPERFIGKDVNVKGQNFEILPFGSGRRMC  444

Query  1392  PGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPT  1571
             PGY+LG+K+++T LANLLHGF WKL  D+K KD++M+E  G++T  KFPL    +PRLP+
Sbjct  445   PGYNLGLKIIQTNLANLLHGFCWKLVEDMKEKDLNMEELAGISTLKKFPLHAVAKPRLPS  504

Query  1572  H  1574
             H
Sbjct  505   H  505



>ref|XP_006468115.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=536

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/505 (52%), Positives = 356/505 (70%), Gaps = 14/505 (3%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             LL    L  I     RR     PPGP PWPIIGNLNL+GS+PH+S+HSLSQKYG +M L+
Sbjct  16    LLVFPLLLFICGSRCRRN-LNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLR  74

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS PV+V SS E AKLFLK HDA FASRP TAA  +T +N SDM W+ YGP+WR ARKI
Sbjct  75    FGSFPVVVGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKI  134

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGN  602
              L E+F+P++L+SFE++R++E    + GLY +  +  PV L+DHL + +L+ ++R+V G 
Sbjct  135   FLIEIFSPKRLESFEFIRVQEIKKFLFGLYKS--SAKPVHLKDHLSKLSLNVISRMVLGK  192

Query  603   KYYSK-DWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKA  779
              Y  + + +   P+ Y+  L++L       F L+GV+ +GD +PWL  LDLQG++K+M A
Sbjct  193   NYTEETEQDFVTPQEYTEMLQEL-------FYLNGVLEIGDSIPWLGFLDLQGHIKRMIA  245

Query  780   FREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTH  959
               ++ ++F   V+ +H A  K    F   DMVD+ LQ+ADDP LE    L RD++  L  
Sbjct  246   LMKKLDRFYELVLHEHNAKRKSSTGFVASDMVDVLLQLADDPTLE--FKLERDQVKALIQ  303

Query  960   DMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAII  1139
             D+LAGG +++  T+EWA  EL +KP I +KAT+ELDRVIGR R VEEKD   LPYIDAI+
Sbjct  304   DLLAGGTESSTVTLEWAISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYIDAIV  363

Query  1140  KETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERF  1319
             KET RLHP+  +L P ++ E+C VAGY++P+ T VL+NVW+IGR+   W+N NEF PERF
Sbjct  364   KETMRLHPVAPMLVPRFARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRPERF  423

Query  1320  LEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISM  1499
               K++D+KG DF LLPFG+GRR CPGY LG+KV++T+L+NLL  F+WKL GD+K +D+ M
Sbjct  424   FGKEIDVKGHDFELLPFGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKEDLDM  483

Query  1500  DEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +E++GL+T  K PL    +PRLP H
Sbjct  484   EESFGLSTPKKIPLLVAPQPRLPIH  508



>gb|ABC69382.1| CYP92A2v2 [Nicotiana tabacum]
Length=509

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/486 (53%), Positives = 351/486 (72%), Gaps = 11/486 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+G++PH+S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  +T +N SD+TWSPYGP+WR AR++ L+E+F+ ++LDS+E
Sbjct  87    KIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  L    G   P++L+D+L   +L+ ++R+V G +Y      L + E  
Sbjct  147   YIRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRY------LDESENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD +PW+  +DLQGYVK+MK   ++++KFL +VI++H
Sbjct  199   FVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                  G EN+  KDMVD+ LQ+ADDP LE  V L R  +   T DMLAGG +++A TVEW
Sbjct  259   NIRRNGVENYVAKDMVDVLLQLADDPKLE--VKLERHGVKAFTQDMLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD    PYI+AI+KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNHPYIEAIVKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                ED  VAGY+V +GT VL++VW+IGR+   WD    F PERF EK +D+KG D+ LLP
Sbjct  377   ECREDIKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKSIDVKGHDYELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGYSLG+KV++ +LANLLHGF W L  ++ P+D++MDE +GL+T  KFPL+ 
Sbjct  437   FGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLAT  496

Query  1548  TIEPRL  1565
              IEPRL
Sbjct  497   VIEPRL  502



>gb|ABC69381.1| CYP92A2v2 [Nicotiana tabacum]
Length=509

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/486 (52%), Positives = 351/486 (72%), Gaps = 11/486 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+G++PH+S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  +T +N SD+TWSPYGP+WR AR++ L+E+F+ ++LDS+E
Sbjct  87    KIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  L    G   P++L+D+    +L+ ++R+V G +Y      L + E  
Sbjct  147   YIRAEELHSLLHNLNKISG--KPIVLKDYSTTLSLNVISRMVLGKRY------LDESENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD +PW+  +DLQGYVK+MK   ++++KFL +VI++H
Sbjct  199   FVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                  G EN+  KDMVD+ LQ+ADDP LE  V L R  +   T DMLAGG +++A TVEW
Sbjct  259   NIRRNGVENYVAKDMVDVLLQLADDPKLE--VKLERHGVKAFTQDMLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD   LPYI+AI+KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                ED  VAGY+V +GT VL++VW+IGR+   WD    F PERF E+ +D+KG D+ LLP
Sbjct  377   ECREDIKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHERSIDVKGHDYELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGYSLG+KV++ +LANLLHGF W L  ++ P+D++MDE +GL+T  KFPL+ 
Sbjct  437   FGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLAT  496

Query  1548  TIEPRL  1565
              IEPRL
Sbjct  497   VIEPRL  502



>ref|XP_003578185.1| PREDICTED: cytochrome P450 71A1-like [Brachypodium distachyon]
Length=521

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/489 (52%), Positives = 353/489 (72%), Gaps = 7/489 (1%)
 Frame = +3

Query  114   RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAK  293
             ++ Y  PPGP+PWPIIGNLNL+G++PH+S+H+LS++YG LM L+FGS PV+V SS + AK
Sbjct  32    KRTYNLPPGPKPWPIIGNLNLIGTLPHRSIHALSKQYGPLMQLQFGSFPVVVGSSVDMAK  91

Query  294   LFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEY  470
              FLKTHD VF  RP TAA  HT ++ SD+TWSPYG +WR ARKI L+E+F+ ++L+S+EY
Sbjct  92    FFLKTHDVVFTDRPKTAAGKHTTYDYSDITWSPYGAYWRQARKICLTELFSAKRLESYEY  151

Query  471   VRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYS  650
             +R EE +AL+  L+ A G    V+L+D L   +L+ +TR+V G KY  K+ +       +
Sbjct  152   IRGEEVLALLRDLHGASG--RVVVLKDFLSTVSLNVITRMVMGKKYLEKEVKDEAGAVIT  209

Query  651   IPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHM  830
              P  + +  LD+ FLL+GV+N+GD +PWL  +DLQGY+K+MK   + +++FL +V+++H 
Sbjct  210   TP-DEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMKKLSKMFDRFLEHVVDEHS  268

Query  831   AMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                + + E F  KDMVD+ LQ+A DP+LE  V L R+ +   T DM+AGG +++A TVEW
Sbjct  269   ERCRREGEGFVAKDMVDVLLQVASDPDLE--VKLNREGVKAFTQDMIAGGTESSAVTVEW  326

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP +  KATEELDRV+GR RWV EKD + LPY++AI+KET RLHP+  LL P 
Sbjct  327   ALSELLKKPEVFAKATEELDRVVGRGRWVTEKDMASLPYVEAIVKETMRLHPVAPLLVPR  386

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
              S ED  + G+++P GT VL++VWSIGR+   WD   EF PERFL   +D+KGQD+ LLP
Sbjct  387   LSREDTSIGGHDIPAGTRVLVSVWSIGRDPALWDKPEEFAPERFLGSRIDVKGQDYELLP  446

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FGSGRR CPGYSLG+KV++ +LANLLHGF W+L   +  +++SM+E +GL+T  K PL  
Sbjct  447   FGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGVTKEELSMEEIFGLSTPRKSPLEA  506

Query  1548  TIEPRLPTH  1574
              +EP+LP  
Sbjct  507   VVEPKLPAQ  515



>ref|XP_004235548.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=508

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/488 (52%), Positives = 349/488 (72%), Gaps = 11/488 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+GS+PH+S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  26    RKRKLNLPPGPKPWPIIGNLNLMGSLPHRSIHDLSVKYGPIMQLQFGSFPVVVGSSVEMA  85

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLKT D  F  RP TAA  +T +N SD+TWSPYG +WR AR++ L E+F+ ++LDS+E
Sbjct  86    KIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSYE  145

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +++  L  + G   P+LL+D+L   +L+ ++R+V G  Y      L + +  
Sbjct  146   YIRAEELHSILHNLNKSSG--KPILLKDYLTTLSLNVISRMVLGKSY------LDESDNS  197

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +   + +  LD+ FLL+GV+N+GD +PWL  +DLQGYVK+MK   ++++KFL +V+++H
Sbjct  198   IVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVKRMKVVSKKFDKFLEHVLDEH  257

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                    EN+  KDMVD+ LQ+ADDP L  DV L R  +   T D+LAGG +++A TVEW
Sbjct  258   NMRRNAVENYVAKDMVDVLLQLADDPTL--DVKLERHGVKAFTQDLLAGGTESSAVTVEW  315

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KAT ELDRVIG+ RWV+EKD   LPYI+AI KET RLHP+  +L P 
Sbjct  316   AISELLKKPEIFKKATNELDRVIGQNRWVQEKDIPNLPYIEAIAKETMRLHPVAPMLVPR  375

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                EDC VAGY+V +GT VL++VW+IGR+   WD    F P+RFLEK +D+KG DF LLP
Sbjct  376   ECREDCKVAGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPDRFLEKSIDVKGHDFELLP  435

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGYSLG+KV++ +LANLLHGF W L  ++ P++++M+E +GL+T  KFPLS 
Sbjct  436   FGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEELNMEEIFGLSTPKKFPLSA  495

Query  1548  TIEPRLPT  1571
              I+PRL +
Sbjct  496   VIQPRLSS  503



>ref|NP_001063284.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAD36157.1| putative cytochrome P450 monooxygenase CYP92A1 [Oryza sativa 
Japonica Group]
 dbj|BAF25198.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAG98103.1| unnamed protein product [Oryza sativa Japonica Group]
Length=525

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/532 (50%), Positives = 366/532 (69%), Gaps = 30/532 (6%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME+ SW    +  L A+ FL      H RR AY+ PPGP PWPIIGNLNL+G++PH+S+H
Sbjct  3     MELPSWASVLVIVLAAVVFLLATILRHGRR-AYRLPPGPNPWPIIGNLNLIGALPHRSIH  61

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS++YG LM L+FGS PV+V SS E A+ FLK+HD VF  RP TAA  HT +N +D+ W
Sbjct  62    ELSKRYGPLMQLRFGSFPVVVGSSAEMARFFLKSHDIVFTDRPRTAAGKHTTYNYTDILW  121

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARK+ ++E+F+ R+L+SFE++R EE  AL+  L+   G   PVLLRD+L  
Sbjct  122   SPYGAYWRQARKMCVTELFSARRLESFEHIRGEEVRALLRDLH---GAAAPVLLRDYLST  178

Query  564   FTLSTMTRLVTGNKYYS-------------KDWELGKPEGYSIPLKKLQGFLDDWFLLSG  704
              TL  ++R+V G KY                      PE + +        +D+ FLLSG
Sbjct  179   ATLGVISRMVLGKKYVGVEGASAGNGGGGEGTSPAATPEEFKM-------MMDELFLLSG  231

Query  705   VINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH--MAMMKGDENFAPKDMVD  878
             V+N+GD++PWL  LDLQGY+++MK   ++ ++F+ +V+++H  +   +GD  FA +D+VD
Sbjct  232   VLNIGDFIPWLDWLDLQGYIRRMKRVGKKLDRFMEHVLDEHDKVRRQQGD-RFAARDLVD  290

Query  879   IFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATE  1058
             + LQ+ADDPNLE  V L RD +  LT D++AGG DT+A TVEWA  EL RKP I+ KATE
Sbjct  291   VLLQLADDPNLE--VQLRRDNVKALTQDLIAGGTDTSAITVEWAISELLRKPEILAKATE  348

Query  1059  ELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGT  1238
             ELDRV+GR R V E D + LPY++AI+KET R+HP+  LL PH + ED  V GY++P GT
Sbjct  349   ELDRVVGRGRLVTETDMTSLPYVEAIVKETMRVHPVAPLLAPHVAREDASVGGYDIPAGT  408

Query  1239  TVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKV  1418
              VL+NVW+I R+   WD+  EF PERF+   +D+KGQDF LLPFGSGRR CPG+SLG+KV
Sbjct  409   RVLVNVWTIARDPALWDSPEEFMPERFIGSKIDVKGQDFQLLPFGSGRRLCPGHSLGLKV  468

Query  1419  VRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ++ +LA+LLHGF+W+L   +   ++SM+E +GL+T  K PL   ++P+LP H
Sbjct  469   IQLSLASLLHGFEWRLPDGVSAGELSMEEVFGLSTPRKVPLEVVVKPKLPAH  520



>ref|XP_006363446.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Solanum 
tuberosum]
Length=450

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/520 (54%), Positives = 350/520 (67%), Gaps = 76/520 (15%)
 Frame = +3

Query  27    MEVFSWFFQAL-PWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSL  203
             ME+ SW F     WLLA+AF+ KI   H +RK    PPGP+PWPIIGNLNLLGS+PH S 
Sbjct  1     MEI-SWVFIVFGSWLLALAFVLKIFN-HPKRK---LPPGPKPWPIIGNLNLLGSLPHVSF  55

Query  204   HSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHTFNRSDMTW  383
             H LSQKYG+LMLLK                         F S+P   A+           
Sbjct  56    HHLSQKYGDLMLLK-------------------------FGSKPVLVAS-----------  79

Query  384   SPYGPFWRHARKILLSE--VFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHL  557
             SP       A++IL +   +F  R                       +    P+LL+DHL
Sbjct  80    SP-----EMAKEILKTHDAIFASRP---------------------PLAAGKPILLKDHL  113

Query  558   VRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWL  737
              RFTL T++R+   +KY S   +    +     L++LQ  LD+W +L GV+NLGDW+P  
Sbjct  114   PRFTLRTISRMAMSDKYCS---DQSNSDTSIATLERLQWMLDEWLVLGGVMNLGDWIPLF  170

Query  738   SGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAM-MKGDENFAPKDMVDIFLQIADDPNLE  914
             S  DLQGYV++MKA  + + +F  YVI+DH A  M+   +F PKDMVD  L ++DDPNL 
Sbjct  171   SWFDLQGYVRRMKALGKNFTQFYKYVIDDHNATKMQTTGDFVPKDMVDALLHLSDDPNL-  229

Query  915   ADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWV  1094
              +V LT DR+MGL H++LAG  DT+AAT+EW FQEL R+P II+KA +ELDR IG+ERWV
Sbjct  230   -NVQLTSDRMMGLMHNLLAGATDTSAATIEWTFQELLRRPNIIDKARQELDRAIGKERWV  288

Query  1095  EEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRN  1274
             EE+DFS+LPYIDAIIKE+FRLHPLC LLPPHYSIEDC VAGY++P+GT V +N WSIGRN
Sbjct  289   EEEDFSKLPYIDAIIKESFRLHPLCALLPPHYSIEDCKVAGYDIPKGTIVYVNAWSIGRN  348

Query  1275  SKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGF  1454
             SKYW+ A EF PERF+E ++D+ GQ+FALLPFGSGRR+CPGYSLGMKVVRTT+ANLLHGF
Sbjct  349   SKYWERAEEFIPERFIENNIDMTGQNFALLPFGSGRRRCPGYSLGMKVVRTTMANLLHGF  408

Query  1455  KWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              WKL GD++P+DISM+E YGL+THPK P+S  +EPRLP H
Sbjct  409   NWKLTGDMRPEDISMEEMYGLSTHPKKPISVIMEPRLPLH  448



>ref|XP_010685305.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/518 (50%), Positives = 368/518 (71%), Gaps = 11/518 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME  +W   A  WL++IA +     + +RRK    PPGP+PWPIIGN NL+GS+PH+SLH
Sbjct  1     MEAPTWAAYAAAWLVSIALVVLSHHLRRRRK-LNLPPGPKPWPIIGNFNLIGSLPHRSLH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              L++ YG LM+LKFGS PV+V SS + AKLFL+T+D  FA RP T+A  +T +N SD+TW
Sbjct  60    ELTKTYGPLMMLKFGSVPVLVGSSVKMAKLFLRTYDVAFAGRPKTSAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             S YGP+WR ARK+ L E+F+ ++L+SFEY+R+EE  +++  +++  G   P++L+DHL  
Sbjct  120   SQYGPYWRQARKMCLMELFSVKRLESFEYIRVEELNSVLRAIFNTNG--EPMMLKDHLST  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G +Y  +       E   +   + +  LD+ FLL+GV NLGDW+P L  
Sbjct  178   LSLNVISRMVFGKRYLDET----NDEKPIVTPDEFKKMLDELFLLNGVFNLGDWIPCLKY  233

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAM-MKGDENFAPKDMVDIFLQIADDPNLEAD  920
             LD+QGYVK+MK   +++++F+ +V+++H A  +K  E++ PKDMVD+ LQ+ADDPNLE  
Sbjct  234   LDVQGYVKRMKVLAKKFDRFMEHVLDEHNARKVKEKEDWVPKDMVDVLLQLADDPNLE--  291

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L R  +   + D++AGG +++A TVEWA  EL +KP II KATEELDRVIG+ERWVEE
Sbjct  292   VKLERIGVKAFSQDLIAGGTESSAVTVEWAMAELLKKPDIIRKATEELDRVIGKERWVEE  351

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD   LPYI AI KET RLHP+  +L P  + E   +  Y++P+G+ VL+N ++I R+  
Sbjct  352   KDIQNLPYIRAISKETMRLHPVAPMLVPRMTREQVKIEDYDIPKGSLVLVNTFTIQRDLN  411

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              ++   EF PERFL  ++D+KGQDF LLPFGSGRR CPGYSLG+KV+ ++LANLLHGF W
Sbjct  412   VYEKPEEFWPERFLATNIDVKGQDFELLPFGSGRRMCPGYSLGLKVIESSLANLLHGFIW  471

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             KL G++K +DI M+E +GL+   K PL   +EPRLP +
Sbjct  472   KLPGNMKVEDIDMEEIFGLSNPKKNPLMACVEPRLPHY  509



>ref|XP_008242317.1| PREDICTED: flavonoid 3'-monooxygenase-like [Prunus mume]
Length=517

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/474 (55%), Positives = 334/474 (70%), Gaps = 9/474 (2%)
 Frame = +3

Query  150   WPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFAS  329
             WPIIGNLNL+G +PHQS H  SQ YG +M +K GS PV+VASSPE AK FLKTHD +FAS
Sbjct  48    WPIIGNLNLVGPLPHQSAHKWSQIYGPIMQIKLGSCPVVVASSPEMAKQFLKTHDRIFAS  107

Query  330   RPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISG  506
             RP TAA  +  +    +T +PYGP+WR  RKIL SE+F+P+ L+SF Y+R+EE    IS 
Sbjct  108   RPQTAAGKYLNYGYQSVTHAPYGPYWRQGRKILTSELFSPKSLESFRYIRVEENRTFISR  167

Query  507   LYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDD  686
             LY   G    V+L+ HL R TLS + R+V G  ++S    L K +  +I LK+ Q   D+
Sbjct  168   LYAMSG--KAVVLKQHLSRLTLSVLCRVVLGKDHFS----LTKSKSSTISLKESQDMTDE  221

Query  687   WFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPK  866
              +LL+GV N+GDW+PWL   DLQGYVK+MKA +++ ++F  +V+ +H A  +G E F  K
Sbjct  222   LYLLAGVANIGDWIPWLDVFDLQGYVKRMKALQKKLDQFYEFVLNEHKARKEGVEEFVAK  281

Query  867   DMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIE  1046
             DMVD+ LQ  DDPN + +V LT D +   T D++ GG D +A T+EWA  EL ++P +IE
Sbjct  282   DMVDLLLQQVDDPN-DLEVKLTYDTVKAFTQDLVIGGSDNSATTLEWAMSELIKQPNLIE  340

Query  1047  KATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEV  1226
             KATEELDRVIGRERWVEE+D   LPYIDAI+KE  R HP+   LP H ++EDC VAGY+V
Sbjct  341   KATEELDRVIGRERWVEEEDLENLPYIDAIMKEAMRKHPVIVFLP-HLALEDCNVAGYDV  399

Query  1227  PRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSL  1406
              +GT VL+N+WS+GR+   WD  +EF PERFL K +D+KGQ F  LPFGSGRR CPGY  
Sbjct  400   CKGTLVLVNIWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFEFLPFGSGRRMCPGYGH  459

Query  1407  GMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
              +K+V + LAN+LHGF WKL  ++K +D+ M+E YGL TH KFPL    EPRLP
Sbjct  460   ALKMVGSCLANMLHGFTWKLPENVKTEDLGMEETYGLLTHRKFPLVVVTEPRLP  513



>gb|AET01782.2| cytochrome P450 family protein [Medicago truncatula]
Length=514

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/485 (52%), Positives = 354/485 (73%), Gaps = 11/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+ WPIIGNLNL+GS+PHQSLH L++KYG +M L FGSKPVIV SSPE AK+FL
Sbjct  36    YNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKKYGPIMHLWFGSKPVIVGSSPEIAKVFL  95

Query  303   KTHDAVFASRPA-TAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KT+DAV A RP  +A  + T+N S++TWS YGP+W+ ARK+ L E+F+ ++L+S+EY+R 
Sbjct  96    KTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGPYWQQARKMCLLELFSVKRLESYEYMRK  155

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E  A +  L+++      +LL+DHL   +L+ ++R+V G KY      L K E   I  
Sbjct  156   QELHAFLHELFNS--KNKTILLKDHLSTLSLNVISRMVLGKKY------LEKSENAIISP  207

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
             ++ +  LD+ FLL+GV+N+GD++PW+  LDLQGYVK+MK   ++++ F+ +V+E+H+   
Sbjct  208   EEFKKMLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMKTLGKKFDWFMEHVLEEHIERR  267

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             K   ++  KDMVD+ L++A++P+LE  V L R  +   T D++AGG DT+  TVEWA  E
Sbjct  268   KCVNDYVAKDMVDVLLKLAENPSLE--VKLERHGVKAFTQDLIAGGTDTSTVTVEWAISE  325

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L +KP II++ATEELD+VIGR+RWVEEKD   LPY+ AI KET RLHP   LL P  + E
Sbjct  326   LVKKPEIIKRATEELDKVIGRDRWVEEKDIVNLPYVFAIAKETMRLHPAAPLLVPREASE  385

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC V GY++P+GT +L+N W+IGR+   WDN  EF PERF+  ++D+KG D+ LLPFG+G
Sbjct  386   DCNVDGYDIPKGTLILVNTWTIGRDPNVWDNPYEFIPERFIGNNIDVKGHDYELLPFGTG  445

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++++LANLLHGF W+L  D+K +D++M+E +GLTT  K PL   +EP
Sbjct  446   RRMCPGYPLGLKVIQSSLANLLHGFNWRLPNDMKKEDLNMEEIFGLTTPRKIPLEVVVEP  505

Query  1560  RLPTH  1574
             RLP H
Sbjct  506   RLPHH  510



>ref|XP_006342921.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=509

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/488 (52%), Positives = 347/488 (71%), Gaps = 11/488 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+GS+ H+S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGSLAHRSIHDLSVKYGPIMQLQFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLKT D  F  RP TAA  +T +N SD+TWSPYG +WR AR++ L E+F+ ++LDS+E
Sbjct  87    KIFLKTMDINFVGRPKTAAGKYTTYNYSDITWSPYGSYWRQARRMCLMELFSAKRLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R +E  +++  L    G   P+LL+D+L   +L+ ++R+V G  Y      L   E  
Sbjct  147   YIRDQELHSILHNLNKLSG--KPILLKDYLTTLSLNVISRMVLGKSY------LDVSENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +   + +  LD+ FLL+GV+N+GD +PWL  +DLQGYVK+MK   ++++KFL +V+++H
Sbjct  199   IVTPDEFKKMLDELFLLNGVLNIGDSIPWLDFMDLQGYVKRMKVVSKKFDKFLEHVLDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                    EN+  KDMVDI LQ+ADDP L  DV L R  +   T D+LAGG +++A TVEW
Sbjct  259   NVRRNAVENYVAKDMVDILLQLADDPTL--DVKLERHGVKAFTQDLLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD   LPYI+AI KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIAKETMRLHPVAPMLVPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                EDC VAGY+V +GT VL++VW+IGR+   WD    F PERFL+K +D+KG DF LLP
Sbjct  377   ECREDCKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEAFKPERFLDKSIDVKGHDFELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGYSLG+KV++ +LANLLHGF W L  ++ P++++M+E +GL+T  KFPLS 
Sbjct  437   FGAGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEELNMEEVFGLSTPKKFPLSA  496

Query  1548  TIEPRLPT  1571
              IEPRL +
Sbjct  497   VIEPRLSS  504



>ref|XP_011035728.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Populus euphratica]
Length=511

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/514 (51%), Positives = 369/514 (72%), Gaps = 11/514 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             +W   A  WL  ++ +   + +  RR+    PPGP+PWPIIGNLNL+G +PH+SLH+LSQ
Sbjct  3     TWVSYAFAWLATVSLILLASRL--RRRKLNPPPGPKPWPIIGNLNLIGELPHRSLHALSQ  60

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG LM ++FGS PV+V SS E AK  LKTHD +F+ RP TAA  +T +N SD+TWSPYG
Sbjct  61    KYGPLMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYG  120

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARK+ L E+F+ ++L+S+EY+R+EE  AL+  L  + G   P+ L+DHL   +L+
Sbjct  121   PYWRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLNKSSG--RPINLKDHLADVSLN  178

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G KY  K  E    E   +  ++ +  LD+ FLL+GV+++GD +PW++ LDLQ
Sbjct  179   VISRMVLGKKYTVKSSE---NEKEIVTPQEFKEMLDELFLLNGVLDIGDSIPWIAFLDLQ  235

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKG-DENFAPKDMVDIFLQIADDPNLEADVALT  932
             GY+K+MK   ++++KF+ +V+++H +  K  D+N+ PKDMVD+ LQ+A DPNLE  V L 
Sbjct  236   GYIKRMKTLSKKFDKFMEHVLDEHESRRKTEDKNWEPKDMVDVLLQLASDPNLE--VKLE  293

Query  933   RDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFS  1112
             R  +   + D++AGG +++A TVEWA  E+ RKP + EKA+EELDRVIGRERWVEEKD  
Sbjct  294   RHGVKAFSQDLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEKDMV  353

Query  1113  QLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDN  1292
              LPYI AI KE  RLHP+  +L P  + ED  V GY++ +G+ VL+NVW+IGR+ K WD 
Sbjct  354   NLPYIYAIAKEVMRLHPVAPMLVPRAAREDINVNGYDIKKGSRVLVNVWTIGRDPKVWDK  413

Query  1293  ANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG  1472
              +EFCPERF+   +D++G D+ LLPFG+GRR CPGY LG+KV++ TL+NLLHGFKW+L  
Sbjct  414   PDEFCPERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPD  473

Query  1473  DLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              ++ +D+SM+E +GL+T  K+PL    EPRLP H
Sbjct  474   GVRKEDLSMEEIFGLSTPKKYPLVAVAEPRLPAH  507



>gb|KDO48980.1| hypothetical protein CISIN_1g010365mg [Citrus sinensis]
Length=506

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/489 (53%), Positives = 351/489 (72%), Gaps = 19/489 (4%)
 Frame = +3

Query  114   RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAK  293
             R+    PPGP PWPIIGNLNL+GS+PH+S+HSLSQKYG +M L+FGS PV+V SS E AK
Sbjct  31    RRNLNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQKYGPIMQLRFGSFPVVVGSSVEMAK  90

Query  294   LFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEY  470
             LFLK HDA FASRP TAA  +T +N SDM W+ YGP+WR ARKI L E+F+P++L+SFE+
Sbjct  91    LFLKIHDANFASRPRTAAGKYTTYNYSDMVWATYGPYWRQARKIFLIEIFSPKRLESFEF  150

Query  471   VRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSK-DWELGKPEGY  647
             +R++E    + GLY +  +  PV L+DHL + +L+ ++R+V G  Y  + + +   P+ Y
Sbjct  151   IRVQEIKKFLFGLYKS--SAKPVHLKDHLSKLSLNVISRMVLGKNYTEETEQDFVTPQEY  208

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
             +  L++L       F L+GV+ +GD +PWL  LDLQG++K+MKA  ++ ++F   V+ +H
Sbjct  209   TEMLQEL-------FYLNGVLEIGDSIPWLGFLDLQGHIKRMKALMKKLDRFYELVLHEH  261

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
              A  K    F   DMVD+ LQ+ADDP LE    L RD+      D+LAGG +++  T+EW
Sbjct  262   NAKRKSSTGFVASDMVDVLLQLADDPTLE--FKLERDQ------DLLAGGTESSTVTLEW  313

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KAT+ELDRVIGR R VEEKD   LPYIDAI+KET RLHP+  +L P 
Sbjct  314   AISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYIDAIVKETMRLHPVAPMLVPR  373

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
             ++ E+C VAGY++P+ T VL+NVW+IGR+   W+N NEF PERF  K++D+KG DF LLP
Sbjct  374   FARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRPERFFGKEIDVKGHDFELLP  433

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY LG+KV++T+L+NLL  F+WKL GD+K +D+ M+E++GL+T  K PL  
Sbjct  434   FGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMKKEDLDMEESFGLSTPKKIPLLV  493

Query  1548  TIEPRLPTH  1574
               +PRLP H
Sbjct  494   VPQPRLPIH  502



>gb|AER39774.1| CYP92A44-4 [Festuca rubra subsp. commutata]
Length=516

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/508 (50%), Positives = 356/508 (70%), Gaps = 12/508 (2%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +LA     K     +  + Y  PPGP+ WPIIGNLNL+G++PH+S+H+LS++YG L+ L+
Sbjct  13    VLATVLFLKAVLRRRSGRKYNLPPGPKAWPIIGNLNLMGTLPHRSIHALSKQYGPLLQLQ  72

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS P +V SS E AK FLKTHD  F  RP  A+  HT +N SD+TWSPYG +WR ARK+
Sbjct  73    FGSFPCVVGSSVEMAKFFLKTHDVSFTDRPKFASGKHTTYNYSDITWSPYGAYWRQARKM  132

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAV--GTKNPVLLRDHLVRFTLSTMTRLVT  596
              L+E+F+ R+L S+EY+R EE +AL+  L+     G    ++L+D+L   +L+ +TR+V 
Sbjct  133   CLTELFSARRLRSYEYIRSEEVLALVRDLHRGATAGAGRALVLKDYLSTVSLNVITRMVM  192

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G KY  K+   G     + P  + +  +D+ FLL+GV+N+GD +PWL  +DLQGY+K+MK
Sbjct  193   GKKYLEKEVRDGSGAVITTP-DEFKWMIDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMK  251

Query  777   AFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL +V+++H    + D E+F  KDMVD+ LQ A DPNLE  V L RD +   
Sbjct  252   KLSKMFDRFLEHVVDEHSERRRRDGESFVAKDMVDVLLQFASDPNLE--VKLNRDGVKAF  309

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
             T D++AGG +++A TVEWA  EL +KP +  +ATEELDRV+GR RW+ EKD   LPY+DA
Sbjct  310   TQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWITEKDMPSLPYVDA  369

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET RLHP+  +L P  S ED  +AGY++P GT VL++VWSIGR+ + WD   EF PE
Sbjct  370   IVKETMRLHPVAPMLVPRLSREDTTIAGYDIPAGTRVLVSVWSIGRDPELWDVPEEFMPE  429

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL-DGDLKPKD  1490
             RF+   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF+WKL DG     +
Sbjct  430   RFIGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFEWKLPDG----VE  485

Query  1491  ISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ++M+E +GL+T  KFPL   +EP+LP H
Sbjct  486   LNMEEIFGLSTPRKFPLEAVVEPKLPAH  513



>ref|XP_011071969.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=507

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/515 (49%), Positives = 363/515 (70%), Gaps = 15/515 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME   WF      L  I F++ +T +  RR+    PPGPRPWP+IGNLNL+G +PH+S+H
Sbjct  1     METQFWF----SCLSLIVFVYVLTKV-LRREKLNLPPGPRPWPVIGNLNLIGPLPHRSIH  55

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              L+QKYG L+ LKFGS  V+V S+ E AK+FLKT D  FASRP TAA  +T +N +D+TW
Sbjct  56    ELAQKYGPLIHLKFGSASVVVGSNVEMAKVFLKTMDVNFASRPVTAAGKYTGYNYTDITW  115

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR AR++ L E+F+ ++L+S+EY+RIEE  +L+  ++   G   P+L++D+L  
Sbjct  116   APYGPYWRQARRMCLMELFSAKRLESYEYIRIEEMNSLLKNMFKCCG--QPILVKDYLST  173

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              TL+ ++R+V G +Y  KD E        +  ++ +  LD+ FLL+GVIN+GD +PW+S 
Sbjct  174   VTLNVISRMVLGKRYLDKDIE-----NPVVAPQEFKKMLDELFLLNGVINVGDLIPWISF  228

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK   ++++KFL +V+++H    +  E +  +DMVD+ L++A+DP LE  V
Sbjct  229   LDLQGYVKRMKIVHKKFDKFLEHVLDEHQERRRSIEGYVSRDMVDVLLELAEDPTLE--V  286

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  + G   D+LAGG +++  T+ WA  EL ++P   +KATEELDRVIGR RWV+E+
Sbjct  287   KLERHGVKGHILDLLAGGTESSTVTIIWAISELLKQPKYFKKATEELDRVIGRNRWVKEQ  346

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPYI AI+KET RLHP+  +L P  + EDC VAGY++ +GT V +NVW+IG +   
Sbjct  347   DMPNLPYIQAIMKETMRLHPIAPILTPRLAREDCKVAGYDIKKGTQVFVNVWTIGLDPSI  406

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             W+N  EF P+RF++K +D++G DF LLPFG+GRR CPGYSLG+KV+ ++LANL+HGF WK
Sbjct  407   WENPTEFNPDRFIKKPIDVRGHDFELLPFGAGRRMCPGYSLGLKVILSSLANLIHGFNWK  466

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             L   +KP+D++M+E +GL+   K PL    EPRLP
Sbjct  467   LPDPMKPEDLNMEEVFGLSVPRKVPLVAVPEPRLP  501



>ref|XP_006665049.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=525

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/504 (51%), Positives = 360/504 (71%), Gaps = 9/504 (2%)
 Frame = +3

Query  81    FLFKITTIHQR---RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFG  251
              LF   T+ +R   R +Y  PPGPRPWPIIGNL+L+G++PH+S+H+LS++YG LM L+FG
Sbjct  20    ILFLAATLSRRGGRRASYNLPPGPRPWPIIGNLHLVGALPHRSIHALSERYGPLMHLRFG  79

Query  252   SKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILL  428
             S+ V+V SS E A+ FLKTHDAVFA RP TAA  +T +N SDMTWSPYG +WR ARKI L
Sbjct  80    SQHVVVGSSAELARFFLKTHDAVFADRPRTAAGKYTTYNYSDMTWSPYGAYWRQARKICL  139

Query  429   SEVFTPRKLDSFEYVRIEERMALISGLYDAVGT-KNPVLLRDHLVRFTLSTMTRLVTGNK  605
             +E+F+ R++DS+E++R +E  AL+ GL  A  + +  V L++HL   +L+ ++R+V G K
Sbjct  140   TELFSARRIDSYEHIRSDETRALLRGLNAAAASGRRAVRLKEHLSTASLNLISRMVLGRK  199

Query  606   YYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFR  785
             Y      + + E  + P ++ +  +D+ FLL+GV+N+GD +PWL+ LDLQGY+++MK   
Sbjct  200   YLEGGEVVHRGEVVTTP-EQFRWMIDELFLLNGVLNIGDSIPWLNFLDLQGYIRRMKKLS  258

Query  786   EEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHD  962
             + +++FL +V+++H      + E F  +D+VD+ L++ADDP L+  V  TRD +   T D
Sbjct  259   KMFDRFLEHVLDEHETRRHHEGEAFVARDLVDVLLKVADDPCLQ--VEFTRDSVKAFTQD  316

Query  963   MLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIK  1142
             ++AGG +++A T+EWA  EL +KP +  KATEELDRVIGR RWV EKD   L YIDAI+K
Sbjct  317   LIAGGTESSAMTIEWAISELLKKPEVFNKATEELDRVIGRGRWVTEKDIPSLLYIDAILK  376

Query  1143  ETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFL  1322
             ET R+HP+  +L P  S  D    GY++P G+ VL++ WSIGR+ K WD+  EF PERF+
Sbjct  377   ETMRMHPVAPMLTPRMSRMDTSYNGYDIPAGSRVLVSTWSIGRDPKLWDSPEEFMPERFV  436

Query  1323  EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMD  1502
             +  +DIKGQDF LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W+L   +  + +SM+
Sbjct  437   DSKIDIKGQDFKLLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSWRLPDGMTREQLSME  496

Query  1503  EAYGLTTHPKFPLSYTIEPRLPTH  1574
             E +GL+   KFPL   +EP+LP H
Sbjct  497   EIFGLSMPRKFPLEVVVEPKLPVH  520



>gb|AGV54723.1| flavonoid 3'-monooxygenase-like protein [Phaseolus vulgaris]
Length=511

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/485 (51%), Positives = 350/485 (72%), Gaps = 12/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGNLNL+G +PH+S+H LS+KYG +M + FGS PV+V SS + AK FL
Sbjct  34    YNLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIMHVWFGSNPVVVGSSVDMAKAFL  93

Query  303   KTHDAVFASRPA-TAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  +A  + T+N +D+TWS YGP+WR AR++ L E+F+ ++L+ +EY+R 
Sbjct  94    KTHDATVAGRPKFSAGKYTTYNYTDITWSQYGPYWRQARRMCLLELFSQKRLEEYEYIRK  153

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E   L++ L+ +      +LL+DHL   +L+ + R V G  Y  K    G PE +    
Sbjct  154   QELRCLLNKLFHS--ADKTILLKDHLSNLSLNVLCRKVFGKNYLEKSKTPGSPEEF----  207

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
                +  +D+ FLL+GV N+GD++PW+  LDLQGY+K+MKA  ++++ F+ +V+++H    
Sbjct  208   ---KRMIDELFLLNGVYNIGDFIPWMDFLDLQGYIKRMKALSKKFDMFMEHVLDEHFERK  264

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             KG +++  KDMVD+FLQ+A+DP LE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  265   KGVKDYVAKDMVDVFLQLAEDPTLE--VKLERQGVKAFTQDLIAGGTESSAVTVEWAISE  322

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L R+P I +KATEELDRVIGRERWVEEKD   LPY++AI+KE  RLHP+  +L P  + E
Sbjct  323   LLRRPEIFKKATEELDRVIGRERWVEEKDIVDLPYVNAIVKEVMRLHPVAPMLVPRMARE  382

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC + GY++P+GT VL++VW+IGR+   WD+ NEF PERFL K++D+KG ++ LLPFG+G
Sbjct  383   DCQIGGYDIPKGTQVLVHVWAIGRDPAIWDSPNEFQPERFLAKEIDVKGHNYELLPFGAG  442

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++ +LANLLHGF W+L  +++ +D++M+E +GL+T  K PL   +EP
Sbjct  443   RRMCPGYPLGLKVIQASLANLLHGFNWRLPQNVQTEDLNMEEIFGLSTPKKIPLETVLEP  502

Query  1560  RLPTH  1574
             RLP H
Sbjct  503   RLPHH  507



>ref|XP_011035730.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Populus euphratica]
Length=511

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/514 (51%), Positives = 370/514 (72%), Gaps = 11/514 (2%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             +W   A  WL  ++ +   + +  RR+    PPGP+PWPIIGNLNL+G +PH+SLH+LSQ
Sbjct  3     TWVSYAFAWLATVSLILLASRL--RRRKLNPPPGPKPWPIIGNLNLIGELPHRSLHALSQ  60

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG LM ++FGS PV+V SS E AK  LKTHD +F+ RP TAA  +T +N SD+TWSPYG
Sbjct  61    KYGPLMQVQFGSFPVVVGSSVEMAKTILKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYG  120

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARK+ L E+F+ ++L+S+EY+R+EE  AL+  L+ + G   P+ L+DHL   +L+
Sbjct  121   PYWRQARKMCLMELFSAKRLESYEYIRVEELKALLKTLHKSSG--RPINLKDHLADVSLN  178

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G KY  K  E    E   +  ++ +  LD+ FLL+GV+++GD +PW++ LDLQ
Sbjct  179   VISRMVLGKKYTVKSSE---NEKEIVTPQEFKEMLDELFLLNGVLDIGDSIPWVAFLDLQ  235

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKG-DENFAPKDMVDIFLQIADDPNLEADVALT  932
             G++K+MK   ++++KF+ +V+++H +  K  D+N+ PKDMVD+ LQ+A DPNLE  V L 
Sbjct  236   GHIKRMKVLSKKFDKFMEHVLDEHESRRKTEDKNWEPKDMVDVLLQLASDPNLE--VKLE  293

Query  933   RDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFS  1112
             R  +   + D++AGG +++A TVEWA  E+ RKP + EKA+EELDRVIGRERWVEEKD  
Sbjct  294   RHGVKAFSQDLIAGGTESSAVTVEWAISEILRKPEVFEKASEELDRVIGRERWVEEKDMV  353

Query  1113  QLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDN  1292
              LPYI AI KE  RLHP+  +L P  + ED  V GY++ +G+ VL+NVW+IGR+ K WD 
Sbjct  354   NLPYIYAIAKEVMRLHPVAPMLVPRAAREDINVNGYDIKKGSRVLVNVWTIGRDPKVWDK  413

Query  1293  ANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG  1472
              +EFCPERF+   +D++G D+ LLPFG+GRR CPGY LG+KV++ TL+NLLHGFKW+L  
Sbjct  414   PDEFCPERFIGNSIDVRGHDYELLPFGAGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPD  473

Query  1473  DLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              ++ +D+SM+E +GL+T  K+PL    EPRLP H
Sbjct  474   GVRKEDLSMEEIFGLSTPKKYPLVAVAEPRLPAH  507



>ref|XP_004148565.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004165405.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=513

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/483 (52%), Positives = 350/483 (72%), Gaps = 11/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWP+IGNL+L+GS+PHQS+H LS+KYG +M L+FGS P++V SS E AKLFLKT 
Sbjct  35    PPGPKPWPVIGNLDLIGSLPHQSIHQLSKKYGPIMHLRFGSFPIVVGSSVEMAKLFLKTQ  94

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  FASRP T A  +T +N S++TWS YGP+W   RK+ L E+F+ R+LDS+EY+R EE 
Sbjct  95    DLNFASRPKTTAGKYTTYNHSNITWSQYGPYWGQLRKMCLMELFSARRLDSYEYIRKEEM  154

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
               LI  +Y + G    + ++D+L   +L+ ++R+V G KY  +  E G      +   + 
Sbjct  155   NGLIREIYKSCG--EVIKVKDYLFAVSLNVISRMVLGKKYTDEPSESG-----IVSPDEF  207

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  +D+ FLL+GV+N+GD +PW+  LDLQGYVK+MK   ++ ++FL +V+++H    KG 
Sbjct  208   RKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKRMKGLSKKLDRFLEHVLDEHKERRKGV  267

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             EN+  KDMVD+ LQ+ADDP+LE  V L R  +   T D+L GG +++  TVEW   EL +
Sbjct  268   ENYVAKDMVDVLLQLADDPDLE--VKLERHGVKAFTQDLLGGGIESSTVTVEWTISELLK  325

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
              P I+ KATEEL++VIG+ERWVEEKD   LPYI+AI KET RLHP+  +L P  + EDC 
Sbjct  326   TPEILNKATEELNKVIGKERWVEEKDMINLPYINAIAKETMRLHPVAPMLVPRMAREDCQ  385

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKD-VDIKGQDFALLPFGSGRR  1385
             VAGY++ +GT VL+NVW+IGR+   W N + F P+RF+E + +D+KG+DF LLPFGSGRR
Sbjct  386   VAGYDIAKGTRVLVNVWTIGRDQTVWKNPHAFDPDRFMENNCIDVKGEDFELLPFGSGRR  445

Query  1386  KCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
              CPGYSLG+KV+ +TLANLLHGF WKL GD++ +D++M+E++GL+T  K+PL    EPRL
Sbjct  446   MCPGYSLGLKVILSTLANLLHGFNWKLPGDMEKEDLNMEESFGLSTPKKYPLDAVAEPRL  505

Query  1566  PTH  1574
             P H
Sbjct  506   PPH  508



>gb|AAG44132.1|AF218296_1 cytochrome P450 [Pisum sativum]
Length=495

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 344/472 (73%), Gaps = 11/472 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGN NL+G++PHQSLH L+QKYG +M L FGSK V+V S+ E AK FL
Sbjct  33    YNLPPGPKPWPIIGNFNLIGTLPHQSLHGLTQKYGPIMHLWFGSKRVVVGSTVEMAKAFL  92

Query  303   KTHDAVFASRPA-TAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  +A  + T+N SD+TWS YGP+WR AR++ L E+F+ ++L+S+EY+R 
Sbjct  93    KTHDATLAGRPKFSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIRK  152

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E    +  L+D+      +LL+DHL   +L+ ++R+V G KY      L K E   I  
Sbjct  153   QELHVFLHELFDS--RNKTILLKDHLSSLSLNVISRMVLGRKY------LEKVENSIISP  204

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
              + +  LD+ FLL+G++N+GD++PW+  LD QGYVK+MK   ++++ F+ +V+E+H+   
Sbjct  205   DEFKNMLDELFLLNGILNIGDFIPWIHFLDFQGYVKRMKVLSKKFDGFMEHVLEEHIERR  264

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             KG +++  KDMVD+ LQ+A+DP+LE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  265   KGVKDYVAKDMVDVLLQLAEDPDLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISE  322

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L RKP I +KATEELDRVIGRERWVEEKD + LPY+ AI KET RLHP+  +L P  + E
Sbjct  323   LIRKPEIFKKATEELDRVIGRERWVEEKDIANLPYVYAIAKETMRLHPVAPMLVPREARE  382

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC + GY++P+G+ +L+N W+I R+S  WDN NEF PERFL KD+D+KG D+ LLPFG+G
Sbjct  383   DCNINGYDIPKGSLILVNTWTIARDSNVWDNPNEFMPERFLGKDIDVKGHDYELLPFGAG  442

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKF  1535
             RR CPGY LG+KV++++LANLLHGF W+L  D+K +D++M+E +GL+T  K 
Sbjct  443   RRMCPGYPLGIKVIQSSLANLLHGFNWRLSDDVKKEDLNMEEIFGLSTPKKI  494



>ref|XP_011035092.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/517 (51%), Positives = 357/517 (69%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M+ FS     + WL A+ +L K           K PPGP+PWPIIGN NLLG +PHQSLH
Sbjct  1     MDAFSLIVLVVAWLFALLYLPKF--FKSWLNPLKLPPGPKPWPIIGNFNLLGPLPHQSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS KYG+ M L FGS PVIV SS + AK  LKT+D +FASRP TAA  +T +  SD+ W
Sbjct  59    QLSLKYGKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR  RKI L+E+F+ ++L+S+EY+R+EE       LY   G    + L+D+L  
Sbjct  119   APYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLYRNCG--KSIELKDYLSH  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
             +TLS ++R+V G KY+S      + E   + L++ Q  LD+ FLL+GV+N+GDW+PWL  
Sbjct  177   YTLSIISRIVLGKKYFSA----SESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK  +  ++KF ++VI++H    K  +N+ PKDMVD+ LQ+ADDP LE  V
Sbjct  233   LDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKNWQPKDMVDLLLQLADDPELE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LTRD I GLT D++AGG DT A   +W+  EL +KP + ++ T+ELDRV+GRERWVEEK
Sbjct  291   KLTRDNIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRERWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D  QLPYI+AI+KE  R+HP   +L PH +++DC V GY++P+GT + IN WS+GR+   
Sbjct  351   DIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDCKVGGYDIPKGTRIFINTWSMGRDPDL  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             W++  +F PERF+ K VDIKG +F LLPFGSGRR CPGY LG K++  +LAN+LHGF W+
Sbjct  411   WEDPEDFRPERFIGKGVDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWE  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L   +KP+D+  DE +GL T  K+P     +PRLP H
Sbjct  471   LPPGIKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLH  507



>ref|XP_003627307.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
 gb|AET01783.1| cytochrome P450 family protein [Medicago truncatula]
Length=514

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/502 (50%), Positives = 357/502 (71%), Gaps = 12/502 (2%)
 Frame = +3

Query  75    IAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGS  254
             +  L  I  +   R+ Y  PPGP+PWPIIGN+NL+GS+PHQS+H L++KYG +M L FGS
Sbjct  19    VILLLFIHRLRLHRRKYNLPPGPKPWPIIGNMNLIGSLPHQSIHGLTKKYGPIMRLWFGS  78

Query  255   KPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLS  431
             K VIV SSP+ AK FLKT+D V   RP  A   +T +N S++TW+PYGP+++ ARK+   
Sbjct  79    KLVIVGSSPDIAKAFLKTNDIVLVGRPKFACGKYTTYNYSNITWNPYGPYFQQARKMFQR  138

Query  432   EVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYY  611
             E+F+ + L+S+EY+R EE    +  L+++      +LL+DHL  F+L+ ++R+V G KY 
Sbjct  139   ELFSVKSLESYEYMRKEELHIFLHKLFNS--KNKTILLKDHLSTFSLNIISRMVLGKKY-  195

Query  612   SKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREE  791
                  L K E   I  ++ +  LD+ FLL+GV N+GD++PW+  LDLQGYVK+MKA  + 
Sbjct  196   -----LEKSENVIISPEEFKEMLDELFLLNGVFNIGDFIPWIQFLDLQGYVKRMKACGKR  250

Query  792   YEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLA  971
             + +F+ +V+E+H+   K  +++  KDMVD+ LQ+A++PNLE  V + R+ +   T D++A
Sbjct  251   FNRFMEHVLEEHIERRKDVKDYVAKDMVDVLLQLAENPNLE--VKIKRNGVKAFTQDLIA  308

Query  972   GGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETF  1151
             GG DT++  +EWA  EL ++P II++ATEELDRVIGR+RWVEEKD   LPY+ AI KET 
Sbjct  309   GGTDTSSVIIEWAISELVKRPEIIKRATEELDRVIGRDRWVEEKDIVNLPYVFAIAKETM  368

Query  1152  RLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKD  1331
             RLHP+  +L P  + E+C V GY++P+GT +L+N W+IGR+S  WDN  EF PERF+  D
Sbjct  369   RLHPVTPMLVPREATENCNVDGYDIPKGTMILVNTWTIGRDSDSWDNPYEFIPERFINND  428

Query  1332  VD-IKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEA  1508
             +D IKG D+ +LP G+GRR CPGY LG+KVV+++LANLLHGF W+L  D+K +D++M+E 
Sbjct  429   IDIIKGHDYKMLPLGAGRRMCPGYPLGLKVVQSSLANLLHGFNWRLPNDMKKEDLNMEEI  488

Query  1509  YGLTTHPKFPLSYTIEPRLPTH  1574
             +GLTT  K PL   +EP+LP H
Sbjct  489   FGLTTPKKIPLEVVLEPKLPYH  510



>ref|XP_008678485.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
Length=533

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/527 (49%), Positives = 358/527 (68%), Gaps = 13/527 (2%)
 Frame = +3

Query  21    LMMEVFS--WFFQALPWLLAIAFL-FKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIP  191
             ++ME+ S       L  +L I  L  +      RR+ Y+ PPGPRPWP+IGNLNL+G++P
Sbjct  8     ILMELSSSPMLLTCLGMVLTIVILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALP  67

Query  192   HQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNR  368
             H+S+H LS KYGELM L+FGS  V+VASSPE A+LFLK HD +F  RP TAA  HT +N 
Sbjct  68    HRSIHELSNKYGELMHLRFGSYSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNY  127

Query  369   SDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLL-  545
             +D+TWSPYG +WRHAR+I  +++F+P +L SFE VR EE   L+ GL+ A G +  V L 
Sbjct  128   ADITWSPYGAYWRHARRICATQLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLG  187

Query  546   RDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFL---DDWFLLSGVINL  716
             +DHL  F+++ +TR+V G +++  D E  +      P+  L  F+   D+  LL+GV+N+
Sbjct  188   KDHLSTFSMNVITRMVLGKRFF--DGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNI  245

Query  717   GDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQI  893
             GDW+PWL  LDLQGYV++MK     ++ FL +V++ H    + + E+FA +DMVD+ +Q+
Sbjct  246   GDWIPWLDCLDLQGYVRRMKRVAARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQL  305

Query  894   ADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRV  1073
             ADDP   ++V + R  +   T D++ GG +  +ATVEWA  EL RKP ++  A EELDR 
Sbjct  306   ADDPT--SEVQIGRVGVKAFTQDLIVGGTEPVSATVEWAMSELLRKPSVLAMAAEELDRE  363

Query  1074  IGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLIN  1253
             +GR RWV EKD + LP + AI+KET R+HP+  LLPPH + ED  + GY++P+GT VLIN
Sbjct  364   VGRGRWVTEKDVAHLPCLQAIVKETMRVHPIAPLLPPHVTREDASIGGYDIPKGTHVLIN  423

Query  1254  VWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTL  1433
             VW+IGR+   WD   EF PERF+    D+KG+DF LLPFGSGRR CPGYSLG++ ++ +L
Sbjct  424   VWAIGRDPALWDAPEEFRPERFVGSKTDVKGRDFELLPFGSGRRMCPGYSLGLQEIQLSL  483

Query  1434  ANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ANLLHGF W L   +  +D+ MDE +GL+T  KFPL   + PRL + 
Sbjct  484   ANLLHGFTWTLPEGMAKEDLRMDELFGLSTTRKFPLEVVVRPRLASE  530



>ref|XP_007135432.1| hypothetical protein PHAVU_010G128900g [Phaseolus vulgaris]
 gb|ESW07426.1| hypothetical protein PHAVU_010G128900g [Phaseolus vulgaris]
Length=512

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/485 (49%), Positives = 356/485 (73%), Gaps = 11/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGNLNL+G +PH+S+H LS+KYG ++ + FGS PV+V SS + AK FL
Sbjct  34    YNLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIVHVWFGSNPVVVGSSVDMAKAFL  93

Query  303   KTHDAVFASRPA-TAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  +A  + T+N +D+TWS YGP+WR AR++ L E+F+ ++L+ +EY+R 
Sbjct  94    KTHDATVAGRPKFSAGKYTTYNYTDITWSQYGPYWRQARRMCLLELFSQKRLEEYEYIRK  153

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E  +L++ L+ +      +LL+DHL   +L+ + R+V G  Y      L + E   +  
Sbjct  154   QELRSLLNKLFHS--ADKTILLKDHLSNLSLNVICRMVLGKNY------LEESENAVVSP  205

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
             ++ +  +D+ FLL+GV+N+GD++PW++ LDLQGY+K+MK+  +++++FL +V+++H+   
Sbjct  206   EEFKRMIDELFLLNGVLNIGDFIPWINFLDLQGYIKRMKSCGKKFDRFLEHVLDEHIERK  265

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             KG +++  KDMVD+ LQ+A+DP LE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  266   KGVKDYVAKDMVDVLLQLAEDPTLE--VKLERQGVKAFTQDLIAGGTESSAVTVEWAISE  323

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L R+P I +KATEELDRVIGRERWVEEKD   LPY++AI+KE  RLHP+  +L P  + E
Sbjct  324   LLRRPEIFKKATEELDRVIGRERWVEEKDIVDLPYVNAIVKEVMRLHPVAPMLVPRMARE  383

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC + GY++P+GT VL++VW+IGR+   WD+ NEF PERFL K++D+KG ++ LLPFG+G
Sbjct  384   DCQIGGYDIPKGTQVLVHVWAIGRDPAIWDSPNEFQPERFLAKEIDVKGHNYELLPFGAG  443

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++ +LANLLHGF W+L  +++ +D++M+E +GL+T  K PL   ++P
Sbjct  444   RRMCPGYPLGLKVIQASLANLLHGFNWRLPQNVQTEDLNMEEIFGLSTPKKIPLETVLQP  503

Query  1560  RLPTH  1574
             RLP H
Sbjct  504   RLPHH  508



>ref|XP_006381618.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
 gb|ERP59415.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
Length=510

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/517 (51%), Positives = 358/517 (69%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME FS     L W+ A+ +L K       R   K PPGP+PWPIIGN +LLG +PHQSLH
Sbjct  1     MEAFSLVVLVLAWVSALLYLPKF--FKSLRNPLKLPPGPKPWPIIGNFDLLGPLPHQSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS KYG+ M L+FGS PV V SS + AK  LKT+D +FASRP TAA  +T +  SD+ W
Sbjct  59    QLSLKYGKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR  RKI L+E+F+ ++L+S+EY+RIEE       LY   G    + L+D+L  
Sbjct  119   APYGPYWRQGRKIYLTELFSAKRLESYEYMRIEEMREFTRRLYRNCG--KTIELKDYLSH  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
             +TLS ++R+V G KY+S      + E   + L++ Q  LD+ FLL+GV+N+GDW+PWL  
Sbjct  177   YTLSIISRIVLGKKYFSA----SESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LD+QGYVK+MK  +  +++F ++VI++H A  K  +N+ PKDMVD+ LQ+ADDP LE  V
Sbjct  233   LDMQGYVKRMKELKVRFDRFHDHVIDEHNAKRKATKNWQPKDMVDLLLQLADDPELE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LTRD I GLT D++AGG DT A   +W+  EL +KP + ++ T+ELDRV+GR+RWVEEK
Sbjct  291   KLTRDNIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRDRWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D  QLPYI+AI+KE  R+HP   +L PH +++D  V GY++P+GT + IN WS+GR+   
Sbjct  351   DIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTWSMGRDPDL  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             W++  +F PERF+ K +DIKG +F LLPFGSGRR CPGY LG K++  +LAN+LHGF W+
Sbjct  411   WEDPEDFRPERFIGKGIDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWE  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L   +KP+D+  DE +GL T  K+P     +PRLP H
Sbjct  471   LPPGMKPQDVKRDEVFGLATQRKYPTVAVAKPRLPLH  507



>gb|AER39773.1| CYP92A44-3 [Festuca rubra subsp. commutata]
Length=516

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/509 (50%), Positives = 360/509 (71%), Gaps = 14/509 (3%)
 Frame = +3

Query  69    LAIAFLFKITTIHQRR--KAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLL  242
             + +A +  +  + QRR  + Y  PPGP+ WPIIGNLNL+G++PH+S+H+LS++YG L+ L
Sbjct  12    VVLATVLFLMAVLQRRSSRKYNLPPGPKAWPIIGNLNLIGTLPHRSIHALSKQYGPLLQL  71

Query  243   KFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARK  419
             +FGS P +V SS E AK FLKTHD +F  RP  AA  HT +N SD+TWSPYG +WR ARK
Sbjct  72    QFGSFPCVVGSSVEMAKFFLKTHDVMFTDRPKFAAGKHTTYNYSDITWSPYGAYWRQARK  131

Query  420   ILLSEVFTPRKLDSFEYVRIEERMALISGLYDA--VGTKNPVLLRDHLVRFTLSTMTRLV  593
             + L+E+F+ R+L S+EY+R EE +AL+  L+    VG    ++L+D+L   +L+ +TR+V
Sbjct  132   MCLTELFSARRLQSYEYIRSEEVLALLRDLHRGATVGAGRALVLKDYLSTVSLNVITRMV  191

Query  594   TGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKM  773
              G KY  K+   G     + P  + +  +D+ FLL+GV+N+GD +PWL  +DLQGY+K+M
Sbjct  192   MGKKYLEKEVRDGSGAVITTP-DEFKWMIDELFLLNGVLNIGDSIPWLDWMDLQGYIKRM  250

Query  774   KAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             K   + +++FL +V+++H    + + E+F  KDMVD+ LQ A +P+LE  V L R+ +  
Sbjct  251   KKLSKMFDRFLEHVVDEHSERRRHEAESFVAKDMVDVLLQFASNPDLE--VKLNREGVKA  308

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
              T D++AGG +++A TVEWA  EL +KP +  +ATEELDRV+GR RWV EKD   LPY+D
Sbjct  309   FTQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWVTEKDMPSLPYVD  368

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET RLHP+  +L P  S E   + GY++P GT VL++VW+IGR+ + WD   EF P
Sbjct  369   AIVKETMRLHPVAPMLVPRLSREVTTIGGYDIPAGTRVLVSVWTIGRDPELWDAPEEFMP  428

Query  1311  ERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL-DGDLKPK  1487
             ERFL   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF+WKL DG     
Sbjct  429   ERFLGSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFEWKLPDG----V  484

Query  1488  DISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ++SM+E +GL+T  KFPL   +EP+LP H
Sbjct  485   ELSMEEIFGLSTPRKFPLEAVVEPKLPAH  513



>ref|XP_002324180.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
 gb|EEF02745.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
Length=510

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/517 (51%), Positives = 357/517 (69%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M+ FS     + WL A+ +L K           K PPGP+PWPIIGN NLLG +PHQSLH
Sbjct  1     MDAFSLIVLVVAWLFALLYLPKY--FKSWLSPLKLPPGPKPWPIIGNFNLLGPLPHQSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS KYG+ M L FGS PV+V SS + AK  LKT+D +FASRP TAA  +T +  SD+ W
Sbjct  59    QLSLKYGKTMQLHFGSYPVMVTSSLDMAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR  RKI L+E+F+ ++L+S+EY+R+EE       LY   G    + L+D+L  
Sbjct  119   APYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLYRNCG--KSIELKDYLSH  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
             +TLS ++R+V G KY+S      + E   + L++ Q  LD+ FLL+GV+N+GDW+PWL  
Sbjct  177   YTLSIISRIVLGKKYFSA----SESEKEIVSLEEFQEMLDELFLLNGVLNIGDWIPWLDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK  +  ++KF ++VI++H    K  +N+ PKDMVD+ LQ+ADDP LE  V
Sbjct  233   LDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKNWQPKDMVDLLLQLADDPELE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LTRD + GLT D++AGG DT A   +W+  EL +KP + ++ T+ELDRV+GRERWVEEK
Sbjct  291   KLTRDNMKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRERWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D  QLPYI+AI+KE  R+HP   +L PH +++DC V GY++P+GT + IN WS+GR+   
Sbjct  351   DIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDCKVGGYDIPKGTRIFINTWSMGRDPDL  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             W++  +F PERF+ K VDIKG +F LLPFGSGRR CPGY LG K++  +LAN+LHGF W+
Sbjct  411   WEDPEDFRPERFIGKGVDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWE  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L   +KP+D+  DE +GL T  K+P     +PRLP H
Sbjct  471   LPPGIKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLH  507



>gb|AFW61881.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=557

 Score =   533 bits (1372),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 259/526 (49%), Positives = 358/526 (68%), Gaps = 13/526 (2%)
 Frame = +3

Query  21    LMMEVFS--WFFQALPWLLAIAFL-FKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIP  191
             ++ME+ S       L  +L I  L  +      RR+ Y+ PPGPRPWP+IGNLNL+G++P
Sbjct  32    ILMELSSSPMLLTCLGMVLTIVILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALP  91

Query  192   HQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNR  368
             H+S+H LS KYGELM L+FGS  V+VASSPE A+LFLK HD +F  RP TAA  HT +N 
Sbjct  92    HRSIHELSNKYGELMHLRFGSYSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNY  151

Query  369   SDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLL-  545
             +D+TWSPYG +WRHAR+I  +++F+P +L SFE VR EE   L+ GL+ A G +  V L 
Sbjct  152   ADITWSPYGAYWRHARRICATQLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLG  211

Query  546   RDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFL---DDWFLLSGVINL  716
             +DHL  F+++ +TR+V G +++  D E  +      P+  L  F+   D+  LL+GV+N+
Sbjct  212   KDHLSTFSMNVITRMVLGKRFF--DGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNI  269

Query  717   GDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQI  893
             GDW+PWL  LDLQGYV++MK     ++ FL +V++ H    + + E+FA +DMVD+ +Q+
Sbjct  270   GDWIPWLDCLDLQGYVRRMKRVAARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQL  329

Query  894   ADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRV  1073
             ADDP   ++V + R  +   T D++ GG +  +ATVEWA  EL RKP ++  A EELDR 
Sbjct  330   ADDPT--SEVQIGRVGVKAFTQDLIVGGTEPVSATVEWAMSELLRKPSVLAMAAEELDRE  387

Query  1074  IGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLIN  1253
             +GR RWV EKD + LP + AI+KET R+HP+  LLPPH + ED  + GY++P+GT VLIN
Sbjct  388   VGRGRWVTEKDVAHLPCLQAIVKETMRVHPIAPLLPPHVTREDASIGGYDIPKGTHVLIN  447

Query  1254  VWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTL  1433
             VW+IGR+   WD   EF PERF+    D+KG+DF LLPFGSGRR CPGYSLG++ ++ +L
Sbjct  448   VWAIGRDPALWDAPEEFRPERFVGSKTDVKGRDFELLPFGSGRRMCPGYSLGLQEIQLSL  507

Query  1434  ANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPT  1571
             ANLLHGF W L   +  +D+ MDE +GL+T  KFPL   + PRL +
Sbjct  508   ANLLHGFTWTLPEGMAKEDLRMDELFGLSTTRKFPLEVVVRPRLAS  553



>ref|XP_002445595.1| hypothetical protein SORBIDRAFT_07g022320 [Sorghum bicolor]
 gb|EES15090.1| hypothetical protein SORBIDRAFT_07g022320 [Sorghum bicolor]
Length=530

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 260/516 (50%), Positives = 356/516 (69%), Gaps = 18/516 (3%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +LAI    +       R+ Y+ PPGP PWP+IGN NL+G++PH+S+H LS+KYGELM L+
Sbjct  15    VLAIVIFGRRLKGRPSRRVYRLPPGPSPWPVIGNFNLIGALPHRSIHELSKKYGELMHLR  74

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS  V+VASS E AKLFLKTHD +F  RP TAA  HT +N  D+TWSPYG +WRHAR+I
Sbjct  75    FGSYTVVVASSAEMAKLFLKTHDLLFLDRPRTAAGRHTTYNYGDITWSPYGAYWRHARRI  134

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLL-RDHLVRFTLSTMTRLVTG  599
               +++F P +L SFE++R +E  +L+ GL+ A  +   V L +DHL  F+++ +TR+V G
Sbjct  135   CATQLFIPGRLASFEHIRADEVRSLVRGLFAASASGRAVRLGKDHLSTFSMNVITRMVLG  194

Query  600   NKYYSKDWELGKPEGYSIPLKKLQGFL---DDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
              + +  D   G+      P+  L  F+   D+  LL+GV+N+GDW+PWL  LDLQGYV++
Sbjct  195   KRLF--DAAGGENAAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWIPWLDRLDLQGYVRR  252

Query  771   MKAFREEYEKFLNYVIEDHMAMM-----KGDENFAPKDM--VDIFLQIADDPNLEADVAL  929
             MK   E ++ FL +V++ H         +  E+F  +DM  VD+ +Q+ADDP    DV +
Sbjct  253   MKRVAERFDAFLEHVLDAHSQHQQRRHERDGESFVARDMDMVDVLMQLADDPTF--DVQI  310

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
              R  +   T D++ GG ++TA TVEWA  EL R P ++  A EELDRV+GR RWV EKD 
Sbjct  311   GRVGVKAFTQDLIVGGSESTAVTVEWAMSELLRNPSVLAMAAEELDRVVGRGRWVTEKDV  370

Query  1110  SQ-LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYW  1286
             +  LPY+ A+IKET R+HP+  LLPPH + ED  +AGY++P+GT VLINVW+IGR+   W
Sbjct  371   AHDLPYLQAVIKETMRVHPVAPLLPPHVAREDASIAGYDIPKGTHVLINVWTIGRDPAVW  430

Query  1287  DNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL  1466
             D   EF PERF+   VD+KGQDF LLPFGSGRR CPGY+LG+K ++ +LANLLHGF W+L
Sbjct  431   DAPEEFRPERFVGSKVDVKGQDFELLPFGSGRRMCPGYNLGLKEIQLSLANLLHGFTWRL  490

Query  1467  -DGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPT  1571
              +G +K +D+SMDE +GL+T  KFPL   ++PRLP+
Sbjct  491   PEGMVKEEDLSMDELFGLSTTRKFPLEVIVQPRLPS  526



>ref|XP_002303387.2| hypothetical protein POPTR_0003s06510g [Populus trichocarpa]
 gb|ABK96148.1| unknown [Populus trichocarpa]
 gb|EEE78366.2| hypothetical protein POPTR_0003s06510g [Populus trichocarpa]
Length=509

 Score =   530 bits (1366),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 255/515 (50%), Positives = 356/515 (69%), Gaps = 14/515 (3%)
 Frame = +3

Query  36    FSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLL-GSIPHQSLHSL  212
              S F   L   +A+  LF+    H  R     PPGP+PWPIIGNLNLL G +PH+++H+L
Sbjct  3     LSTFAALLLATVAVITLFR----HLTRPKLNLPPGPKPWPIIGNLNLLTGPLPHRNMHAL  58

Query  213   SQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSP  389
              QKYG +M LKFGS PV+V SS E A+  LKT+D   A RP  AA  +T +N S++TWS 
Sbjct  59    VQKYGPIMQLKFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQ  118

Query  390   YGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFT  569
             YGP+WR ARKI L E+F+P++LD FE VR++E  AL+  L+ + G   P+  RD     +
Sbjct  119   YGPYWRQARKICLMEIFSPKRLDQFETVRVQELHALLRKLFVSAG--KPINARDEFSDLS  176

Query  570   LSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLD  749
             LS ++RLV G  Y  K    G  + Y  P K+ +  +D+ FLL+GV+++GD +PWL+ LD
Sbjct  177   LSVISRLVLGKNYTVKT---GNQKQYMSP-KEFKEMIDELFLLNGVLDIGDSIPWLAFLD  232

Query  750   LQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVAL  929
             LQGY+K+MKA  + ++ FL Y + +H    KG +++ P+DM+DI LQ++DDPNLE  V L
Sbjct  233   LQGYIKRMKAVGQLFDGFLEYTLNEHQQRRKGVKDYVPQDMMDILLQLSDDPNLE--VQL  290

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
              R  +   T D++AGG +++A T EWA  EL +KP   ++A EELDRVIGR+RW+EEKD 
Sbjct  291   DRTAVKAFTMDLIAGGTESSAVTTEWAMAELLKKPEYFKRANEELDRVIGRDRWIEEKDI  350

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWD  1289
               LP+I+AI KET RLHP+   L P  + ED  + GY++P+GT V++NVW+IGR++  W+
Sbjct  351   VNLPFINAICKETMRLHPVSPFLVPRLAREDIQLGGYDIPKGTRVMVNVWTIGRDASIWE  410

Query  1290  NANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLD  1469
               +EFCPERF+ K +D+KG +F LLPFG+GRR C GYSLG+KV++ ++ANLLHGFKWKL 
Sbjct  411   KPHEFCPERFIGKSIDVKGHNFELLPFGAGRRMCVGYSLGLKVIQASVANLLHGFKWKLP  470

Query  1470  GDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             GD+K ++++M E +GL+T  +  L   +EPRLP H
Sbjct  471   GDMKTEELNMQEIFGLSTPKQIALVAELEPRLPAH  505



>ref|XP_008344136.1| PREDICTED: flavonoid 3'-monooxygenase-like, partial [Malus domestica]
Length=483

 Score =   529 bits (1362),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 262/488 (54%), Positives = 348/488 (71%), Gaps = 10/488 (2%)
 Frame = +3

Query  27    MEVFSW-FFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSL  203
             ME FS      L  L  +A + K  T+  + K  K PPGP PWPIIGNLNL+G +PHQSL
Sbjct  1     MEYFSCAVILTLACLATLALVSK--TLFPQLKXQKFPPGPNPWPIIGNLNLIGPLPHQSL  58

Query  204   HSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMT  380
             H LS  YG +M L  GS+PV+VASSPE AK FLKTHD VF+SRP TAA  + T++   ++
Sbjct  59    HKLSLTYGPIMQLXXGSRPVVVASSPEMAKQFLKTHDHVFSSRPQTAAGKYLTYDYQSVS  118

Query  381   WSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLV  560
             WSPYGP+WR  RKI L E+F+ ++L+SFEY+R+EE  A  S L     + NPV+L++HL 
Sbjct  119   WSPYGPYWRQGRKIFLYELFSSKRLESFEYIRVEENRAFTSRLCAIAKSGNPVVLKEHLS  178

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
             R T S M+R+V G  Y+S    + + EG  + LK+ Q  LD++F+L+GV N+GDW+PWL+
Sbjct  179   RLTFSIMSRIVLGKDYFS----VAEYEGSIMSLKEFQDMLDEFFVLNGVFNIGDWIPWLN  234

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
              LDL GY+K+MKA +++  +F ++++ +H A  +G E F PKDMVD+ LQ+ D  N + +
Sbjct  235   FLDLHGYIKRMKAMQKKINRFYDFMLNEHKAQKEGVEEFVPKDMVDLLLQLVDGSN-DLE  293

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L  D I   T D++AGG DT+A  +EWA  EL ++P +I+KATEELDRVIGRERWVEE
Sbjct  294   VKLNYDSIKAFTQDLIAGGTDTSATNLEWAMSELIKQPSLIKKATEELDRVIGRERWVEE  353

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD +QLPYIDAI+KET R HP   +LPPH ++E+  VAGY+V +GT V +N WS+GR+ K
Sbjct  354   KDLAQLPYIDAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTVVFVNTWSMGRDPK  413

Query  1281  YWDNANEFCPERFLEK-DVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
              W+   EF PERFL    +D++GQ F LLPFGSGRR CPGY LG+K++RT LAN+LHGF 
Sbjct  414   LWEEPEEFRPERFLGNIGIDLQGQSFELLPFGSGRRMCPGYKLGLKMIRTCLANMLHGFN  473

Query  1458  WKLDGDLK  1481
             WKL G++K
Sbjct  474   WKLPGNVK  481



>gb|EMS57898.1| Flavonoid 3'-monooxygenase [Triticum urartu]
Length=515

 Score =   530 bits (1365),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 256/501 (51%), Positives = 353/501 (70%), Gaps = 12/501 (2%)
 Frame = +3

Query  84    LFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPV  263
             LF    +  RR+ +  PPGP+PWPIIGNLNL+G++PH+S+H+LS++YG LM L+FGS PV
Sbjct  18    LFLKAVLRLRRRQHNLPPGPKPWPIIGNLNLIGTLPHRSIHALSKQYGPLMQLQFGSFPV  77

Query  264   IVASSPETAKLFLKTHDAVFASRPATAAAHHTF--NRSDMTWSPYGPFWRHARKILLSEV  437
             +V SS E AK FLKTHD VF  RP TAA   T   N SD+TWSPYG +WR ARK+ L+E+
Sbjct  78    VVGSSVEMAKFFLKTHDVVFTDRPKTAAGRDTTYNNYSDITWSPYGAYWRQARKMCLTEL  137

Query  438   FTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSK  617
             F+ ++L+S+EY+R EE +AL+  LY   G    V+L+D+L   +L+ +TR+V G KY  K
Sbjct  138   FSAKRLESYEYIRREEVLALLGDLYRG-GAGRVVVLKDYLSTVSLNVITRMVMGKKYLEK  196

Query  618   DWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYE  797
             +         + P ++ +  +D+ FLL+GV+N+GD +PWL  +DLQGY+K+MK   + ++
Sbjct  197   EVRDEAGAVITTP-EEFKWMIDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMKKLSKMFD  255

Query  798   KFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAG  974
             +FL +V+++H    + + E+F   DMVD+ LQ A DP LE  V L R+ +   T D++AG
Sbjct  256   RFLEHVVDEHSERRRCEGESFVVNDMVDVLLQFASDPGLE--VKLNREGVKAFTQDLIAG  313

Query  975   GEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFR  1154
             G +++A TVEWA  EL +KP ++ KATEELDRV+GR RWV EKD   LPY+DAI+KET R
Sbjct  314   GTESSAVTVEWALSELLKKPEVLAKATEELDRVVGRGRWVTEKDMPSLPYVDAIVKETMR  373

Query  1155  LHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDV  1334
             LHP+  +L P  S ED  + GY++P GT  L+ VWSIGR+ + W+   EF PERFL   +
Sbjct  374   LHPVAPMLVPRLSREDTSINGYDIPAGTRGLVMVWSIGRDPELWEAPEEFMPERFLGSRL  433

Query  1335  DIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL-DGDLKPKDISMDEAY  1511
             D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W+L DG     ++SM+E +
Sbjct  434   DVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFTWRLPDG----VELSMEEIF  489

Query  1512  GLTTHPKFPLSYTIEPRLPTH  1574
             GL+T  K PL   +EP+LP H
Sbjct  490   GLSTPRKCPLEAVVEPKLPAH  510



>ref|XP_004165407.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=516

 Score =   530 bits (1365),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 252/483 (52%), Positives = 345/483 (71%), Gaps = 11/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNL+L+GS+PHQS+H LS+KYG +M L+FGS PV+V SS E AK+ LKT 
Sbjct  38    PPGPKPWPIIGNLDLIGSLPHQSIHQLSKKYGPIMHLRFGSFPVVVGSSVEMAKIVLKTQ  97

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F  RP TAA  +T +N S++TWS YGP+WR  RK+ L E+F+ R+LDS+EY+R EE 
Sbjct  98    DLNFVWRPKTAAGKYTTYNYSNITWSQYGPYWRQLRKMCLMELFSARRLDSYEYIRKEEM  157

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
               LI  +Y + G    + ++D+L   +L+ ++R+V G +Y  +  E G      +   + 
Sbjct  158   NGLIREIYKSCG--EVIKVKDYLFALSLNVISRMVLGKRYTDESSESG-----IVSPDEF  210

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +  +D+ FLL+GV+N+GD +PW+  LDLQGYVK+MK   ++ ++FL +V+++H    KG 
Sbjct  211   RKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKRMKGLSKKLDRFLEHVLDEHKERRKGV  270

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             EN+  KDMVD+ LQ+AD P+LE  V L R  +   T D+L GG +T+  T+EWA  EL +
Sbjct  271   ENYVAKDMVDVLLQLADHPDLE--VKLERHGVKAFTQDLLGGGTETSTITIEWAMSELLK  328

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
              P I  KAT EL++VIG+ERWVEEKD   LPYI+AI KET RLHP+  +L P  + EDC 
Sbjct  329   NPKIFNKATIELNKVIGKERWVEEKDMINLPYINAIAKETMRLHPVVPMLVPRMAGEDCQ  388

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKD-VDIKGQDFALLPFGSGRR  1385
             +AGY++ +GT VL+NVW+IGR+   W N + F P+RF+E   VD+KGQDF LLPFGSGRR
Sbjct  389   IAGYDIAKGTRVLVNVWTIGRDQTVWKNPHAFDPDRFIENSRVDVKGQDFELLPFGSGRR  448

Query  1386  KCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
              CPGYSLG+KV+ +TLANLLHGF WKL GD++ +D++M+E +GL+T  K+PL    EPRL
Sbjct  449   MCPGYSLGLKVILSTLANLLHGFNWKLPGDMEKEDLNMEEIFGLSTPKKYPLDAVAEPRL  508

Query  1566  PTH  1574
             P H
Sbjct  509   PPH  511



>emb|CDP12827.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   530 bits (1364),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 256/519 (49%), Positives = 364/519 (70%), Gaps = 15/519 (3%)
 Frame = +3

Query  27    MEVFS--WFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQS  200
             ME FS  W   AL W+  +  + +++  H  +K    PPGPR WPIIGNLNL+G++PH+S
Sbjct  1     MESFSPNWAACALVWVATVVIITQLSK-HFHQKKLNLPPGPRQWPIIGNLNLIGTLPHRS  59

Query  201   LHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDM  377
             LH LS  YG LM L+FGS PV+V SS E AK+FLKT D  FA RP TAA  + T+N SD+
Sbjct  60    LHHLSLTYGPLMHLQFGSFPVVVGSSVEMAKVFLKTMDLTFAGRPKTAAGKYITYNYSDL  119

Query  378   TWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHL  557
              WSPYGP+   ARKI L+E+F+ ++L+S+E++++EE  +L+  L+ + G   PV+L+D+L
Sbjct  120   LWSPYGPYCCQARKIFLTELFSAKRLESYEHIQVEEMNSLLLQLFKSSG--KPVVLKDYL  177

Query  558   VRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWL  737
                +L+ ++R+V G  Y      + + E   +  ++ +  +D++FLL+GV N+GD++PW+
Sbjct  178   STGSLNVISRMVLGKTY------IDESENSIVTPEEFRQMMDEFFLLTGVFNIGDFIPWI  231

Query  738   SGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEA  917
               LDLQGY+K+MK   +++++FL +V+++H A  K + N   KD+VD+ L +ADDP LE 
Sbjct  232   DFLDLQGYIKRMKILSKKFDRFLEHVLDEHNAQRKDETNCVSKDLVDVLLGLADDPTLE-  290

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V L R  +  LT D+L  G +T+A T+EWA  EL + P I +KA EELDRVIG+ RWV+
Sbjct  291   -VKLERREVKALTLDLLTAGTETSAITIEWAISELLKNPEIFDKAGEELDRVIGQNRWVK  349

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             EKD   LPYI+AI+KET R+HP   LL P  + EDC VAGY++ +GT V +NVWSIGR+ 
Sbjct  350   EKDMPNLPYIEAIVKETMRMHP-AALLTPRCAREDCKVAGYDIQKGTRVAVNVWSIGRDP  408

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
             + W+   EF P+RF+ KD+D KGQD   LPFG+GRR CP YSLG+KVV+++LANLLHG++
Sbjct  409   ELWEKPEEFWPDRFMGKDIDFKGQDCKFLPFGAGRRMCPAYSLGLKVVQSSLANLLHGYR  468

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL  D+KP+D+ M+E +G+TT  K PL   +EPRLP +
Sbjct  469   WKLPNDMKPEDLDMEEIFGITTPRKIPLVAIVEPRLPCN  507



>ref|XP_002310738.2| hypothetical protein POPTR_0007s11380g, partial [Populus trichocarpa]
 gb|EEE91188.2| hypothetical protein POPTR_0007s11380g, partial [Populus trichocarpa]
Length=487

 Score =   528 bits (1360),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 249/489 (51%), Positives = 343/489 (70%), Gaps = 22/489 (4%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             RR+    PPGP+PWPIIGNLNL+G +PH+SL +LS+KYG LM +KFGS PV+V SS E A
Sbjct  16    RRRKLHLPPGPKPWPIIGNLNLMGELPHRSLEALSKKYGSLMQVKFGSHPVVVGSSVEMA  75

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             +  LKTHD   A RP TA+  +T +N  ++TW+PYGP+WR ARK+ L E+F+P++LD FE
Sbjct  76    RAILKTHDLSLAGRPKTASGKYTTYNYQNITWAPYGPYWRQARKLCLIELFSPKRLDQFE  135

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R+EE +  ++ L+   G   P+ +RDH    + S ++RLV G KY ++  +    E  
Sbjct  136   YIRVEENLKFLNTLFQKRG--KPITVRDHFSDLSFSVISRLVLGRKYMAESED----EKD  189

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              + LK+L+  LD+ FLL+GV+ +GD++PWL+ LDLQGY+K+MKA  ++ + F+ +  E  
Sbjct  190   MLSLKELKEVLDEMFLLNGVLVIGDFIPWLAFLDLQGYIKRMKAVAKKMDMFMEHANE--  247

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                        P+DM+DI LQ+ADDPNLE  V L R  +   T D++ GG +++A T EW
Sbjct  248   -----------PRDMLDILLQVADDPNLE--VKLDRIGVKAFTQDLINGGTESSAVTTEW  294

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  E+ +KP I +KATEELDRVIGRERWV+E D   LP+I+AI+KET RLHP+  LL P 
Sbjct  295   ALAEIMKKPEIFDKATEELDRVIGRERWVQENDIDNLPFINAIVKETMRLHPVAPLLVPR  354

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
              + ED  +AGY++P+GT VL+N  +IGR+   WD   EFCPERF+ K VD+KG DF LLP
Sbjct  355   LAREDIQIAGYDIPKGTRVLVNASAIGRDPSLWDKPKEFCPERFIGKSVDVKGHDFELLP  414

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY LG+KV++T++ANLLH FKWKL  ++  KD++M+E  GL+   K PL  
Sbjct  415   FGAGRRICPGYPLGLKVIQTSVANLLHEFKWKLPNNMTAKDLNMEEILGLSAPRKVPLVA  474

Query  1548  TIEPRLPTH  1574
              +EPRLP+ 
Sbjct  475   VLEPRLPSE  483



>gb|AER39771.1| CYP92A44-1 [Festuca rubra subsp. commutata]
Length=516

 Score =   529 bits (1363),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 253/508 (50%), Positives = 355/508 (70%), Gaps = 12/508 (2%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +LA     K     +  + Y  PPGP+ WPIIGNLNL+G++PH+S+H+LS++YG L+ L+
Sbjct  13    VLATVLFLKAVLRRRSSRKYNLPPGPKAWPIIGNLNLIGTLPHRSIHALSKQYGPLLQLQ  72

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS P +V SS E AK FLKTHD +F  RP  AA  HT +N SD+TWSPYG +WR ARK+
Sbjct  73    FGSFPCVVGSSVEMAKFFLKTHDVMFTDRPKFAAGKHTTYNYSDITWSPYGAYWRQARKM  132

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDA--VGTKNPVLLRDHLVRFTLSTMTRLVT  596
              L+E+F+ R+L S+EY+R EE +AL+  L+    VG    ++L+D+L   +L+ +TR+V 
Sbjct  133   CLTELFSARRLQSYEYIRSEEVLALLRDLHRGATVGAGRALVLKDYLSTVSLNVITRMVM  192

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G KY  K+   G     + P  + +  +D+ FLL+GV+N+GD +PWL  +DLQGY+K+MK
Sbjct  193   GKKYLEKEVRDGSGAVITTP-DEFKWMIDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMK  251

Query  777   AFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL +V+++H    + + E+F  KDMVD+ LQ A +P+LE  V L R+ +   
Sbjct  252   KLSKMFDRFLEHVVDEHSERRRHEAESFVAKDMVDVLLQFASNPDLE--VKLNREGVKAF  309

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
             T D++AGG +++A TVEWA  EL +KP +  +ATEELDRV+GR RWV EKD   LPY+DA
Sbjct  310   TQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWVTEKDMPSLPYVDA  369

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET RLHP+  +L P  S E   + GY++P GT VL++VW+IGR+ + WD   EF PE
Sbjct  370   IVKETMRLHPVAPMLVPRLSREVTTIGGYDIPAGTRVLVSVWTIGRDPELWDAPEEFMPE  429

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL-DGDLKPKD  1490
             RFL   +D+KGQD+ LLPFGSGRR CPGYS G+KV++ +LANLLHGF+WKL DG     +
Sbjct  430   RFLGSRLDVKGQDYELLPFGSGRRMCPGYSPGLKVIQVSLANLLHGFEWKLPDG----VE  485

Query  1491  ISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +SM+E +GL+T  KFPL   +EP+LP H
Sbjct  486   LSMEEIFGLSTPRKFPLEAVVEPKLPAH  513



>ref|XP_003528553.1| PREDICTED: flavonoid 3'-monooxygenase [Glycine max]
Length=516

 Score =   529 bits (1362),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 248/485 (51%), Positives = 352/485 (73%), Gaps = 11/485 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+PWPIIGNLNL+GS+PH+S+H+LS+KYG +M + FGS  V+V SS E AK  L
Sbjct  38    YNLPPGPKPWPIIGNLNLIGSLPHRSIHTLSKKYGPIMHVWFGSSSVVVGSSVEIAKAVL  97

Query  303   KTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHDA  A RP  AA  +T +N SD+TWS YGP+WR AR++ L E+F+ ++L  +EY+R 
Sbjct  98    KTHDATLAGRPKFAAGKYTTYNYSDITWSQYGPYWRQARRMCLMELFSAKRLQEYEYIRK  157

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E   L++ L+++      +LL+DHL   +L+ ++R+V G KY      L + +   +  
Sbjct  158   QELRCLLNELFNSANKT--ILLKDHLSSLSLNVISRMVLGKKY------LEESQNAVVSP  209

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
              + +  LD+ FLL+GV N+GD++PW+  LDLQGY+K+MK   ++++ F+ +V+++H+   
Sbjct  210   DEFKKMLDELFLLNGVYNIGDFIPWIDFLDLQGYIKRMKTLSKKFDMFMEHVLDEHIERK  269

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             KG +++  KDMVD+ LQ+A+DP LE  V L R  +   T D++AGG +++A TVEWA  E
Sbjct  270   KGIKDYVAKDMVDVLLQLAEDPTLE--VKLERHGVKAFTQDLIAGGTESSAVTVEWAISE  327

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L R+P I +KATEELDRVIGRERWVEEKD   LPY++AI+KE  RLHP+  +L P  + E
Sbjct  328   LLRRPEIFKKATEELDRVIGRERWVEEKDIVNLPYVNAIVKEAMRLHPVAPMLVPRLARE  387

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC + GY++P+GT VL+NVW+IGR+   WDN NEF PERFL K++D+KG D+ LLPFG+G
Sbjct  388   DCNLGGYDIPKGTQVLVNVWTIGRDPSIWDNPNEFQPERFLNKEIDVKGHDYELLPFGAG  447

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEP  1559
             RR CPGY LG+KV++ +LANLLHGF W+L  +++ +D++MDE +GL+T  K PL   +EP
Sbjct  448   RRMCPGYPLGLKVIQASLANLLHGFNWRLPDNVRKEDLNMDEIFGLSTPKKLPLETVVEP  507

Query  1560  RLPTH  1574
             RLP H
Sbjct  508   RLPYH  512



>ref|XP_003627306.1| Flavonoid 3',5'-hydroxylase [Medicago truncatula]
Length=505

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 249/479 (52%), Positives = 349/479 (73%), Gaps = 11/479 (2%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGP+ WPIIGNLNL+GS+PHQSLH L++KYG +M L FGSKPVIV SSPE AK+FL
Sbjct  36    YNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKKYGPIMHLWFGSKPVIVGSSPEIAKVFL  95

Query  303   KTHDAVFASRPA-TAAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KT+DAV A RP  +A  + T+N S++TWS YGP+W+ ARK+ L E+F+ ++L+S+EY+R 
Sbjct  96    KTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGPYWQQARKMCLLELFSVKRLESYEYMRK  155

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             +E  A +  L+++      +LL+DHL   +L+ ++R+V G KY      L K E   I  
Sbjct  156   QELHAFLHELFNS--KNKTILLKDHLSTLSLNVISRMVLGKKY------LEKSENAIISP  207

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
             ++ +  LD+ FLL+GV+N+GD++PW+  LDLQGYVK+MK   ++++ F+ +V+E+H+   
Sbjct  208   EEFKKMLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMKTLGKKFDWFMEHVLEEHIERR  267

Query  840   KGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQE  1019
             K   ++  KDMVD+ L++A++P+LE  V L R  +   T D++AGG DT+  TVEWA  E
Sbjct  268   KCVNDYVAKDMVDVLLKLAENPSLE--VKLERHGVKAFTQDLIAGGTDTSTVTVEWAISE  325

Query  1020  LFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIE  1199
             L +KP II++ATEELD+VIGR+RWVEEKD   LPY+ AI KET RLHP   LL P  + E
Sbjct  326   LVKKPEIIKRATEELDKVIGRDRWVEEKDIVNLPYVFAIAKETMRLHPAAPLLVPREASE  385

Query  1200  DCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSG  1379
             DC V GY++P+GT +L+N W+IGR+   WDN  EF PERF+  ++D+KG D+ LLPFG+G
Sbjct  386   DCNVDGYDIPKGTLILVNTWTIGRDPNVWDNPYEFIPERFIGNNIDVKGHDYELLPFGTG  445

Query  1380  RRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIE  1556
             RR CPGY LG+KV++++LANLLHGF W+L  D+K +D++M+E +GLTT  K PL   +E
Sbjct  446   RRMCPGYPLGLKVIQSSLANLLHGFNWRLPNDMKKEDLNMEEIFGLTTPRKIPLEVVVE  504



>ref|XP_011015794.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   528 bits (1361),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 263/517 (51%), Positives = 355/517 (69%), Gaps = 11/517 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M+ FS     + WL A+ +L K           K PPGP+PWPIIGN NLLG +PHQSLH
Sbjct  1     MDAFSLIVLVVAWLFALLYLPKF--FKSWLNPLKLPPGPKPWPIIGNFNLLGPLPHQSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS KYG+ M L FGS PVIV SS + AK  LKT+D +FASRP TAA  +T +  SD+ W
Sbjct  59    QLSLKYGKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFASRPQTAAGKYTTYEYSDLAW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             +PYGP+WR  RKI L+E+F+ ++L+S+EY+R+EE       LY   G    + L+D+L  
Sbjct  119   APYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLYRNCG--KSIELKDYLSH  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
             +TLS ++R+V G KY+S      + E   + L++ Q  LD+ FLL+GV+N+GDW+PWL  
Sbjct  177   YTLSIISRIVLGKKYFSA----SESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYVK+MK  +  ++KF ++VI++H    K  +N+ PKDMVD+ LQ+ADDP LE  V
Sbjct  233   LDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKNWQPKDMVDLLLQLADDPELE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              LTRD I GLT D++AGG DT A   +W+  EL +KP + ++ T+ELDRV+GRERWVEEK
Sbjct  291   KLTRDNIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVVGRERWVEEK  350

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D  QLPYI+AI+KE  R+HP   +L PH +++D  V GY++P+GT + IN WS+GR+   
Sbjct  351   DIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTWSMGRDPDL  410

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             W++  +F PERF  K +DIKG +F LLPFGSGRR CPGY LG K++  +LAN+LHGF W+
Sbjct  411   WEDPEDFRPERFFGKGIDIKGHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWE  470

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L   +KP+D+  DE +GL T  K+P     +PRLP H
Sbjct  471   LPPGIKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLH  507



>dbj|BAD36163.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38068.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 gb|EAZ44888.1| hypothetical protein OsJ_29529 [Oryza sativa Japonica Group]
Length=522

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 246/507 (49%), Positives = 350/507 (69%), Gaps = 6/507 (1%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             LL      K  +   RR+ Y  PPGP+PWPIIGNLNL+G++PH+S+H LS++YG L+ L+
Sbjct  13    LLTTMLFLKAISTRCRRRKYNLPPGPKPWPIIGNLNLVGALPHRSIHELSRRYGPLVYLR  72

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS PV+V SS E A+ FLKT DA F  RP TAA  HT +N  D+TWSP   +WR AR++
Sbjct  73    FGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPCDAYWRQARRV  132

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLY--DAVGTKNPVLLRDHLVRFTLSTMTRLVT  596
             +L+E+F+ R+++S+E++R EE  AL+  L+   + G +  ++++D+L   +L+ +TR+V 
Sbjct  133   VLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLSTASLNMITRMVM  192

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G +Y   +    +P      L + +  L++ F L+GV N+GD +PWL  LDLQGYVK+MK
Sbjct  193   GKRYVQGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLEWLDLQGYVKRMK  252

Query  777   AFREEYEKFLNYVIEDHMAMMKGDEN-FAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                +  ++ L +V+++H    + + N F   DMVD+ L++ADD +LE  V L+RD I   
Sbjct  253   KVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLE--VKLSRDSIKAF  310

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
             T D++AGG ++++ T+EWA  EL RKP +  KATEELDR++G  RWV EKD   LPYI+A
Sbjct  311   TQDLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPYIEA  370

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET RLHP+  LL P  S ED  V GY++P GT V +NVW+I R+   WD + EF PE
Sbjct  371   IVKETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEFMPE  430

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDI  1493
             RFL K +D+KGQDF LLPFGSGRR CPGY+LG+KV++ ++ANLLHGF W+L  D+  +D+
Sbjct  431   RFLGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVKEDL  490

Query  1494  SMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             SM+E +GL+   KFPL   +EP+L +H
Sbjct  491   SMEEIFGLSMPRKFPLEVAVEPKLSSH  517



>gb|EMT12959.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=549

 Score =   528 bits (1361),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 251/511 (49%), Positives = 354/511 (69%), Gaps = 11/511 (2%)
 Frame = +3

Query  60    PWL----LAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYG  227
             PW     + +A +  +  + +R+     PPGP+PWPIIGNLNL+G++PH+S+H+LS++YG
Sbjct  38    PWAPFLAVVLATILFLKAVFRRKGTCNLPPGPKPWPIIGNLNLIGTLPHRSIHALSRQYG  97

Query  228   ELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFW  404
              LM L+FGS PV+V +S E AKLFLKTHD VF  RP TAA  +T ++ S +TWSPY   W
Sbjct  98    PLMQLRFGSFPVVVGASAEMAKLFLKTHDVVFTDRPRTAAGKYTGYDNSTITWSPYNAHW  157

Query  405   RHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMT  584
             R AR++ L+E+F+ ++L+S+ Y+R EE  AL+ GL++  G    VLL+DHL   +L+ ++
Sbjct  158   RQARRVCLAELFSAKRLESYAYIRREEMCALLCGLHETSG--RVVLLKDHLSTLSLNVIS  215

Query  585   RLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYV  764
             R+V G KY  K   +G+     +  ++ +  +D+ F L+GV+N+GD +PWL  +DLQGYV
Sbjct  216   RMVLGRKYLEKQ-AVGEDGPAIMAPEEFKCMIDELFFLNGVLNIGDSIPWLDWMDLQGYV  274

Query  765   KKMKAFREEYEKFLNYVIEDHMAMMK-GDENFAPKDMVDIFLQIADDPNLEADVALTRDR  941
             ++MK   +++++FL +V++DH    +   E+F  +DMVD+ L+IA DPNLE  V L R+ 
Sbjct  275   RRMKKLSKKFDQFLEHVLDDHNERRRLQGESFVSRDMVDVLLEIASDPNLE--VKLHRNG  332

Query  942   IMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLP  1121
             +     D++AGG +TTA TVEWA  ++ +KP +  KATEELDRV+GRERWV E D   LP
Sbjct  333   VKAFIQDLIAGGTETTAITVEWAMSQMLKKPEVFSKATEELDRVVGRERWVTEDDIPNLP  392

Query  1122  YIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANE  1301
             Y++AI+KET R+HP+  +L P  + ED  V GY +P GT VLINVWSIGR+   WD+  E
Sbjct  393   YVEAIVKETMRMHPVAPMLAPRLAREDASVGGYNIPVGTRVLINVWSIGRDPAVWDSPEE  452

Query  1302  FCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLK  1481
             F PERF+   +DIKG DF LLPFGSGRR CPGYSLG+KV+  +LANLLHGF  KL   + 
Sbjct  453   FIPERFVGSKIDIKGHDFELLPFGSGRRMCPGYSLGLKVIHVSLANLLHGFVCKLPDGVA  512

Query  1482  PKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
                +SM+E +GL+T  KFPL   ++P+L  H
Sbjct  513   TDQLSMEEIFGLSTPRKFPLQVVMKPKLQGH  543



>gb|EAZ09261.1| hypothetical protein OsI_31534 [Oryza sativa Indica Group]
Length=522

 Score =   527 bits (1357),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 354/507 (70%), Gaps = 7/507 (1%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             L  + FL  I+T  +RRK Y  PPGP+PWPIIGNLNL+G++PH+S+H LS++YG L+ L+
Sbjct  14    LTTMLFLRAISTRCRRRK-YNLPPGPKPWPIIGNLNLVGALPHRSIHELSRRYGPLVYLR  72

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS PV+V SS E A+ FLKT DA F  RP TAA  HT +N  D+TWSP   +WR AR++
Sbjct  73    FGSFPVVVGSSVEMARFFLKTRDAAFIDRPRTAAGKHTAYNYRDITWSPCDAYWRQARRV  132

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLY--DAVGTKNPVLLRDHLVRFTLSTMTRLVT  596
             +L+E+F+ R+++S+E++R EE  AL+  L+   + G +  ++++D+L   +L+ +TR+V 
Sbjct  133   VLTELFSARRIESYEHIRREEVHALLRDLHYASSSGGRRAIVIKDYLSTASLNMITRMVM  192

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G +Y   +    +P      L + +  L++ F L+GV N+GD +PWL  LDLQGYVK+MK
Sbjct  193   GKRYVQGEVVHEEPGSARTTLAQFKELLEELFFLNGVFNVGDQIPWLEWLDLQGYVKRMK  252

Query  777   AFREEYEKFLNYVIEDHMAMMKGDEN-FAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                +  ++ L +V+++H    + + N F   DMVD+ L++ADD +LE  V L+RD I   
Sbjct  253   KVSKALDQLLEHVVDEHSERRQREGNGFVAGDMVDVLLRLADDSSLE--VKLSRDSIKAF  310

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
             T D++AGG ++++ T+EWA  EL RKP +  KATEELDR++G  RWV EKD   LPYI+A
Sbjct  311   TQDLIAGGTESSSETIEWAISELLRKPEMFAKATEELDRIVGHRRWVNEKDILDLPYIEA  370

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET RLHP+  LL P  S ED  V GY++P GT V +NVW+I R+   WD + EF PE
Sbjct  371   IVKETMRLHPIGPLLAPRLSREDTSVGGYDIPTGTRVFVNVWAIARDPTLWDASEEFVPE  430

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDI  1493
             RFL K +D+KGQDF LLPFGSGRR CPGY+LG+KV++ ++ANLLHGF W+L  D+  +D+
Sbjct  431   RFLGKKIDVKGQDFELLPFGSGRRMCPGYNLGLKVIQLSIANLLHGFTWRLPKDMVKEDL  490

Query  1494  SMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             SM+E +GL+   KFPL   +EP+L +H
Sbjct  491   SMEEIFGLSMPRKFPLEVVVEPKLSSH  517



>emb|CDP17539.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   527 bits (1357),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 255/524 (49%), Positives = 367/524 (70%), Gaps = 14/524 (3%)
 Frame = +3

Query  12    PHTLMMEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIP  191
             P T+  +V S+ F  +   ++  + + +  I    K    PPGP+PWPI+GNLNL+GS+ 
Sbjct  7     PPTIERKVPSYHF--ICQFISNYWCYSLVCIISNMKKLNLPPGPKPWPIVGNLNLIGSLS  64

Query  192   HQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNR  368
             H+SLH LS  YG LM L+FGS PV+V SS   AK+FLKT D  FA RP TAA  +T +N 
Sbjct  65    HRSLHQLSLTYGPLMHLRFGSFPVVVGSSMMMAKVFLKTMDVTFADRPKTAAGKYTSYNC  124

Query  369   SDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLR  548
             SD+ WSPYG +WR ARK+ L E+F+ ++L+S+E++R+EE  +L+ GL+ ++G   PVLL+
Sbjct  125   SDIMWSPYGAYWRQARKMCLMELFSAKRLESYEHIRVEEMNSLLLGLFQSLG--KPVLLK  182

Query  549   DHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWV  728
             D+L   +L+ ++R+V G +Y  +       +   I  ++    +D+  LL+GV N+GD +
Sbjct  183   DYLTTMSLNVISRMVLGKRYLDES-----DQNSIITPEEFVKMMDELLLLNGVFNIGDSI  237

Query  729   PWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH-MAMMKGDE-NFAPKDMVDIFLQIADD  902
             PWL+ LDLQGY+K+MK   ++++ FL +V+++H +A M+ DE N   KDMVD+ L +A+ 
Sbjct  238   PWLNFLDLQGYIKRMKILSKKFDWFLEHVLDEHNVARMRNDEQNQVSKDMVDVLLDLAEH  297

Query  903   PNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGR  1082
                 ++V L R  +   T D+L GG +++A TVEWA  EL +KP + +KAT++LDRVIG+
Sbjct  298   QT--SEVKLERHGVKAFTQDLLVGGTESSALTVEWAISELLKKPELFKKATQQLDRVIGQ  355

Query  1083  ERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWS  1262
              RWV EKD   LPY++AI+KET R+HP+  +L P  + EDC VAGY++ +GT VLINVWS
Sbjct  356   NRWVTEKDIPNLPYVEAIVKETMRMHPVVPMLVPRCAREDCNVAGYDIQKGTRVLINVWS  415

Query  1263  IGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANL  1442
             IGR+ + W +  EF PERF+ K++D+KGQD+ LLPFGSGRR CPGYSLG+KVV++TLANL
Sbjct  416   IGRDPELWKDPQEFYPERFIGKEIDVKGQDYELLPFGSGRRMCPGYSLGLKVVQSTLANL  475

Query  1443  LHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             LHG+ WKL  D+ P+++ M+E +GL+T  KFPL   +EPRLP H
Sbjct  476   LHGYNWKLPSDMNPEELDMEEIFGLSTPRKFPLVTIVEPRLPHH  519



>ref|XP_010064025.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW71323.1| hypothetical protein EUGRSUZ_F04405 [Eucalyptus grandis]
Length=510

 Score =   526 bits (1354),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 256/518 (49%), Positives = 352/518 (68%), Gaps = 12/518 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M+  SW    +  L A   L  + + H RR+  K PPGP+PWPIIGNLNL+G +PH+S+H
Sbjct  1     MDAPSWVAYGIACLAAAFLLLLLLSGHLRRRQLKLPPGPKPWPIIGNLNLIGPLPHRSIH  60

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS+ YG LM L+FG   V+V  S + AK  L+TH  VFA RP  AA  +T +N SD+ W
Sbjct  61    DLSRTYGPLMKLQFGYYDVVVGCSADMAKALLQTHGTVFAYRPNLAAGKYTAYNYSDVLW  120

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+ R ARKI L+ +F+  +L SFEY+R+EE   L   +++  G   PV L+DHL  
Sbjct  121   SPYGPYLRQARKIFLTHLFSAARLQSFEYIRVEETRVLTRNMFEGKG--QPVNLKDHLSD  178

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL-KKLQGFLDDWFLLSGVINLGDWVPWLS  740
              TL+ ++R+V G KY  K       E   I L ++ +  + +WF+L+GV+N+GD+ PWL+
Sbjct  179   LTLNVISRMVLGKKYTDKF------ESSDIVLPEEFKKMIAEWFMLNGVVNIGDFAPWLN  232

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEAD  920
              LDL+GY+K+MKA  +++++FL +V+++H A   G +    KDMVD+ LQ  DDPN+E  
Sbjct  233   FLDLRGYIKRMKALSKKFDRFLEHVVDEHEARRVGLKGHEAKDMVDVLLQHVDDPNVE--  290

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V + R  +  L  D++ GG  T+A +VEWA  EL + PW+ +KAT EL+ +IGRERWV+E
Sbjct  291   VKIERHGVKALIQDLIVGGTGTSAMSVEWAISELLKNPWVYDKATRELNSIIGRERWVQE  350

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
              D S LPYI+AI+KET RLHP    L P Y+ +DC VAGY+VPRGT V+++ WSI R+ K
Sbjct  351   ADLSNLPYINAIVKETMRLHPPGAFLAPRYASQDCKVAGYDVPRGTRVIVSAWSIMRDPK  410

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
             YWD   +F PERF+ K +D+KGQ+F LLPFGSGRR CPGY+ G+KV+ T+LANL+HGF W
Sbjct  411   YWDEPEKFRPERFVGKAIDVKGQNFELLPFGSGRRMCPGYNFGLKVIPTSLANLIHGFTW  470

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +L GDL  +D++M+E  GL+   K PL    EPRLP H
Sbjct  471   RLPGDLMREDLNMEEVAGLSAPRKIPLVAVAEPRLPLH  508



>emb|CCP37679.1| cytochrome P450 [Lolium sp. CD-2012]
Length=519

 Score =   525 bits (1353),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 257/522 (49%), Positives = 359/522 (69%), Gaps = 14/522 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME+  W    L  +LA     K     +    Y  PPGP+ WPIIGNLNL+G++PH+S+H
Sbjct  1     MELPQWA-SFLAVVLATVIFLKAVLRRRSSCKYNLPPGPKAWPIIGNLNLIGALPHRSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             +LS+ YG LM L+FGS P +V SS + AK FLKTHD VF  RP  AA  HT +N SD+TW
Sbjct  60    ALSKHYGPLMQLQFGSFPCVVGSSVDMAKFFLKTHDVVFTDRPKFAAGKHTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYD---AVGTKNPVLLRDH  554
             SPYG +WR ARK+ L+E+F+ R+L S+EY+R EE +AL+  L++   A G    ++++D+
Sbjct  120   SPYGAYWRQARKMCLTELFSARRLQSYEYIRSEEVLALLRDLHNGATAAGAGRTLVIKDY  179

Query  555   LVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPW  734
             L   +L+ +TR+V G KY  K+         + P  + +  +D+ FLL+GV+N+GD +P 
Sbjct  180   LSTVSLNVITRMVMGKKYLEKEVRDESGALITTP-DEFKWMIDELFLLNGVLNIGDSIPC  238

Query  735   LSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNL  911
             L  +DLQGY+K+MK   + +++FL +V+++H    + D E+F  KDMVD+ LQ A +P+L
Sbjct  239   LDWMDLQGYMKRMKKLSKMFDRFLEHVVDEHSEQRRRDGESFVAKDMVDVLLQFASNPDL  298

Query  912   EADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERW  1091
             E  V L R+ +   T D++AGG +++A TVEWA  EL +KP +  KATEELDRV+GR+RW
Sbjct  299   E--VKLNREGVKAFTQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRDRW  356

Query  1092  VEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGR  1271
             V EKD   LPY+DAI+KET RLHP+  +L P  S ED  + GY++P GT  L++VWSIGR
Sbjct  357   VTEKDMPSLPYMDAIVKETMRLHPVAPMLVPRLSREDTSIGGYDIPAGTRGLVSVWSIGR  416

Query  1272  NSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHG  1451
             + + WD   EF PERF+   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHG
Sbjct  417   DPELWDAPEEFMPERFIGSKLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHG  476

Query  1452  FKWKL-DGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             F+WKL DG     +++M+E +GL+T  KFPL   +EP+LP H
Sbjct  477   FEWKLPDG----VELNMEEIFGLSTPRKFPLEAVVEPKLPAH  514



>ref|XP_011036443.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
 ref|XP_011036444.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=509

 Score =   525 bits (1352),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/492 (51%), Positives = 347/492 (71%), Gaps = 10/492 (2%)
 Frame = +3

Query  105   HQRRKAYKTPPGPRPWPIIGNLNLL-GSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSP  281
             H  R     PPGP+PWPIIGNLNLL G +PH+++H+L QKYG +M LKFGS PV+V SS 
Sbjct  22    HLTRPKLNLPPGPKPWPIIGNLNLLAGPLPHRNMHALVQKYGPIMQLKFGSFPVVVGSSV  81

Query  282   ETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLD  458
             E A+  LKT+D   A RP  AA  +T +N S++TWS YGP+WR ARKI L E+F+P++LD
Sbjct  82    EMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQYGPYWRQARKICLMEIFSPKRLD  141

Query  459   SFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKP  638
              FE VR++E  AL+  L+ + G   P+  RD+    +LS ++RLV G  Y  K    G  
Sbjct  142   QFETVRVQELHALLRKLFVSAG--KPINARDNFSDLSLSVISRLVLGKNYTVKT---GNQ  196

Query  639   EGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVI  818
             + Y  P K+ +  +D+ FLL+GV+++GD +PWL+ LDLQGY+K+MKA    ++ FL + +
Sbjct  197   KEYMSP-KEFKEMIDELFLLNGVLDIGDSIPWLAFLDLQGYIKRMKAVGRLFDGFLEHTL  255

Query  819   EDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAAT  998
              +H    KG +++ P+DM+DI LQ++DDPNLE  V L R  +   T D++AGG +++A T
Sbjct  256   NEHQQRRKGVKDYVPQDMMDILLQLSDDPNLE--VQLDRTAVKAFTMDLIAGGTESSAVT  313

Query  999   VEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLL  1178
              EWA  EL +KP   ++A EELDRVIGR+RWVEEKD   LP+I+AI KET RLHP+   L
Sbjct  314   TEWAMAELLKKPEYFKRANEELDRVIGRDRWVEEKDIVNLPFINAICKETMRLHPVSPFL  373

Query  1179  PPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFA  1358
              P  + ED  + GY++P+GT V++NVW+IGR++  W+  +EFCPERF+ K +D+KG +F 
Sbjct  374   VPRLAREDIQLGGYDIPKGTRVMVNVWTIGRDASIWEKPHEFCPERFIGKPIDVKGHNFE  433

Query  1359  LLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFP  1538
             LLPFG+GRR C GYSLG+KV++ ++ANLLHGFKWKL GD+  ++++M E +GL+T  + P
Sbjct  434   LLPFGAGRRMCVGYSLGLKVIQASVANLLHGFKWKLPGDMTTEELNMQEIFGLSTPKQIP  493

Query  1539  LSYTIEPRLPTH  1574
             L   +EPRLP H
Sbjct  494   LVAELEPRLPAH  505



>ref|XP_006426677.1| hypothetical protein CICLE_v10025396mg [Citrus clementina]
 gb|ESR39917.1| hypothetical protein CICLE_v10025396mg [Citrus clementina]
Length=511

 Score =   525 bits (1351),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 254/482 (53%), Positives = 355/482 (74%), Gaps = 15/482 (3%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +P++S+H+LS+KYG +M LKFGS PV+V SS E A+ FLKTH
Sbjct  40    PPGPKPWPIIGNLNLIGPLPYRSIHALSEKYGPIMQLKFGSFPVVVGSSVEMAEAFLKTH  99

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             DA+F+ RP  AA  +T FN S++TWS YGP+WR  RKI L E+FT ++L+S+EY+R+EE 
Sbjct  100   DALFSYRPKLAAGKYTTFNYSNITWSQYGPYWRQLRKICLMELFTAKRLNSYEYIRVEET  159

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
             M  +  LY++ G   P++L+D+L+   L  M+R+V G KY ++           +   + 
Sbjct  160   MLFLRNLYESSG--KPIILKDNLLDLNLEVMSRMVLGKKYTNE----------IVARHEF  207

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +   D+ F+L GV+++GD +PWL  LDLQGY+K+MK   +++++   Y ++DH A  KG 
Sbjct  208   KEMADELFILGGVLDIGDMIPWLGFLDLQGYIKRMKVLAKKFDRLFEYELDDHNARRKGV  267

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             +N+  KDM+D+ LQ+ADDP LE  V L R  +  +T D+LAGG +++A TVEWA  EL +
Sbjct  268   DNYEAKDMMDVLLQLADDPTLE--VKLERHSLKAVTQDLLAGGTESSAVTVEWAISELMK  325

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP +++KATEELDRV+G+ERWVEEKD   LP+IDAI+KET RLHP+   L P  + EDC 
Sbjct  326   KPKLLKKATEELDRVVGKERWVEEKDIVNLPFIDAIVKETMRLHPVSPTLVPRMASEDCK  385

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++P+GT VL+NVW+IGR+   W+N NEF P+RFL K +D+KG+DF LLPFG+GRR 
Sbjct  386   VAGYDIPKGTRVLVNVWTIGRDPALWENPNEFYPQRFLGKSIDVKGRDFELLPFGTGRRI  445

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPG SLG+KVV+++LANLLHGF WKL G++  ++++M+E +GL+T  KFPL    +PRL 
Sbjct  446   CPGMSLGLKVVQSSLANLLHGFSWKLPGNMSNQELNMEETFGLSTPKKFPLEVVAQPRLS  505

Query  1569  TH  1574
              H
Sbjct  506   FH  507



>ref|XP_011036445.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=509

 Score =   524 bits (1350),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 254/515 (49%), Positives = 355/515 (69%), Gaps = 14/515 (3%)
 Frame = +3

Query  36    FSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLL-GSIPHQSLHSL  212
              S F   L   +A+  LF+    H  R     PPGP+PWPIIGNLNLL G +PH+++H+L
Sbjct  3     LSTFAALLLATVAVITLFR----HLTRPKLNLPPGPKPWPIIGNLNLLAGPLPHRNMHAL  58

Query  213   SQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSP  389
              QKYG +M LKFGS PV+V SS E A+  LKT+D   A RP  AA  +T +N S++TWS 
Sbjct  59    VQKYGPIMQLKFGSFPVVVGSSVEMAEAVLKTNDVKLADRPKIAAGKYTTYNYSNITWSQ  118

Query  390   YGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFT  569
             YGP+WR ARKI L E+F+P++LD FE VR++E  AL+  L+ + G   P+  RD+    +
Sbjct  119   YGPYWRQARKICLMEIFSPKRLDQFETVRVQELHALLRKLFVSAG--KPINARDNFSDLS  176

Query  570   LSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLD  749
             LS ++RLV G  Y  K    G  + Y  P K+ +  +D+ FLL+GV+++GD +PWL+ LD
Sbjct  177   LSVISRLVLGKNYTVKT---GNQKEYMSP-KEFKEMIDELFLLNGVLDIGDSIPWLAFLD  232

Query  750   LQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVAL  929
             LQGY+K+MKA    ++ FL + + +H    KG +++ P+DM+DI LQ++DDPNLE  V L
Sbjct  233   LQGYIKRMKAVGRLFDGFLEHTLNEHQQRRKGVKDYVPQDMMDILLQLSDDPNLE--VQL  290

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
              R  +   T D++AGG +++A T EWA  EL +KP   ++A EELDRVIGR+RWVEEKD 
Sbjct  291   DRTAVKAFTMDLIAGGTESSAVTTEWAMAELLKKPEYFKRANEELDRVIGRDRWVEEKDI  350

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWD  1289
               LP+I+AI KET RLHP+   L P  + ED  + GY++P+GT V++NVW+IGR++  W+
Sbjct  351   VNLPFINAICKETMRLHPVSPFLVPRLAREDIQLGGYDIPKGTRVMVNVWTIGRDASIWE  410

Query  1290  NANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLD  1469
               +EFCPERF+ K +D+KG +F LLPFG+GRR C GYSLG+KV++ ++ANLLHGFKWKL 
Sbjct  411   KPHEFCPERFIGKPIDVKGHNFELLPFGAGRRMCVGYSLGLKVIQASVANLLHGFKWKLP  470

Query  1470  GDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             GD+  ++++M E +GL+T  +  L   +EPRLP H
Sbjct  471   GDMTTEELNMQEIFGLSTPKQIALVAELEPRLPAH  505



>gb|AJD25214.1| cytochrome P450 CYP92A73 [Salvia miltiorrhiza]
Length=509

 Score =   524 bits (1350),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 248/474 (52%), Positives = 345/474 (73%), Gaps = 12/474 (3%)
 Frame = +3

Query  156   IIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRP  335
             +IGNLNL+GS+PH SLHSLSQKYG +MLLKFGS PV+V SS   AK+FLKT D  FASRP
Sbjct  42    VIGNLNLIGSLPHHSLHSLSQKYGPIMLLKFGSAPVVVGSSVAAAKIFLKTMDLTFASRP  101

Query  336   ATAAAH-HTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLY  512
              T+A    T+N SD+TWSPYGP+WR ARK+ L E+F+ R+L+S+EY+R EE  +L+  L+
Sbjct  102   KTSAGKITTYNYSDITWSPYGPYWRQARKMCLMELFSARRLESYEYIRAEEMSSLLKELF  161

Query  513   DAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWF  692
                G   P LL+D L   +L+ ++R+V G +Y   D      E   +  ++ +  LD+ F
Sbjct  162   GFSG--RPFLLKDCLSTVSLNVISRMVLGRRYLDGD------ENAVVSPEEFKKMLDELF  213

Query  693   LLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDM  872
             LL+GV+N+GD +P+++ LDLQGYVK+MK   +++++FL +V+++H A  +  E +  +DM
Sbjct  214   LLNGVLNIGDLIPYINFLDLQGYVKRMKVVSKKFDRFLEHVLDEHEARRRTTE-YVSRDM  272

Query  873   VDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKA  1052
             VD+ L++A+DP LE  V L R  +   T D+LAGG +++A TVEWA  EL +KP I +KA
Sbjct  273   VDVLLELAEDPTLE--VKLERHGVKAFTQDLLAGGTESSAVTVEWAISELLKKPEIFKKA  330

Query  1053  TEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPR  1232
             TEELDRVIG  RWV+EKD   LPY++AI+KET RLHP+  +L P  + EDC V GY++ +
Sbjct  331   TEELDRVIGPTRWVKEKDIPSLPYVEAIVKETMRLHPVAPMLVPRLAREDCKVDGYDIKK  390

Query  1233  GTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGM  1412
             GT VL+N W+I R+   W+N NEF P+RF+ K++D+KGQDF LLPFGSGRR CPGY+LG+
Sbjct  391   GTQVLVNTWTIQRDPSIWENPNEFNPDRFIGKNIDVKGQDFELLPFGSGRRMCPGYALGL  450

Query  1413  KVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             KV++++LANLLHGF W+L   +KP +++M+E +GL+T  KFPL    EPRLP +
Sbjct  451   KVIQSSLANLLHGFNWRLPDKMKPAELNMEEIFGLSTPRKFPLVAVAEPRLPLN  504



>gb|AER39772.1| CYP92A44-2 [Festuca rubra subsp. commutata]
Length=516

 Score =   524 bits (1350),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 352/507 (69%), Gaps = 10/507 (2%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +LA     K     +  + Y  PPGP+ WPIIGNLNL+G++PH+S+H+LS++YG L+ L+
Sbjct  13    VLATVLFLKAVLRRRSGRKYNLPPGPKAWPIIGNLNLMGTLPHRSIHALSKQYGPLLQLQ  72

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS P +V SS E AK FLKTHD  F  RP  A+  HT +N SD+TWSPYG +WR ARK+
Sbjct  73    FGSFPCVVGSSVEMAKFFLKTHDVSFTDRPKFASGKHTTYNYSDITWSPYGAYWRQARKM  132

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAV--GTKNPVLLRDHLVRFTLSTMTRLVT  596
              L+E+F+ R+L S+EY+R EE +AL+  L+     G    ++L+D+L   +L+ +TR+V 
Sbjct  133   CLTELFSARRLRSYEYIRSEEVLALVRDLHRGATAGAGRALVLKDYLSTVSLNVITRMVM  192

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G KY  K+         + P  + +  +D+ FLL+GV+N+GD +P L  +DLQGY+K+MK
Sbjct  193   GKKYLEKEVRDESGAVITTP-DEFKWMIDELFLLNGVLNIGDSIPCLDWMDLQGYIKRMK  251

Query  777   AFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL +V+E+H    + D E+F  KDMVD+ LQ A +P+LE  V L R+ +   
Sbjct  252   KLSKMFDRFLEHVVEEHSERRRRDGESFVAKDMVDVLLQFASNPDLE--VKLNREGVKAF  309

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
             T D++AGG +++A TVEWA  EL +KP +  +ATEELDRV+GR RWV EKD   LPY+DA
Sbjct  310   TQDLIAGGTESSAVTVEWALSELLKKPEVFARATEELDRVVGRGRWVTEKDMPSLPYVDA  369

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET RLHP+  +L P  S ED  + GY++P GT VL++VWSIGR+ + W+   EF PE
Sbjct  370   IVKETMRLHPVAPMLVPRLSREDTSIGGYDIPAGTRVLVSVWSIGRDPELWEAPEEFMPE  429

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDI  1493
             RF+   +D+KGQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF+WKL   +   ++
Sbjct  430   RFIGSRLDVKGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFEWKLPHGV---EL  486

Query  1494  SMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             SM+E +GL+T  KFPL   +EP+LP H
Sbjct  487   SMEEIFGLSTPRKFPLEAVLEPKLPAH  513



>dbj|BAJ96250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   524 bits (1349),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 245/500 (49%), Positives = 349/500 (70%), Gaps = 6/500 (1%)
 Frame = +3

Query  81    FLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKP  260
              LF      + R A+  PPGP+PWPIIGNLNL+G++PH+S+H LS++YG +M L+FGS P
Sbjct  1     MLFLKCVFRRSRHAHNLPPGPKPWPIIGNLNLMGALPHRSIHDLSKRYGPIMYLRFGSFP  60

Query  261   VIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEV  437
             V+V SS E AK FLKTHD VF  RP  AA  HT +N S++ W+PYG +WR ARK+ L+E+
Sbjct  61    VVVGSSVEMAKFFLKTHDVVFIDRPKMAAGKHTTYNYSNIIWAPYGAYWRQARKVCLTEL  120

Query  438   FTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSK  617
             F+ ++L+S+EY+R EE  AL+  L++A G    V+L+D+L   +L+ +TR++ G KY  +
Sbjct  121   FSAKRLESYEYIRSEEMRALLRDLHEASG--RVVVLKDYLSTLSLNVITRMMLGKKYLHR  178

Query  618   DWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYE  797
               E     G +  +++ +  +D+WFLL+GV+N+GD +PWL  +DLQGY+K+MK     ++
Sbjct  179   PMEGTDGGGSTTTMEEFKWMIDEWFLLNGVLNIGDPIPWLDWMDLQGYIKRMKKLSMMFD  238

Query  798   KFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAG  974
             +FL +V+++H    + + E+F  +DMVD+ L+IA DP+LE  V + RD +     D++ G
Sbjct  239   RFLEHVVDEHNDRRRLEGESFVSRDMVDVLLEIASDPDLE--VQIDRDSVKAFIQDLIVG  296

Query  975   GEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFR  1154
             G +T++ TVEWA  EL +KP ++ KATEELDRV+GR RWV E+D   LPY++AI+KE  R
Sbjct  297   GTETSSITVEWAISELLKKPEVLAKATEELDRVVGRGRWVTEQDIPSLPYVEAIVKEAMR  356

Query  1155  LHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDV  1334
             LHP+  LL P  S E+  V GY++P GT V ++VWSIGR+   WD   EF PERFL   +
Sbjct  357   LHPVAPLLAPRLSREEASVGGYDIPAGTRVFVSVWSIGRDPALWDAPEEFTPERFLGSKM  416

Query  1335  DIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYG  1514
             D+KGQDF LLPFGSGRR CP +SLG+KV++ +LANLLHGF W+L   +   ++ M+E +G
Sbjct  417   DVKGQDFELLPFGSGRRMCPAHSLGLKVIQVSLANLLHGFAWRLPDGVSTAELGMEEIFG  476

Query  1515  LTTHPKFPLSYTIEPRLPTH  1574
             LTT  KFPL    +P+L  H
Sbjct  477   LTTPRKFPLEVVFKPKLLDH  496



>ref|XP_006465908.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=511

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 253/482 (52%), Positives = 354/482 (73%), Gaps = 15/482 (3%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +P++S+H+LS+KYG +M LKFGS PV+V SS E A+ FLKTH
Sbjct  40    PPGPKPWPIIGNLNLIGPLPYRSIHALSEKYGPIMQLKFGSFPVVVGSSVEMAEAFLKTH  99

Query  312   DAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             DA+F+ RP  AA  +T FN S++TWS YGP+WR  RKI L E+FT ++L+S+EY+R+EE 
Sbjct  100   DALFSYRPKLAAGKYTTFNYSNITWSQYGPYWRQLRKICLMELFTAKRLNSYEYIRVEET  159

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
             M  +  LY++ G   P++L+D+L+   L  M+R+V G KY ++           +   + 
Sbjct  160   MLFLRNLYESSG--KPIILKDNLLDLNLEVMSRMVLGKKYTNE----------IVARHEF  207

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
             +   D+ F+L GV+++GD +PWL  LDLQGY+K+MK   +++++   Y +++H A  KG 
Sbjct  208   KEMADELFILGGVLDIGDMIPWLGFLDLQGYIKRMKVLAKKFDRLFEYELDEHNARRKGV  267

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             +N+  KDM+D+ LQ+ADDP LE  V L R  +  +T D+LAGG +++A TVEWA  EL +
Sbjct  268   DNYEAKDMMDVLLQLADDPTLE--VKLERHSLKAVTQDLLAGGTESSAVTVEWAISELMK  325

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
             KP +++KATEELDRV+G+ERWVEEKD   LP+IDAI+KET RLHP+   L P  + EDC 
Sbjct  326   KPKLLKKATEELDRVVGKERWVEEKDIVNLPFIDAIVKETMRLHPVSPTLVPRMASEDCK  385

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++P+GT VL+NVW+IGR+   W+N NEF P+RFL K +D+KG DF LLPFG+GRR 
Sbjct  386   VAGYDIPKGTRVLVNVWTIGRDPALWENPNEFYPQRFLGKSIDVKGHDFELLPFGTGRRI  445

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             CPG SLG+KVV+++LANLLHGF WKL G +  ++++M+E +GL+T  KFPL    +PRL 
Sbjct  446   CPGMSLGLKVVQSSLANLLHGFSWKLPGTMSNQELNMEETFGLSTPKKFPLEVVAQPRLS  505

Query  1569  TH  1574
             +H
Sbjct  506   SH  507



>emb|CDP21011.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   520 bits (1338),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 244/430 (57%), Positives = 324/430 (75%), Gaps = 9/430 (2%)
 Frame = +3

Query  288   AKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSF  464
             AK FL+THD++FASRP TAAA +T +N S M W+PYGP WR  RKI L+++F+ ++LDS+
Sbjct  2     AKEFLQTHDSIFASRPTTAAAKYTSYNCSGMLWAPYGPHWRQVRKIGLTQIFSTKRLDSY  61

Query  465   EYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEG  644
             E +RI+ER A +S LY   G   PV+LRDHL+RFTLS   ++V  NKY+++     + +G
Sbjct  62    ESIRIKERHAFMSRLYALSG--KPVVLRDHLIRFTLSAACQMVLSNKYFAQ----SEGDG  115

Query  645   YSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIED  824
               +  ++LQ  ++ WFLL GV N+GDW+PWL   DLQGYVK+MK    ++++F N+V++D
Sbjct  116   SVVTFEELQEMIETWFLLGGVFNIGDWIPWLDRFDLQGYVKQMKELYNKFDRFQNHVLDD  175

Query  825   HMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
             H A  K +++F PKDMVDI LQ  +DP+L+  V LT D++ GL  D+L GG DT+A+TV+
Sbjct  176   HRARRKTEKDFIPKDMVDILLQHTEDPDLQ--VKLTGDQMKGLILDLLVGGTDTSASTVD  233

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  EL + P +IEKATEELD VIG+++WVEE DFS+LP++ AIIKETFRLHPL TLL P
Sbjct  234   WAMNELLKHPHLIEKATEELDSVIGKDKWVEEADFSKLPFLGAIIKETFRLHPLATLLAP  293

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
             HY++EDC VAGY + +GTTVLIN WS+GRNSKYWD+  EF PERFL KD+D+KG +F LL
Sbjct  294   HYALEDCTVAGYHIAKGTTVLINTWSMGRNSKYWDSPEEFIPERFLGKDIDVKGHNFELL  353

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PF SGRR CPGY L +K+V T LANLLHGF WKL   +KP++I  +E YG++THP+  L+
Sbjct  354   PFSSGRRMCPGYVLALKLVGTMLANLLHGFNWKLPHGMKPEEICTEELYGISTHPRISLT  413

Query  1545  YTIEPRLPTH  1574
                EPRLP +
Sbjct  414   MIPEPRLPVN  423



>ref|XP_006427642.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
 gb|ESR40882.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
Length=516

 Score =   523 bits (1346),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 255/512 (50%), Positives = 352/512 (69%), Gaps = 16/512 (3%)
 Frame = +3

Query  45    FFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKY  224
             F+  L +L  + FLF+     Q  +    PPGPRPWP+IGNLNL+G +PH S+HSLSQKY
Sbjct  14    FYSILFFLPIVLFLFR----RQFSRKLNLPPGPRPWPLIGNLNLIGPLPHVSIHSLSQKY  69

Query  225   GELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPF  401
             G LM LK+G  PV+V SS E A+L LKTHD  FASRPA  A  +T +N S M+ +PYGP+
Sbjct  70    GPLMHLKYGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSAMSTAPYGPY  129

Query  402   WRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTM  581
             WR ARKI L E+ + ++LD FEY+R+EER A +S L+ +  T  PV L+D L    L+ +
Sbjct  130   WRQARKICLMELLSAKRLDQFEYIRVEERNAFLSELFKSAST--PVHLKDRLYTLNLTLI  187

Query  582   TRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGY  761
              R+V G +Y  +       E  ++  K     +++ FLL G++++GD +PWL+  DLQG+
Sbjct  188   CRMVLGKRYTDE------AEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDLQGH  241

Query  762   VKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDR  941
             VK+MK   ++ +KF   ++++H    K  + +   DMVD+ +Q+ADDP+LE  V L R+ 
Sbjct  242   VKRMKDVSKKLDKFYEGILDEHHERRKSVKGYGVHDMVDVLMQLADDPSLE--VKLEREH  299

Query  942   IMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLP  1121
             I  L  D+L  G DT+A +VEWA  EL + P  I+KATEELDRVIG++RWVEEKD   LP
Sbjct  300   IKALIQDLLTAGTDTSAISVEWAMSELLKNPEAIQKATEELDRVIGKDRWVEEKDIVNLP  359

Query  1122  YIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANE  1301
             YI+AI+KET RLHP+  LL P  + +DC VAGY++ R T V++NVW+IGR+   W+  NE
Sbjct  360   YIEAIVKETMRLHPVAPLLLPRVARDDCRVAGYDILRNTRVVVNVWAIGRDPTMWEKPNE  419

Query  1302  FCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLK  1481
             F P RF++K++D+KG DF LLPFGSGRR CPGY+LG+KV+++TLANLL+GF+WKL GD+K
Sbjct  420   FRPHRFIDKNIDVKGHDFQLLPFGSGRRICPGYALGLKVIQSTLANLLYGFEWKLPGDMK  479

Query  1482  PKDISMDEAYGLTTHPKFPLSYT-IEPRLPTH  1574
              +D+ M++ +GLT   K PL     +PRL  H
Sbjct  480   NEDLDMEDRFGLTMSRKTPLVVVPSKPRLSLH  511



>emb|CAA64635.1| cytochrome P450 [Nicotiana tabacum]
Length=509

 Score =   522 bits (1344),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 252/487 (52%), Positives = 347/487 (71%), Gaps = 13/487 (3%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGNLNL+G++P++S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNLNLIGNLPYRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP TAA  +T +N SD+TWSPYGP+WR AR++ L+E+F+ + LDS+E
Sbjct  87    KIFLKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKCLDSYE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  L    G   P++L+D+L   +L+ ++R+V G +Y      L + E  
Sbjct  147   YIRAEELHSLLHNLNKISG--KPIVLKDYLTTLSLNVISRMVLGKRY------LDESENS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD +PW+  +DLQGYVK+MK   ++++KFL +VI++H
Sbjct  199   FVNPEEFKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
                  G EN+  KDM D+ LQ+ADDP LE  V L R  +   T DMLAGG +++A TVEW
Sbjct  259   NIRRNGVENYVAKDMEDVLLQLADDPKLE--VKLERHGVKAFTQDMLAGGTESSAVTVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I +KATEELDRVIG+ RWV+EKD   LPYI+AI+KET RLHP+  +    
Sbjct  317   AISELSKKPEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMKATE  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEK-DVDIKGQDFALL  1364
                E+  VAGY+V +GT VL++VW+IGR+   WD    F PERF EK  +D+KG D+ LL
Sbjct  377   CR-ENSKVAGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKASIDVKGHDYELL  435

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PFG GRR CPGYSLG+KV++ +LANLLHGF W L  ++ P+D++MDE +GL+T  KFPL+
Sbjct  436   PFGVGRRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLA  495

Query  1545  YTIEPRL  1565
               IEPRL
Sbjct  496   TVIEPRL  502



>ref|XP_009771564.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana sylvestris]
Length=510

 Score =   521 bits (1342),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 241/486 (50%), Positives = 343/486 (71%), Gaps = 10/486 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPIIGN NL+G + H+S+H LS KYG ++  +FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIIGNFNLIGPLAHRSVHELSLKYGPILQRRFGSYPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP  AA  +T +N S++TWS YGP+WR ARK+ L E+FT ++L+S E
Sbjct  87    KVFLKSMDINFVDRPKMAAGKYTTYNYSNITWSAYGPYWRQARKMCLMELFTAKRLESLE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  LY+ + T  P+LL+D+L+  +L+ ++R+V G +Y      L + +  
Sbjct  147   YIRTEELHSLLHDLYN-LSTGKPILLKDYLMTLSLNVISRMVLGKRY------LDESKNS  199

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD++PW+  +DLQGYVK+MK    ++++FL +V++ H
Sbjct  200   IVTPEEFKKMLDELFLLNGVLNIGDYIPWIDFMDLQGYVKRMKVLSNKFDRFLEHVLDQH  259

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
              A    +EN+  KDMVD+ LQ ADDP LE  V L R  +   T D+LAGG +++A  VEW
Sbjct  260   NARRNAEENYVAKDMVDVLLQFADDPTLE--VKLERHGVKAFTQDLLAGGTESSAVIVEW  317

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I  KATEELDRVIG+ RWV+EKD   LPYI+AI+KET RLHP+  +L P 
Sbjct  318   AISELLKKPEIFNKATEELDRVIGQNRWVQEKDIPHLPYIEAIVKETMRLHPVAPMLTPR  377

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                EDC VAGY++ +GT +L++VW+I R+   WD    F PERFL   +D+KG +F LLP
Sbjct  378   LCGEDCKVAGYDILKGTRLLVSVWTIARDPTLWDEPEAFKPERFLGNSIDVKGHNFELLP  437

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FG+GRR CPGY+LG+KV++ +LANLLHGFKW L  ++ P+D++M+E +GL+   K PL+ 
Sbjct  438   FGAGRRMCPGYNLGLKVIQASLANLLHGFKWSLPDNMTPEDLNMEEIFGLSIPKKIPLAA  497

Query  1548  TIEPRL  1565
              +EPRL
Sbjct  498   VVEPRL  503



>gb|EAZ07221.1| hypothetical protein OsI_29466 [Oryza sativa Indica Group]
Length=520

 Score =   520 bits (1339),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 249/492 (51%), Positives = 353/492 (72%), Gaps = 9/492 (2%)
 Frame = +3

Query  114   RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAK  293
             R+ Y  PPGP PWP+IGN NL+G++PH+S+H LS+KYGELMLL+FGS PV+V SS   A+
Sbjct  29    RRGYNLPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGSSVAMAR  88

Query  294   LFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEY  470
             L LKTHDAVF  RP TA+  HT +  +D+TWSPYG +WR AR+I ++E+F+ R++ SFE+
Sbjct  89    LVLKTHDAVFIDRPRTASGKHTTYGYADITWSPYGAYWRQARRICVTELFSARRVASFEH  148

Query  471   VRIEERMALISGLYDAV--GTKNPVLL-RDHLVRFTLSTMTRLVTGNKYYSKDWELGKPE  641
             +R +E  AL+ GL+ A   G    V L RDHL   +++ +TR+V G +++ +  +    E
Sbjct  149   IRADEVRALVRGLFAAASSGRSGAVYLNRDHLSTLSMNVITRMVLGKRFFGEGADAA--E  206

Query  642   GYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIE  821
             G    L + +  LD+  LL+GV+N+GDW+PW+  +DLQGYV++MK   + ++ F+ +V++
Sbjct  207   GPVSTLSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFMEHVLD  266

Query  822   DHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAAT  998
             +H    + + E F  +DMVD+ + +ADDP+LE  + L R  +   T D++AGG ++++ T
Sbjct  267   EHSERRRREGEAFVARDMVDVLMDLADDPSLE--IKLGRVGVKAFTQDLIAGGTESSSVT  324

Query  999   VEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLL  1178
             VEWA  ELF+ P I   AT+ELDRV+GR RWV EKD   LPY+DAI+KET R+HP+  LL
Sbjct  325   VEWALSELFKNPAIFATATDELDRVVGRGRWVTEKDIPNLPYLDAIMKETMRMHPIVPLL  384

Query  1179  PPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFA  1358
              P  + +D  VAGY++P+G  VLINVW+IGR+ + WD A EF PERF+   +D+KGQDF 
Sbjct  385   IPRVARDDAAVAGYDIPKGARVLINVWTIGRDPELWDAAEEFMPERFIGSRIDVKGQDFE  444

Query  1359  LLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFP  1538
             LLPFGSGRR CPGY+LG+KV++ +LANLLHGF W+L   +K +++SMDE +GL+T  K+P
Sbjct  445   LLPFGSGRRMCPGYNLGLKVMQLSLANLLHGFAWRLPEGMKEEELSMDEVFGLSTTRKYP  504

Query  1539  LSYTIEPRLPTH  1574
             L   +EPRLP H
Sbjct  505   LQVVVEPRLPVH  516



>ref|XP_006493371.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=556

 Score =   520 bits (1338),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 256/512 (50%), Positives = 350/512 (68%), Gaps = 16/512 (3%)
 Frame = +3

Query  45    FFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKY  224
             F+  L +L  + FLF      Q  +    PPGPRPWP+IGNLNL+G +PH S+HSLSQKY
Sbjct  54    FYSILFFLPIVLFLFH----RQFSRKLNLPPGPRPWPLIGNLNLIGPLPHVSIHSLSQKY  109

Query  225   GELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPF  401
             G LM LKFG  PV+V SS E A+L LKTHD  FASRPA  A  +T +N S M  +PYGP+
Sbjct  110   GPLMHLKFGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSGMATAPYGPY  169

Query  402   WRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTM  581
             WR ARKI L E+ + ++LD FEY+R+EER A +S L+ +  T  PV L+D L    L+++
Sbjct  170   WRQARKICLMELLSAKRLDQFEYIRVEERNAFLSELFKSAST--PVHLKDRLYTLNLTSI  227

Query  582   TRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGY  761
              R+V G +Y  +       E  ++  K     +++ FLL G++++GD +PWL+  DLQG+
Sbjct  228   CRMVLGKRYTDE------AEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDLQGH  281

Query  762   VKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDR  941
             VK+MK   ++ +KF   ++++H    K  +++   DMVD+ +Q+ADDP+LE  V L R+ 
Sbjct  282   VKRMKDVSKKLDKFYEGILDEHHERRKSVKDYGVHDMVDVLMQLADDPSLE--VKLEREH  339

Query  942   IMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLP  1121
             I  L  D+L  G DT+A +VEWA  EL + P  I+KATEELDRVIG++RWVEEKD   LP
Sbjct  340   IKALIQDLLTAGTDTSAISVEWAMSELLKNPEAIQKATEELDRVIGKDRWVEEKDIVNLP  399

Query  1122  YIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANE  1301
             YI+A++KET RLHP+  LL P  + +DC VAGY++ R T V++NVW+IGR+   W+  NE
Sbjct  400   YIEALVKETMRLHPVAPLLLPRVARDDCRVAGYDILRNTRVVVNVWAIGRDPTMWEKPNE  459

Query  1302  FCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLK  1481
             F P RF+ K++D+KG DF LLPFGSGRR CPGY LG+KVV++TLANLL+GF+WKL GD+K
Sbjct  460   FRPHRFIGKNIDVKGHDFQLLPFGSGRRICPGYGLGLKVVQSTLANLLYGFEWKLPGDMK  519

Query  1482  PKDISMDEAYGLTTHPKFPLSYT-IEPRLPTH  1574
              +D+ M++ +GLT   K PL     +PRL  H
Sbjct  520   NEDLDMEDRFGLTMPRKIPLVVVPSKPRLSLH  551



>ref|XP_009337217.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Pyrus x bretschneideri]
Length=495

 Score =   517 bits (1331),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 262/517 (51%), Positives = 348/517 (67%), Gaps = 25/517 (5%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME FS         LA   LF  T   Q +K +K PPGP+PWPIIGNLNL+G +PH SLH
Sbjct  1     MEYFSCAVILTLACLATLALFSKTLFPQLKK-HKFPPGPKPWPIIGNLNLIGPLPHHSLH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHTFNRSDMTWS  386
              LSQ YG +M L+FGS+PV+                     RP    A   F+    +WS
Sbjct  60    KLSQTYGPIMQLRFGSRPVVEED----------------FXRPXRQYATQIFHYH--SWS  101

Query  387   PYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRF  566
             PYGP+WR  RKI L E+F+ ++L+SFEY+R+EE  A  S L     + NPV+L++HL R 
Sbjct  102   PYGPYWRQGRKIFLYELFSSKRLESFEYIRVEENRAFTSRLCAIAKSGNPVVLKEHLSRL  161

Query  567   TLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGL  746
             T S M+R+V G  Y+S    +   EG  + LK+ Q  LD++F+L+GV N+GDW+PWL+ L
Sbjct  162   TFSIMSRIVLGKDYFS----MAAYEGSIMSLKEFQDMLDEFFVLNGVFNIGDWMPWLNFL  217

Query  747   DLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVA  926
             DLQGY+K+MKA +++  +F ++V+ +H A  +G E F P DMVD+ LQ+ D  N + +V 
Sbjct  218   DLQGYIKRMKAMQKKINRFYDFVLNEHKAQKEGVEEFVPNDMVDLLLQLVDGSN-DLEVK  276

Query  927   LTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKD  1106
             L  D I   T D++AGG DT+A ++EWA  EL ++P +I+KATEELDRVIGRERWVEEKD
Sbjct  277   LNYDSIKAFTQDLIAGGTDTSAISLEWAMSELLKQPSLIKKATEELDRVIGRERWVEEKD  336

Query  1107  FSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYW  1286
              +Q+PYI AI+KET R HP   +LPPH ++E+  VAGY+V +GT V +N WS+GR+ K W
Sbjct  337   LAQIPYIHAIMKETMRRHPAVVILPPHLAVENSNVAGYDVCKGTLVFVNTWSMGRDPKLW  396

Query  1287  DNANEFCPERFL-EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             +   EF PERFL    +D++GQ F LLPFGSGRR CPGY LG+K++RT LAN+LHGF WK
Sbjct  397   EEPEEFRPERFLGNTGIDLQGQSFELLPFGSGRRMCPGYKLGLKMIRTCLANMLHGFNWK  456

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L G++K +D+ M+EAYGL T  KFPL   +EPRLP H
Sbjct  457   LPGNVKVEDLGMEEAYGLVTPRKFPLVAVMEPRLPVH  493



>ref|XP_009413866.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=516

 Score =   517 bits (1332),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 351/507 (69%), Gaps = 9/507 (2%)
 Frame = +3

Query  69    LAIAFLFKITT---IHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELML  239
             LA+  +F + T     +RR     PPGPRPWP+IGNLNL+G +P++SL +LSQK+G LM 
Sbjct  10    LALVLVFTLLTGLYRGRRRHKLNLPPGPRPWPVIGNLNLIGPLPYRSLAALSQKHGPLMH  69

Query  240   LKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHTF-NRSDMTWSPYGPFWRHAR  416
             L+FGS PV+V SS + AK FLKTHD  F SRP T A  +TF N S+++WSPYGP+WR AR
Sbjct  70    LRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKTVAGKYTFYNHSNISWSPYGPYWRQAR  129

Query  417   KILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVT  596
             +IL+ E+ TP++LDS++Y+R+EE   L+  L+ +  T+ PVLL D++    L+ ++R+V 
Sbjct  130   RILIMELLTPKRLDSYQYIRVEEVRGLLRDLFRS--TETPVLLNDYIFTVNLNIISRIVL  187

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G KY  +           +P ++ +  +++  LL+GVIN+GD +PWL+ LDLQGYVK+MK
Sbjct  188   GRKYTQEQSVSSGAPAAIVPQEEFKEMIEELMLLNGVINVGDLIPWLNFLDLQGYVKRMK  247

Query  777   AFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL +V+++H    + + + F P+D+VD+ L++ADD +LE  V L R  +   
Sbjct  248   MVGKRFDRFLEHVLDEHNERRRREGKAFVPRDLVDVLLELADDHSLE--VKLERHCLKAF  305

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
               DM AGG DT+  T+EWA  E+ ++P   +KATEELDRVIGR RWVEE+D  +LPYI+A
Sbjct  306   ILDMFAGGTDTSTVTIEWAVSEILKRPETFDKATEELDRVIGRGRWVEEEDVHRLPYIEA  365

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET R+HP+  LL P  S E   V GY++P GT VL+NVW+IGR+   WD   EF PE
Sbjct  366   IVKETMRIHPVGPLLVPRLSREHTTVDGYDIPAGTGVLVNVWAIGRDPAVWDAPEEFRPE  425

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDI  1493
             RF+   +D+KG  F LLPFG+GRR CPG SLG+K+VR +LANLLHGFKW+L   +  +++
Sbjct  426   RFVGSPIDVKGHHFELLPFGAGRRMCPGNSLGLKMVRLSLANLLHGFKWRLPPGMTAEEL  485

Query  1494  SMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              MDE +GLTT  K  L   +EP+LP H
Sbjct  486   KMDEIFGLTTPRKVRLQAVVEPKLPAH  512



>ref|XP_006427726.1| hypothetical protein CICLE_v10025388mg [Citrus clementina]
 gb|ESR40966.1| hypothetical protein CICLE_v10025388mg [Citrus clementina]
Length=513

 Score =   517 bits (1331),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 253/514 (49%), Positives = 352/514 (68%), Gaps = 13/514 (3%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNL-LGSIPHQSLHSLS  215
             SW      WL  +A +     + +RRK    PPGP+ WPIIGNLNL +G  PH+S+ +L 
Sbjct  7     SWVSCWAAWLATLAVILIPLHLLRRRK-LNLPPGPKSWPIIGNLNLIMGPAPHRSVDALC  65

Query  216   QKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPY  392
             +KYG ++ LKFGS PV+V SS E AK  LK+HDA+FA RP  AA  +T +N S++TWSPY
Sbjct  66    KKYGPIVQLKFGSFPVVVCSSVEMAKAILKSHDAIFAYRPKMAAGKYTGYNFSNITWSPY  125

Query  393   GPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTL  572
             GP++  ARKI   E+FT ++L S+EY+R+EE   L+  LY++ G   P+ L+DHL   +L
Sbjct  126   GPYFNQARKICTMELFTAKRLKSYEYIRVEELNVLLKHLYESSG--KPIALKDHLADVSL  183

Query  573   STMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDL  752
             + ++R+V G KY ++     +  G  I   +L+  +D+  LL+GV ++GD +PWL  LDL
Sbjct  184   NVISRVVLGKKYSNE-----RQNGIEITRHELKEMIDELILLNGVFDIGDSIPWLGFLDL  238

Query  753   QGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALT  932
             QG +K+MKA  +++++FL  V+++H A  KG +N+  KDMVD+ L +ADDP LE  V L 
Sbjct  239   QGNIKRMKAVAKKFDRFLEQVVDEHNARRKGIDNYVAKDMVDVLLLLADDPTLE--VRLD  296

Query  933   RDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFS  1112
             R  + G T D++AG  +T+   +EWAF EL + P I++KATEELDRVIG+ERW EEKD  
Sbjct  297   RHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKATEELDRVIGKERWFEEKDIV  356

Query  1113  QLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDN  1292
              LP+I+AIIKET RLH    +L P  + EDC VA Y++ +GT VL+N W+I R+   W+N
Sbjct  357   NLPFIEAIIKETMRLHG-APMLMPRMAREDCKVAAYDILKGTQVLVNTWTIERDPALWEN  415

Query  1293  ANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG  1472
              NEFCPERFL K +D+KG DF LLPFG+GRR CPGYS G+KV++++LANLLHGF WKL G
Sbjct  416   PNEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSHGLKVIQSSLANLLHGFTWKLPG  475

Query  1473  DLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ++  K+++M+E + L    K PL    +PRL  H
Sbjct  476   NMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPH  509



>ref|XP_006452810.1| hypothetical protein CICLE_v10008392mg [Citrus clementina]
 gb|ESR66050.1| hypothetical protein CICLE_v10008392mg [Citrus clementina]
Length=425

 Score =   513 bits (1320),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 242/428 (57%), Positives = 324/428 (76%), Gaps = 10/428 (2%)
 Frame = +3

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             M LKFGS PV+VA+S E AK FL+THD +FASRP TAA  HT +N  ++TW+PYGP+WR 
Sbjct  1     MQLKFGSFPVVVAASAEMAKQFLQTHDHIFASRPQTAAGKHTTYNYLNLTWAPYGPYWRQ  60

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RK+ LSE+F+ ++L+S++Y+R+EE  A IS LY   G   PV+L++HL R TLS ++R 
Sbjct  61    GRKLYLSELFSSKRLESYQYIRVEEYRAFISRLYALSG--KPVVLKEHLSRVTLSIISRT  118

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G KY+S+     K E   + L++ Q  LD+ FLL+GV+N+GDW+PWL  LDLQGYVK+
Sbjct  119   VLGKKYFSE----SKAEDSIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDLQGYVKR  174

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIM  947
             MKA ++++++F ++V ++H A  KG+ ++F PKDMVD+ LQ+ADDPNL  DV L  D + 
Sbjct  175   MKALKKKFDRFHDHVFDEHKANRKGNLKDFVPKDMVDLLLQMADDPNL--DVKLNYDSVR  232

Query  948   GLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYI  1127
             G T D++AGG DT+A TVEWA  EL ++P +I+KATEE+DRV+GR+RWVEEKD  QLPYI
Sbjct  233   GFTQDLIAGGTDTSATTVEWAMSELMKRPDLIKKATEEIDRVVGRQRWVEEKDIPQLPYI  292

Query  1128  DAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFC  1307
             DAI+KET R HP+  LL PH ++EDC VAG+++ +GT V IN WSIGR+   WD   EF 
Sbjct  293   DAIMKETMRKHPVAVLLAPHLALEDCTVAGFDIRKGTRVFINTWSIGRDPSVWDKPEEFR  352

Query  1308  PERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPK  1487
              ERFL+K  D+KGQ F LLPFGSGRR CPGYSLG+K+++++LAN+LHGF WKL   +KP+
Sbjct  353   RERFLDKAFDVKGQHFELLPFGSGRRMCPGYSLGVKMIKSSLANMLHGFNWKLPAHMKPE  412

Query  1488  DISMDEAY  1511
              ISMDE +
Sbjct  413   HISMDEVF  420



>gb|ADO16185.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=513

 Score =   516 bits (1329),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 256/514 (50%), Positives = 354/514 (69%), Gaps = 13/514 (3%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             S+ +  + WL  +A L  I+   +R++    PPGP+PWPIIGNLNL+G++PH+S+H LSQ
Sbjct  7     SYTYYTVAWLATVALLI-ISRRTRRQRKLNPPPGPKPWPIIGNLNLIGTLPHRSIHDLSQ  65

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYG  395
             KYG++M LKF S  V+VASS E AK+ LKT D  FA RP TAA  + T+N S++TWSPYG
Sbjct  66    KYGDIMQLKFRSFNVLVASSAEAAKIILKTQDVSFACRPKTAAGKYSTYNYSNITWSPYG  125

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
              +WR ARKI L E+F+ ++L+S+EY+R+EE  +L+  +Y +VG +  +LL+D L   +L+
Sbjct  126   AYWRQARKICLMELFSAKRLESYEYIRVEETNSLLKKIYSSVGEE--ILLKDMLSDVSLN  183

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
              ++R+V G KY      L + E   +   + +  LD+  LL+GV N+GD +PW+  LDLQ
Sbjct  184   VISRMVLGKKY------LDESEDSKVSPNEFKKMLDELLLLNGVFNIGDSIPWIDFLDLQ  237

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALT  932
             GYVK+MK   +++++FL +V+++H    K + E F   DMVD+ LQ+A+DP+L  DV L 
Sbjct  238   GYVKRMKILGKKFDRFLEHVLDEHNERRKAEGEKFVATDMVDVLLQLAEDPDL--DVKLE  295

Query  933   RDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFS  1112
             R  +     DML GG +T+  T+EWA  +L  KP I +K TEELDRVIG+ RWV+EKD  
Sbjct  296   RHGVKAFIQDMLGGGTETSTVTIEWAISQLLMKPEIFQKVTEELDRVIGKNRWVQEKDMP  355

Query  1113  QLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDN  1292
              LPYI+AI KET RLHP+  +L P  + EDC V  Y++  GT VL++VW+IGR+ K WD 
Sbjct  356   NLPYIEAIAKETMRLHPVAPMLVPGRAREDCKVGSYDITEGTRVLVSVWTIGRDPKLWDK  415

Query  1293  ANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG  1472
               EFCPERF+ +D+D++G DF  LPFG+GRR CPGYSLG KV+  TLANLLHGF W L G
Sbjct  416   PEEFCPERFIGRDIDVEGHDFKFLPFGAGRRMCPGYSLGFKVIEATLANLLHGFTWTLPG  475

Query  1473  DLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              +   D++M+E +GLTT  KFPL    +PRLP  
Sbjct  476   KMTKDDLNMEEIFGLTTPKKFPLVTVAQPRLPVE  509



>ref|XP_010090165.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB38962.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=449

 Score =   513 bits (1322),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 331/452 (73%), Gaps = 13/452 (3%)
 Frame = +3

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             M LKFGS PV+VASS + AKLFLKT+D +FASRP  AA  +T +N S++TW+PYGP+WR 
Sbjct  1     MQLKFGSFPVVVASSADMAKLFLKTYDHIFASRPQLAAGKYTTYNYSNITWAPYGPYWRQ  60

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RKI L+E+F+ ++L+S+EY+R+EE  A +S L+   G   PV+L++HL R TLS ++R+
Sbjct  61    GRKIYLAELFSSKRLESYEYIRVEEMRAFMSRLFSLSG--KPVVLKEHLSRVTLSVISRI  118

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G KY+S+     K E   + L++ Q  LD+ FLL+GV N+GDW+PWL  LDLQGY ++
Sbjct  119   VLGKKYFSE----SKSERSIVTLEEFQEMLDELFLLNGVFNIGDWIPWLRFLDLQGYERR  174

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             MKA ++ +++F ++V+++H A  K  ++F  KDMVD+ L++ D+P+LE  V LT D + G
Sbjct  175   MKALKKRFDRFHDHVLDEHKAKRKAVKDFVAKDMVDLLLELGDNPDLE--VKLTCDSVKG  232

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
                D++AGG DT+A TVEWA  EL ++P +I+KATEELDRVIG+ RWV EKD  QLPYI+
Sbjct  233   FLQDLIAGGTDTSATTVEWAMSELLKQPKLIDKATEELDRVIGKNRWVSEKDIPQLPYIN  292

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET R HP+  LL PH ++EDC V+GY++ +GT V IN WSIG +   WD   EF P
Sbjct  293   AIMKETMRKHPVAVLLAPHLALEDCQVSGYDIRKGTLVFINTWSIGSDQSVWDAPKEFRP  352

Query  1311  ERFL---EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG-DL  1478
             ERFL    KD+D+KGQ F LLPFGSGRR CPGYSLG+K++  +LANLLHGF WKL G + 
Sbjct  353   ERFLGKAGKDIDVKGQCFKLLPFGSGRRMCPGYSLGLKMISASLANLLHGFNWKLGGTNQ  412

Query  1479  KPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              P+D+ M+E YGL T  KFPL   +EPRLP H
Sbjct  413   TPEDLDMEELYGLATIRKFPLVAVMEPRLPVH  444



>emb|CAA65580.1| cytochrome P450 [Nicotiana tabacum]
Length=498

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 238/479 (50%), Positives = 336/479 (70%), Gaps = 11/479 (2%)
 Frame = +3

Query  111   RRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             R++    PPGP+PWPI+GN NL+  + H+S+H LS KYG +M L+FGS PV+V SS E A
Sbjct  27    RQRKLNLPPGPKPWPIVGNFNLIAPLAHRSVHELSLKYGPIMQLRFGSFPVVVGSSVEMA  86

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             K+FLK+ D  F  RP  AA  +T +N S++TWS YGP+WR ARK+ L E+FT ++L+S E
Sbjct  87    KVFLKSMDINFVDRPKMAAGKYTTYNYSNITWSAYGPYWRQARKMCLMELFTAKRLESLE  146

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             Y+R EE  +L+  LY+  G   P+LL+D+L+  +L+ ++R+V G +Y      L + +  
Sbjct  147   YIRTEELQSLLHDLYNLTG--KPILLKDYLMTLSLNVISRMVLGKRY------LDESKNS  198

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
              +  ++ +  LD+ FLL+GV+N+GD++PW+  +DLQGYVK+MK    ++++FL YV+++H
Sbjct  199   IVTPEEFKKMLDELFLLNGVLNIGDYIPWIDFMDLQGYVKRMKVLSNKFDRFLEYVLDEH  258

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
              A    +EN+  KDMVD+ LQ ADDP LE  V L R  +   T D+LAGG ++TA  VEW
Sbjct  259   NARRNAEENYVAKDMVDVLLQFADDPTLE--VKLERHGVKAFTQDLLAGGTESTAVIVEW  316

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL +KP I  KATEELDRVIG+ RWV+EKD    PYI+AI+KET RLHP+  +L P 
Sbjct  317   AISELLKKPEIFNKATEELDRVIGQNRWVQEKDIPNFPYIEAIVKETMRLHPVAPMLTPR  376

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
                EDC VAGY++ +GT VL++VW+I R+   WD    F PERFL   +D+KG +F LLP
Sbjct  377   LCGEDCKVAGYDILKGTRVLVSVWTIARDPTLWDEPEAFKPERFLGNSIDVKGHNFELLP  436

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             FG+GRR CPGY+LG+KV++ +LANLLHGFKW L  ++ P+D++M+E + L+   K PL+
Sbjct  437   FGAGRRMCPGYNLGLKVIQASLANLLHGFKWSLPDNMTPEDLNMEEIFCLSIPKKIPLA  495



>emb|CDP17013.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   515 bits (1326),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 247/510 (48%), Positives = 348/510 (68%), Gaps = 32/510 (6%)
 Frame = +3

Query  54    ALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
             A  WL  +         HQ++     PPGP+PWPI+GNLNL+G++PH+S+H LS  YG L
Sbjct  15    AATWLATMVIALLCRRFHQKK--LNLPPGPKPWPIVGNLNLIGTLPHRSIHQLSLTYGPL  72

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             M L+FGS PV+V SS E AK+FLKT DA FA RP T A  +T +N S++ WSPYGP+WR 
Sbjct  73    MHLRFGSFPVVVGSSVEMAKVFLKTMDATFADRPKTIAGKYTGYNYSNILWSPYGPYWRQ  132

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RK+ L E+F+ ++L+S+E++R+EE  +L+ GL+ ++G   PVLL+DHL   TL+ ++R+
Sbjct  133   VRKMCLMELFSAKRLESYEHIRVEEMNSLLLGLFQSLG--KPVLLKDHLTTMTLNVISRM  190

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G +Y  +       +   +  ++    +D+  LL+GV N+GD +PWL+ LDLQGY+K+
Sbjct  191   VLGKRYLDQS-----DQNSIVTPEEFVKMMDELLLLNGVFNIGDSIPWLNFLDLQGYIKR  245

Query  771   MKAFREEYEKFLNYVIEDHMA--MMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRI  944
             +KA  ++++ FL +V+++H A  M   ++N   KDMVD+ L +A+D  LE  V L R  +
Sbjct  246   LKALSKKFDWFLEHVLDEHNAARMANDEQNRVSKDMVDVLLDLAEDQTLE--VKLERHGV  303

Query  945   MGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPY  1124
                T D+L GG +++A TVEWA  EL +KP + EKA +ELDRVIG+ RWV EKD   LPY
Sbjct  304   KAFTLDLLVGGTESSAMTVEWAISELLKKPELFEKAIQELDRVIGQNRWVTEKDIPNLPY  363

Query  1125  IDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEF  1304
             ++AI+KET R+HP+  +L P +                  L+NVW+IGR+ + W N  EF
Sbjct  364   VEAIVKETLRMHPVAPMLVPRF------------------LVNVWTIGRDPELWKNPQEF  405

Query  1305  CPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKP  1484
             CP RF+ K++D+KGQD+ LLPFGSGRRKCPGYSLG+KVV++TLANLLHG+ WKL GD+ P
Sbjct  406   CPARFIGKEIDVKGQDYELLPFGSGRRKCPGYSLGLKVVQSTLANLLHGYNWKLPGDMNP  465

Query  1485  KDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +++ M E +GLTT  KFPL   +EPRLP H
Sbjct  466   EELDMGEIFGLTTPRKFPLVAVVEPRLPHH  495



>ref|NP_001061964.2| Os08g0456200 [Oryza sativa Japonica Group]
 dbj|BAD10411.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 gb|EAZ42966.1| hypothetical protein OsJ_27558 [Oryza sativa Japonica Group]
 dbj|BAF23878.2| Os08g0456200 [Oryza sativa Japonica Group]
Length=520

 Score =   516 bits (1328),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 248/492 (50%), Positives = 352/492 (72%), Gaps = 9/492 (2%)
 Frame = +3

Query  114   RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAK  293
             R+ Y  PPGP PWP+IGN NL+G++PH+S+H LS+KYGELMLL+FGS PV+V SS   A+
Sbjct  29    RRGYNLPPGPTPWPVIGNFNLIGALPHRSIHELSRKYGELMLLRFGSFPVVVGSSVAMAR  88

Query  294   LFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEY  470
             L LKTHDAVF  RP TA+  HT +  +D+TWSPYG +WR AR+I ++E+F+ R++ SFE+
Sbjct  89    LVLKTHDAVFIDRPRTASRKHTTYGYADITWSPYGAYWRQARRICVTELFSARRVASFEH  148

Query  471   VRIEERMALISGLYDAV--GTKNPVLL-RDHLVRFTLSTMTRLVTGNKYYSKDWELGKPE  641
             +R +E  AL+ GL+ A   G    V L RDHL   +++ +TR+V G +++ +  +    E
Sbjct  149   IRADEVRALVRGLFAAASSGRSGAVHLNRDHLSTLSMNVITRMVLGKRFFGEGADAA--E  206

Query  642   GYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIE  821
             G    L + +  LD+  LL+GV+N+GDW+PW+  +DLQGYV++MK   + ++ F+ +V++
Sbjct  207   GPVSTLSEFKWMLDELLLLNGVLNVGDWIPWVDWMDLQGYVRRMKKVGKMFDAFMEHVLD  266

Query  822   DHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAAT  998
             +H    + + E F  +DMVD+ + +ADDP+LE  + L R  +   T D++AGG ++++ T
Sbjct  267   EHSERRRREGEAFVARDMVDVLMDLADDPSLE--IKLGRVGVKAFTQDLIAGGTESSSVT  324

Query  999   VEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLL  1178
             VEWA  ELF+ P I   AT+ELDRV+GR RWV EKD   LPY+DAI+KET R+HP+  LL
Sbjct  325   VEWALSELFKNPAIFATATDELDRVVGRCRWVTEKDIPNLPYLDAIMKETMRMHPIVPLL  384

Query  1179  PPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFA  1358
              P  + +D  VAGY++P+G  VLINVW+IGR+ + WD A EF PERF+   +D+KGQDF 
Sbjct  385   IPRVARDDAAVAGYDIPKGARVLINVWTIGRDPELWDAAEEFMPERFIGSRIDVKGQDFE  444

Query  1359  LLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFP  1538
             LLPFGSGRR CPGY+LG+KV++ +LANLLHGF W+L   +K +++SMDE +GL+T  K+P
Sbjct  445   LLPFGSGRRMCPGYNLGLKVMQLSLANLLHGFAWRLPEGMKEEELSMDEVFGLSTTRKYP  504

Query  1539  LSYTIEPRLPTH  1574
             L   +EPRLP  
Sbjct  505   LQVVVEPRLPVQ  516



>ref|XP_006494828.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=513

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/514 (49%), Positives = 351/514 (68%), Gaps = 13/514 (3%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLL-GSIPHQSLHSLS  215
             SW      WL  +A +     + +RRK    PPGP+ WPIIGNLNL  G  PH+S+ +L 
Sbjct  7     SWVSCWGAWLATLAVILIPLHLLRRRK-LNLPPGPKSWPIIGNLNLFTGPAPHRSVDALC  65

Query  216   QKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPY  392
             +KYG ++ LKFGS PV+V SS E AK  LK+HDA+FA RP  AA  +T +N S++TWSPY
Sbjct  66    KKYGPIVQLKFGSFPVVVCSSVEMAKAILKSHDAIFAYRPKMAAGKYTGYNFSNITWSPY  125

Query  393   GPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTL  572
             GP++  ARKI   E+FT ++L S+EY+R+EE   L+  LY++ G   P+ L+DHL   +L
Sbjct  126   GPYFSQARKICTMELFTAKRLKSYEYIRVEELNVLLKHLYESSG--KPIALKDHLADVSL  183

Query  573   STMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDL  752
             + ++R+V G KY ++     +  G  I   +L+  +D+  LL+GV ++GD +PWL  LDL
Sbjct  184   NVISRVVLGKKYSNE-----RQNGIEITRHELKEMIDELILLNGVFDIGDSIPWLGFLDL  238

Query  753   QGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALT  932
             QG +K+MKA  +++++FL  V+++H A  KG +N+  KDMVD+ L +ADDP LE  V L 
Sbjct  239   QGNIKRMKAVAKKFDRFLEQVVDEHNARRKGIDNYVAKDMVDVLLLLADDPTLE--VKLD  296

Query  933   RDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFS  1112
             R  + G T D++AG  +T+   +EWAF EL + P I++KA EELDRVIG+ERW EEKD  
Sbjct  297   RHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIV  356

Query  1113  QLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDN  1292
              LP+I+AIIKET RLH    +L P  + EDC VAGY++ +GT VL+N W+I R+   W+N
Sbjct  357   NLPFIEAIIKETMRLHG-APMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWEN  415

Query  1293  ANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDG  1472
              NEFCPERFL K +D+KG DF LLPFG+GRR CPGYS G+KV++++LANLLHGF WKL G
Sbjct  416   PNEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPG  475

Query  1473  DLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ++  K+++M+E + L    K PL    +PRL  H
Sbjct  476   NMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPH  509



>gb|AED99875.1| cytochrome P450 [Panax notoginseng]
Length=512

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 343/476 (72%), Gaps = 16/476 (3%)
 Frame = +3

Query  156   IIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRP  335
             IIGNLNL+GS+PH+S+H LSQKYG +M L+FGS PV+V SS E AK+FLKT D  F  RP
Sbjct  42    IIGNLNLIGSLPHRSIHQLSQKYGPIMQLRFGSFPVVVGSSVEMAKIFLKTMDVNFVGRP  101

Query  336   ATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLY  512
              TAA  HT +N SD+TWSPYG +WR ARK+ L E+F+ ++LDS+EY+R+EE  +++  LY
Sbjct  102   KTAAGKHTTYNYSDITWSPYGAYWRQARKMCLMELFSAKRLDSYEYIRVEEMKSMLKQLY  161

Query  513   DAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWE---LGKPEGYSIPLKKLQGFLD  683
             +  G K  + L+D+L   +L+ ++R+V G +Y  +  +   + +PE +       +  LD
Sbjct  162   ELSGQK--IALKDYLSTVSLNVISRMVLGKRYLDESVDQKAVVRPEEF-------KKMLD  212

Query  684   DWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDE-NFA  860
             + FLL+GV N+GD +PW+  LDLQGYVK+MK   +++++FL +V+++H+A  + ++ ++ 
Sbjct  213   ELFLLNGVFNIGDSIPWIDFLDLQGYVKRMKVVSKKFDRFLEHVLDEHIARRETEKGDYV  272

Query  861   PKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWI  1040
              KDMVD+ LQ++DDP LE  V L R  +   T D+LAGG +++A TVEWA  +L +KP I
Sbjct  273   AKDMVDLLLQLSDDPTLE--VKLERHGVKAFTQDLLAGGTESSAVTVEWAISQLLKKPEI  330

Query  1041  IEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGY  1220
              EKATEELDRVIG+ RWVEEKD   LPYI AI+KET RLHP+  +L P  +  DC V GY
Sbjct  331   FEKATEELDRVIGKSRWVEEKDIQNLPYIQAIVKETMRLHPVAPMLVPREARVDCKVGGY  390

Query  1221  EVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGY  1400
             ++ +GT +L++VW+IGR+   WD  +EF PERF+ K +D+KG DF LLPFG+GRR CPGY
Sbjct  391   DIVKGTRILVSVWTIGRDPTLWDKPDEFVPERFIGKTMDVKGHDFELLPFGAGRRMCPGY  450

Query  1401  SLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             +LG+KV+ ++LANLLHGF WKL   +  +D++MDE +GL+T  + PL    +PRLP
Sbjct  451   TLGLKVIESSLANLLHGFNWKLPDSMTTEDLNMDEIFGLSTPKEIPLVTLAQPRLP  506



>ref|XP_007201979.1| hypothetical protein PRUPE_ppa004832mg [Prunus persica]
 gb|EMJ03178.1| hypothetical protein PRUPE_ppa004832mg [Prunus persica]
Length=489

 Score =   514 bits (1323),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 256/484 (53%), Positives = 336/484 (69%), Gaps = 28/484 (6%)
 Frame = +3

Query  126   KTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLK  305
             K PPGP+PWP +                       + LLKFGS PV+VASSPE  K FLK
Sbjct  31    KLPPGPKPWPKLAT--------------------SISLLKFGSYPVVVASSPEMTKQFLK  70

Query  306   THDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIE  482
             THD +FASRP TAA  + T++  ++TW+PYGP+WR  RKI L E+F+P++L+SF Y+R+E
Sbjct  71    THDHIFASRPQTAAGKYLTYDYLNVTWAPYGPYWRQGRKIFLMELFSPKRLESFRYIRVE  130

Query  483   ERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLK  662
             E  A  S LY   G    V+L++HL R +LS M+R+V G +Y+S    L   E   + LK
Sbjct  131   ENRAFASRLYALSG--KAVVLKEHLSRLSLSIMSRIVLGKEYFS----LTDFESSIMSLK  184

Query  663   KLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMK  842
             + Q  LD+ FLL+GV N+GDW+PWL  LDLQGYVK+MK  +++ + F  +V+ +H A  +
Sbjct  185   EFQDMLDELFLLNGVFNIGDWIPWLDFLDLQGYVKRMKVVKKKMDWFYEFVLHEHKARKE  244

Query  843   GDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQEL  1022
             G + F  KDMVD+ LQ+ DDPN + +V LT D I   T D++AGG DT+A+ +EWA  EL
Sbjct  245   GVKEFVAKDMVDLLLQLVDDPN-DLEVKLTYDSIKAFTQDVIAGGTDTSASVLEWAMSEL  303

Query  1023  FRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIED  1202
              ++P +IEKATEELDRVIG+ERWVEEKD   LPY+DAI+KET R HP   +LPPH ++ED
Sbjct  304   IKQPNLIEKATEELDRVIGKERWVEEKDLENLPYMDAIMKETMRKHPAVVMLPPHLALED  363

Query  1203  CIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGR  1382
             C VAGY+V +GT V +N+WS+GR+   WD  +EF PERFL K +D+KGQ F LLPFGSGR
Sbjct  364   CNVAGYDVRKGTLVFVNLWSMGRDPTLWDAPDEFRPERFLGKAIDVKGQSFELLPFGSGR  423

Query  1383  RKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPR  1562
             R CPGYSLG+K++ + LAN+LHGF WKL  ++K +D+ M+E YGL T  KFPL    EPR
Sbjct  424   RMCPGYSLGLKMIGSCLANMLHGFNWKLPENVKVEDLGMEEVYGLVTPRKFPLVVVTEPR  483

Query  1563  LPTH  1574
             LP H
Sbjct  484   LPIH  487



>gb|EMT01785.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=503

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 250/498 (50%), Positives = 344/498 (69%), Gaps = 23/498 (5%)
 Frame = +3

Query  93    ITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVA  272
             +  + +RR+ Y  PPGP+PWPIIGNLNL+G++PH+S+H+LS+KYG LM L+FGS PV+V 
Sbjct  20    LKAVLRRRRQYNLPPGPKPWPIIGNLNLIGTLPHRSIHALSKKYGPLMQLQFGSFPVVVG  79

Query  273   SSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPR  449
             SS E AK FLKTHD VF  RP TAA  +T +N SD+TWSPYG +WR ARK+ L+E+F+ +
Sbjct  80    SSVEMAKFFLKTHDVVFTDRPKTAAGRYTTYNYSDITWSPYGAYWRQARKMCLTELFSAK  139

Query  450   KLDSFEYVRIEERMALISGLY-DAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWE  626
             +L+S+EY+R EE +AL+  LY    G    V+L+D+L   +L+ +TR+V G KY  K+  
Sbjct  140   RLESYEYIRREEVLALLGDLYRGGAGASRVVVLKDYLSTVSLNVITRMVMGKKYLEKEVR  199

Query  627   LGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFL  806
                    + P  + +  +D+ FLL+GV+N+GD +PWL  +DLQGY+K+MK   + +++FL
Sbjct  200   DEAGAVITTP-DEFKWMIDELFLLNGVLNIGDSIPWLDWMDLQGYIKRMKKLSKMFDRFL  258

Query  807   NYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGED  983
              +V+++H    +   E+F  KDMVD+ LQ A DP LE  V L R+ +   T D++AGG +
Sbjct  259   EHVVDEHSERRRRQGESFVVKDMVDVLLQFASDPGLE--VKLNREGVKAFTQDLIAGGTE  316

Query  984   TTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHP  1163
             ++A TVEWA  EL +KP ++ KATEELDRV+GR RWV EKD S LPY+DAI+KET RLHP
Sbjct  317   SSAVTVEWALSELLKKPEVLAKATEELDRVVGRGRWVTEKDMSSLPYVDAIVKETMRLHP  376

Query  1164  LCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIK  1343
             +  +L P  S ED  + GY +P    VL            W+   EF PERF    +D+K
Sbjct  377   VAPMLVPRLSREDTSINGYALPARPRVL------------WEAPEEFMPERFFGSRLDVK  424

Query  1344  GQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL-DGDLKPKDISMDEAYGLT  1520
             GQD+ LLPFGSGRR CPGYSLG+KV++ +LANLLHGF W+L DG     ++SM+E +GL+
Sbjct  425   GQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFTWRLPDG----VELSMEEIFGLS  480

Query  1521  THPKFPLSYTIEPRLPTH  1574
             T  K+PL   +EP+LP H
Sbjct  481   TPRKYPLEAVVEPKLPAH  498



>ref|XP_006369134.1| hypothetical protein POPTR_0001s16790g [Populus trichocarpa]
 gb|ERP65703.1| hypothetical protein POPTR_0001s16790g [Populus trichocarpa]
Length=513

 Score =   511 bits (1316),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 346/487 (71%), Gaps = 9/487 (2%)
 Frame = +3

Query  117   KAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKL  296
             +  K PPGP+PWPIIGN NL+G +PH+SLH L++KYG +M +KFGS PV+V SS E A+ 
Sbjct  31    RKLKLPPGPKPWPIIGNFNLIGPLPHRSLHELAKKYGPIMQIKFGSIPVVVGSSAEVAEA  90

Query  297   FLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYV  473
              LKTHD   A RP  AA  +T +N SD+TWS YGP+W H RK    E+F+P++LD +++V
Sbjct  91    ILKTHDISLADRPKIAAGKYTTYNYSDITWSQYGPYWSHLRKFCNMEIFSPKRLDFYQHV  150

Query  474   RIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSI  653
             R+EE  +L+  LY   GT  P   R+     +LS ++RLV G + Y+ + E GK  G   
Sbjct  151   RVEELHSLLKSLYKTSGT--PFKTREKFSDLSLSVISRLVLG-RNYTLESEKGK--GVYT  205

Query  654   PLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMA  833
             P  + +  LD+ F+L+GV+ +GDW+PWLS  DLQG +KKMKA  ++ ++F+ + +E+H A
Sbjct  206   P-HEFKKILDELFVLNGVLEIGDWIPWLSYFDLQGNIKKMKAVAKKVDRFIEHELEEHDA  264

Query  834   MMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAF  1013
                G +N+  KDM+DI LQ++DDP+L  DV   R  +  LT D++AGG ++TA T EWA 
Sbjct  265   RRNGVKNYVAKDMMDILLQLSDDPSL--DVEFGRTGVKALTLDLIAGGTESTAVTAEWAL  322

Query  1014  QELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYS  1193
              EL +KP I EKATEELDRVIGRERWVEEKD   LPY+ AI+KET RLH +  LL P  +
Sbjct  323   AELLKKPEIFEKATEELDRVIGRERWVEEKDIVDLPYVTAIMKETMRLHNVSPLLVPRVA  382

Query  1194  IEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFG  1373
              ED  ++GY++P+GT V++NVW+IGR+ K WDN NEFCPERFL ++++++GQ+F L+PFG
Sbjct  383   REDVQISGYDIPKGTVVMVNVWTIGRDPKIWDNPNEFCPERFLGEEIEVEGQNFKLMPFG  442

Query  1374  SGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTI  1553
             +G+R C GY LG+K++++++ANLLHGF WKL   +K +D+ M+E + L+T  K PL    
Sbjct  443   AGKRICVGYPLGLKIIQSSVANLLHGFNWKLPKGMKKEDLDMEEIFALSTPKKNPLVAVA  502

Query  1554  EPRLPTH  1574
             EPRLP H
Sbjct  503   EPRLPPH  509



>ref|XP_011035731.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=513

 Score =   511 bits (1316),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 346/487 (71%), Gaps = 9/487 (2%)
 Frame = +3

Query  117   KAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKL  296
             +  K PPGP+PWPIIGN NL+G +PH+SLH L++KYG +M +KFGS PV+V SS E A+ 
Sbjct  31    RKLKLPPGPKPWPIIGNFNLIGPLPHRSLHELAKKYGPIMQIKFGSIPVVVGSSSEVAEA  90

Query  297   FLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYV  473
              LKTHD   A RP  AA  +T +N SD+TWS YGP+W H RK    E+F+P++LD +++V
Sbjct  91    ILKTHDISLADRPKIAAGKYTTYNYSDITWSQYGPYWSHLRKFCNMEIFSPKRLDFYQHV  150

Query  474   RIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSI  653
             R+EE  +L+  LY   GT  P   R+     +LS ++RLV G + Y+ + E GK  G   
Sbjct  151   RVEELHSLLKSLYKTSGT--PFKTREKFSDLSLSVISRLVLG-RNYTLESEKGK--GVYT  205

Query  654   PLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMA  833
             P  + +  LD+ F+L+GV+ +GDW+PWLS  DLQG +KKMKA  ++ ++F+ + +E+H A
Sbjct  206   P-HEFKKILDELFVLNGVLEIGDWIPWLSYFDLQGNIKKMKAVAKKVDRFIEHELEEHDA  264

Query  834   MMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAF  1013
                G +N+  KDM+DI LQ++DDP+L  DV   R  +  LT D++AGG ++TA T EWA 
Sbjct  265   RRNGVKNYVAKDMMDILLQLSDDPSL--DVEFGRTGVKALTLDLIAGGTESTAVTAEWAL  322

Query  1014  QELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYS  1193
              EL +KP I EKATEELDRVIGRERWVEEKD   LPY+ AI+KET RLH +  LL P  +
Sbjct  323   AELLKKPEIFEKATEELDRVIGRERWVEEKDIVDLPYVTAIMKETMRLHNVSPLLVPRVA  382

Query  1194  IEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFG  1373
              ED  ++GY++P+GT V++NVW+IGR+ K WDN NEFCPERFL ++++++GQ+F L+PFG
Sbjct  383   REDVQISGYDIPKGTVVMVNVWTIGRDPKIWDNPNEFCPERFLGEEIEVEGQNFKLMPFG  442

Query  1374  SGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTI  1553
             +G+R C GY LG+K++++++ANLLHGF WKL   +K +D+ M+E + L+T  K PL    
Sbjct  443   AGKRICVGYPLGLKIIQSSVANLLHGFNWKLPKGMKKEDLDMEEIFALSTPKKNPLVAVA  502

Query  1554  EPRLPTH  1574
             EPRLP H
Sbjct  503   EPRLPPH  509



>gb|KHF98584.1| Cytochrome P450 [Gossypium arboreum]
Length=480

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/517 (49%), Positives = 348/517 (67%), Gaps = 41/517 (8%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M   SWF    PWL A   L  ++    RR+    PPGP+PWPIIGNLNL+GS+PHQS+H
Sbjct  1     MATPSWFSYLTPWL-ATLALILLSLRLCRRRKLNLPPGPKPWPIIGNLNLVGSLPHQSIH  59

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTW  383
             +LS+KYG +M LKFGS PV+VASS E AK  LKT+D +F  RP  AA  + T+N SD+TW
Sbjct  60    ALSRKYGPIMQLKFGSFPVVVASSVEMAKAVLKTNDVIFTDRPKNAAGKYTTYNYSDITW  119

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+WR ARKI L+E+F  ++L+S++Y+R EE    +  LY++ GT+  ++L+DHL  
Sbjct  120   SPYGPYWRQARKICLTELFNAKRLESYQYIRREEMNLFLKRLYESSGTQ--IVLKDHLSS  177

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              +L+ ++R+V G KY       G  E   +   + +  LD+ FLL+GV+++GD +PWL+ 
Sbjct  178   LSLNVISRMVFGKKYTE-----GSGENEIVTPNEFKEMLDELFLLNGVLDIGDSIPWLTF  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGY+K+MKA  +++++FL +V+++H A  +G E++  KDMVD+ LQ+++DPNLE  V
Sbjct  233   LDLQGYIKRMKALSKKFDRFLEHVLDEHNARREGAEDYVAKDMVDVLLQLSEDPNLE--V  290

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L R  +   T                              +ATEELD VIGRERWVEEK
Sbjct  291   KLERHSVKAFT------------------------------QATEELDTVIGRERWVEEK  320

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   LPYID+I KET RLHP+  +L P  + +DC +AGY++P+GT   +NVW+IGR++  
Sbjct  321   DVVNLPYIDSIAKETMRLHPVAPMLVPRVARQDCKIAGYDIPKGTRAFVNVWTIGRDTSL  380

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             WDN NEF P+RF+ K +D+KG DF LLPFG+GRR CPGY LG+KV++ +LAN+LHGF WK
Sbjct  381   WDNPNEFWPDRFMGKSIDVKGHDFELLPFGAGRRMCPGYPLGIKVIQASLANVLHGFTWK  440

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L  +   +D +M+E +GL+T  K+PL    EPRLP H
Sbjct  441   LPNNTTKEDFNMEEIFGLSTPKKYPLEAIAEPRLPLH  477



>ref|XP_007202840.1| hypothetical protein PRUPE_ppa014596mg [Prunus persica]
 gb|EMJ04039.1| hypothetical protein PRUPE_ppa014596mg [Prunus persica]
Length=506

 Score =   509 bits (1310),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 250/476 (53%), Positives = 329/476 (69%), Gaps = 22/476 (5%)
 Frame = +3

Query  150   WPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFAS  329
             WPIIGNLNL+G +PHQS H LSQ YG +M +K GS PV+VASSPE AK FLKTHD +FAS
Sbjct  46    WPIIGNLNLVGPLPHQSAHKLSQTYGPIMQVKLGSCPVVVASSPEMAKQFLKTHDRIFAS  105

Query  330   RPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISG  506
             RP TAA  +  +    +T +PYGP+WR  RKI +SE+F+P+ L+SF Y+R+EE  A IS 
Sbjct  106   RPQTAAGKYLNYGYLSVTHAPYGPYWRQGRKIFISELFSPKSLESFRYIRVEENRAFISR  165

Query  507   LYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDD  686
             LY   G    V+L+ HL   TLS + R+V G  ++S    L   +   I LK+ Q   D+
Sbjct  166   LYAMSG--KAVVLKQHLSSLTLSVLCRIVLGKDHFS----LTTSKSSIISLKESQDMTDE  219

Query  687   WFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPK  866
              +LL+GV N+GDW+PWL   DLQGYVK+MKA +++ ++F  +V+ +H A  +G E F   
Sbjct  220   LYLLAGVANIGDWIPWLDVFDLQGYVKRMKALQKKLDRFYEFVLNEHKARKEGVEEFLMI  279

Query  867   DMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIE  1046
               +D+            +V LT D +   T D++ GG DT+A T+EWA  EL ++P +I+
Sbjct  280   LTIDL------------EVKLTYDTVKAFTQDLVIGGSDTSATTLEWAMSELIKQPNLIK  327

Query  1047  KATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEV  1226
             KATEELDRVIGRERWVEE+D   LPY+DAI+KE  R HP+  LL PH ++EDC VAGY+V
Sbjct  328   KATEELDRVIGRERWVEEEDLENLPYMDAIMKEAMRKHPVIVLL-PHLALEDCNVAGYDV  386

Query  1227  PRGTTVLINVWSIGRN-SKYWDNANEFCPERFLEKD-VDIKGQDFALLPFGSGRRKCPGY  1400
              +GT VL+N+WS+GR+ +  WD  +EF PERFL  + +D+KGQ F LLPFGSGRR CPGY
Sbjct  387   CKGTLVLVNIWSMGRDPTLLWDAPDEFRPERFLGNNAIDVKGQSFELLPFGSGRRMCPGY  446

Query  1401  SLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
                +K+VR+ LAN+LHGF WKL G +K +D+ M+E+YGL TH KFPL    EPRLP
Sbjct  447   GHALKMVRSCLANMLHGFTWKLSGHVKTEDLGMEESYGLLTHRKFPLVVVTEPRLP  502



>ref|XP_008784472.1| PREDICTED: cytochrome P450 71A2-like [Phoenix dactylifera]
Length=776

 Score =   518 bits (1334),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 252/476 (53%), Positives = 339/476 (71%), Gaps = 12/476 (3%)
 Frame = +3

Query  153   PIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASR  332
             P+IGNLNL+ S+PH+SLH+LSQKYG LM L FGS PVIVASS +TAKL LKTHD  F  R
Sbjct  307   PVIGNLNLISSLPHRSLHALSQKYGPLMHLYFGSFPVIVASSVDTAKLILKTHDVTFCGR  366

Query  333   PATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGL  509
             P TAA   T +N S++ WS YGP+WR ARK+ ++E+F+ R+LDS++Y+R+EE   L+  L
Sbjct  367   PKTAAGKWTAYNYSNIGWSQYGPYWRQARKMCMTELFSARRLDSYKYIRVEEVKNLLRDL  426

Query  510   YDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDW  689
             +++ G   PV L DHL   +LS ++R+V G KY      L K E   +   + +  LD++
Sbjct  427   FNSSG--RPVNLSDHLSNASLSIISRMVLGKKY------LDKSESSVVSPVEFKAMLDEF  478

Query  690   FLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPK  866
              LL+GV+N+GD +PWL  LDLQGY+K+MK   +++++FL +V+++H    + + E F  K
Sbjct  479   MLLNGVMNIGDSIPWLDFLDLQGYIKRMKKIGKKFDRFLEHVLDEHGERRRREGEKFVTK  538

Query  867   DMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIE  1046
             DMVD+ L +ADDPNLE  V L R  + G T D++AGG DT A T+EW   EL ++P I +
Sbjct  539   DMVDVLLLLADDPNLE--VKLERRGVKGFTQDLIAGGTDTYAVTMEWVISELLKRPEIFK  596

Query  1047  KATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEV  1226
             KATEELDRVIGR RWVEEK+   LPYI+AI+KET R+HP+  +L P   +EDC VAGY++
Sbjct  597   KATEELDRVIGRSRWVEEKEVHHLPYIEAIMKETMRMHPVVPMLIPRQCMEDCRVAGYDI  656

Query  1227  PRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSL  1406
               GT VL+NVW+IGR+   WD   EF PERF+   +D+KG+DF LLPFGSGRR CPGYSL
Sbjct  657   RAGTRVLVNVWTIGRDPGIWDAPEEFRPERFIGSSIDVKGKDFELLPFGSGRRMCPGYSL  716

Query  1407  GMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             G+  ++ +LANLLHGF W+L   +K +D+SM+E +G TT  K PL   +EP+LP H
Sbjct  717   GLMEIQLSLANLLHGFAWRLPDGMKVEDLSMEEIFGATTPRKVPLEVVVEPKLPAH  772


 Score =   276 bits (707),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 210/316 (66%), Gaps = 16/316 (5%)
 Frame = +3

Query  27   MEVFSW--FFQALPWLLAIAFLFKITTIHQRRKAYKT--PPGPRPWPIIGNLNLLGSIPH  194
            ME+ SW  +   LP  + +  L   +   +RR+  K   PPGP+P P+IGNLNL+ S+PH
Sbjct  1    MELPSWATYLATLPASILLLLLLLKSLFCRRRRLCKLNLPPGPKPLPVIGNLNLISSLPH  60

Query  195  QSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRS  371
            +SLH+LSQKYG LM L FGS PVIVASS +TAKL LKTHD  F  RP TAA   T +N S
Sbjct  61   RSLHALSQKYGPLMHLYFGSFPVIVASSVDTAKLILKTHDVTFCGRPKTAAGKWTAYNYS  120

Query  372  DMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRD  551
            ++ WS YGP+WR ARK+ ++E+F+ R+LDS++Y+R+EE   L+  L+++ G   PV L D
Sbjct  121  NIGWSQYGPYWRQARKMCMTELFSARRLDSYKYIRVEEVKNLLRDLFNSSG--RPVNLSD  178

Query  552  HLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVP  731
            HL   +LS ++R+V G KY      L K E   +   + +  LD++ LL+GV+N+GD +P
Sbjct  179  HLSNASLSIISRMVLGKKY------LDKSESSVVSPVEFKAMLDEFMLLNGVMNIGDSIP  232

Query  732  WLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPN  908
            WL  LDLQGY+K+MK   +++++FL +V+++H    + + E F  KDMVD+ L +ADDPN
Sbjct  233  WLDFLDLQGYIKRMKKIGKKFDRFLEHVLDEHGERRRREGEKFVTKDMVDVLLLLADDPN  292

Query  909  LEADVALTRDRIMGLT  956
            LE  V L R  + G T
Sbjct  293  LE--VKLERRGVKGFT  306



>emb|CDP20028.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   504 bits (1299),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 245/424 (58%), Positives = 319/424 (75%), Gaps = 14/424 (3%)
 Frame = +3

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRH  410
             M LKFGS PV+VASSPE AK FL+THD +FASRP TAA  + ++N SD+TW+PYGPFWR 
Sbjct  1     MQLKFGSSPVVVASSPEMAKEFLQTHDNIFASRPTTAAGKYASYNCSDLTWAPYGPFWRQ  60

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
             ARK+ L+++F P++LDSFE +RIEER A IS LY   G   PV++RDHL R TLST +++
Sbjct  61    ARKLYLTQIFNPKRLDSFESIRIEERRAFISSLYALSG--KPVVIRDHLTRLTLSTASQM  118

Query  591   VTGNKYYSKDWELGKPEGY-SIP-LKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYV  764
             V  NKY+++       EG  S+P  ++ Q  +D W LLSGV N+GDW+PWL   DLQGYV
Sbjct  119   VLSNKYFAQS------EGARSLPTFEEFQEMIDTWCLLSGVFNIGDWIPWLDRFDLQGYV  172

Query  765   KKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRI  944
             K+MKA  +++++F N+V++ H A  K + +F PKDMVDI LQ A+DP+L+  V LT D+I
Sbjct  173   KQMKALHKKFDRFHNHVLDAHQARRKTERDFIPKDMVDILLQYAEDPDLQ--VKLTSDQI  230

Query  945   MGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPY  1124
              GL   ++     T+ A ++     L + P +I KATEELDRVIGR++WVEE DFS+LP+
Sbjct  231   KGLIQFVIYNYSYTSLA-LDLGSNRLLKHPRLIRKATEELDRVIGRDKWVEEADFSKLPF  289

Query  1125  IDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEF  1304
             ++AIIKETFRLHP  TLL P Y++EDC VAG  + +GTTV IN WSIGRNSKYWD+  EF
Sbjct  290   LEAIIKETFRLHPPATLLLPRYALEDCTVAGSNIAKGTTVFINTWSIGRNSKYWDSPEEF  349

Query  1305  CPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKP  1484
              PERFLEKD+D+KGQ+F LLPFGSGRR+CPGY+LG+K++R+ LANLLHGF WKL   +KP
Sbjct  350   IPERFLEKDIDMKGQNFVLLPFGSGRRRCPGYNLGIKLIRSMLANLLHGFNWKLPHGMKP  409

Query  1485  KDIS  1496
             ++I 
Sbjct  410   EEIC  413



>ref|XP_004956936.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=516

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 254/519 (49%), Positives = 351/519 (68%), Gaps = 11/519 (2%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             ME+ +W       L  + FL  ++   +RR+   + PGP+PWP+IGN NLLG++PH+SL 
Sbjct  1     MELPAWASVLAVVLATVLFLRAVSG--RRRRPCSSLPGPKPWPVIGNFNLLGALPHRSLD  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
             +L++++G LM ++FGS PV++ASS + AK FLKTHD+ F  RP  AA  +T +N S++ W
Sbjct  59    ALAKRHGPLMRVQFGSFPVVIASSVDMAKFFLKTHDSAFIDRPKMAAGKYTTYNYSNIAW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG +WR ARKI   E+F+ R+L+S E+VR EE  AL+  L+ A G   P  L++ L  
Sbjct  119   SPYGAYWRQARKICADELFSARRLESSEHVRREEVRALLRDLHGAAGQVVP--LKERLST  176

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL-KKLQGFLDDWFLLSGVINLGDWVPWLS  740
              +L+ + R+V G K  + D E+    G S+   K+ +  LD+ FLL+GV+N+GDW+PWLS
Sbjct  177   MSLNMIARMVLGRK--AVDREVVASGGGSVTTWKEFRWMLDELFLLNGVLNIGDWIPWLS  234

Query  741   GLDLQGYVKKMKAFREEYEKFL-NYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEA  917
              LDLQGYV++MK   + +++F+ N V E +    +  + F  KDMVD  LQ+ADDPNLE 
Sbjct  235   WLDLQGYVRRMKRVGKMFDRFMENVVEEHNERRRREGDAFVAKDMVDRLLQLADDPNLE-  293

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V  TRD +   T D++AGG ++ A  VEWA  EL + P +  KATEELD VIGR RWV 
Sbjct  294   -VKFTRDSVKAFTQDLVAGGTESAAVIVEWAISELLKNPEVFAKATEELDSVIGRGRWVT  352

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             EKD + LPY+DAI+KET RLH +  LL P  S ED  V G+++P GT VL+N W I R+ 
Sbjct  353   EKDMAHLPYVDAIVKETMRLHMVVPLLSPRLSREDTSVGGHDIPAGTRVLVNAWIISRDP  412

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
               W+   EF PERF+   +D+KGQDF +LPFGSGRR CPGYSLG+KV++ TLANLLHGF 
Sbjct  413   ALWEAPEEFRPERFVGSKIDVKGQDFEMLPFGSGRRMCPGYSLGLKVIQGTLANLLHGFA  472

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             W+L   +  +++SM+E +GL+T  KFPL   +EP+LP H
Sbjct  473   WRLPDGMTKEELSMEEVFGLSTPRKFPLQVVVEPKLPAH  511



>ref|NP_001062713.1| Os09g0264400 [Oryza sativa Japonica Group]
 dbj|BAD38500.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF24627.1| Os09g0264400 [Oryza sativa Japonica Group]
 gb|EAZ43968.1| hypothetical protein OsJ_28589 [Oryza sativa Japonica Group]
 dbj|BAG94869.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   506 bits (1302),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 248/490 (51%), Positives = 339/490 (69%), Gaps = 14/490 (3%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             YK PPGP+PWPIIGNLNL+ S+PH+S+H +S+++G ++ L FGS PV+V SS E AKLFL
Sbjct  33    YKLPPGPKPWPIIGNLNLISSLPHRSIHEISKRHGPIVQLWFGSCPVVVGSSVEMAKLFL  92

Query  303   KTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             +T+DAVFA RP TAA  +T ++ +D+TWSPYG +WR ARK+  +E+F+ R+L+S E++R 
Sbjct  93    QTNDAVFADRPRTAAGKYTAYDCTDITWSPYGAYWRQARKMCAAELFSARRLESLEHIRH  152

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             EE  AL+  L+ +    N V LRDHL    L  ++R+V G KY  K     +P G    +
Sbjct  153   EEVRALLRELHGSGAAGNAVQLRDHLSMAALGVISRMVLGKKYVEK-----QPAGGGAAM  207

Query  660   KKLQGF---LDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH-  827
                + F   L++ FL++GV+N+GD++PWL  LDLQGY+++MK       +FL+ V+++H 
Sbjct  208   TTPEEFKWMLEELFLMNGVLNIGDFIPWLDWLDLQGYIRRMKNVNRLIHRFLDRVLDEHD  267

Query  828   -MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
                 ++GD  F  +DMVDI LQ+ADDPNL  DV LTR+ I G+T D++ GG DT+  TVE
Sbjct  268   ERRRLQGD-GFVARDMVDILLQLADDPNL--DVQLTRNGIKGITQDLVTGGADTSTVTVE  324

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  E+ + P I+ KATEELD ++G  R V E D   LPYI AI+KET R+HP+  LL P
Sbjct  325   WAMSEVLKNPAILAKATEELDTIVGVGRLVTEGDIPHLPYIHAIMKETMRMHPVVPLLVP  384

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
               S ED  VAGY+VP GT VL+N W+IGR+   WD+  +F PERF+   +D+KG+DF LL
Sbjct  385   RMSREDASVAGYDVPAGTRVLVNTWTIGRDPSVWDSPEQFRPERFVGSGIDVKGRDFELL  444

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PF SGRR CPGY+LG+KV++ TLANLLH F W L   +   ++SM+E +GLT   K PL 
Sbjct  445   PFSSGRRMCPGYNLGLKVIQLTLANLLHAFSWCLPDGVTAGELSMEEIFGLTMPRKIPLL  504

Query  1545  YTIEPRLPTH  1574
               ++PRLP H
Sbjct  505   AVVKPRLPDH  514



>emb|CDP21484.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   503 bits (1296),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 249/519 (48%), Positives = 344/519 (66%), Gaps = 46/519 (9%)
 Frame = +3

Query  27    MEVFS--WFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQS  200
             ME FS  W   AL W+  +         HQ++     PPGPR WPIIGNLNL+G++PH+S
Sbjct  1     MESFSPTWAAYALAWVTTVVIAHLSKHFHQQK--LNLPPGPRQWPIIGNLNLIGTLPHRS  58

Query  201   LHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDM  377
             LH LS  YG LM L+FGS PV+V SS E AK+FLKT D  FA RP TAA  +T ++ ++M
Sbjct  59    LHQLSLTYGPLMHLQFGSFPVVVGSSVEMAKVFLKTMDGTFAGRPKTAAGKYTAYDCTNM  118

Query  378   TWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHL  557
             TWSPYGP+WR ARKI L+E+F+ ++L+S+E++R+EE  +L+  L                
Sbjct  119   TWSPYGPYWRQARKIFLTELFSAKRLESYEHIRVEEMNSLLLQL----------------  162

Query  558   VRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWL  737
               F L+ ++R+V G  Y      + + E   +  ++ +  +D+ FLL+GV N+GD++PW+
Sbjct  163   --FNLNVISRMVLGKTY------IDESENSIVTPEEFRQMMDEVFLLTGVFNIGDFIPWI  214

Query  738   SGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEA  917
               LDLQGY+K+MK   ++ ++FL +V+++H A  K + +   KDM D+ L +ADDP LE 
Sbjct  215   DFLDLQGYIKRMKILSKKVDRFLEHVLDEHNARRKDETDCVSKDMADVLLDLADDPTLE-  273

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V L R  +  LT D+LAGG +T+A T+EWA  EL + P I  KA EELDRVIG+ RWV 
Sbjct  274   -VKLERRGVKALTLDLLAGGTETSATTIEWAISELLKNPEIFNKAAEELDRVIGQNRWVN  332

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             EKD   LPYI+A+IKET R+HP+  LL P  + EDC VAGY++ RGT V++NV       
Sbjct  333   EKDMPNLPYIEAVIKETMRMHPVVPLLVPRCAREDCKVAGYDIQRGTRVIVNV-------  385

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
                     FCP+RF+ KD+D KGQD   LPFG+GRR CPGYSLG+KV++++LANLLHG++
Sbjct  386   --------FCPDRFMGKDIDFKGQDCKFLPFGAGRRMCPGYSLGLKVIQSSLANLLHGYR  437

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL  D+KP+D+ M+E +G+TT  K PL   +EPRLP +
Sbjct  438   WKLPNDMKPEDLDMEERFGITTPRKIPLVAIVEPRLPRN  476



>ref|XP_006427644.1| hypothetical protein CICLE_v10025378mg [Citrus clementina]
 gb|ESR40884.1| hypothetical protein CICLE_v10025378mg [Citrus clementina]
 gb|KDO55336.1| hypothetical protein CISIN_1g010172mg [Citrus sinensis]
Length=516

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 260/514 (51%), Positives = 349/514 (68%), Gaps = 20/514 (4%)
 Frame = +3

Query  45    FFQALPWLLAIAFLFKITTIHQRRKAYKT--PPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             F+  L +L  + FLF+      RR + K   PPGP+PWP IGNLNL+G +PH S+HSLSQ
Sbjct  14    FYSILFFLPIVLFLFR------RRFSRKVNLPPGPKPWPFIGNLNLIGPLPHVSIHSLSQ  67

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG LM LKFG   V+V SS E A+L LKTHD  FASRPA  A  +T +N S M  +PYG
Sbjct  68    KYGPLMHLKFGLSSVVVGSSVEVAELLLKTHDISFASRPALLAGKYTTYNYSGMATAPYG  127

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARKI L E+   ++LD FEY+R+EER A +  L+ +V T   V L+DHL     +
Sbjct  128   PYWRQARKICLMELLGTKRLDQFEYMRVEERNAFLFELFKSVSTY--VHLKDHLYTLNHT  185

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
             ++ R+V G +Y  K       E  ++  K     L++ FLL+G++++GD +PWL+  DLQ
Sbjct  186   SICRMVLGKRYTDK------AEKNTVTPKDFTEMLEELFLLNGILDIGDSIPWLASFDLQ  239

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             G+VK+MK   ++ +KF   ++++H A  K  +++   DMVD+ L +ADDP+LE  V L R
Sbjct  240   GHVKRMKDVSKKLDKFYEDILDEHYARRKSIKDYGVHDMVDVLLHLADDPSLE--VKLER  297

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
             + I  L  D+L  G DT+A  VEWA  EL + P  I+KATEELDR IGR+RWVEEKD   
Sbjct  298   EHIKALIQDLLTAGTDTSAINVEWAMSELLKSPETIQKATEELDRAIGRDRWVEEKDIVS  357

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LPY+ AI+KET RLHP+  LL P  + EDC VAGY++ + T V++NVW+IGR+   W+  
Sbjct  358   LPYLQAIVKETMRLHPVAPLLAPRVAREDCKVAGYDILKNTRVMVNVWAIGRDPTIWEKP  417

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
             NEF PERF+ K++D+KG DF LLPFGSGRR C GY LG+KVV++TLANLLHGF+WKL GD
Sbjct  418   NEFRPERFIGKEIDVKGHDFQLLPFGSGRRMCIGYGLGLKVVQSTLANLLHGFEWKLPGD  477

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYT-IEPRLPTH  1574
             +K +D++M++ +GLT   K PL     +PRLP H
Sbjct  478   MKNEDLNMEDRFGLTMSRKVPLVVVPSKPRLPLH  511



>gb|AGI98132.1| cytochrome P450 [Narcissus tazetta]
Length=505

 Score =   503 bits (1296),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 246/512 (48%), Positives = 343/512 (67%), Gaps = 25/512 (5%)
 Frame = +3

Query  57    LPWLLAIAFLFKITT-------IHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLS  215
             LPW+L +  L    T       +  RR+    PPGP+P+PI+GNL  +G I H+S+H LS
Sbjct  4     LPWILDLPILVATITTIIIILKLTNRRRRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLS  63

Query  216   QKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPY  392
              KYG +M LKFGS+P++V SS E A+ FLKTHD +FASRP +AA  +T ++ SD+T+SPY
Sbjct  64    LKYGPIMQLKFGSRPIVVGSSVEAARFFLKTHDVIFASRPESAAGKYTAYDYSDITFSPY  123

Query  393   GPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTL  572
             GP+ R  RKI L E+F+PR+LDS EY+R+EE   L+  L+ + G +  V ++D +    +
Sbjct  124   GPYLRQIRKICLVELFSPRRLDSLEYIRVEEIRLLMQDLFRSSGER--VAVKDCMSTLGM  181

Query  573   STMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDL  752
             + ++R+V G KY  ++ E            +L+G +D+WF L+   N GD  PWL   D 
Sbjct  182   NVISRMVLGKKYLGEEGE------------ELKGMIDEWFALTAAFNPGDLFPWLGFFDW  229

Query  753   QGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVAL  929
             +G VKKMKA  + + +F + V+++H    K + E F  KDMVD+ LQIADDP LE  V L
Sbjct  230   RGVVKKMKALSKRFHRFWDRVLDEHNERRKEEGERFEAKDMVDVLLQIADDPGLE--VKL  287

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
             TRD +   T D++ GG +T+A T+EWA  EL + P IIEKATEELDRV+G+ RWVEEKD 
Sbjct  288   TRDSVKAFTQDLIGGGTETSATTIEWATAELVKHPEIIEKATEELDRVVGKTRWVEEKDI  347

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWD  1289
               LPY++++IKET RLHP+  LL P  + ED    GY++P GT V +NVWSIGR+   WD
Sbjct  348   QSLPYLESVIKETMRLHPVLPLLIPRLAREDSTYEGYDIPAGTRVFVNVWSIGRDPSMWD  407

Query  1290  NANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLD  1469
             +  EF PERF+ K++ +KGQ++ LLPFG+GRR CPGY LG++ ++ +LANLLHGF WKL 
Sbjct  408   DPEEFRPERFIGKEISLKGQNYELLPFGAGRRMCPGYPLGLREIQMSLANLLHGFVWKLP  467

Query  1470  GDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
               +  ++++M+E +GL T  K PL   +EPRL
Sbjct  468   DGMTEEELNMEEGFGLATPRKVPLEVVLEPRL  499



>ref|XP_002462454.1| hypothetical protein SORBIDRAFT_02g025830 [Sorghum bicolor]
 gb|EER98975.1| hypothetical protein SORBIDRAFT_02g025830 [Sorghum bicolor]
Length=521

 Score =   504 bits (1298),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 256/525 (49%), Positives = 352/525 (67%), Gaps = 17/525 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRK----AYKTPPGPRPWPIIGNLNLLGSIPH  194
             ME+ +W   +L  ++    LF I  IH RR+       + PGP+PWP+IGN NLLG++PH
Sbjct  1     MELSAW--ASLSAVVLSTVLFLIGAIHARRRRRPSISNSLPGPKPWPVIGNFNLLGALPH  58

Query  195   QSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRS  371
             +SL +LS+ +G LM ++FGS PV++ASS + A+ FLKTHD+ F  RP  AA  +T +N S
Sbjct  59    RSLDALSKLHGPLMRVQFGSFPVVIASSVDMARFFLKTHDSAFIDRPKMAAGKYTTYNYS  118

Query  372   DMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRD  551
             ++ WSPYG +WR ARKI   E+F+ R+L+S E+VR EE  AL+  L+        V L++
Sbjct  119   NIAWSPYGAYWRQARKICADELFSARRLESLEHVRREEVHALLRDLH-GTAPGQVVQLKE  177

Query  552   HLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL-KKLQGFLDDWFLLSGVINLGDWV  728
              L   +L+ + R+V G K      E+    G S+   ++ +  LD+ FLL+GV+N+GDW+
Sbjct  178   RLSTMSLNIIARMVLGRKCVEN--EVVTSGGGSVTTWREFRWMLDELFLLNGVLNVGDWI  235

Query  729   PWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH--MAMMKGDENFAPKDMVDIFLQIADD  902
             PW+S LDLQGYV++MK     +++F+  V+E+H    + +GDE F P+DMVD  LQ+ADD
Sbjct  236   PWVSWLDLQGYVRRMKRVGRMFDRFMENVVEEHNERRLREGDE-FVPQDMVDRLLQLADD  294

Query  903   PNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGR  1082
             P+L  DV LTRD +   T D++AGG ++ A  VEW   EL + P +  KATEELD VIGR
Sbjct  295   PSL--DVKLTRDSVKAFTQDLVAGGTESAAVIVEWGISELMKNPDVFAKATEELDGVIGR  352

Query  1083  ERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAG-YEVPRGTTVLINVW  1259
             +RWV EKD  +LPY+DAI+KET RLH +  LL P  S ED  V G Y++P GT VLIN W
Sbjct  353   DRWVTEKDMPRLPYMDAIVKETMRLHMVVPLLSPRLSREDTSVGGRYDIPAGTRVLINAW  412

Query  1260  SIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLAN  1439
             +I R+   WD   EF PERF+   +D+KGQDF LLPFGSGRR CPGYSLG+KV++ TL N
Sbjct  413   TISRDPALWDAPEEFWPERFVGSKIDVKGQDFELLPFGSGRRMCPGYSLGLKVIQVTLVN  472

Query  1440  LLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             LLHGF W+L   +  +++SM+E +GL+T  KFPL   +EP+LP  
Sbjct  473   LLHGFAWRLPDGMTKEELSMEEVFGLSTPRKFPLQAVVEPKLPAR  517



>gb|EMT12610.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=513

 Score =   503 bits (1296),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 235/489 (48%), Positives = 343/489 (70%), Gaps = 9/489 (2%)
 Frame = +3

Query  117   KAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKL  296
             K Y  PPGP+PWPIIGN +L+G++PH+S+H LS+KYG LM L+FGS P+IVASS + A+ 
Sbjct  28    KKYNLPPGPKPWPIIGNFDLIGALPHRSIHELSKKYGPLMHLRFGSFPLIVASSVDMARF  87

Query  297   FLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYV  473
             FL+T D ++  RP TA+  +T +N +D+TWSPYG +WR AR+I L+++F+PR+L    ++
Sbjct  88    FLRTKDILYVDRPKTASGKYTTYNYADITWSPYGAYWRQARRICLTKLFSPRRLALMAHI  147

Query  474   RIEERMALISGLYDAVGTKNPV-LLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYS  650
             R++E  A++  ++   G    V L RDH+   +L+ +TR+V G + ++     G  EG  
Sbjct  148   RVDEVHAMVRDIFAVSGPTRVVHLYRDHMSTLSLNVITRMVMGKRLFAD----GSLEGPV  203

Query  651   IPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH-  827
               ++  +  +D+ FLL+GV+N+GDW+PWL  +DLQGYV++MK   + ++  + +V+++H 
Sbjct  204   PSMEVFRWMMDELFLLNGVLNIGDWIPWLDWMDLQGYVRRMKKVGKMFDALMEHVLDEHS  263

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
             +   +  E  A +DMVD+ + IADDP+LE  V L R  +   T D++AGG +++AATVEW
Sbjct  264   VGEHRRREGEAARDMVDVLMDIADDPSLE--VPLGRIGVKAFTQDLIAGGTESSAATVEW  321

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             A  EL R+P   + AT+ELDR++GR RWV E+D   LPYI+A++KET R+HP+  LL P 
Sbjct  322   AMSELLRRPDAFDVATKELDRIVGRGRWVMEEDMPNLPYIEAMVKETMRMHPIVPLLIPR  381

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
              + ED  V GY+VP+G  VLINVW++GR+ + WD   EF PERF+   +D+KGQD  LLP
Sbjct  382   VAREDAAVGGYDVPKGARVLINVWAMGRDPELWDAPEEFRPERFIGSKIDVKGQDLELLP  441

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FGSGRR CPGY+LG+K VR +LANLLHGF W L   +  +++SM+E +GLTT  K+PL  
Sbjct  442   FGSGRRMCPGYNLGLKEVRLSLANLLHGFTWTLPEGMSKEEVSMEEVFGLTTSRKYPLEV  501

Query  1548  TIEPRLPTH  1574
               +P+LPTH
Sbjct  502   VADPKLPTH  510



>ref|XP_006493374.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=516

 Score =   503 bits (1294),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 259/514 (50%), Positives = 349/514 (68%), Gaps = 20/514 (4%)
 Frame = +3

Query  45    FFQALPWLLAIAFLFKITTIHQRRKAYKT--PPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             F+  L +L  + FLF+      RR + K   PPGP+PWP IGNLNL+G +PH S+HSLSQ
Sbjct  14    FYSILFFLPIVLFLFR------RRFSRKVNLPPGPKPWPFIGNLNLIGPLPHVSIHSLSQ  67

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYG  395
             KYG LM LKFG   V+V SS E A+L LKTHD  FASRPA  A  +T +N S M  +PYG
Sbjct  68    KYGPLMHLKFGLSSVVVGSSVEVAELLLKTHDISFASRPALLAGKYTTYNYSGMATAPYG  127

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLS  575
             P+WR ARKI L E+   ++L+ FEY+R+EER A +  L+ +V T   V L+DHL     +
Sbjct  128   PYWRQARKICLMELLGTKRLNQFEYMRVEERNAFLFELFKSVSTY--VHLKDHLHTLNHT  185

Query  576   TMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQ  755
             ++ R+V G +Y  K       E  ++  K     L++ FLL+G++++GD +PWL+  DLQ
Sbjct  186   SICRMVLGKRYTDK------AEKNTVTPKDFTEMLEELFLLNGILDIGDSIPWLASFDLQ  239

Query  756   GYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTR  935
             G+VK+MK   ++ +KF   ++++H A  K  +++   DMVD+ L +ADDP+LE  V L R
Sbjct  240   GHVKRMKDVSKKLDKFYEDILDEHYARRKSIKDYGVHDMVDVLLHLADDPSLE--VKLER  297

Query  936   DRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQ  1115
             + I  L  D+L  G DT+A  VEWA  EL + P  I+KATEELDR IGR+RWVEEKD   
Sbjct  298   EHIKALIQDLLTAGTDTSAINVEWAMSELLKSPETIQKATEELDRAIGRDRWVEEKDIVS  357

Query  1116  LPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNA  1295
             LPY+ AI+KET RLHP+  LL P  + EDC VAGY++ + T V++NVW+IGR+   W+  
Sbjct  358   LPYLQAIVKETMRLHPVAPLLAPRVAREDCKVAGYDILKNTRVMVNVWAIGRDPTIWEKP  417

Query  1296  NEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGD  1475
             NEF PERF+ K++D+KG DF LLPFGSGRR C GY LG+KVV++TLANLLHGF+WKL GD
Sbjct  418   NEFRPERFIGKEIDVKGHDFQLLPFGSGRRMCIGYGLGLKVVQSTLANLLHGFEWKLPGD  477

Query  1476  LKPKDISMDEAYGLTTHPKFPLSYT-IEPRLPTH  1574
             +K +D++M++ +GLT   K PL     +PRLP H
Sbjct  478   MKNEDLNMEDRFGLTMSRKVPLVVVPSKPRLPLH  511



>gb|AGT17101.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=507

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 249/491 (51%), Positives = 334/491 (68%), Gaps = 15/491 (3%)
 Frame = +3

Query  108   QRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPET  287
             +RR+A  + PGP+PWPIIGN NLLG++PH+SL +LS+++G LM ++FGS PV++ASS + 
Sbjct  26    RRRRACNSLPGPKPWPIIGNFNLLGALPHRSLDALSKRHGPLMRVQFGSFPVVIASSVDM  85

Query  288   AKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSF  464
             AK FLKTHD+VF  RP  AA  +T +N S++ WSPYG +WR ARKI   E+F+ R+L+SF
Sbjct  86    AKFFLKTHDSVFIDRPKMAAGKYTTYNYSNIAWSPYGAYWRQARKICADELFSARRLESF  145

Query  465   EYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEG  644
             E+VR EE  AL+  L+   G   P  L++ L   +L+ +TR+V G K   K+  +    G
Sbjct  146   EHVRQEEVHALLRTLHGTAGQVVP--LKECLSTMSLNIITRMVLGRKCVDKE-VVASGGG  202

Query  645   YSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIED  824
                  K+ +  LD+ FLL+GV+N+GDW+PWLS LDLQGYV++MK     + +F+  V+E+
Sbjct  203   SVTTWKEFRWMLDELFLLNGVLNIGDWIPWLSWLDLQGYVRRMKRVGRMFNQFMENVVEE  262

Query  825   HMAM-MKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATV  1001
             H    ++  + F P+DMVD  LQ+ADDP+L  DV LTRD +   T         + A  V
Sbjct  263   HNERRLREGDAFVPQDMVDRLLQLADDPSL--DVKLTRDSVKAFTQ--------SAAVIV  312

Query  1002  EWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLP  1181
             EWA  EL + P +  KATEELD VIGR+RWV EKD   LPY+DAI+KET RLH +  LL 
Sbjct  313   EWAISELLKNPDVFAKATEELDGVIGRDRWVTEKDIPHLPYMDAIVKETMRLHMVVPLLS  372

Query  1182  PHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFAL  1361
             P  S ED  V GY++P GT VLIN W+I R+   WD   EF PERF+   +D+KGQDF L
Sbjct  373   PRLSREDTSVGGYDIPAGTRVLINAWTISRDPALWDAPEEFRPERFVGSKIDVKGQDFEL  432

Query  1362  LPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPL  1541
             LPFGSGRR CPGYSLG+KV++ TL NLLHGF W+L   +  +++SM+E +GL+T  KFPL
Sbjct  433   LPFGSGRRMCPGYSLGLKVIQVTLVNLLHGFAWRLPDGMTEEELSMEEVFGLSTPRKFPL  492

Query  1542  SYTIEPRLPTH  1574
                +EP+LP  
Sbjct  493   QAVVEPKLPAR  503



>gb|AGI98131.1| cytochrome P450 CYP92 [Narcissus tazetta]
Length=505

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/512 (48%), Positives = 341/512 (67%), Gaps = 25/512 (5%)
 Frame = +3

Query  57    LPWLLAIAFLFKITT-------IHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLS  215
             LPW+L +  L    T       +  R +    PPGP+P+PI+GNL  +G I H+S+H LS
Sbjct  4     LPWILDLPILVATITTIIIILKLTNRGRRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLS  63

Query  216   QKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPY  392
              KYG +M LKFGS+P++V SS E A+ FLKTHD +FASRP +AA  +T ++ SD+T+SPY
Sbjct  64    LKYGPIMQLKFGSRPIVVGSSVEAARFFLKTHDVIFASRPESAAGKYTAYDYSDITFSPY  123

Query  393   GPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTL  572
             GP+ R  RKI L E+F+PR+LDS EY+R+EE   L+  L+ + G +  V ++D +    +
Sbjct  124   GPYLRQIRKICLVELFSPRRLDSLEYIRVEEIRLLMQDLFRSSGER--VAVKDCMSTLGM  181

Query  573   STMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDL  752
               ++R+V G KY  ++ E            +L+G +D+WF L+   N GD  PWL   D 
Sbjct  182   DVISRMVLGKKYLGEEGE------------ELKGMIDEWFALTAAFNPGDLFPWLGFFDW  229

Query  753   QGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVAL  929
             +G VKKMKA  E + +F + V+++H    K + E F  KDMVD+ LQIADDP LE  V L
Sbjct  230   RGVVKKMKALSERFHRFWDRVLDEHNERRKEEGERFEAKDMVDVLLQIADDPGLE--VKL  287

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
             TRD +   T D++ GG +T+A T+EWA  EL + P IIEKATEELDRV+G+ RWVEEKD 
Sbjct  288   TRDSVKAFTQDLIGGGTETSATTIEWATAELVKHPEIIEKATEELDRVVGKTRWVEEKDV  347

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWD  1289
               LPY+++IIKET RLHP+  LL P  + ED    GY++P GT V +NVWSIGR+   WD
Sbjct  348   QSLPYLESIIKETMRLHPVLPLLIPRLAREDSTYEGYDIPAGTRVFVNVWSIGRDPSMWD  407

Query  1290  NANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLD  1469
             +  EF PERF+ K++ +KGQ++ LLPFG+GRR CPGY LG++ ++ +LANLLHGF WKL 
Sbjct  408   DPEEFRPERFIGKEISLKGQNYELLPFGAGRRMCPGYPLGLREIQMSLANLLHGFVWKLP  467

Query  1470  GDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
               +  ++++M+E +GL T  K PL   +EPRL
Sbjct  468   DGMTKEELNMEEGFGLATPRKVPLEVVLEPRL  499



>gb|ABK24537.1| unknown [Picea sitchensis]
Length=514

 Score =   501 bits (1290),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 248/517 (48%), Positives = 347/517 (67%), Gaps = 13/517 (3%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M++ S F  ALP+L  +A +       + R + K PPGPR WPIIGNLNL+G +PH+SL 
Sbjct  1     MDLLSIF--ALPYLPVLAIVSVYLIYMRLRPSVKLPPGPRAWPIIGNLNLMGKLPHRSLD  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS+ YG LM ++ GS P +VASS E A+ FL+THD  F+SRP  A+  +T +N SD+TW
Sbjct  59    RLSKTYGPLMYIRLGSIPCVVASSAEMAREFLQTHDLTFSSRPQVASGKYTTYNYSDITW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYG ++R ARK+ L E+F+ ++L+SFEY+R+EE   ++  +++      PV +R     
Sbjct  119   SPYGDYFRLARKVCLMELFSAKRLESFEYIRVEEVARMLGSVFETCQRGLPVEIRKETYG  178

Query  564   FTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSG  743
              + + ++R+  G +Y+ K+       G  + L++L+  L+++FLL+GV N+ D++PWL  
Sbjct  179   VSNNIISRMALGRRYFDKE------AGNMMRLEELKEMLEEFFLLNGVFNIVDFIPWLGW  232

Query  744   LDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADV  923
             LDLQGYV +MK   E  + FL  V+E+H    KG EN+  KDM+D+ L+ ADDP L    
Sbjct  233   LDLQGYVGRMKKLSERLDVFLEEVVEEHDRRRKGVENYVAKDMMDVLLKQADDPQLN---  289

Query  924   ALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEK  1103
              L+R ++   T D++AGG +T+A  VEW   EL +KP ++E+AT+ELDRV+GRERWVEEK
Sbjct  290   -LSRIKVKAFTLDIIAGGTETSATLVEWGLSELLKKPEMLERATKELDRVVGRERWVEEK  348

Query  1104  DFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKY  1283
             D   L Y+  I+KET RLHP+  LL PH S + C +AGY++P  T V +NVWSIGR+ + 
Sbjct  349   DMGGLEYVQWIVKETMRLHPVAPLLVPHLSTQRCRIAGYDIPANTRVFVNVWSIGRDDQS  408

Query  1284  WDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
             W+N NEF PERF    VD+ G+D+ LLPFGSGRR CPG SLG+KVV+  LANL+HGF+WK
Sbjct  409   WENPNEFRPERFKGSTVDVMGRDYELLPFGSGRRMCPGNSLGLKVVQIALANLIHGFQWK  468

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L     PKD+ M E +GL+T    PL     PRLP+H
Sbjct  469   LPDGQSPKDLDMGEIFGLSTSKTCPLVAMARPRLPSH  505



>gb|ADD84652.1| CYP92A45 [Scoparia dulcis]
Length=509

 Score =   501 bits (1290),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 236/489 (48%), Positives = 343/489 (70%), Gaps = 13/489 (3%)
 Frame = +3

Query  117   KAYKTPPGPRPWPIIGNLNLL--GSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETA  290
             +  K PPGP+PWPIIGNLNL+   S PH+SLH+LSQKYGEL +LKFG+ PV++A+SPE A
Sbjct  29    RKLKHPPGPKPWPIIGNLNLIIGSSRPHRSLHALSQKYGELSMLKFGNIPVVIAASPEMA  88

Query  291   KLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFE  467
             KLFLKT+D VFASRPA +   +T F+ SD+TW+PYG +W  A +I L+EV  P+ L  +E
Sbjct  89    KLFLKTYDTVFASRPAQSGGRYTTFDFSDVTWAPYGQYWIGA-QIFLTEVLNPKALKLYE  147

Query  468   YVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGY  647
             +VR+EE+   +S ++    +  PV+LR+ + R++LSTM++ + G   +      G   G 
Sbjct  148   HVRVEEKRTFLSRVHSLSLSGKPVVLREEVYRYSLSTMSKTIFGRLCFQSHESDG---GN  204

Query  648   SIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH  827
             ++ L +++  LD+ F++ G +N+GD++PWL+ LDLQG +K+MKA   + ++F + +I+ H
Sbjct  205   TLTLDQVKALLDECFVMGGALNIGDYIPWLNFLDLQGLLKQMKALYNKLDRFYSDMIDYH  264

Query  828   MAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEW  1007
             +      E     + +D  L+    P    +V LTR+ + G+   +LAGG DT+   +EW
Sbjct  265   LTH---RELSVSINALDSLLRKVRIP---PEVKLTRENVKGMLQGLLAGGTDTSVIAIEW  318

Query  1008  AFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPH  1187
             +  E+ R P + +KA EEL+RVIG+ RWVEE+DFSQLPY++AIIKE+ RLHP+  LL PH
Sbjct  319   SIHEIMRHPRVYDKAKEELERVIGKSRWVEEEDFSQLPYLEAIIKESMRLHPIAALLAPH  378

Query  1188  YSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLP  1367
              ++EDC VAGY++ +GT V+IN WS+GR+ K WD   EF PERF+ +++D+ G +FALLP
Sbjct  379   LAMEDCNVAGYDISKGTVVMINNWSLGRDPKAWDKPEEFMPERFMVEEIDMLGSNFALLP  438

Query  1368  FGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSY  1547
             FGSGRR CPGY L + +VR+TLANLLHG+ W+L   + P+++ ++E YG T HPK P++ 
Sbjct  439   FGSGRRMCPGYRLALNIVRSTLANLLHGYNWRLPDGMTPEEVCLEEEYGFTIHPKIPVAM  498

Query  1548  TIEPRLPTH  1574
              IEP LP H
Sbjct  499   IIEPSLPAH  507



>ref|XP_004956935.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=518

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/495 (50%), Positives = 334/495 (67%), Gaps = 12/495 (2%)
 Frame = +3

Query  105   HQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPE  284
             H+RR+AY  PPGP+PWPIIGN+NL+G +PH S+H LS++YG LM L+FGS PV++A+S E
Sbjct  26    HRRRRAYNLPPGPKPWPIIGNMNLMGELPHSSIHELSKRYGPLMQLRFGSLPVVIAASAE  85

Query  285   TAKLFLKTHDAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDS  461
              AK  LK +DA F+ RP  A   +  ++ SD+ WSPYGP+ R  R+I  +E+F+ ++L S
Sbjct  86    MAKHILKINDAAFSDRPRFAVGKYIAYDCSDILWSPYGPYLRQTRRICAAELFSTKRLQS  145

Query  462   FEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPE  641
             F+++R EE   ++  L  A G    V LRD L   TL  ++R+V G KY  ++      E
Sbjct  146   FDHIRDEEVRVMLRDLRRASGRT--VRLRDTLQMLTLGVISRVVLGRKYVEEE---AAGE  200

Query  642   GYSIPLKKLQGF---LDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNY  812
             G S P+    G+   +D++F+L G  N+GD++PWL  LDLQGYV++MK     +++FL +
Sbjct  201   GASPPVITPAGYREMVDEFFVLHGAFNIGDFIPWLDWLDLQGYVRRMKKLSAMFDRFLEH  260

Query  813   VIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTT  989
             V++ H    + + E FA KDMVD+   +ADDPNLE  V L+RD +  +T D++ G  DT+
Sbjct  261   VLDVHNERRRLEGERFAAKDMVDVLQDLADDPNLE--VQLSRDNVKAITQDLIIGATDTS  318

Query  990   AATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLC  1169
             A T+EWA  EL + P I+ KAT+EL+ VIG +R   EKD   LPYIDAI+KET R+HP  
Sbjct  319   ANTMEWALSELLKNPKILAKATDELNNVIGPDRLATEKDLPHLPYIDAILKETMRVHPAA  378

Query  1170  TLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQ  1349
              +L PH + ED  V GY++  GT V INVWSIGR+   WD   EF PERFLE+ +D++GQ
Sbjct  379   PMLAPHLAREDTRVDGYDILAGTAVFINVWSIGRDPALWDAPEEFRPERFLERKIDMRGQ  438

Query  1350  DFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHP  1529
             DF LLPFGSGRR CPGYSL MKV+   LANLLHGF W+L   +  +D+SM+E + L    
Sbjct  439   DFELLPFGSGRRMCPGYSLAMKVMALGLANLLHGFVWRLPEGMTVEDLSMEETFFLAMPR  498

Query  1530  KFPLSYTIEPRLPTH  1574
             KFPL  T+EPRLP H
Sbjct  499   KFPLEATVEPRLPAH  513



>emb|CDP00858.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   495 bits (1275),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/493 (50%), Positives = 323/493 (66%), Gaps = 57/493 (12%)
 Frame = +3

Query  90    KITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIV  269
             +IT+  + +K Y+  PGP+PWPIIGNL+L+ S PH+S HSL  KYG +M L FG KP+IV
Sbjct  22    RITSTKRPKKNYR--PGPKPWPIIGNLHLIDSQPHRSFHSLYHKYGGIMPLWFGGKPLIV  79

Query  270   ASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTP  446
             AS+PE AK FLK HD  F+SRPA AA  +  +N SD+TW+P G                 
Sbjct  80    ASTPEAAKEFLKNHDYNFSSRPANAAGKYIIYNYSDVTWAPTG-----------------  122

Query  447   RKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWE  626
                                                HL R+TL+ +TR V G  Y S   +
Sbjct  123   ---------------------------------DKHLFRYTLTIITRTVLGKTYIST--K  147

Query  627   LGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFL  806
                 +   +  ++L   LD WF+L+GV+N+GDWVPW +  DL+GYVK+MK   ++YEKF 
Sbjct  148   ESNDDSAIVTFEELTAMLDKWFVLNGVLNIGDWVPWHNVFDLRGYVKQMKEVDKDYEKFF  207

Query  807   NYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDT  986
             N+V+EDH A  K +++F P+DMVDI L +A+DPNLE  V L+R+ + GL  D+L GG DT
Sbjct  208   NFVLEDHKARTKAEKDFVPRDMVDILLNLAEDPNLE--VKLSRESVKGLIQDLLLGGTDT  265

Query  987   TAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPL  1166
             +  TVE+    L + P + EK TEELDRV+GR+RWVEE DF +LP+++A++KETFR +PL
Sbjct  266   STTTVEFVVTALVKHPHLTEKVTEELDRVVGRDRWVEEDDFPKLPFLEAVVKETFRCYPL  325

Query  1167  CTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKG  1346
             CTLL P +++EDC VAGY V +GTTVL+N WSIGR+  YWD+  EF PERFLEKD+DIKG
Sbjct  326   CTLLAPRFAMEDCKVAGYNVYKGTTVLVNAWSIGRDPNYWDSPEEFLPERFLEKDIDIKG  385

Query  1347  QDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTH  1526
             Q+F  L FGS RR+C GY+LG+K VR+ L+NLLHGF  KL    KP+D+ MDE YG TTH
Sbjct  386   QNFEPLAFGSSRRRCAGYALGLKAVRSMLSNLLHGFNLKLPDGTKPEDVCMDEVYGFTTH  445

Query  1527  PKFPLSYTIEPRL  1565
             PK P+   +EPRL
Sbjct  446   PKVPIKLILEPRL  458



>ref|XP_002444467.1| hypothetical protein SORBIDRAFT_07g022300 [Sorghum bicolor]
 gb|EES13962.1| hypothetical protein SORBIDRAFT_07g022300 [Sorghum bicolor]
Length=512

 Score =   496 bits (1278),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 244/518 (47%), Positives = 344/518 (66%), Gaps = 27/518 (5%)
 Frame = +3

Query  45    FFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKY  224
                 L  +LAI  L + T   + R+ Y+ PPGPRPWPIIGN NL+G++PH+S+H LS+KY
Sbjct  9     LLTCLAMVLAIVILRR-TLKGKPRRVYRLPPGPRPWPIIGNFNLIGALPHRSIHELSKKY  67

Query  225   GELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPF  401
             GELM L+FGS  V+V SS + AKLFLKTHD +F  RP TAA  HT +N  D+TWSPYG +
Sbjct  68    GELMHLRFGSYSVVVGSSADMAKLFLKTHDLLFLDRPKTAAGKHTTYNYGDITWSPYGAY  127

Query  402   WRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPV-----LLRDHLVRF  566
             WRHAR+I  +++F+P +L SFE++R +E  +L+ GL+ A  + +       L +DHL   
Sbjct  128   WRHARRICATQLFSPGRLASFEHIRADEVRSLVRGLFAASASASGSGCAVRLNKDHLYTL  187

Query  567   TLSTMTRLVTGNKYYSKDWELGK--PEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
             +++ +TR+V G + +    +      EG    L   +  +D+  L++GV+N+GDW+PWL 
Sbjct  188   SMNVITRMVLGKRLFDGGGDDDDDVAEGPVSSLADFKWMMDELLLVNGVLNIGDWIPWLD  247

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEA  917
              LDLQGY+++MK   + + +F++Y++++H    + + E+F  +DMVD+ +Q+ADDP    
Sbjct  248   WLDLQGYMRRMKRIGKRFSEFIDYILDEHDDRRRREGESFVARDMVDVLMQLADDPTF--  305

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
             DV + R  +   T D++ GG ++TA TVEWA  EL RKP +   ATEELDRV+G  RWV 
Sbjct  306   DVQIGRVGVKAFTQDLIVGGSESTAVTVEWAISELLRKPSLFAMATEELDRVVGHGRWVT  365

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             EKD + LPY+ +I+KET RLHP+  LL P  + ED  +AGY++P+GT VLI         
Sbjct  366   EKDIAHLPYLQSIVKETMRLHPIVPLLIPRVTREDASIAGYDIPKGTCVLI---------  416

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
                   NEF PERF+   +D+KGQDF LLPFGSGRR CPGY+LG+K ++ TLANLLHGF 
Sbjct  417   ------NEFRPERFVGSKIDVKGQDFELLPFGSGRRMCPGYNLGLKEIQLTLANLLHGFT  470

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPT  1571
             W L   +  +D+SMDE +GL+T  K PL   ++PRLP 
Sbjct  471   WSLPEGMAKEDLSMDEVFGLSTTRKLPLEVIVQPRLPA  508



>gb|KDP33920.1| hypothetical protein JCGZ_07491 [Jatropha curcas]
Length=441

 Score =   494 bits (1271),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 333/452 (74%), Gaps = 18/452 (4%)
 Frame = +3

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             M LKFGS PVIVASS E AK  LK++D +FASRP TAA  +T +N S++TW+PYGP+WR 
Sbjct  1     MQLKFGSFPVIVASSSEIAKQILKSNDQIFASRPQTAAGKYTTYNYSNITWAPYGPYWRQ  60

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RKI L+E+F+ ++L S+EY+R+EE  A ++ + +++ +K P++L+DHL R TLS ++R+
Sbjct  61    GRKIYLTELFSSKRLQSYEYIRVEEIRAFLARI-NSLSSK-PIILKDHLSRVTLSIISRI  118

Query  591   VTGNKYYSKDWELGKPEGYSI-PLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVK  767
             V G KY+S +    + E   I  L++ Q  LD+ F L+GV+N+GDW+PWL+ LDLQGYVK
Sbjct  119   VLGKKYFSTN----ESENEEIVTLEEFQEMLDELFWLNGVLNIGDWIPWLNFLDLQGYVK  174

Query  768   KMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIM  947
             +MKA + ++++F ++V+ +H     G+E     DMVD+ L+++++P+L  DV L  D + 
Sbjct  175   RMKALKIKFDRFHDHVLGEHKEKKAGEE-----DMVDLLLKLSNNPDL--DVKLNSDSVK  227

Query  948   GLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYI  1127
             G T D++AGG DT+A TVEWA  EL ++P +I+KATEELDRVIG++RWVEEKD  QLPYI
Sbjct  228   GFTQDLIAGGTDTSATTVEWAMSELMKQPHLIKKATEELDRVIGKDRWVEEKDIPQLPYI  287

Query  1128  DAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFC  1307
             DAI+KET R HP+  +L PH ++ED  +AGY++ +GT V IN WS+GR+S  WD   EF 
Sbjct  288   DAIMKETMRKHPVAVMLAPHLALEDTKLAGYDIAKGTRVFINTWSMGRDSSMWDEPEEFR  347

Query  1308  PERFLE---KDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDL  1478
             PERFL     ++D+KGQ   LLPFGSGRR CPGYSLG+K++ ++LANLLHGF W+L  ++
Sbjct  348   PERFLSDKGSNIDVKGQSLELLPFGSGRRMCPGYSLGLKMIGSSLANLLHGFNWELPDNM  407

Query  1479  KPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             KP+D+SMDE YGL T  KFPL    +PRL  H
Sbjct  408   KPEDLSMDEVYGLATPRKFPLVAIPKPRLQIH  439



>gb|AGI97940.1| flavonoid 3'-monooxygenase-like protein [Narcissus tazetta]
Length=506

 Score =   494 bits (1272),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 246/513 (48%), Positives = 340/513 (66%), Gaps = 26/513 (5%)
 Frame = +3

Query  57    LPWLLAIAFLFKITT-------IHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLS  215
             LPW+L +  L    T       +  R +    PPGP+P+PI+GNL  +G I H+S+H LS
Sbjct  4     LPWILDLPILVATITTIIIILKLTNRGRRLNLPPGPKPYPIMGNLTQIGPIAHRSIHDLS  63

Query  216   QKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPY  392
              KYG +M LKFGS+P++V SS E A+ FLKTHD +FASRP +AA  +T ++ SD+T+SPY
Sbjct  64    LKYGPIMQLKFGSRPIVVGSSVEAARFFLKTHDVIFASRPESAAGKYTAYDYSDITFSPY  123

Query  393   GPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTL  572
             GP+ R  RKI L E+F+PR+LDS EY+R+EE   L+  L+ + G +  V ++D +    +
Sbjct  124   GPYLRQIRKICLVELFSPRRLDSLEYIRVEEIRLLMQDLFRSSGGR--VAVKDCMSTLGM  181

Query  573   STMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDL  752
               ++R+V G KY  ++ E            +L+G +D+WF L+   N GD  PWL   D 
Sbjct  182   DVISRMVLGKKYLGEEGE------------ELKGMIDEWFALTAAFNPGDLFPWLGFFDW  229

Query  753   QGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVAL  929
             +G VKKMKA  E + +F + V+++H    K + E F  KDMVD+ LQIADDP LE  V L
Sbjct  230   RGVVKKMKALSERFHRFWDRVLDEHNERRKEEGERFEAKDMVDVLLQIADDPGLE--VKL  287

Query  930   TRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDF  1109
             TRD +   T D++ GG +T+A T+EWA  EL + P IIEKATEELDRV+G+ RWVEEKD 
Sbjct  288   TRDSVKAFTQDLIGGGTETSATTIEWATAELVKHPEIIEKATEELDRVVGKTRWVEEKDV  347

Query  1110  SQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRG-TTVLINVWSIGRNSKYW  1286
               LPY+++IIKET RLHP+  LL P  + ED    GY++P G T V +NVWSIGR+   W
Sbjct  348   QSLPYLESIIKETMRLHPVLPLLIPRLAREDSTYEGYDIPAGGTRVFVNVWSIGRDPSMW  407

Query  1287  DNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL  1466
             D+  E  PERF+ K++ +KGQ++ LLPFG+GRR CPGY LG++ ++ +LANLLHGF WKL
Sbjct  408   DDPEESRPERFIGKEISLKGQNYELLPFGAGRRMCPGYPLGLREIQMSLANLLHGFVWKL  467

Query  1467  DGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRL  1565
                +  ++++M+E +GL T  K PL   +EPRL
Sbjct  468   PDGMTKEELNMEEGFGLATPRKVPLEVVLEPRL  500



>emb|CAN82002.1| hypothetical protein VITISV_023197 [Vitis vinifera]
Length=461

 Score =   491 bits (1263),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 239/423 (57%), Positives = 319/423 (75%), Gaps = 12/423 (3%)
 Frame = +3

Query  114   RKAYKT--PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPET  287
             R A+K   PPGP+PW IIGNLNL+G +PH SLH LSQKYG++M L+FGS PV+VASSPE 
Sbjct  27    RPAHKQNLPPGPKPWRIIGNLNLIGHLPHLSLHKLSQKYGQIMQLQFGSFPVVVASSPEM  86

Query  288   AKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSF  464
             A+ FLKT+D +FASRP TAA  +T +N S++TW+PYGP WR  RKI  +E+F+ ++L+S 
Sbjct  87    ARQFLKTNDHLFASRPQTAAGKYTAYNYSNITWAPYGPCWRQGRKIFHTELFSWKRLESC  146

Query  465   EYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEG  644
             EY+R+EER A +S LY   G   PV+L+DHL R TLS ++R+V G KY+++  E G+   
Sbjct  147   EYIRVEERRAFVSRLYALSG--KPVMLKDHLSRVTLSVISRIVLGEKYFNES-ESGRS--  201

Query  645   YSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIED  824
               + +++ Q  LD+ FLL+GV+N+GDW+PW++ LDLQGYVK+MKA R+++++  ++VIE 
Sbjct  202   -IVTVEEFQEMLDELFLLNGVLNIGDWIPWIAFLDLQGYVKRMKALRDKFDRLFDHVIEK  260

Query  825   HMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
             H A  +   +F  KDMVD+ L++ADDP+LE  V L  D + GLT D+LAGG DT+A T+E
Sbjct  261   HRARREA-ADFVAKDMVDMLLRLADDPDLE--VKLGTDGVKGLTLDLLAGGTDTSATTME  317

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  E+ R+P I  KATEELDRVIGR+RWVEEKD  QLPYIDAI+KET RLHP+  LL P
Sbjct  318   WAMSEILRQPSIATKATEELDRVIGRDRWVEEKDIPQLPYIDAIVKETMRLHPVAVLLAP  377

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
             H +++DC V+GY++ +GT VL+N WSIGR+   WD   EF PERFL K +D+ GQ+F LL
Sbjct  378   HLALQDCNVSGYDIRKGTRVLVNAWSIGRDPNIWDAPEEFRPERFLGKAIDVNGQNFELL  437

Query  1365  PFG  1373
             PFG
Sbjct  438   PFG  440



>gb|EMT12612.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=510

 Score =   490 bits (1262),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 233/490 (48%), Positives = 332/490 (68%), Gaps = 8/490 (2%)
 Frame = +3

Query  108   QRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPET  287
              R + Y  PPGP+PWP+IGN +L+G++PH+S+H LS+KYG LM L+FGS P+I+ SS + 
Sbjct  25    HRGQKYNLPPGPKPWPVIGNFDLIGALPHRSIHELSKKYGPLMHLRFGSFPLIIGSSVDM  84

Query  288   AKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSF  464
             A+ FLKT D ++  RP TA+  +T +N +DMTWSPYG +WR AR+I L+++F PR+L   
Sbjct  85    ARYFLKTQDILYVDRPKTASGKYTTYNYADMTWSPYGAYWRQARRICLTQLFNPRRLALL  144

Query  465   EYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEG  644
             E++R +E  AL+  L+ AV      L RDH+   +++ +TR+V G + +      G  EG
Sbjct  145   EHIRADEVKALMCDLF-AVSGHAVHLSRDHMSMVSMNVITRMVMGKRLFVD----GVAEG  199

Query  645   YSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIED  824
                 LK  +  LD+ FLL+GV+N+GDW+PWL  +DLQGYV++MK   + ++ F  +V+++
Sbjct  200   PVPSLKVFRWMLDELFLLNGVLNIGDWIPWLDWMDLQGYVRRMKKIGKLFDAFNEHVLDE  259

Query  825   HMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
             H       E  A +DM  + ++ A+D  LE  V   R  +   T D++AGG +++A TVE
Sbjct  260   HSGERGRGEGEAARDMGGVLMEKANDNALE--VQYGRIGVKAFTQDLIAGGTESSAVTVE  317

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             WA  EL R+P   + ATEELDRV+GR RWV EKD   LPYI+AI+KE+ R+HP+  LL P
Sbjct  318   WAMSELMRRPATFDVATEELDRVVGRARWVTEKDMPNLPYIEAIVKESMRMHPIVPLLTP  377

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALL  1364
               + ED  + GY++P+G  VLINVW+IGR+ + WD   EF PERFL   + + GQD  LL
Sbjct  378   RLAREDATIDGYDIPKGARVLINVWAIGRDPELWDAPEEFKPERFLGSKMGVIGQDLELL  437

Query  1365  PFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLS  1544
             PFGSGRR CPGY+LG+KVV  +LANLLHGF W+L   ++ +D+SM+E +GL+T  K+PL 
Sbjct  438   PFGSGRRMCPGYNLGLKVVHLSLANLLHGFTWRLPEGVRKEDLSMEEVFGLSTGRKYPLQ  497

Query  1545  YTIEPRLPTH  1574
                +P+LP H
Sbjct  498   VVAKPKLPNH  507



>ref|XP_006477116.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=532

 Score =   489 bits (1258),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 246/518 (47%), Positives = 339/518 (65%), Gaps = 16/518 (3%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQ  218
             + ++  L + L +  L     I + +     PPGP+PW +IGNLNL+G   H SL SLSQ
Sbjct  17    TMWYSILAFFLPVLLLLYYRHISRNKINLLPPPGPKPWHLIGNLNLIGQHLHVSLQSLSQ  76

Query  219   KYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAA-AHHTFNRSDMTWSPYG  395
             KYG LM LKFG + V+V SS E A+L LKTHD  FASRP   A  H  +N   M  +PYG
Sbjct  77    KYGPLMQLKFGLETVVVGSSAEVAELLLKTHDVTFASRPPLLAWKHANYNYLVMPGAPYG  136

Query  396   PFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKN-----PVLLRDHLV  560
             P WR  RKI ++++ +P+ L  FEY+RIEER AL+  LY +  + +     PV L++ L 
Sbjct  137   PHWRQTRKIYMTQLLSPKSLAQFEYIRIEERKALLFKLYKSSTSSSSSSSTPVHLKERLF  196

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
              F L+ M+R++ G +Y  +D      E   +  K+    +D+ FLL GV+++GD +PWL+
Sbjct  197   MFNLAIMSRMLFGKRYTEED------ENNIVTPKQFTEIVDELFLLPGVLDIGDAIPWLA  250

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD--ENFAPKDMVDIFLQIADDPNLE  914
              LDLQG +K+MKA +++ +KF  +V+ +H    K    +     D+VD+ LQ+ADDP LE
Sbjct  251   FLDLQGNIKRMKAVKKKIDKFYEHVLHEHERHGKRKLFKEHGTNDIVDVLLQLADDPTLE  310

Query  915   ADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWV  1094
               V L RD I     D+L GG +T+A T+EW   EL + P +I+KAT+ELDRVIGR +WV
Sbjct  311   --VKLERDHIKASMQDLLVGGIETSAVTLEWTMSELLKNPEVIQKATDELDRVIGRNKWV  368

Query  1095  EEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRN  1274
             EEKD   LPYI AI+KE  RLHP  TLL PH + E+C VAG  + + + V++NVW+IGR+
Sbjct  369   EEKDIVNLPYIQAIVKEVMRLHPPLTLLAPHKARENCKVAGSNILKNSRVIVNVWAIGRD  428

Query  1275  SKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGF  1454
                W+  NEFCPERF+ K++D+ G +F LLPFGSGRR C GY+LG+K+V++TLANLLHGF
Sbjct  429   PTLWEKPNEFCPERFVGKEIDVVGHNFELLPFGSGRRMCVGYALGLKIVQSTLANLLHGF  488

Query  1455  KWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             +WKL GD+K +D+ M+E +G  T  K PL    +PRLP
Sbjct  489   EWKLPGDMKKEDLDMEERFGGRTSRKNPLLVVPKPRLP  526



>ref|XP_006465159.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=528

 Score =   489 bits (1258),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 239/477 (50%), Positives = 325/477 (68%), Gaps = 15/477 (3%)
 Frame = +3

Query  159   IGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPA  338
             IGNLNL+G +PH SLHSLSQKYG L+ LKFG   V+V SS E A+L LKTHD  FASRPA
Sbjct  54    IGNLNLIGQLPHVSLHSLSQKYGPLIQLKFGLDTVVVGSSAEVAELILKTHDLSFASRPA  113

Query  339   TAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYD  515
               A  H  FN   M  +PYGP WR  RK   +++ +P++L  FEY+R+EER AL+  +Y 
Sbjct  114   LLAGKHANFNHLVMATAPYGPHWRQTRKTFKTQILSPKRLGQFEYIRVEERKALLFKMYK  173

Query  516   AVGTK----NPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLD  683
             +  +      PV L+D L  F L+TM+R++ G +Y   D      E   +  K+    +D
Sbjct  174   SSSSSSPSSTPVHLKDRLYMFNLATMSRMLLGKRYTEDD------ENNIVTAKEFTEIVD  227

Query  684   DWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH--MAMMKGDENF  857
             + FL+SG++++GD +PWL+ LDLQG VK+MKA +++ +KF  +V+++H   A  K     
Sbjct  228   EVFLISGILDIGDAIPWLAFLDLQGNVKRMKAVKKKADKFYEHVLDEHERHAKRKSFNEH  287

Query  858   APKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPW  1037
               KDMVD+ LQ+ADDP LE  V + RD I     D+L GG +T+A T EWA  EL + P 
Sbjct  288   GTKDMVDVLLQLADDPTLE--VKVERDHIKAAIQDLLLGGIETSAITTEWAMSELLKNPR  345

Query  1038  IIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAG  1217
             +I+KATEELDRVIGR +WVEEKD   LPYI AI+KE  RLHP  TLL P  + E+C VAG
Sbjct  346   VIQKATEELDRVIGRNKWVEEKDIVNLPYIQAIVKEVMRLHPPATLLVPRLAGENCKVAG  405

Query  1218  YEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPG  1397
             Y++ + + V++NVW+IGR+   W+  NEFCPERF+ K++D+ G +F LLPFG+GRR C G
Sbjct  406   YDIIKNSRVIVNVWAIGRDPTLWEKPNEFCPERFIGKEIDVVGHNFELLPFGAGRRMCVG  465

Query  1398  YSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             Y+LG+  V++TLANLLHGF+WKL G+++ +D+ M+E +G+TT  K PL    +PRLP
Sbjct  466   YALGLITVQSTLANLLHGFEWKLPGNVRKEDLDMEERFGVTTSRKNPLLVVPKPRLP  522



>emb|CAN82001.1| hypothetical protein VITISV_023196 [Vitis vinifera]
Length=421

 Score =   483 bits (1244),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 238/448 (53%), Positives = 324/448 (72%), Gaps = 30/448 (7%)
 Frame = +3

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             M L+FGS PV+VASS E  K FLKT+D +FASRP TAA  +T +N S++TW+PYGP+WR 
Sbjct  1     MELRFGSFPVVVASSSEMXKQFLKTNDHLFASRPHTAAGKYTNYNYSNITWAPYGPYWRQ  60

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
              RKI L+E+F+ ++L+S+EY+ +EER A IS LY   G   PV+L++HL R TLS ++R+
Sbjct  61    GRKIFLTEMFSSKRLESYEYIXVEERQAFISRLYALSG--KPVMLKEHLSRVTLSVISRI  118

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G KY+S ++E G+     + +++ Q  L +  LL+GV+N+G W+PW++ LDLQGYVK+
Sbjct  119   VLGXKYFS-EFESGRS---MVTVEECQKMLVELLLLNGVLNIGXWIPWIAFLDLQGYVKR  174

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMG  950
             MKA R ++++F ++V+E H A  +  E+F  KDMVD+ L++ADDP++E  V LT D I G
Sbjct  175   MKALRHKFDRFYDHVLEKHRAR-REXEDFVAKDMVDMLLRLADDPDIE--VKLTTDGIKG  231

Query  951   LTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYID  1130
                                 F ++ R+P I  KATEELDRVIGR RWVEEKD  QLPYID
Sbjct  232   --------------------FTQVLRQPNIANKATEELDRVIGRNRWVEEKDIPQLPYID  271

Query  1131  AIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCP  1310
             AI+KET RLHP+  LL PH +++DC VAGY++ +GT VLIN WSIGR+   WD   EF P
Sbjct  272   AIVKETMRLHPVAVLLAPHLALQDCHVAGYDIRKGTRVLINTWSIGRDPNLWDAPEEFFP  331

Query  1311  ERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKD  1490
             ERFL K +D+KGQ+F LLPFGSGRR CPGYSL +K++ ++LAN+LHGF WKL GD+KP++
Sbjct  332   ERFLGKAIDVKGQNFELLPFGSGRRMCPGYSLALKMIGSSLANMLHGFHWKLPGDMKPEE  391

Query  1491  ISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ++++E +GLTT  K PL   +EPRLP+H
Sbjct  392   LNIEEVFGLTTPRKVPLVAFMEPRLPSH  419



>gb|KCW71321.1| hypothetical protein EUGRSUZ_F04403, partial [Eucalyptus grandis]
Length=501

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 240/497 (48%), Positives = 342/497 (69%), Gaps = 12/497 (2%)
 Frame = +3

Query  87    FKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVI  266
             F + + H RR+  K PPGP+PWPIIGNLNL+  + H+SLH LS+ YG +M L+ GS  V+
Sbjct  14    FLLLSGHLRRRKLKLPPGPKPWPIIGNLNLISPLLHRSLHELSRIYGPIMKLQLGSCNVV  73

Query  267   VASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFT  443
             V SS + AK  LKTHDAVFA RP  AA  +T +N S MTWSPYGP+++  RKI L+++F+
Sbjct  74    VCSSADMAKAILKTHDAVFAYRPRNAAGKYTAYNYSGMTWSPYGPYFQQVRKIFLAQLFS  133

Query  444   PRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDW  623
               +L S EY+R+EE   L   L++A G    + L+DHL    L+ + R+V G KY  K  
Sbjct  134   AARLQSSEYIRVEEMRVLTRNLFEAKGQS--INLKDHLSDLNLNVVCRMVLGKKYTDKS-  190

Query  624   ELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKF  803
                      +  ++ +  +D+ FLL+GV+NLGD++P L  LDLQGY+K+MKA  +++++F
Sbjct  191   ----ENSNIVSAEEFRKMVDELFLLTGVLNLGDFLPLLDFLDLQGYIKRMKAVNKKFDRF  246

Query  804   LNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGED  983
             L +V+ +H A  +  E +  KD VD+ LQ  DDPNL   V + R  +  LT +++AGG +
Sbjct  247   LEHVLGEHEA--RRVEGYEAKDKVDVLLQHVDDPNL--GVKIERHGVKALTQELIAGGTE  302

Query  984   TTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHP  1163
              +AA+VEWA  EL + P+   KAT+ELD +IGRERWV+E D + LPY++A+IKE  RLHP
Sbjct  303   GSAASVEWAMCELLKNPYTFNKATQELDNIIGRERWVQEADVTNLPYLNAVIKEMMRLHP  362

Query  1164  LCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIK  1343
             +   L   ++ +DC VAGY+VP+GT VL++ WSIGR+ + WD+   F PERF+ K +D+K
Sbjct  363   VGAFLAHRFASQDCKVAGYDVPKGTRVLVSKWSIGRDPELWDDPENFRPERFIGKAIDVK  422

Query  1344  GQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTT  1523
             GQDF LLPFGSGRR CPGY+LG+++++T+LANL+HGF WKL  ++  ++++++E  GL+T
Sbjct  423   GQDFELLPFGSGRRMCPGYNLGLRMIQTSLANLIHGFSWKLPKNMTREELNIEEVPGLST  482

Query  1524  HPKFPLSYTIEPRLPTH  1574
               K PL    EPRLP H
Sbjct  483   PKKIPLVAVAEPRLPLH  499



>ref|XP_006493375.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=506

 Score =   485 bits (1249),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 241/483 (50%), Positives = 333/483 (69%), Gaps = 12/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +PH S+HSLS+KYG LM LKFG   V+V SS E A+L LKTH
Sbjct  31    PPGPKPWPIIGNLNLIGPLPHISIHSLSRKYGPLMHLKFGFDSVVVGSSVEVAELLLKTH  90

Query  312   DAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F+SRP   A  + T++ + M  +PY P+WR ARKI + E+ +P++LD FEY+R+EER
Sbjct  91    DLSFSSRPQLLAGKYLTYDYTGMGTAPYSPYWRQARKICVMELLSPKRLDQFEYMRVEER  150

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
                +  ++ +     PV L+D L    LSTM+R+V G +Y  +D      E   +  K+ 
Sbjct  151   KLFLHDMFKSCS--KPVQLKDRLYMLNLSTMSRMVLGKRYTEED------ENNIVTPKEF  202

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
                L++ FL+ G +++GD +PWL+ LDLQG+VK+MK    + ++F  +++++  A  K  
Sbjct  203   TEMLEELFLVHGTLDIGDAIPWLAPLDLQGHVKRMKDVNRKLDRFYEHILDERYARKKSG  262

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             ++    DMVD+ +Q ADDP LE  V L R ++  +  D+L  G DT+A  VEWA   L +
Sbjct  263   KDQGVNDMVDVLVQFADDPTLE--VKLERHQLKAIIQDLLTAGTDTSALNVEWAMSLLLK  320

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
              P  I+KATEELDRVIGR+RWV+EKD   LPYI AI+KET RLHP+  LL P  + EDC 
Sbjct  321   NPEAIQKATEELDRVIGRDRWVQEKDIVNLPYIQAIVKETMRLHPVVPLLIPRVAREDCK  380

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++ + + VLIN+W+IGR+S  W+  NEF P+RF+ K++D+KG D+ LLPFGSGRR 
Sbjct  381   VAGYDILKNSRVLINIWTIGRDSTIWEKPNEFWPDRFIGKEIDVKGHDYELLPFGSGRRM  440

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYT-IEPRL  1565
             C GY LG+K+V+++LANLLHGF+WKL GD+K +D+ M+E +GLTT  K PL     +PRL
Sbjct  441   CLGYGLGLKLVQSSLANLLHGFEWKLPGDMKRQDLDMEERFGLTTCKKNPLVVVPTKPRL  500

Query  1566  PTH  1574
             P H
Sbjct  501   PHH  503



>ref|XP_006477121.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=533

 Score =   485 bits (1248),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 245/516 (47%), Positives = 334/516 (65%), Gaps = 17/516 (3%)
 Frame = +3

Query  48    FQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYG  227
             +  L + L +  L     I + +     PPGP+PW +I NLNL+G   H SL SLSQKYG
Sbjct  20    YSILAFFLPVLLLLYYRHIFRNKINLLPPPGPKPWHLIVNLNLIGQNLHVSLQSLSQKYG  79

Query  228   ELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAA-AHHTFNRSDMTWSPYGPFW  404
              LM LKFG + V+V SS E A+L LKTHD  FASRP   A  H  +N   M  +PYGP W
Sbjct  80    PLMQLKFGLETVVVGSSAEVAELLLKTHDVTFASRPPLLAWKHANYNYLVMPGAPYGPHW  139

Query  405   RHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKN------PVLLRDHLVRF  566
             R  RKI ++++ +P+ L  FEY+RIEER AL+  LY +  + +      PV L++ L  F
Sbjct  140   RQTRKIYMTQLLSPKSLAQFEYIRIEERKALLFKLYKSSTSSSSSSSSTPVHLKERLFMF  199

Query  567   TLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGL  746
              L+ M+R++ G +Y  +D      E   +  K+    +D+ FLL GV+++GD +PWL+ L
Sbjct  200   NLAIMSRMLLGKRYTEED------ENNIVTPKQFTEIVDELFLLPGVLDIGDAIPWLAFL  253

Query  747   DLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD--ENFAPKDMVDIFLQIADDPNLEAD  920
             DLQG +K+MKA +++ +KF  +V+ +H    K    +     D+VD+ LQ+ADDP LE  
Sbjct  254   DLQGNIKRMKAVKKKIDKFYEHVLHEHERHGKRKLFKEHGTNDIVDVLLQLADDPTLE--  311

Query  921   VALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEE  1100
             V L RD I     D+L GG  T+A T+EW   EL + P +I+KAT+ELDRVIGR  WVEE
Sbjct  312   VKLERDHIKASMQDLLVGGIGTSAVTLEWTMSELLKNPEVIQKATDELDRVIGRNNWVEE  371

Query  1101  KDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSK  1280
             KD   LPYI AI+KE  RLHP  TLL PH + E+C VAGY + + + V++NVW+IGR+  
Sbjct  372   KDIVNLPYIQAIVKEVMRLHPPLTLLAPHKARENCKVAGYNILKNSRVIVNVWAIGRDPT  431

Query  1281  YWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKW  1460
              W+  NEFCPERF+ K++D+ G +F LLPFGSGRR C GY+LG+K+V++TLANLLHGF+W
Sbjct  432   LWEKPNEFCPERFIGKEIDVVGHNFELLPFGSGRRMCVGYALGLKIVQSTLANLLHGFEW  491

Query  1461  KLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             KL GD+K +D+ M+E +   T  K PL    +PRLP
Sbjct  492   KLPGDMKKEDLDMEERFSGRTSRKNPLLVVPKPRLP  527



>ref|NP_001148045.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG29574.1| flavonoid 3-monooxygenase [Zea mays]
Length=525

 Score =   483 bits (1244),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 242/523 (46%), Positives = 340/523 (65%), Gaps = 23/523 (4%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKA---YKTPPGPRPWPIIGNLNLLGSIPHQSLHS  209
             S+F  A+   +A A LF +T +  R ++   Y+ PPGPRPWP+IGNLNL+G +PH S+H 
Sbjct  10    SFFLVAV---VAGATLFLVTVLRLRARSTRKYRLPPGPRPWPVIGNLNLIGPLPHHSVHE  66

Query  210   LSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWS  386
             LS++YG LM L+FGS PV+VASS +TA+L LKTHD  F  RP TAA  +T +N + + + 
Sbjct  67    LSKRYGPLMSLRFGSFPVVVASSVDTARLILKTHDLAFIDRPQTAAGRYTTYNCAGLFYQ  126

Query  387   PYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDA----VGTKNPVLLRDH  554
             PYG +WR AR++  +E+F+ R+L S E+VR +E  A++S L  A     G  + V LR+H
Sbjct  127   PYGAYWRQARRLCQAELFSARRLMSLEHVRSDEVRAMLSDLRAASSAPAGGHDAVTLREH  186

Query  555   LVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL--KKLQGFLDDWFLLSGVINLGDWV  728
             L    LS ++R++ G KY          EG S P   ++ +  +D+ F L+GV+N+ D +
Sbjct  187   LYMVNLSVVSRMLLGKKYVV--------EGSSSPATPEEFRWLIDEHFFLNGVLNVADMI  238

Query  729   PWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDP  905
             PWLS LD QGYVK+MK   +  ++FL +V+++H    + + E+F   DM+D+ L++ADDP
Sbjct  239   PWLSPLDPQGYVKRMKRSAKMLDRFLEHVVDEHNERRRREGEDFVAMDMMDVLLELADDP  298

Query  906   NLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRE  1085
             + + +V +TRD + G T D++ GG DT+A TVEWA  EL R P ++ KATEELDRV+GR+
Sbjct  299   S-QLEVPITRDNVKGFTLDLMGGGTDTSAVTVEWAMSELLRNPEVLAKATEELDRVVGRD  357

Query  1086  RWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSI  1265
             R V E D   LPY+DA++KET RLHP+  LL P    ED  V GY++P G  V +N W+I
Sbjct  358   RLVAEGDIPSLPYLDAVVKETLRLHPVAPLLTPRLCREDVSVGGYDIPAGARVFVNAWAI  417

Query  1266  GRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLL  1445
             GR+   W+   EF PERF    VD+KGQ F LLPFGSGRR CPG  L +++V T L NLL
Sbjct  418   GRDPAVWEAPLEFRPERFAGSSVDVKGQHFELLPFGSGRRMCPGMGLALRMVPTILGNLL  477

Query  1446  HGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             H F W+L   +  +++ M+E +GLT     PL    EP+LP  
Sbjct  478   HAFAWRLPDGVAAEELGMEETFGLTVPRLVPLQAVAEPKLPAR  520



>ref|XP_006492022.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=528

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 238/478 (50%), Positives = 324/478 (68%), Gaps = 13/478 (3%)
 Frame = +3

Query  156   IIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRP  335
             +IGNLNL+G +PH SL SLSQ YG LM LKFG   V+V SS + A+L LKTHD  FASRP
Sbjct  55    LIGNLNLMGHLPHVSLQSLSQIYGPLMQLKFGLDTVVVGSSAQVAELILKTHDTSFASRP  114

Query  336   AT-AAAHHTFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLY  512
             A  A  H  +N S +  +PYGP+ R ARKI ++E+  P++L  FEY+R+EER A +  LY
Sbjct  115   ALLAGKHANYNYSVLATAPYGPYLRQARKIYITELLNPKRLAEFEYMRVEERKAFLCKLY  174

Query  513   DAVGTKN-PVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDW  689
              +    + P+ LRD L   TL+ M+R++ G +Y  +D      E   +  K+    +D+ 
Sbjct  175   KSSSNSSMPIHLRDRLYMLTLAIMSRMLLGKRYTEED------ENNVVTPKEFTEIVDEL  228

Query  690   FLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDH--MAMMKGDENFAP  863
             FL+SGV+++GD +PWLS LDLQG VK+MKA +++  KF  YV++DH   A  K  +    
Sbjct  229   FLISGVLDIGDAIPWLSFLDLQGNVKRMKAVKKKANKFYEYVLDDHEHHARRKWVKEHGA  288

Query  864   KDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWII  1043
              DMVD+ LQ+ADDP LE  V L RD I     D+L  G DT++ T+EWA  EL +KP +I
Sbjct  289   NDMVDVLLQLADDPTLE--VKLERDHIKASNQDLLLAGIDTSSITIEWAMTELLKKPEVI  346

Query  1044  EKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYE  1223
             +KAT+ELD  IGR +WVEEKD + LPY+ AI+KE  RLHP  TLL P  + ++C + GY+
Sbjct  347   QKATKELDTAIGRNKWVEEKDIANLPYVQAIVKEVMRLHPAATLLVPRLARKNCKLDGYD  406

Query  1224  VPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYS  1403
             + + + V+INVW+IGR+   W+  +EFCPER + K++D+ G +F LLPFG GRR C GY+
Sbjct  407   IIKNSRVIINVWAIGRDPTIWEKPDEFCPERLIGKEIDVVGHNFELLPFGVGRRMCAGYA  466

Query  1404  LGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYT-IEPRLPTH  1574
             LG+K V++TLANLLHGF+WKL GD+K +D+ M+E +GLTT  K PL     +PRLP H
Sbjct  467   LGLKTVQSTLANLLHGFEWKLPGDMKKEDLDMEERFGLTTSKKNPLLVIPNKPRLPLH  524



>ref|XP_003581159.2| PREDICTED: flavonoid 3'-monooxygenase-like [Brachypodium distachyon]
Length=600

 Score =   485 bits (1248),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 252/537 (47%), Positives = 342/537 (64%), Gaps = 31/537 (6%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQR---RKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHS  209
             +W    L  L+A A L  +   H R   R  Y+ PPGP+PWPIIGNL+LLG++PH+SL  
Sbjct  62    AWASSFLAVLMATAILLLVLR-HGRNSHRHRYRLPPGPKPWPIIGNLHLLGALPHRSLRE  120

Query  210   LSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWS  386
             LS++YG L+ L+ GS PV+V SS ETA+ FLKTHDA  A RP TAA  HT +N SDM WS
Sbjct  121   LSKRYGPLIQLRLGSFPVVVGSSAETARFFLKTHDAASAGRPRTAAGRHTAYNYSDMLWS  180

Query  387   PYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVL--LRDHLV  560
             PYG  WR  R++ L+E+F+  +L SFE++R +E  AL+ GL+DA G   PV+  +++HL 
Sbjct  181   PYGAHWRRLRRVCLAELFSAARLGSFEHIRRDEVRALLRGLHDASGIGMPVVVKVKEHLF  240

Query  561   RFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLS  740
               TL  ++R+V GNKY  KD       G ++  ++    ++++F L+G +N+GD+VPWL 
Sbjct  241   AATLGMISRMVLGNKYVGKD----AGSGSAMEPEEFMRVMEEFFFLNGALNVGDFVPWLG  296

Query  741   GLDLQGYVKKMKAFREEYEKFLNYVIEDHMA--MMKGDENFAPKDMVDIFLQIADDPNLE  914
              LDLQGYV +MK      + F+  V+++H A   ++GD +F  KDM D+ L++     +E
Sbjct  297   WLDLQGYVGRMKNVAWALDAFMERVLDEHDARRRLEGDGSFVAKDMADV-LRLQQRRQIE  355

Query  915   A----DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGR  1082
             +       L RD +  L  D++AGG +T A T+EWA  EL R P  ++ A EEL RV+GR
Sbjct  356   SGDEEGEPLERDSVKALAMDLIAGGTNTNAVTLEWAMSELLRNPAAMDAAGEELGRVVGR  415

Query  1083  ERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIV--------AGYEVPRGT  1238
              R V E D   LPY+ A++KET RLHP+ TLL PH + ED  V          Y+VP GT
Sbjct  416   GRLVREDDIQSLPYLRAVVKETLRLHPVGTLLAPHEAQEDATVPAFVSGNGVSYDVPAGT  475

Query  1239  TVLINVWSIGRNSKYWD-NANEFCPERFLE----KDVDIKGQDFALLPFGSGRRKCPGYS  1403
              VL+NVW+I R+   W     EF PERFLE      VD+ GQD  LLPFG+GRR CPGY 
Sbjct  476   RVLVNVWAIARDPALWGPKPEEFRPERFLEGGGNSGVDVVGQDMELLPFGAGRRMCPGYG  535

Query  1404  LGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             LG+KVV+  LANL+HGF W+L   +  +++ MDE +GLTT  KFPL   +EP+LP H
Sbjct  536   LGIKVVQICLANLIHGFAWRLPDGVAAEELGMDEVFGLTTSRKFPLEAVLEPKLPAH  592



>gb|ACF84248.1| unknown [Zea mays]
 tpg|DAA45476.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=525

 Score =   482 bits (1240),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 242/523 (46%), Positives = 339/523 (65%), Gaps = 23/523 (4%)
 Frame = +3

Query  39    SWFFQALPWLLAIAFLFKITTIHQRRKA---YKTPPGPRPWPIIGNLNLLGSIPHQSLHS  209
             S+F  A+   +A A LF +T +  R ++   Y+ PPGPRPWP+IGNLNL+G +PH S+H 
Sbjct  10    SFFLVAV---VAGATLFLVTVLRLRARSTRKYRLPPGPRPWPVIGNLNLIGPLPHHSVHE  66

Query  210   LSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWS  386
             LS++YG LM L+FGS PV+VASS +TA+L LKTHD  F  RP TAA  +T +N + + + 
Sbjct  67    LSKRYGPLMSLRFGSFPVVVASSIDTARLILKTHDLAFIDRPQTAAGRYTTYNCAGLFYQ  126

Query  387   PYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAV----GTKNPVLLRDH  554
             PYG +WR AR++  +E+F+ R+L S E+VR +E  A++S L  A     G  + V LR+H
Sbjct  127   PYGAYWRQARRLCQAELFSARRLMSLEHVRSDEVRAMLSDLRAAASAPAGGHDAVTLREH  186

Query  555   LVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL--KKLQGFLDDWFLLSGVINLGDWV  728
             L    LS ++R++ G KY          EG S P   ++ +  +D+ F L+GV+N+ D +
Sbjct  187   LYMVNLSVVSRMLLGKKYVV--------EGSSSPATPEEFRWLIDEHFFLNGVLNVADMI  238

Query  729   PWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDP  905
             PWLS LD QGYVK+MK   +  ++FL +V+++H    + + E+F   DM+D+ L++ADDP
Sbjct  239   PWLSPLDPQGYVKRMKRSAKMLDRFLEHVVDEHNERRRREGEDFVAMDMMDVLLELADDP  298

Query  906   NLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRE  1085
             + + +V +TRD + G T D++ GG DT+A TVEWA  EL R P ++ KATEELDRV+GR 
Sbjct  299   S-QLEVPITRDNVKGFTLDLMGGGTDTSAVTVEWAMSELLRNPEVLAKATEELDRVVGRN  357

Query  1086  RWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSI  1265
             R V E D   LPY+DA++KET RLHP+  LL P    ED  V GY++P G  V +N W+I
Sbjct  358   RLVAEGDIPSLPYLDAVVKETLRLHPVAPLLTPRLCREDVSVGGYDIPAGARVFVNAWAI  417

Query  1266  GRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLL  1445
             GR+   W+   EF PERF    VD+KGQ F LLPFGSGRR CPG  L +++V T L NLL
Sbjct  418   GRDPAVWEAPLEFRPERFAGSGVDVKGQHFELLPFGSGRRMCPGMGLALRMVPTILGNLL  477

Query  1446  HGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             H F W+L   +  +++ M+E +GLT     PL    EP+LP  
Sbjct  478   HAFAWRLPDGVAAEELGMEETFGLTVPRLVPLQAVAEPKLPAR  520



>ref|XP_006427648.1| hypothetical protein CICLE_v10025417mg [Citrus clementina]
 gb|ESR40888.1| hypothetical protein CICLE_v10025417mg [Citrus clementina]
Length=506

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 239/483 (49%), Positives = 331/483 (69%), Gaps = 12/483 (2%)
 Frame = +3

Query  132   PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTH  311
             PPGP+PWPIIGNLNL+G +PH S+HSLS+KYG LM LKFG   V+V SS E A+L LKTH
Sbjct  31    PPGPKPWPIIGNLNLIGPLPHISIHSLSRKYGPLMHLKFGFDSVVVGSSVEVAELLLKTH  90

Query  312   DAVFASRPATAAAHH-TFNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEER  488
             D  F+SRP   A  + T++ + M  +PY P+WR ARKI + E+ +P++LD FEY+R+EER
Sbjct  91    DLSFSSRPQLLAGKYLTYDYTGMGTAPYSPYWRQARKICVMELLSPKRLDQFEYMRVEER  150

Query  489   MALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKL  668
                +  ++ +     PV L+D L    LSTM+R+V G +Y  +D      E   +  K+ 
Sbjct  151   KLFLHDMFKSCS--KPVQLKDRLYMLNLSTMSRMVLGKRYTEED------ENNIVTPKEF  202

Query  669   QGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD  848
                L++ FL+ G +++GD +PWL+ LDLQG+VK+MK    + ++F   ++++  A  K  
Sbjct  203   TEMLEELFLVHGTLDIGDAIPWLAPLDLQGHVKRMKDVNRKLDRFYEQILDERYARKKSG  262

Query  849   ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFR  1028
             ++    DMVD+ +Q ADDP LE  V + R ++  +  D+L  G DT+A  VEWA   L +
Sbjct  263   KDQGVNDMVDVLVQFADDPTLE--VKIERHQLKAIIQDLLTAGTDTSALNVEWAMSLLLK  320

Query  1029  KPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCI  1208
              P  I+KATEELDRVIGR+RWV+EKD   LPYI AI+KET RLHP+  LL P  + EDC 
Sbjct  321   NPEAIQKATEELDRVIGRDRWVQEKDIVNLPYIQAIVKETMRLHPVVPLLIPRVAREDCK  380

Query  1209  VAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRK  1388
             VAGY++ + + VLIN+W+IGR+   W+  NEF P+RF+ K++D+KG D+ LLPFGSGRR 
Sbjct  381   VAGYDLLKNSRVLINIWTIGRDPTIWEKPNEFWPDRFIGKEIDVKGHDYELLPFGSGRRM  440

Query  1389  CPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYT-IEPRL  1565
             C GY LG+K+V+++LANLLHGF+WKL GD+K +D+ M+E +GLTT  K PL     +PRL
Sbjct  441   CLGYGLGLKLVQSSLANLLHGFEWKLPGDMKRQDLDMEERFGLTTCKKNPLVVVPTKPRL  500

Query  1566  PTH  1574
             P H
Sbjct  501   PHH  503



>emb|CDP21888.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   474 bits (1221),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 237/517 (46%), Positives = 332/517 (64%), Gaps = 58/517 (11%)
 Frame = +3

Query  27    MEVFS--WFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQS  200
             ME FS  W   AL W+  +         HQ++     PPGPR WPIIGNLNL+G++PH+S
Sbjct  1     MESFSPTWAAYALAWVATVVIAHLSKHFHQQK--LNLPPGPRQWPIIGNLNLIGTLPHRS  58

Query  201   LHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAA-HHTFNRSDM  377
             LH LS  YG LM L+FG+ PV+V SS E AK+FLKT D  FA RP TA+  +++++ +DM
Sbjct  59    LHQLSLTYGPLMHLQFGTFPVVVGSSVEMAKVFLKTMDVTFAGRPKTASGKYNSYDCTDM  118

Query  378   TWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHL  557
             TWS YGP+WR ARKI L+E+F+ ++L+S+E++R+EE  +L+  L+ + G   PV+L+D+L
Sbjct  119   TWSAYGPYWRQARKIFLTELFSAKRLESYEHIRVEEMNSLLLQLFKSSG--KPVVLKDYL  176

Query  558   VRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWL  737
                +L+ ++R+V G  Y      + + E   +   + +  +D+ FLL+GV N+GD++PW+
Sbjct  177   STGSLNVISRMVLGKTY------IDESENSIVTPDEFRQMMDELFLLTGVFNIGDFIPWI  230

Query  738   SGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEA  917
               LDLQGY+K+MK   +++++FL +V+++H A  K D N   KD+VD+ L +ADDP LE 
Sbjct  231   DFLDLQGYIKRMKILSKKFDRFLEHVLDEHNAQRKDDTNCVSKDLVDVLLGLADDPTLE-  289

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V L R  +  LT D+LAGG +T+A TVEWA  EL + P I  KA EELDRVIG+ RWV 
Sbjct  290   -VKLERRGVKALTLDLLAGGTETSATTVEWAISELLKNPEIFNKAAEELDRVIGQNRWVN  348

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             EKD   LPYI+A++KET R+HP                                      
Sbjct  349   EKDMPNLPYIEAVVKETMRMHP--------------------------------------  370

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
                     FCP+RF+ KD+D KGQD   LPFG+GRR CPGYSLG+KV++++LANLLHG++
Sbjct  371   -----PELFCPDRFMGKDIDFKGQDCKFLPFGAGRRMCPGYSLGLKVIQSSLANLLHGYR  425

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLP  1568
             WKL  D+ P+D+ M+E +GLTT  K PL   +EPRLP
Sbjct  426   WKLPNDMMPEDLDMEEIFGLTTPRKIPLVAIVEPRLP  462



>gb|KCW71322.1| hypothetical protein EUGRSUZ_F04404 [Eucalyptus grandis]
Length=502

 Score =   473 bits (1218),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 244/519 (47%), Positives = 346/519 (67%), Gaps = 22/519 (4%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLH  206
             M+  SW    +  L   +FL  + + H RR+  K PPGP+PWPIIGNLNL+  + H+SLH
Sbjct  1     MDAPSWAVCGIACLAVASFL--LLSSHLRRRKLKLPPGPKPWPIIGNLNLISPLLHRSLH  58

Query  207   SLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTW  383
              LS+ YG +M L+ GS  V+V SS + AK  LKTHDAVFA RP +AA  +T +N S MTW
Sbjct  59    ELSRIYGPIMKLQLGSGSVVVCSSADMAKAILKTHDAVFAYRPKSAAGKYTAYNYSGMTW  118

Query  384   SPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVR  563
             SPYGP+++  RKI L+++F+  +L S EY+R+EE   L   L+DA G    + L+DHL  
Sbjct  119   SPYGPYFQEIRKIFLAQLFSAARLQSSEYIRVEEMRVLTRNLFDAKGQS--INLKDHLSD  176

Query  564   FTLSTMTRLVTGNKYY--SKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWL  737
               L+ + R+V G KY   S++  +   EG+       +  +D+ FLL GV+NLGD++P L
Sbjct  177   LNLNMICRMVLGKKYSDKSENSNIVSAEGF-------RKMVDELFLLIGVLNLGDFLPLL  229

Query  738   SGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGDENFAPKDMVDIFLQIADDPNLEA  917
               LDLQ    +MKA  +++++FL  V+ +H A  +  E +  KDMVD+ LQ  +DPNL  
Sbjct  230   DFLDLQ----RMKAVNKKFDRFLEDVLGEHEA--RKVEGYEAKDMVDVLLQHVNDPNL--  281

Query  918   DVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVE  1097
              V + R  +  L  +++AGG + +AA+VEWA  EL + P I  KAT+ELD +IGRERWV+
Sbjct  282   GVKIERHVVKALIQELIAGGTEGSAASVEWAMCELLKNPHIFNKATQELDNIIGRERWVQ  341

Query  1098  EKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNS  1277
             E     LPY++A+IKE  RLHP+   +  H++ +DC VAGY++P+GT VL++ WSIGR+ 
Sbjct  342   EAGVMNLPYLNAVIKEIMRLHPVGAFIAHHFASQDCEVAGYDIPKGTRVLVSKWSIGRDP  401

Query  1278  KYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFK  1457
             + WD+   F PERF+ K +D+KGQDF LLPFGSGRR CPGY+LG+++++TTLANL+HGF 
Sbjct  402   ELWDDPENFRPERFIGKAIDVKGQDFELLPFGSGRRMCPGYNLGLRMIQTTLANLIHGFS  461

Query  1458  WKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             WKL  ++  ++++M+E  GL+T  K P     EPRLP H
Sbjct  462   WKLPENMTREELNMEEVPGLSTPKKIPFIAVAEPRLPLH  500



>ref|XP_004984305.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=536

 Score =   474 bits (1220),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 231/494 (47%), Positives = 329/494 (67%), Gaps = 17/494 (3%)
 Frame = +3

Query  123   YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFL  302
             Y  PPGPRPWP+IGNLNL+GS+PH+S+H LS ++G LM L+FGS PV+V +S + A+  L
Sbjct  44    YNLPPGPRPWPVIGNLNLIGSLPHRSIHELSARHGPLMSLRFGSVPVVVGASVDAARFIL  103

Query  303   KTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRI  479
             KTHD  F  RP  A+  +T +N SD+ WSPYG +WR ARK+  +++F+ R+L S E+VR+
Sbjct  104   KTHDVAFIDRPKMASGRYTAYNFSDIVWSPYGAYWRQARKLWQTKLFSARQLRSQEHVRL  163

Query  480   EERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPL  659
             EE   L+ GL+     +  V L++HL+   L+ ++R+  G KY  +        G  +  
Sbjct  164   EEVRDLLRGLHGLAEGRVAVALKEHLLMLNLNVISRMALGRKYVGEG-----TAGSPVSP  218

Query  660   KKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAMM  839
              + +  +D+ F+L+GV ++GD++PWL+ LDLQGY+ +MK   + +++FL +V+++H    
Sbjct  219   AEFRWMVDELFVLNGVFSIGDFIPWLNCLDLQGYIARMKRLGKMFDRFLEHVVDEHNERR  278

Query  840   KGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQ  1016
             + + E F  KDMVD+ L++ADDP+LE  V + RD + G   D++AGG DT+A   EWA  
Sbjct  279   RREGEGFVAKDMVDLLLELADDPSLE--VPIERDGVKGFALDLIAGGTDTSAVATEWAMS  336

Query  1017  ELFRKPWIIEKATEELDRVIGRERW-VEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYS  1193
             EL R P ++ KATEELD V+G  R  V E+D  +LPY++A++KETFRLHP+  LL P  S
Sbjct  337   ELLRNPEVMAKATEELDSVVGHGRLLVTEEDIPKLPYLEAVVKETFRLHPVTPLLAPRLS  396

Query  1194  IEDC------IVAGYEVPRGTTVLINVWSIGRNSKYWDNA-NEFCPERFLEKDVDIKGQD  1352
              ED          GY++P GT V +N+W+IGR+   W  A  EF PERF+   VD+KGQD
Sbjct  397   REDASSTGGGGGGGYDIPAGTLVFVNIWTIGRDPAVWGRAAEEFRPERFVGSSVDVKGQD  456

Query  1353  FALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPK  1532
               LLPFGSGRR CPGY+LG+K+V+ TLANLLH F W+L   +  +++SM+E +GL    K
Sbjct  457   LELLPFGSGRRMCPGYTLGLKMVQLTLANLLHAFAWRLPDGVAAEELSMEEKFGLAVPRK  516

Query  1533  FPLSYTIEPRLPTH  1574
              PL    EPRLP H
Sbjct  517   VPLEAVAEPRLPAH  530



>gb|EMT08550.1| Flavonoid 3'-monooxygenase [Aegilops tauschii]
Length=531

 Score =   469 bits (1207),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 250/540 (46%), Positives = 354/540 (66%), Gaps = 36/540 (7%)
 Frame = +3

Query  27    MEVFSWFFQALPWLLAIAFLFKITTIHQRRKAY-----KTPPGPRPWPIIGNLNLLGSIP  191
             M+V +W      W   +A +  + TI +R +       + PPGP+PWP+IGNLNL+G++P
Sbjct  1     MDVTAW-----AWASFLAVVLVVLTILRRGRGSQPQGNRLPPGPKPWPVIGNLNLIGALP  55

Query  192   HQSLHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNR  368
             H+S+H LS++YG LM L+FGS PV+V SS E A+ FLKTHD VFA RP TAA  HT +N 
Sbjct  56    HRSIHELSKQYGPLMQLRFGSFPVVVGSSAEMARFFLKTHDKVFADRPRTAAGKHTTYNY  115

Query  369   SDMTWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEE----RMALISGLYDAVGTKNP  536
             SD+ W+PY   +R AR++  +E+F+  +L S++++R EE       L +  + A G   P
Sbjct  116   SDVLWAPYNAHFRRARRLFATELFSAARLKSYKHIRHEEVSALLRDLAAAAHGASGRAVP  175

Query  537   VLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINL  716
               LR HL   T   ++R+V G KY  K  E G     ++ L+ L G ++++FLL+GVIN+
Sbjct  176   --LRGHLFAATNGIISRVVLGKKYAEK--EAGG--SAAMALEDLSGLIEEFFLLNGVINV  229

Query  717   GDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAM--MKGDENFAPKDMVDIFLQ  890
             GD++PW   LDLQGYV++MK + ++ ++FL +V+E+H     +KG E F  +DMVD+ LQ
Sbjct  230   GDFIPWFDWLDLQGYVRRMKKYSKKMDRFLEHVLEEHEERRRVKG-EQFVARDMVDVLLQ  288

Query  891   IADDPN-LEADV--ALTRDRIM---------GLTHDMLAGGEDTTAATVEWAFQELFRKP  1034
             +AD+PN L+ D   ALT+ R           G  + ++    DT++ T+EWA  E+ R P
Sbjct  289   LADNPNRLDRDTVKALTQVRTPSLILPYFQPGYIYTIVDQDSDTSSVTMEWAMSEVLRNP  348

Query  1035  WIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVA  1214
              ++ KAT+ELDRV+GR+R V EKD   LPYI+AI+KE  R+HP+  +L PH + ED  V 
Sbjct  349   EVLGKATKELDRVVGRDRMVMEKDIPDLPYIEAIVKEAMRMHPVSPMLAPHLAREDASVN  408

Query  1215  GYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCP  1394
             G+++P GT VL+NVW+IGR+  YWD   EF PERF+   +D+KGQD  LLPFG+GRR CP
Sbjct  409   GHDIPAGTLVLVNVWAIGRDPTYWDAPEEFRPERFMGSKIDVKGQDMELLPFGAGRRMCP  468

Query  1395  GYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             GYSLG+KVV+  +ANLLHGF W L      + ++M+E YGLTT  KFPL   +EP+L  H
Sbjct  469   GYSLGLKVVQLIVANLLHGFTWGLPDGTTMEQLNMEEIYGLTTARKFPLEAVVEPKLQEH  528



>gb|EAY85957.1| hypothetical protein OsI_07321 [Oryza sativa Indica Group]
Length=537

 Score =   468 bits (1204),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 338/521 (65%), Gaps = 24/521 (5%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKA----YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
             +L +A L  +    +RR+     Y  PPGPRPWP+IGNLNL+G++PH+S+  LSQ+YG L
Sbjct  19    VLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPHRSIRDLSQRYGPL  78

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             M L+FGS PV+V SS + A+ FL+ +D  F  RP TAA  +T +N + + WS YG +WR 
Sbjct  79    MSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYWRQ  138

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
             AR++ ++E+ + R+L S E+VR EE  A++ GL    G    V+L++H++  TL+ ++R+
Sbjct  139   ARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVTLNVISRM  198

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G KY  ++ E   P       ++ +  +++ F L+GV N+GD VPWL  LD QGY+ +
Sbjct  199   VFGKKYIVEEGEGSSP----TTAEEFRWMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGR  254

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIM  947
             MK     +++FL +++++H+   + + + FA +DMVD+ LQ ADDP+L+  V + RD + 
Sbjct  255   MKRLGGMFDRFLEHILDEHVERRRREGDGFAARDMVDLLLQFADDPSLK--VPIQRDGVK  312

Query  948   GLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYI  1127
                 +++ G  DTT+ +VEWA  E+ R P ++ +AT+ELDRV+GR R V E D   LPY+
Sbjct  313   AFILELITGSTDTTSVSVEWAMSEVLRNPSVLARATDELDRVVGRRRLVAEGDIPNLPYL  372

Query  1128  DAIIKETFRLHPLCTLLPPHYSIEDCI-------VAGYEVPRGTTVLINVWSIGRNSKYW  1286
             DA++KE+ RLHP+  LL P  S ED          A Y++P GT VL+NVW+IGR+   W
Sbjct  373   DAVVKESMRLHPVVPLLVPRVSREDAFSVSVAGAAASYDIPAGTRVLVNVWAIGRDPAVW  432

Query  1287  -DNANEFCPERFL----EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHG  1451
              D+A EF PERF        VD+KGQDF LLPFGSGRR CPG+ LG+K+V+ TLANLLHG
Sbjct  433   GDDAEEFRPERFAAGGERGGVDVKGQDFELLPFGSGRRMCPGFGLGLKMVQLTLANLLHG  492

Query  1452  FKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             F W+L G    +++SM+E +G++      L    EP+LP H
Sbjct  493   FAWRLPGGAAAEELSMEEKFGISVSRLVQLKAIPEPKLPAH  533



>ref|XP_002462453.1| hypothetical protein SORBIDRAFT_02g025820 [Sorghum bicolor]
 gb|EER98974.1| hypothetical protein SORBIDRAFT_02g025820 [Sorghum bicolor]
Length=522

 Score =   464 bits (1195),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 241/510 (47%), Positives = 335/510 (66%), Gaps = 12/510 (2%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLK  245
             +L   F  +   +   R+AY  PPGP+PWPIIGNLNL+G +PH+S+H LS++YG LM L+
Sbjct  13    VLCAVFFLRTFLLRGHRRAYNPPPGPKPWPIIGNLNLIGELPHRSIHELSKRYGPLMQLR  72

Query  246   FGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKI  422
             FGS PV+V +S E AKLFLK +DA F+ RP  A   +T ++ SD+ WSP+GP+ R AR+I
Sbjct  73    FGSLPVVVGASAEIAKLFLKVNDAAFSDRPRFAVGKYTAYDCSDILWSPFGPYLRQARRI  132

Query  423   LLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGN  602
               +E+F+ ++L+SFE++R EE   L+  L  A G    V LRD+L   TL  ++R+V G 
Sbjct  133   CATELFSAKRLESFEHIRDEEVRVLLRQLRQASG--RAVRLRDYLQMLTLGVISRIVLGK  190

Query  603   KYYSKDWELGKPEGYS-----IPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVK  767
             KY  ++   G  EG S     I   + +  + ++F L GV N+GD++PWL  LDLQGYV 
Sbjct  191   KYV-QEAAAGDGEGDSSAPTVITADEFREMVGEYFELHGVFNVGDFIPWLDCLDLQGYVA  249

Query  768   KMKAFREEYEKFLNYVIEDHMAMMKGDE-NFAPKDMVDIFLQIADDPNLEADVALTRDRI  944
             +MK     +++FL +V++ H    + +  +F PKDM+D+ LQ+ADD +LE  V L+RD +
Sbjct  250   RMKRMNARFDRFLEHVLDVHNERRRREGGSFVPKDMLDVLLQLADDTDLE--VQLSRDNV  307

Query  945   MGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPY  1124
               +T D++ G  DTTA TVEWA  EL +   II KA EEL+ V+G +R V E D  +LPY
Sbjct  308   KAITQDLIVGATDTTANTVEWAISELLKNSKIIAKAMEELNNVVGPDRLVTESDLPRLPY  367

Query  1125  IDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEF  1304
             ++A++KET R+HP   LL PH + ED  V GY+V  GT V +NVW+IG +   WD   EF
Sbjct  368   LEALLKETMRVHPPAPLLAPHVAREDTSVDGYDVLAGTVVFVNVWAIGHDPALWDAPGEF  427

Query  1305  CPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKP  1484
              PERFLE  +D++GQDF L+PFGSGRR CPG++L +KVV   LANLLHGF+W+L      
Sbjct  428   RPERFLESKIDMRGQDFQLVPFGSGRRMCPGFNLALKVVALGLANLLHGFQWRLPDGETA  487

Query  1485  KDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
              ++SM+E + L    KFPL   +EPRLP  
Sbjct  488   AELSMEEVFVLAMPRKFPLKAVVEPRLPAR  517



>dbj|BAD23209.1| putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
 dbj|BAD22905.1| putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=537

 Score =   464 bits (1195),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 228/521 (44%), Positives = 338/521 (65%), Gaps = 24/521 (5%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKA----YKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGEL  233
             +L +A L  +    +RR+     Y  PPGPRPWP+IGNLNL+G++P++S+  LS++YG L
Sbjct  19    VLVLATLLFVAAFLRRRQGARRKYNIPPGPRPWPVIGNLNLIGALPYRSIRDLSRRYGPL  78

Query  234   MLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRH  410
             M L+FGS PV+V SS + A+ FL+ +D  F  RP TAA  +T +N + + WS YG +WR 
Sbjct  79    MSLRFGSFPVVVGSSVDMARYFLRANDLAFLDRPRTAAGRYTVYNYAGVLWSHYGEYWRQ  138

Query  411   ARKILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRL  590
             AR++ ++E+ + R+L S E+VR EE  A++ GL    G    V+L++H++  TL+ ++R+
Sbjct  139   ARRLWVTELLSARRLASTEHVRAEEVRAMLRGLSRRAGAGTAVVLKEHMLMVTLNVISRM  198

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G KY  ++ E   P       ++ +  +++ F L+GV N+GD VPWL  LD QGY+ +
Sbjct  199   VFGKKYIVEEGEGSSP----TTAEEFRWMIEEIFFLNGVFNIGDMVPWLGWLDPQGYIGR  254

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIM  947
             MK     +++FL +++++H+   + + + FA +DMVD+ LQ ADDP+L+  V + RD + 
Sbjct  255   MKRLGGMFDRFLEHILDEHVERRRREGDGFAARDMVDLLLQFADDPSLK--VPIQRDGVK  312

Query  948   GLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYI  1127
                 +++ G  DTT+ +VEWA  E+ R P ++ +AT+ELDRV+GR R V E D   LPY+
Sbjct  313   AFILELITGSTDTTSVSVEWAMSEVLRNPSVLARATDELDRVVGRRRLVAEGDIPNLPYL  372

Query  1128  DAIIKETFRLHPLCTLLPPHYSIEDCI-------VAGYEVPRGTTVLINVWSIGRNSKYW  1286
             DA++KE+ RLHP+  LL P  S ED          A Y++P GT VL+NVW+IGR+   W
Sbjct  373   DAVVKESMRLHPVVPLLVPRVSREDAFSVSVAGAAASYDIPAGTRVLVNVWAIGRDPAVW  432

Query  1287  -DNANEFCPERFL----EKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHG  1451
              D+A EF PERF        VD+KGQDF LLPFGSGRR CPG+ LG+K+V+ TLANLLHG
Sbjct  433   GDDAEEFRPERFAAGGERGGVDVKGQDFELLPFGSGRRMCPGFGLGLKMVQLTLANLLHG  492

Query  1452  FKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             F W+L G    +++SM+E +G++      L    EP+LP H
Sbjct  493   FAWRLPGGAAAEELSMEEKFGISVSRLVQLKAIPEPKLPAH  533



>ref|XP_004984304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=523

 Score =   464 bits (1193),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 242/510 (47%), Positives = 334/510 (65%), Gaps = 19/510 (4%)
 Frame = +3

Query  78    AFLFKITTIHQRR--KAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELMLLKFG  251
             A LF +  + QRR  + Y  PPGPRPWP+IGNLNL+G +PH S+H LS +YG LM L+FG
Sbjct  17    AALFLVAILRQRRPTRKYNLPPGPRPWPVIGNLNLIGPLPHHSIHDLSARYGPLMSLRFG  76

Query  252   SKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILL  428
             S PV+V SS ETA+ FLKTHD  F  RP TAA  HT +N S + WSP+G +WR  R++  
Sbjct  77    SSPVVVGSSVETARFFLKTHDLAFIDRPRTAAGKHTTYNYSGLFWSPHGAYWRQGRRLWQ  136

Query  429   SEVFTPRKLDSFEYVRIEERMALISGL------YDAVGTKNPVLLRDHLVRFTLSTMTRL  590
             +E+F  R+L S E+VR EE  ++++ L        A G    V LR+HL    L+ ++R+
Sbjct  137   AELFNARRLASLEHVRGEEVRSMLNDLRASAAAAAAGGQHAAVALREHLYMVNLNVISRM  196

Query  591   VTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKK  770
             V G KY           G  +  ++ +  +D+ F L+G +N+GD +PWLS LD QGYV++
Sbjct  197   VLGRKYVVDG------AGSPVTPEEFRRMIDEHFSLNGALNVGDMIPWLSWLDPQGYVRR  250

Query  771   MKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIM  947
             MK   + +++FL YV+++H    + + + F   DMVD+ L++ADDPNLE  V + RD + 
Sbjct  251   MKRSAKMFDRFLEYVLDEHNERRRREGKEFIATDMVDVLLELADDPNLE--VPIGRDGVK  308

Query  948   GLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYI  1127
             G T D++ GG DT++ TVEWA  E+ R P ++ KA+EEL+RVIGR+R V E+D   LPY+
Sbjct  309   GFTLDLIGGGTDTSSVTVEWAMSEILRSPEVLAKASEELERVIGRDRLVAEQDIPNLPYM  368

Query  1128  DAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFC  1307
             +AI+KET RLHP+  L+ P  S ED  +  Y++P GT VLINVW+IGR+   W+   EF 
Sbjct  369   EAIVKETMRLHPVAPLMSPRLSREDVSMGRYDIPAGTRVLINVWAIGRDPAVWEAPMEFR  428

Query  1308  PERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKL-DGDLKP  1484
             PERF+   VD+KGQDF LLPFGSGRR CPG  LG+++V   LANLLH F W+L  G    
Sbjct  429   PERFVGSGVDVKGQDFELLPFGSGRRMCPGIGLGLRMVHMILANLLHAFAWRLPGGAAAA  488

Query  1485  KDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             +++SM+E + LT   + PL    EP+LP H
Sbjct  489   EELSMEETFSLTVPRRVPLEAVAEPKLPDH  518



>ref|XP_002467826.1| hypothetical protein SORBIDRAFT_01g034730 [Sorghum bicolor]
 gb|EER94824.1| hypothetical protein SORBIDRAFT_01g034730 [Sorghum bicolor]
Length=529

 Score =   463 bits (1191),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 246/517 (48%), Positives = 335/517 (65%), Gaps = 19/517 (4%)
 Frame = +3

Query  66    LLAIAFLFKITTIHQRRKAYKT------PPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYG  227
             +LA A L      H++R +  T      PPGPRPWPIIGNLNL+G++PH+S+H+LS +YG
Sbjct  13    VLATALLVVAALRHRKRSSTSTSKHRRLPPGPRPWPIIGNLNLIGALPHRSIHALSARYG  72

Query  228   ELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFW  404
               M L+FGS PV+V SS + A+ FLKT+DA F  RP  A+  HT ++ SD+ WSPYG +W
Sbjct  73    PFMSLRFGSVPVVVGSSVDAARFFLKTNDASFIDRPKMASGKHTAYDYSDIVWSPYGAYW  132

Query  405   RHARKILLSEVFTPRKLDSFEYVRIEERMALISGLYD----AVGTKNPVL-LRDHLVRFT  569
             R ARK+  + +F+ R+L S E+VR EE  AL+  L      A G    V+ L++HL+ F+
Sbjct  133   RQARKLWKAHLFSDRQLRSQEHVRSEELRALLRDLSLSSSAAAGRGGVVVVLKEHLLMFS  192

Query  570   LSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLD  749
             L+ ++R+  G KY     E G   G  I   + +  +D+ FLL+GV  +GD++PWLS LD
Sbjct  193   LNVISRMALGGKYVG---EGGTDAGSPISPAEFRWMVDELFLLNGVFCVGDFIPWLSWLD  249

Query  750   LQGYVKKMKAFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVA  926
             +QGYV +MK   + +++FL +V+E+H    + + + F   DMVD+ L++ADDP LE  V 
Sbjct  250   IQGYVGRMKRLGKMFDRFLEHVVEEHSQRRRREGDKFVAADMVDLLLELADDPKLE--VP  307

Query  927   LTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKD  1106
             + RD + G   D++AGG D++A T+EWA  EL RKP ++ KA EELD VIG  R V E+D
Sbjct  308   IKRDGVKGFALDLIAGGTDSSAVTIEWAMSELLRKPEVLAKAVEELDGVIGHGRLVTEQD  367

Query  1107  FSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYW  1286
                LPY++AI+KET RLHP+  LL P    ED     Y++PRGT V +NVW+IGR+   W
Sbjct  368   IRSLPYVEAIVKETMRLHPVTPLLAPRLCREDASTGSYDIPRGTLVFVNVWAIGRDPAVW  427

Query  1287  -DNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWK  1463
               +A EF PERF    VD+KGQD  LLPFGSGRR CPGY LG+K+V+ TLANLLH F W+
Sbjct  428   GGDAEEFRPERFAGSAVDVKGQDLELLPFGSGRRMCPGYVLGLKMVQVTLANLLHAFAWR  487

Query  1464  LDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             L   + P+ +SM E +GL      PL     PRLP H
Sbjct  488   LPDGVAPEKLSMQEKFGLAVPRVVPLEAVAVPRLPAH  524



>ref|XP_009413943.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   460 bits (1184),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 313/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  69    LAIAFLFKITTI---HQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELML  239
             LA+  +F + T     +RR+    PPGPRPWP+IGNLNL+G +P++SL +LSQK+G LM 
Sbjct  10    LALVLVFTLLTGLYGGRRRQKLNLPPGPRPWPVIGNLNLIGPLPYRSLAALSQKHGPLMH  69

Query  240   LKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHTF-NRSDMTWSPYGPFWRHAR  416
             L+FGS PV+V SS + AK FLKTHD  F SRP + A  +TF N S + WSPYGP+WR AR
Sbjct  70    LRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKSVAGEYTFYNYSSIGWSPYGPYWRQAR  129

Query  417   KILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVT  596
             +IL+ E+ TP++LDS++Y+R+EE   L+  L+ + GT  PVLL+DH+    L+ ++R+V 
Sbjct  130   RILIMELLTPKRLDSYQYIRVEEVRGLLRDLFRSTGT--PVLLKDHIFTVILNIISRIVL  187

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G KY  +           +P ++ +  +++  LL+GVIN+GD +PWL+ LDLQGYVK+MK
Sbjct  188   GRKYTQEQSVSSGAPAAIVPQEEFKEMIEELMLLNGVINVGDLIPWLNFLDLQGYVKRMK  247

Query  777   AFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL  V++ H    + + + F P+D+VD+ L++ADD  LE  V L R  +   
Sbjct  248   MVGKRFDRFLERVLDKHNERRRREGKAFVPRDLVDVLLELADDHGLE--VKLERHCVKAF  305

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
               D+ AGG DT   T+EWA  E+ ++P   +KATEELDRVIGR RWVEE+D  +LPYI+A
Sbjct  306   ILDIFAGGTDTYTVTIEWAVSEILKRPETFDKATEELDRVIGRGRWVEEEDVHRLPYIEA  365

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET R+HP+  LL P  S E   V GY++P GT VL+NVW+IGR+   WD   EF PE
Sbjct  366   IVKETMRIHPVAPLLVPRLSREHTTVDGYDIPAGTRVLVNVWAIGRDPAVWDAPEEFRPE  425

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTL  1433
             RF+   +D+KG  F LLPFG+GRR CPG SLG+K+   T+
Sbjct  426   RFVGSPIDVKGHHFELLPFGAGRRMCPGNSLGLKMSTPTV  465



>dbj|BAK04187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/527 (45%), Positives = 338/527 (64%), Gaps = 17/527 (3%)
 Frame = +3

Query  24    MMEVFSWFFQALPWLLAIAFLFKITTIH-QRRKAYKTPPGPRPWPIIGNLNLLGSIPHQS  200
             +MEV  W    +  L    FL  I   H Q+ + Y  PPGPRPWP+IGNLNL+G +PH+S
Sbjct  5     LMEV-PWAPSLVVLLATAVFLVAILRRHRQQSRKYNIPPGPRPWPVIGNLNLIGPLPHRS  63

Query  201   LHSLSQKYGELMLLKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHT-FNRSDM  377
             +H LS +YG LM L+FGS P++V SS E A+ FL+THD  F  RP  A   +T +N S M
Sbjct  64    IHVLSSRYGPLMSLRFGSFPIVVGSSLEAAEFFLRTHDLAFLDRPRMACGKYTVYNYSGM  123

Query  378   TWSPYGPFWRHARKILLSEVFTPRKLDSFEYVRIEERMALISGLY------DAVGTKNPV  539
              WS YGP+WR  RK+ L+E+ + R+L   E++R EE  A++  L+       +  T   V
Sbjct  124   LWSHYGPYWRLLRKLWLTELLSTRQLRLTEHIRGEEVRAMLRDLHPSTSTAASTSTGRAV  183

Query  540   LLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLG  719
             +L+DHL+  TL+ ++R+V G KY  +    G     ++  ++ +  +++ F L+G  ++G
Sbjct  184   VLKDHLLMVTLNVISRMVLGKKYVGE----GAGSASAVKPEQFRWMIEEIFFLNGAPHIG  239

Query  720   DWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIEDHMAM-MKGDENFAPKDMVDIFLQIA  896
             D +PWLS LD QGYV +MK   + +++F+ +V+ +H    ++  + F PKDMVD+ LQ+A
Sbjct  240   DMIPWLSWLDPQGYVGRMKRLGKMFDRFIEHVLREHNERRLQEGKAFVPKDMVDLLLQLA  299

Query  897   DDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVI  1076
             DDP LE  V ++ D +     +++AG  DT+A TVEWA  EL RKP ++ K TEELDRVI
Sbjct  300   DDPTLE--VPISGDGVKASVLELIAGATDTSAVTVEWAMSELLRKPHVLAKVTEELDRVI  357

Query  1077  GRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINV  1256
             GR+R V E D S LPY++A++KET RLHP+  LL P  S E   +AGYE+P GT VL+NV
Sbjct  358   GRDRLVAEGDISSLPYLEAVVKETLRLHPVVPLLIPRVSREHTSIAGYEIPVGTRVLVNV  417

Query  1257  WSIGRNSKYW-DNANEFCPERFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTL  1433
             W+IGR+   W + A EF PERFL   VD+KG D  LLPFG+GRR CP + LG+K+V+  L
Sbjct  418   WAIGRDPTVWGETAAEFQPERFLGSKVDVKGHDLELLPFGAGRRMCPAHGLGLKMVQLVL  477

Query  1434  ANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPLSYTIEPRLPTH  1574
             ANLLHG+ W+L   +  +++SM+E +G++      L    EP+L  H
Sbjct  478   ANLLHGYAWRLPDGMAAEELSMEEKFGISVSRMHHLHAIPEPKLMDH  524



>ref|XP_009407098.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=539

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 225/462 (49%), Positives = 315/462 (68%), Gaps = 9/462 (2%)
 Frame = +3

Query  69    LAIAFLFKITTI---HQRRKAYKTPPGPRPWPIIGNLNLLGSIPHQSLHSLSQKYGELML  239
             LAI  +F + T     +RR+    PPGPRPWP+IGNLNL+G +P++SL +L+QK+G LM 
Sbjct  10    LAIVLVFTLLTALAGGRRRRKLNLPPGPRPWPVIGNLNLIGRLPYRSLAALAQKHGPLMH  69

Query  240   LKFGSKPVIVASSPETAKLFLKTHDAVFASRPATAAAHHTF-NRSDMTWSPYGPFWRHAR  416
             L+FGS PV+V SS + AK FLKTHD  F SR  TAA  +TF N SD+ WSPYGP+WR AR
Sbjct  70    LRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRRKTAAGKYTFYNYSDIGWSPYGPYWRQAR  129

Query  417   KILLSEVFTPRKLDSFEYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVT  596
             +I + E+FT ++LDS++Y+R+EE   L+  L+ +  T  PVLL+DHL    L+ M+R+V 
Sbjct  130   RICIMELFTTKRLDSYQYIRVEEVRCLLQDLFRSAET--PVLLKDHLFTINLNIMSRMVL  187

Query  597   GNKYYSKDWELGKPEGYSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMK  776
             G KY  +           +P ++ +  +++  LL+GVIN+GD +PWL+ LDLQGYVK+MK
Sbjct  188   GRKYTQEQSLSSVAPTAIVPQEEFKEMVEELLLLNGVINVGDLIPWLNFLDLQGYVKRMK  247

Query  777   AFREEYEKFLNYVIEDHMAMMKGD-ENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGL  953
                + +++FL +V+++H    + + + F P+DM D+ L++ADD  LE  V L R  +   
Sbjct  248   MLGKRFDRFLEHVLDEHNERRRREGKAFVPRDMADVLLELADDDGLE--VKLERHCLKAF  305

Query  954   THDMLAGGEDTTAATVEWAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDA  1133
               DM   G DT+  T+EWA  E+ ++P   +KATEELDRVIGR RWVEE+D  +LPYI+A
Sbjct  306   ILDMFVAGTDTSTITIEWAISEILKRPETFDKATEELDRVIGRGRWVEEEDVHRLPYIEA  365

Query  1134  IIKETFRLHPLCTLLPPHYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPE  1313
             I+KET R+HP+  LL P +S E   V GY++P  T VL+NVW+IGR+   WD   EF PE
Sbjct  366   IVKETMRMHPVAPLLIPRFSREHTTVDGYDIPARTGVLVNVWAIGRDPAVWDAPEEFRPE  425

Query  1314  RFLEKDVDIKGQDFALLPFGSGRRKCPGYSLGMKVVRTTLAN  1439
             RF+   +D+KG  F LLPFG+GRR CPGYSLG+K++   +A+
Sbjct  426   RFVGSPIDVKGHHFELLPFGAGRRMCPGYSLGLKLIGDGVAH  467



>gb|KGN58498.1| hypothetical protein Csa_3G651820 [Cucumis sativus]
Length=428

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 219/431 (51%), Positives = 305/431 (71%), Gaps = 11/431 (3%)
 Frame = +3

Query  288   AKLFLKTHDAVFASRPATAAAHHT-FNRSDMTWSPYGPFWRHARKILLSEVFTPRKLDSF  464
             AKLFLKT D  FASRP T A  +T +N S++TWS YGP+W   RK+ L E+F+ R+LDS+
Sbjct  2     AKLFLKTQDLNFASRPKTTAGKYTTYNHSNITWSQYGPYWGQLRKMCLMELFSARRLDSY  61

Query  465   EYVRIEERMALISGLYDAVGTKNPVLLRDHLVRFTLSTMTRLVTGNKYYSKDWELGKPEG  644
             EY+R EE   LI  +Y + G    + ++D+L   +L+ ++R+V G KY  +  E G    
Sbjct  62    EYIRKEEMNGLIREIYKSCG--EVIKVKDYLFAVSLNVISRMVLGKKYTDEPSESG----  115

Query  645   YSIPLKKLQGFLDDWFLLSGVINLGDWVPWLSGLDLQGYVKKMKAFREEYEKFLNYVIED  824
               +   + +  +D+ FLL+GV+N+GD +PW+  LDLQGYVK+MK   ++ ++FL +V+++
Sbjct  116   -IVSPDEFRKMMDELFLLNGVLNIGDSIPWMDFLDLQGYVKRMKGLSKKLDRFLEHVLDE  174

Query  825   HMAMMKGDENFAPKDMVDIFLQIADDPNLEADVALTRDRIMGLTHDMLAGGEDTTAATVE  1004
             H    KG EN+  KDMVD+ LQ+ADDP+LE  V L R  +   T D+L GG +++  TVE
Sbjct  175   HKERRKGVENYVAKDMVDVLLQLADDPDLE--VKLERHGVKAFTQDLLGGGIESSTVTVE  232

Query  1005  WAFQELFRKPWIIEKATEELDRVIGRERWVEEKDFSQLPYIDAIIKETFRLHPLCTLLPP  1184
             W   EL + P I+ KATEEL++VIG+ERWVEEKD   LPYI+AI KET RLHP+  +L P
Sbjct  233   WTISELLKTPEILNKATEELNKVIGKERWVEEKDMINLPYINAIAKETMRLHPVAPMLVP  292

Query  1185  HYSIEDCIVAGYEVPRGTTVLINVWSIGRNSKYWDNANEFCPERFLEKD-VDIKGQDFAL  1361
               + EDC VAGY++ +GT VL+NVW+IGR+   W N + F P+RF+E + +D+KG+DF L
Sbjct  293   RMAREDCQVAGYDIAKGTRVLVNVWTIGRDQPVWKNPHAFDPDRFMENNCIDVKGEDFEL  352

Query  1362  LPFGSGRRKCPGYSLGMKVVRTTLANLLHGFKWKLDGDLKPKDISMDEAYGLTTHPKFPL  1541
             LPFGSGRR CPGYSLG+KV+ +TLANLLHGF WKL GD++ +D++M+E++GL+T  K+PL
Sbjct  353   LPFGSGRRMCPGYSLGLKVILSTLANLLHGFNWKLPGDMEKEDLNMEESFGLSTPKKYPL  412

Query  1542  SYTIEPRLPTH  1574
                 EPRLP H
Sbjct  413   DAVAEPRLPPH  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4649561693112