BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77862_g1_i1 len=1370 path=[1348:0-1369]

Length=1370
                                                                      Score     E

ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    430   4e-144   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    419   1e-139   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    411   1e-136   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    409   6e-136   
ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    402   5e-133   
ref|XP_002884670.1|  exopolygalacturonase                               402   1e-132   
gb|ADK92878.1|  polygalacturonase                                       398   1e-131   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    397   3e-131   
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    399   2e-130   
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    397   4e-130   
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    390   4e-128   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    389   5e-128   
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g             388   5e-128   
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    387   1e-127   Vitis vinifera
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    386   4e-127   Vitis vinifera
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    388   4e-127   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    387   1e-126   
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    385   3e-126   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    382   3e-125   Vitis vinifera
emb|CBI22050.3|  unnamed protein product                                382   3e-125   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             385   7e-125   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    380   2e-124   
ref|XP_002862616.1|  polygalacturonase                                  381   2e-124   
ref|XP_002885005.1|  polygalacturonase                                  381   3e-124   
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             380   7e-124   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               378   1e-123   
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      377   2e-123   
emb|CAA51692.1|  exopolygalacturonase                                   379   2e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CBI28390.3|  unnamed protein product                                379   2e-123   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    376   7e-123   
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    377   9e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CAA11160.1|  polygalacturonase                                      377   9e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32525.1|  polygalacturonase; pectinase                            377   9e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CAA51033.1|  exopolygalacturonase                                   375   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049259.1|  Polygalacturonase                                  373   1e-121   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               371   3e-121   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               371   3e-121   
ref|NP_187442.1|  polygalacturonase-like protein                        373   3e-121   Arabidopsis thaliana [mouse-ear cress]
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     371   4e-121   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               370   7e-121   
emb|CDX80531.1|  BnaC07g29130D                                          371   8e-121   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               370   8e-121   
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               370   1e-120   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    369   2e-120   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               371   4e-120   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    368   6e-120   
emb|CDX74027.1|  BnaA03g30200D                                          369   8e-120   
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    369   8e-120   
emb|CDY07972.1|  BnaC03g35510D                                          368   1e-119   
gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                     365   2e-119   
emb|CBI22052.3|  unnamed protein product                                386   3e-119   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               366   3e-119   
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               366   3e-119   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               366   3e-119   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     367   1e-118   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    364   2e-118   
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    364   3e-118   Gossypium barbadense [Egyptian cotton]
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    367   5e-118   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    363   7e-118   Vitis vinifera
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     362   7e-118   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    362   2e-117   Gossypium hirsutum [American cotton]
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               365   3e-117   
emb|CAN65676.1|  hypothetical protein VITISV_002011                     363   1e-115   Vitis vinifera
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               358   2e-115   
ref|XP_010112808.1|  hypothetical protein L484_020040                   356   2e-115   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               356   3e-115   
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             356   3e-115   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               356   4e-115   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               355   4e-115   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  355   5e-115   Ricinus communis
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               355   6e-115   
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               355   6e-115   
gb|ADC53480.1|  polygalacturonase                                       355   1e-114   Gossypium hirsutum [American cotton]
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    358   1e-114   
dbj|BAA89479.1|  polygalacturonase                                      353   3e-114   Salix gilgiana
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    353   5e-114   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               353   6e-114   
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               352   7e-114   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               352   1e-113   
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  352   1e-113   
ref|XP_010093135.1|  hypothetical protein L484_009327                   352   2e-113   
dbj|BAA89478.1|  polygalacturonase                                      351   2e-113   Salix gilgiana
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               351   2e-113   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    349   3e-113   Oenothera organensis
dbj|BAA89476.1|  polygalacturonase                                      350   4e-113   Salix gilgiana
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             349   9e-113   
ref|XP_002526191.1|  Polygalacturonase precursor, putative              348   2e-112   Ricinus communis
emb|CDP04350.1|  unnamed protein product                                348   3e-112   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             348   3e-112   
ref|XP_010112809.1|  hypothetical protein L484_020041                   348   3e-112   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               348   4e-112   
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               347   7e-112   
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               347   1e-111   
dbj|BAA89477.1|  polygalacturonase                                      347   1e-111   Salix gilgiana
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               347   2e-111   
ref|XP_010112811.1|  hypothetical protein L484_020043                   346   2e-111   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             346   2e-111   
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               345   3e-111   
emb|CDP04343.1|  unnamed protein product                                345   4e-111   
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               345   4e-111   
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               345   4e-111   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               345   4e-111   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               345   8e-111   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               344   1e-110   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               343   2e-110   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               343   4e-110   
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  343   4e-110   
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               343   5e-110   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               342   1e-109   
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               341   2e-109   
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               340   4e-109   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             342   4e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               340   4e-109   
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       340   7e-109   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  339   9e-109   
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  338   1e-108   
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               338   2e-108   
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   338   2e-108   
emb|CDP18013.1|  unnamed protein product                                338   3e-108   
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    337   3e-108
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  337   4e-108   
gb|AFK41055.1|  unknown                                                 337   6e-108   
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  337   6e-108   
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       337   1e-107   
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  336   1e-107   
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    336   2e-107
emb|CDY28013.1|  BnaC05g44150D                                          339   2e-107   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    335   4e-107   Nicotiana tabacum [American tobacco]
emb|CDP04348.1|  unnamed protein product                                335   6e-107   
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    335   6e-107   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  335   7e-107   
emb|CAA50335.1|  polygalacturonase                                      333   1e-106   Nicotiana tabacum [American tobacco]
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  334   1e-106   
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               335   2e-106   
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    332   2e-106   
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          334   2e-106   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    333   2e-106   
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               333   2e-106   
dbj|BAH20364.1|  AT3G14040                                              328   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  333   8e-106   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  332   8e-106   
ref|XP_010112807.1|  hypothetical protein L484_020039                   332   1e-105   
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  332   1e-105   
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               331   1e-105   
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    330   1e-105   Platanus x hispanica [London plane tree]
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               331   1e-105   
ref|XP_004491599.1|  PREDICTED: polygalacturonase-like                  331   2e-105   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             330   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               331   3e-105   
emb|CDY35969.1|  BnaA05g29810D                                          334   3e-105   
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               331   3e-105   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               330   5e-105   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  330   6e-105   
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  330   6e-105   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       330   6e-105   
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               330   1e-104   
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               329   2e-104   
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               328   3e-104   
ref|NP_187441.1|  polygalacturonase-like protein                        328   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  328   3e-104   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               328   3e-104   
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               328   3e-104   
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             327   4e-104   
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    325   7e-104   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             327   8e-104   
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               326   1e-103   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  326   1e-103   
dbj|BAK05779.1|  predicted protein                                      326   2e-103   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  325   2e-103   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  326   2e-103   
gb|ADP09681.1|  polygalacturonase                                       326   3e-103   
gb|AHL24657.1|  Sal k 6.01 allergen                                     324   3e-103   
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    330   3e-103   
ref|XP_003560585.2|  PREDICTED: exopolygalacturonase-like               325   4e-103   
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  325   5e-103   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               325   6e-103   
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  324   8e-103   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    324   8e-103   
ref|XP_002884668.1|  polygalacturonase 3                                324   8e-103   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  323   9e-103   
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               324   9e-103   
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  323   1e-102   
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    324   1e-102   
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  324   1e-102   
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  324   1e-102   
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  323   1e-102   
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  324   1e-102   
emb|CDY22137.1|  BnaC01g39640D                                          323   1e-102   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  323   1e-102   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  323   2e-102   
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               323   2e-102   
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          323   3e-102   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  322   4e-102   
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    322   5e-102   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               322   6e-102   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       322   6e-102   
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               322   6e-102   
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  321   7e-102   
gb|KHN24677.1|  Polygalacturonase                                       321   9e-102   
gb|KHN15656.1|  Polygalacturonase                                       320   9e-102   
ref|NP_199625.1|  putative polygalacturonase / pectinase                321   9e-102   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187439.1|  polygalacturonase-like protein                        321   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               322   1e-101   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  321   1e-101   
emb|CAA05892.1|  polygalacturonase                                      321   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|EMT33862.1|  putative Exopolygalacturonase                           321   2e-101   
gb|AAO24261.1|  putative pollen polygalacturonase                       320   2e-101   Turnera subulata [white alder]
gb|KHN10402.1|  Polygalacturonase                                       319   2e-101   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     340   2e-101   Vitis vinifera
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             320   2e-101   
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             320   2e-101   
gb|KHN46909.1|  Polygalacturonase                                       320   3e-101   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             320   3e-101   
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               321   4e-101   
ref|XP_010026119.1|  PREDICTED: exopolygalacturonase-like               320   4e-101   
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             319   5e-101   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             319   6e-101   
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             319   6e-101   
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          318   6e-101   
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             319   7e-101   
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               322   7e-101   
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       318   8e-101   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  319   8e-101   
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               322   8e-101   
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    320   9e-101   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               319   1e-100   
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          319   1e-100   
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             318   1e-100   
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               318   2e-100   
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  318   2e-100   
gb|ABN13878.1|  polygalacturonase                                       317   3e-100   
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  318   3e-100   
emb|CDY07974.1|  BnaC03g35490D                                          317   3e-100   
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               317   3e-100   
gb|ABG38468.1|  pollen-expressed protein MF9c                           317   3e-100   Brassica oleracea
gb|ABL63521.1|  pollen-specific protein MF9l                            317   3e-100   Brassica oleracea var. alboglabra
gb|ABY21306.1|  pollen allergen Pla o 2                                 317   3e-100   Platanus orientalis
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  317   4e-100   
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    317   4e-100   
ref|XP_004292314.1|  PREDICTED: exopolygalacturonase-like               318   5e-100   
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             318   5e-100   Populus trichocarpa [western balsam poplar]
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             316   6e-100   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               317   6e-100   
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               317   8e-100   
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    317   8e-100   Vitis vinifera
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       318   8e-100   
emb|CDY54512.1|  BnaC07g49180D                                          316   9e-100   
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             317   9e-100   Elaeis guineensis
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               318   1e-99    
ref|NP_187440.1|  polygalacturonase-like protein                        315   2e-99    Arabidopsis thaliana [mouse-ear cress]
gb|ABE77145.1|  putative polygalacturonase                              315   3e-99    Fragaria x ananassa
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                315   3e-99    
gb|ABR26683.1|  polygalacturonase                                       315   3e-99    Fragaria chiloensis
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                315   3e-99    
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    314   4e-99    
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  314   7e-99    
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  314   7e-99    
ref|XP_006595658.1|  PREDICTED: polygalacturonase-like isoform X2       313   2e-98    
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                313   2e-98    
emb|CDX86325.1|  BnaA06g30420D                                          312   2e-98    
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative    313   2e-98    
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                313   2e-98    
gb|AAP37458.1|  polygalacturonase                                       312   3e-98    Fragaria x ananassa
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             311   3e-98    
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         312   3e-98    
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               312   4e-98    
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             312   4e-98    
ref|XP_010652203.1|  PREDICTED: exopolygalacturonase                    312   4e-98    
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             313   5e-98    
ref|XP_002437276.1|  hypothetical protein SORBIDRAFT_10g024020          312   5e-98    Sorghum bicolor [broomcorn]
emb|CBI36886.3|  unnamed protein product                                313   5e-98    
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                311   7e-98    
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         312   7e-98    
ref|XP_002870065.1|  glycoside hydrolase family 28 protein              312   7e-98    
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  311   7e-98    
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       311   8e-98    
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  311   9e-98    
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               310   1e-97    
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               311   1e-97    
ref|XP_006656242.1|  PREDICTED: exopolygalacturonase-like               311   2e-97    
emb|CDY05701.1|  BnaC02g38360D                                          310   2e-97    
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  310   2e-97    
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         310   2e-97    
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  311   2e-97    
gb|KFK28496.1|  hypothetical protein AALP_AA7G003400                    311   2e-97    
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               310   2e-97    
ref|XP_003595656.1|  Polygalactorunase PG11                             310   2e-97    
ref|XP_010434565.1|  PREDICTED: exopolygalacturonase-like               310   3e-97    
emb|CAA72003.1|  polygalacturonase                                      309   5e-97    
ref|XP_010064300.1|  PREDICTED: exopolygalacturonase-like               308   7e-97    
ref|XP_009400098.1|  PREDICTED: exopolygalacturonase-like               311   8e-97    
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               310   8e-97    
emb|CDX90415.1|  BnaA03g43660D                                          309   1e-96    
emb|CDY01524.1|  BnaC07g35140D                                          308   1e-96    
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  314   1e-96    
ref|XP_010938370.1|  PREDICTED: exopolygalacturonase-like               308   1e-96    
gb|AAO62938.1|  polygalactorunase PG11 precursor                        308   2e-96    
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    308   2e-96    
gb|ACP74159.1|  putative polygalacturonase                              307   2e-96    
ref|XP_004144956.1|  PREDICTED: exopolygalacturonase-like               308   2e-96    
gb|AES65915.2|  polygalacturonase 11c, putative                         308   3e-96    
ref|XP_004967187.1|  PREDICTED: polygalacturonase-like                  307   3e-96    
ref|XP_006285299.1|  hypothetical protein CARUB_v10006680mg             308   3e-96    
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                  307   3e-96    
ref|XP_010439893.1|  PREDICTED: exopolygalacturonase                    307   4e-96    
ref|XP_007050989.1|  Polygalacturonase 4, putative                      308   4e-96    
ref|XP_002879431.1|  hypothetical protein ARALYDRAFT_902380             307   4e-96    
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  306   5e-96    
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    306   1e-95    
ref|XP_006845393.1|  hypothetical protein AMTR_s00019p00058670          305   1e-95    
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               306   1e-95    
sp|Q40312.1|PGLR_MEDSA  RecName: Full=Polygalacturonase; Short=PG...    306   1e-95    
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                  306   1e-95    
ref|NP_193552.1|  glycoside hydrolase family 28 protein / polygal...    306   1e-95    
emb|CDY35967.1|  BnaA05g29830D                                          301   2e-95    
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               305   2e-95    
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               305   2e-95    
emb|CDY22140.1|  BnaC01g39610D                                          305   3e-95    
gb|KHN40047.1|  Polygalacturonase                                       304   3e-95    
gb|AFK35534.1|  unknown                                                 305   3e-95    
ref|XP_002529095.1|  Polygalacturonase precursor, putative              304   3e-95    
ref|XP_003518573.1|  PREDICTED: polygalacturonase-like                  304   4e-95    
gb|KHN43962.1|  Polygalacturonase                                       304   4e-95    
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       304   5e-95    
gb|AHL24656.1|  Ole e 13.01 allergen                                    303   5e-95    
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       302   5e-95    
ref|XP_009136909.1|  PREDICTED: exopolygalacturonase                    305   5e-95    
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  307   5e-95    
ref|XP_003595659.1|  Polygalactorunase PG11                             304   7e-95    
ref|XP_010449495.1|  PREDICTED: exopolygalacturonase-like               304   7e-95    
ref|NP_001152243.1|  polygalacturonase precursor                        304   7e-95    
gb|AIL01321.1|  group 13 allergen Sor h 13.02                           304   7e-95    
ref|XP_009350286.1|  PREDICTED: exopolygalacturonase-like               304   8e-95    
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  303   8e-95    
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    326   9e-95    
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     303   1e-94    
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               303   1e-94    
ref|XP_010099972.1|  hypothetical protein L484_014009                   303   1e-94    
emb|CBI28399.3|  unnamed protein product                                301   2e-94    
gb|ACN85236.1|  polygalacturonase precursor                             303   2e-94    
emb|CAN69218.1|  hypothetical protein VITISV_012014                     315   3e-94    
ref|XP_006656243.1|  PREDICTED: exopolygalacturonase-like               303   3e-94    
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                301   3e-94    
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           303   3e-94    
ref|XP_009141290.1|  PREDICTED: exopolygalacturonase-like               302   4e-94    
gb|KGN44972.1|  hypothetical protein Csa_7G404800                       302   5e-94    
ref|XP_010469513.1|  PREDICTED: exopolygalacturonase-like               301   6e-94    
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          301   8e-94    
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               300   9e-94    
gb|ABD79098.1|  Zea m 13 allergen                                       300   2e-93    
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  310   2e-93    
ref|XP_006414139.1|  hypothetical protein EUTSA_v10027030mg             300   2e-93    
gb|KDP24950.1|  hypothetical protein JCGZ_24417                         300   2e-93    
emb|CAA40910.1|  polygalacturonase                                      300   2e-93    
ref|NP_001105432.1|  exopolygalacturonase precursor                     300   2e-93    
gb|KDO58458.1|  hypothetical protein CISIN_1g045893mg                   297   3e-93    
ref|NP_001105862.1|  exopolygalacturonase precursor                     300   3e-93    
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               299   4e-93    
ref|NP_001058060.1|  Os06g0611400                                       300   5e-93    
ref|XP_009771846.1|  PREDICTED: exopolygalacturonase clone GBGE184      299   5e-93    
gb|KFK37211.1|  hypothetical protein AALP_AA4G228400                    298   5e-93    
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             299   5e-93    
ref|XP_008451547.1|  PREDICTED: exopolygalacturonase clone GBGE184      300   6e-93    
ref|XP_008649072.1|  PREDICTED: exopolygalacturonase-like               299   6e-93    
ref|XP_008649075.1|  PREDICTED: exopolygalacturonase-like               299   6e-93    
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       298   6e-93    
ref|NP_001057815.1|  Os06g0545400                                       299   7e-93    
gb|EAZ01276.1|  hypothetical protein OsI_23299                          299   7e-93    
gb|AAP42648.1|  polygalacturonase                                       298   7e-93    
ref|XP_008364854.1|  PREDICTED: exopolygalacturonase-like               298   8e-93    
sp|P35339.1|PGLR3_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    299   8e-93    
ref|XP_006397562.1|  hypothetical protein EUTSA_v10001486mg             298   8e-93    
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    300   8e-93    
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               299   8e-93    
emb|CDY23765.1|  BnaC04g43570D                                          298   8e-93    
emb|CAA40851.1|  polygalacturonase                                      298   9e-93    
emb|CAA46680.1|  polygalacturonase                                      298   1e-92    
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    298   1e-92    
ref|XP_008649074.1|  PREDICTED: exopolygalacturonase                    298   1e-92    
gb|KGN66774.1|  hypothetical protein Csa_1G689640                       297   1e-92    
gb|EAZ01647.1|  hypothetical protein OsI_23683                          298   2e-92    
gb|ABD79097.1|  Zea m 13 allergen                                       298   2e-92    
ref|XP_010509923.1|  PREDICTED: exopolygalacturonase-like               297   2e-92    
ref|XP_006858747.1|  hypothetical protein AMTR_s00066p00135670          297   2e-92    
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               297   2e-92    
ref|XP_010413907.1|  PREDICTED: exopolygalacturonase-like               296   3e-92    
ref|XP_011097018.1|  PREDICTED: polygalacturonase-like                  296   3e-92    
ref|XP_010317352.1|  PREDICTED: exopolygalacturonase-like               296   3e-92    
ref|XP_009142978.1|  PREDICTED: polygalacturonase                       296   3e-92    
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    296   4e-92    
sp|P35338.1|PGLR2_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    297   4e-92    
emb|CDY17902.1|  BnaC04g03170D                                          296   5e-92    
ref|XP_006838947.1|  hypothetical protein AMTR_s00002p00270640          295   6e-92    
ref|XP_006353088.1|  PREDICTED: exopolygalacturonase-like               295   7e-92    
ref|XP_002437275.1|  hypothetical protein SORBIDRAFT_10g024010          296   8e-92    
emb|CDP17107.1|  unnamed protein product                                296   8e-92    
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               296   8e-92    
ref|XP_006295486.1|  hypothetical protein CARUB_v10024590mg             296   8e-92    
emb|CBI22963.3|  unnamed protein product                                296   9e-92    
gb|KCW80886.1|  hypothetical protein EUGRSUZ_C02249                     296   1e-91    
ref|XP_010248093.1|  PREDICTED: exopolygalacturonase-like               294   1e-91    
gb|EAZ37619.1|  hypothetical protein OsJ_21954                          296   1e-91    
ref|XP_008460791.1|  PREDICTED: polygalacturonase-like                  295   1e-91    
emb|CDP18456.1|  unnamed protein product                                295   2e-91    
ref|XP_004134494.1|  PREDICTED: exopolygalacturonase-like               296   2e-91    
emb|CDX88444.1|  BnaC06g38880D                                          295   2e-91    
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               295   2e-91    
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             295   2e-91    
emb|CDY23407.1|  BnaC04g49350D                                          294   2e-91    
ref|XP_002301489.1|  Exopolygalacturonase clone GBGE184 precursor...    295   3e-91    
ref|XP_004986318.1|  PREDICTED: exopolygalacturonase-like               295   4e-91    
ref|XP_010522804.1|  PREDICTED: exopolygalacturonase clone GBGE18...    295   4e-91    
gb|KGN43436.1|  Polygalacturonase                                       292   4e-91    
ref|XP_008788254.1|  PREDICTED: polygalacturonase-like                  293   4e-91    
ref|XP_009417454.1|  PREDICTED: exopolygalacturonase-like               294   4e-91    
ref|XP_007202949.1|  hypothetical protein PRUPE_ppa016502mg             294   5e-91    
ref|XP_008383110.1|  PREDICTED: exopolygalacturonase-like               293   6e-91    
gb|KDP27317.1|  hypothetical protein JCGZ_21001                         294   6e-91    
ref|XP_004288736.1|  PREDICTED: polygalacturonase-like                  293   6e-91    
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    292   7e-91    
ref|XP_004495937.1|  PREDICTED: exopolygalacturonase clone GBGE18...    293   8e-91    
ref|XP_006296295.1|  hypothetical protein CARUB_v10025465mg             293   1e-90    
ref|XP_004289111.1|  PREDICTED: exopolygalacturonase-like               293   1e-90    
ref|XP_002880074.1|  hypothetical protein ARALYDRAFT_903793             292   1e-90    
ref|XP_006372692.1|  hypothetical protein POPTR_0017s03930g             292   1e-90    
ref|XP_009379685.1|  PREDICTED: exopolygalacturonase-like               293   1e-90    
gb|ACN85300.1|  exopolygalacturonase precursor                          293   1e-90    
ref|NP_001284460.1|  polygalacturonase-like precursor                   293   1e-90    
gb|AAX45476.1|  polygalacturonase                                       293   1e-90    
ref|XP_010253373.1|  PREDICTED: exopolygalacturonase-like               290   2e-90    
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               292   2e-90    
ref|XP_002529094.1|  Polygalacturonase precursor, putative              292   2e-90    
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               293   2e-90    
ref|XP_009602001.1|  PREDICTED: polygalacturonase-like                  292   2e-90    
ref|XP_009367790.1|  PREDICTED: exopolygalacturonase-like               292   2e-90    
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    292   2e-90    
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             292   2e-90    
ref|XP_008349920.1|  PREDICTED: exopolygalacturonase-like               291   2e-90    
ref|XP_010506294.1|  PREDICTED: polygalacturonase-like                  291   2e-90    
ref|XP_004974598.1|  PREDICTED: exopolygalacturonase-like               291   2e-90    
ref|NP_181917.1|  putative polygalacturonase /pectinase                 291   2e-90    
ref|NP_180874.1|  protein NIMNA                                         300   3e-90    
ref|XP_002301488.2|  hypothetical protein POPTR_0002s20330g             292   3e-90    
ref|XP_011082446.1|  PREDICTED: exopolygalacturonase clone GBGE18...    292   3e-90    
ref|XP_009142235.1|  PREDICTED: polygalacturonase-like                  291   3e-90    
ref|XP_008366452.1|  PREDICTED: exopolygalacturonase-like               291   3e-90    
ref|XP_009597284.1|  PREDICTED: exopolygalacturonase clone GBGE18...    291   3e-90    
ref|NP_001141808.1|  uncharacterized protein LOC100273946 precursor     292   4e-90    
emb|CDP06168.1|  unnamed protein product                                291   4e-90    
ref|XP_002529090.1|  Polygalacturonase precursor, putative              291   6e-90    
ref|XP_008660316.1|  PREDICTED: exopolygalacturonase-like               290   6e-90    
ref|XP_010064302.1|  PREDICTED: exopolygalacturonase-like               291   6e-90    
ref|XP_008226319.1|  PREDICTED: exopolygalacturonase                    290   7e-90    
ref|XP_010508362.1|  PREDICTED: polygalacturonase-like                  290   7e-90    
emb|CAA16789.1|  polygalacturonase-like protein                         289   7e-90    
emb|CDY30445.1|  BnaA04g25460D                                          290   8e-90    
gb|AFW76314.1|  hypothetical protein ZEAMMB73_313945                    291   9e-90    
ref|XP_008231357.1|  PREDICTED: exopolygalacturonase-like               287   9e-90    
ref|XP_008226942.1|  PREDICTED: polygalacturonase-like                  291   9e-90    
ref|XP_010649600.1|  PREDICTED: exopolygalacturonase-like               292   9e-90    
ref|XP_006447721.1|  hypothetical protein CICLE_v10017883mg             288   1e-89    
ref|XP_006845391.1|  hypothetical protein AMTR_s00019p00057300          287   1e-89    
ref|XP_009142232.1|  PREDICTED: polygalacturonase-like                  290   1e-89    
emb|CDY52447.1|  BnaA07g39240D                                          290   1e-89    
ref|XP_007140804.1|  hypothetical protein PHAVU_008G143500g             290   2e-89    
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                289   2e-89    
ref|XP_002529089.1|  Polygalacturonase precursor, putative              289   2e-89    
ref|XP_009411633.1|  PREDICTED: exopolygalacturonase-like               290   2e-89    
emb|CDX84700.1|  BnaA03g15300D                                          290   2e-89    
gb|KDO51597.1|  hypothetical protein CISIN_1g046411mg                   289   2e-89    
ref|XP_009132913.1|  PREDICTED: exopolygalacturonase-like               289   3e-89    
ref|XP_006839042.1|  hypothetical protein AMTR_s00090p00047840          288   3e-89    
ref|XP_006410452.1|  hypothetical protein EUTSA_v10017763mg             289   4e-89    
ref|XP_008438909.1|  PREDICTED: exopolygalacturonase-like               290   4e-89    
ref|XP_008243063.1|  PREDICTED: polygalacturonase                       288   4e-89    
ref|XP_008788256.1|  PREDICTED: polygalacturonase-like                  288   4e-89    
ref|XP_003517970.1|  PREDICTED: polygalacturonase-like                  288   4e-89    
ref|XP_011085138.1|  PREDICTED: polygalacturonase                       288   5e-89    
ref|XP_008678508.1|  PREDICTED: exopolygalacturonase-like               288   6e-89    
ref|XP_008243113.1|  PREDICTED: polygalacturonase                       288   9e-89    
ref|XP_011015579.1|  PREDICTED: exopolygalacturonase clone GBGE184      291   1e-88    
ref|XP_006493146.1|  PREDICTED: polygalacturonase-like                  287   1e-88    
ref|XP_006493147.1|  PREDICTED: polygalacturonase-like                  287   1e-88    
ref|XP_009766215.1|  PREDICTED: polygalacturonase-like                  287   1e-88    
ref|XP_009775637.1|  PREDICTED: polygalacturonase-like                  287   2e-88    
ref|XP_010667119.1|  PREDICTED: exopolygalacturonase-like               288   2e-88    
ref|XP_008813782.1|  PREDICTED: polygalacturonase-like                  286   2e-88    
gb|KCW66880.1|  hypothetical protein EUGRSUZ_F00634                     286   2e-88    
gb|KDO51598.1|  hypothetical protein CISIN_1g041973mg                   287   2e-88    
emb|CDP04342.1|  unnamed protein product                                283   2e-88    
gb|EAZ01274.1|  hypothetical protein OsI_23298                          286   2e-88    
ref|XP_008465729.1|  PREDICTED: polygalacturonase-like                  286   2e-88    
ref|XP_002444237.1|  hypothetical protein SORBIDRAFT_07g016970          286   3e-88    
gb|EYU42229.1|  hypothetical protein MIMGU_mgv1a007314mg                287   3e-88    
emb|CDX79512.1|  BnaC03g18480D                                          286   3e-88    
ref|XP_006295606.1|  hypothetical protein CARUB_v10024718mg             286   3e-88    
ref|XP_004161670.1|  PREDICTED: polygalacturonase-like                  288   3e-88    
ref|XP_010517967.1|  PREDICTED: polygalacturonase-like                  285   4e-88    
ref|XP_006295779.1|  hypothetical protein CARUB_v10024902mg             286   4e-88    
ref|XP_004142600.1|  PREDICTED: polygalacturonase-like                  286   4e-88    



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   430 bits (1105),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 278/389 (71%), Gaps = 7/389 (2%)
 Frame = +1

Query  73    AAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAG  249
             A   C LL   VT +  + FDV  +GAK +G  DDSKA   AW  AC A  A+T+  A G
Sbjct  11    AYHLCFLL--LVTQVQGSNFDVKAYGAKANGMTDDSKAINSAWKDACAAKEASTVVIAKG  68

Query  250   KFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDG  426
              +M GP+ F+GPC  P+T+  Q   L A  DP   +    WV F  V G+T++GG IFDG
Sbjct  69    NYMVGPLKFEGPCTAPVTVKVQGT-LKAPADPKRLRDD--WVAFRNVEGLTVSGGGIFDG  125

Query  427   NGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERY  606
              GA  W++ +C K G    LP NLQF  +T  ++ G+T+ NSK FH+ I +  +VT +  
Sbjct  126   QGAIAWSVNNCAKTGKCNSLPTNLQFTKLTNSKIEGITSLNSKLFHMNILNCNNVTFQNI  185

Query  607   TVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAI  786
              ++AP NS NTDG+HIG+++ V+I GATIKTGDDCVSLGDG Q ++VEKVTCGPGHG++I
Sbjct  186   VINAPKNSLNTDGIHIGRSTMVNITGATIKTGDDCVSLGDGCQQINVEKVTCGPGHGISI  245

Query  787   GSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPIL  966
             GSLG+Y +E+PV+GVTV+NCTLTNT NG RIKTWP SP G A+N++FEDIIMNNVSNPIL
Sbjct  246   GSLGRYHDEQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPIL  305

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQ+YCP+N C A + S+VK+S + F+ I+GTS++++A+KI CS  +PCQ V + DINL+
Sbjct  306   IDQEYCPYNNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVFVEDINLV  365

Query  1147  YKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             Y GK+GS+ S C NVKP + GKV PA C+
Sbjct  366   YNGKEGSSTSLCANVKPQVSGKVFPATCT  394



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/397 (50%), Positives = 278/397 (70%), Gaps = 4/397 (1%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN  231
             M S  I    F + L SF     AA FD+ K+GAK DGK DDS+A   AW  AC +   +
Sbjct  1     MGSKFILGTTFFLFLISFSIKARAADFDIKKYGAKADGKTDDSQAINRAWKEACASTTPS  60

Query  232   TI-TAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
             T+  A G +MAGP+ FQGPCK P++I  +   L A  +P   K   GWV F  + G+T++
Sbjct  61    TVLIAKGNYMAGPVKFQGPCKAPVSIRVEGT-LQAPAEPEKLKSQDGWVVFRNIDGLTVS  119

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG  FDG G+  W+  DC K G    LP N++F+ +T   +  +T+ NSK FH+ + + K
Sbjct  120   GGGTFDGQGSIAWSKNDCAKTGKCNSLPINIRFSGLTNSHIQNITSSNSKLFHINVLNCK  179

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             +VT++   + APG S NTDG+HIG++S ++I GA IKTGDDC+SLGDG Q +++EKV CG
Sbjct  180   NVTLQHVIITAPGESLNTDGIHIGRSSNINITGAEIKTGDDCISLGDGSQQINIEKVKCG  239

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG++IGSLG+Y +E+PV GVTV+NCT++NT NG R+KTWP SP G A+++HFEDIIM 
Sbjct  240   PGHGISIGSLGRYHDEQPVTGVTVRNCTISNTSNGVRVKTWPASPNGVASDLHFEDIIME  299

Query  946   NV-SNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
             NV ++P+LIDQ+YCP  QC+A + SKVK+S + FKNI+GTS+  + +K+ CS  +PCQ V
Sbjct  300   NVKTSPVLIDQEYCPNGQCQAKIPSKVKISNVSFKNIRGTSADPVVVKLACSKGIPCQNV  359

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              ++DI+L Y GK+G+A S CTNVKP++ G++ P AC+
Sbjct  360   QISDIHLTYNGKNGAATSVCTNVKPTMTGQIFPPACA  396



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   411 bits (1057),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 277/400 (69%), Gaps = 10/400 (3%)
 Frame = +1

Query  61    ILIQAAWFCILL---ASFVTG----LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKA  219
             ++ +AA F  LL   A+  TG    +  A  DV KFGAK DG++DDS+    AW  AC +
Sbjct  5     MMARAAIFLYLLSLAAAMRTGGVSMIGQAEIDVRKFGAKADGRSDDSQIIVNAWNKACTS  64

Query  220   PGANTIT-AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIG  396
             P  +T+  + G ++AGP+ FQGPCK  + +  +   + A  D   FK  G WV F  + G
Sbjct  65    PSPSTVVISKGSYLAGPLKFQGPCKADVNLKVEGA-VKAPADLNKFKSQGSWVLFQNIDG  123

Query  397   VTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRI  573
             +T++GG  FDG GA  W   +C + G    LP NLQF ++    +  +T+ NSK FH+ +
Sbjct  124   LTLSGGGSFDGQGAAAWKENNCAQTGKCNSLPTNLQFTSINNSHVQDITSLNSKLFHVEL  183

Query  574   GSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEK  753
              +  +VT++  T+DAP +S NTDG+H+G++  V+IIGA I+TGDDCVSLGDG Q VH+E 
Sbjct  184   LNCNNVTLQHVTIDAPEDSLNTDGIHVGRSMGVNIIGADIRTGDDCVSLGDGSQQVHIEG  243

Query  754   VTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFED  933
             VTCGPGHG+++GSLGKY +E+PV+GVTV+NCTLTNT+NG R+KTWP SP G A+ MHFED
Sbjct  244   VTCGPGHGISVGSLGKYHDEQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFED  303

Query  934   IIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPC  1113
             I +NNVS PILIDQ YCP+N C+  + SKVK+S + F+NI+GTS++ +A+K+ CS  VPC
Sbjct  304   ITVNNVSTPILIDQNYCPYNNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPC  363

Query  1114  QGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             Q V + DINL Y G++G+A S+C NVKP+I GK+    C+
Sbjct  364   QKVELADINLRYNGRNGTATSQCENVKPTIAGKLSLPICA  403



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   409 bits (1051),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 194/393 (49%), Positives = 276/393 (70%), Gaps = 5/393 (1%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-  240
             +++A +F  L+A F+    AA  D+ KFGAK DGK DDS+A   AW  AC +   +T+  
Sbjct  6     VLRATFFLFLVALFIKA-KAADIDIKKFGAKADGKTDDSQAINSAWKEACTSATPSTVVI  64

Query  241   AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-I  417
             A G +M GP+ FQGPCK P+++  +   L A  +P   K   GWV F  +  ++++GG  
Sbjct  65    AKGNYMVGPVKFQGPCKAPVSLRVEGT-LQAPAEPEKLKSQDGWVIFQNIDALSVSGGGT  123

Query  418   FDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTI  597
             FDG G+  W+  DC K G    LP +L+   +T   +  +T+ NSK FH+ I + K+VT+
Sbjct  124   FDGQGSIAWSKNDCAKTGKCNSLPISLRLTGLTNAHIQDITSTNSKLFHMNILNCKNVTL  183

Query  598   ERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHG  777
             +  T+ APG S NTDG+HIG+++ ++I GA I+TGDDCVS+GDG Q +++EKVTCGPGHG
Sbjct  184   QHVTIKAPGESLNTDGIHIGRSTNINITGAEIQTGDDCVSIGDGSQQINIEKVTCGPGHG  243

Query  778   LAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNV-S  954
             ++IGSLG+Y +E+PV GVTV+NCT+ NT NG R+KTWP SP G A+++HFEDIIM NV +
Sbjct  244   ISIGSLGRYHDEQPVRGVTVRNCTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMENVTT  303

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             +P+LIDQ+YCP  QC+A + S+VK+S + FKNI+GTS+  +A+K+ CS  +PCQ V ++D
Sbjct  304   SPVLIDQEYCPNGQCQAKMPSRVKISNVSFKNIRGTSADPVAVKLACSKGIPCQNVEISD  363

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             INL   GK+G+  S C+NV P++ GKV+P ACS
Sbjct  364   INLTCNGKNGTCTSVCSNVNPTVTGKVIPPACS  396



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   402 bits (1032),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 264/370 (71%), Gaps = 5/370 (1%)
 Frame = +1

Query  145   FGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPITIDAQKM  321
              GAKGDG+ DD+ AF  AW  AC A G +TIT   G+++   I F GPCKGP+T++    
Sbjct  35    LGAKGDGRTDDTAAFAAAWKQACGATGKSTITVGKGEYLVTRIDFNGPCKGPVTVELLG-  93

Query  322   NLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHICPLPAN  495
             NL A  +    + HGGWV F  ++  T+NG   I DG GA  W   DC K G    LP N
Sbjct  94    NLKAPAEVTKTEAHGGWVNFGNLVDFTLNGHGSILDGQGALAWKKNDCAKTGKCNNLPIN  153

Query  496   LQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVS  675
             ++F  +T  R+  +T+ NSK FH+ I + K++T+E   +DAP  S NTDG+HIG+++ V+
Sbjct  154   VRFTGLTNSRIRSITSSNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSNGVN  213

Query  676   IIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLT  855
             ++GA ++TGDDCVS+GDG +++ +E V CGPGHG+AIGSLG+YPNE+PV GV V++CT++
Sbjct  214   LLGAHVRTGDDCVSIGDGSENLVIENVRCGPGHGIAIGSLGRYPNEQPVRGVHVRHCTIS  273

Query  856   NTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSG  1035
             NT+NG RIKTWP SP G A+N+HFEDI+M NV  PIL+DQ+YCP+N CK G  S VK+S 
Sbjct  274   NTMNGVRIKTWPASPAGIASNLHFEDIVMENVGTPILVDQEYCPYNHCKRGSPSMVKISD  333

Query  1036  IGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKV  1215
             + FKNI+GTSS+K A+K+ CS  VPC  V ++DINL Y GKDG AVS+C NVKP + GK+
Sbjct  334   VSFKNIRGTSSTKTAVKLVCSKGVPCSKVELSDINLTYNGKDGPAVSECANVKPILSGKI  393

Query  1216  VPAACSV-HK  1242
             +PAAC+  HK
Sbjct  394   IPAACTAPHK  403



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   402 bits (1033),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 262/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DDS AF  AW  AC A G+      G+++   + F+GPCKGP+T
Sbjct  73    ASLDVKASGAKGDGKTDDSAAFMAAWKEACAA-GSTITVPKGEYLVESLEFKGPCKGPVT  131

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    NL A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  132   LELNG-NLKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKC  190

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+E   +DAP  S NTDG+HIG
Sbjct  191   NSLPINIRFTGLTNSKIKSITSTNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIG  250

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  251   RSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  310

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  311   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPYGHCKAGVPS  370

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS +  KNIKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  371   KVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  430

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  431   ILSGKLVPAACT  442



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/393 (50%), Positives = 269/393 (68%), Gaps = 7/393 (2%)
 Frame = +1

Query  61    ILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT  240
             ++ Q A    LL S +    A   DV  +G K DGK DDS+A   AW  AC A  A T+ 
Sbjct  5     LIPQVASLLFLLHSVILA-KALTLDVKHYGVKVDGKTDDSQAINKAWKDACAATNATTLR  63

Query  241   -AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI-NGG  414
                G +M   + FQGPCK P+T+D Q       P       +  WV+F+ + G+T+  GG
Sbjct  64    IGKGNYMVSKMAFQGPCKSPLTVDFQ--GTFKAPSNAKNYKNQEWVSFTNLNGLTLFGGG  121

Query  415   IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVT  594
              FDG GA  W++ +C K G    LP NL+   +T   +  +T+ +SK FH+ I + K++T
Sbjct  122   TFDGQGAVAWSINNCAKTGKCGSLPNNLRMTGLTNSIIRDITSLDSKLFHINIINCKNLT  181

Query  595   IERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGH  774
             +ER T+ AP +S NTDG+HIG+++ V+I  ATIKTGDDCVS+GDG Q +++EKVTCGPGH
Sbjct  182   LERITITAPESSLNTDGIHIGRSTGVNITSATIKTGDDCVSIGDGAQQINIEKVTCGPGH  241

Query  775   GLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVS  954
             G++IGSLG+Y +E+PV+G+TVKNCTLT+T+NG RIKTWP SP G A+NM FE+IIMNNVS
Sbjct  242   GISIGSLGRYHDEQPVVGITVKNCTLTSTMNGVRIKTWPASPSGLASNMRFENIIMNNVS  301

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             NPI+IDQQYCP++QC+A + S+VK+S + F  I+GTS++++A+K+ CS  +PCQ V + D
Sbjct  302   NPIMIDQQYCPYSQCEAKIPSRVKISDVSFSGIRGTSATQLAVKLVCSKGIPCQNVAVGD  361

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             INL Y    G A S+C NVKP + G VVPA C+
Sbjct  362   INLAY--NKGQATSQCANVKPQVRGSVVPAPCT  392



>ref|XP_011073814.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Sesamum indicum]
Length=394

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 265/388 (68%), Gaps = 3/388 (1%)
 Frame = +1

Query  79    WFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKA-PGANTITAAGKF  255
             W  +L+ + V G HAA FDV  +GAK DGK+DDSKA   AW AAC +   +N +   G +
Sbjct  5     WIWMLMMAMVAGNHAAVFDVKSYGAKADGKSDDSKAILDAWKAACNSGQASNVLIPKGTY  64

Query  256   MAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGGIFDGNGA  435
             M G +  +GPCK PITI+A K   +A  +P   +   GW+ F  +    + GG FDG G 
Sbjct  65    MVGSMIMEGPCKAPITIEANKARFVAPINPNQLRARNGWINFVGIDRFGLQGGRFDGQGE  124

Query  436   TTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVD  615
               W+  +C   G    +P NL FN +T   +  +T+ +SKQ+H+ + S K+VT     + 
Sbjct  125   LAWHQNNCVGTGKCGSMPINLSFNRITNALIHSITSYDSKQYHIDVLSCKNVTFRSIRIS  184

Query  616   APGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSL  795
             AP  S NTDG+HI ++S +++  A IKTGDDCVS+GDG Q V++EKV CGPGHG+AIGSL
Sbjct  185   APDQSLNTDGIHIVRSSGINVTEADIKTGDDCVSVGDGSQQVNIEKVKCGPGHGIAIGSL  244

Query  796   GKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSNPILID  972
             GKY NE+PV+GVTVKNCT+T+T++G R++TWP SP  G A ++HF++I+MNNVS PI ID
Sbjct  245   GKYNNEEPVVGVTVKNCTITHTMSGVRVETWPASPSEGVARDLHFQNIVMNNVSTPISID  304

Query  973   QQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK  1152
             Q+YCP+ +C   + S+VK+S + F +I+GTS+SK+A+++ CS A PC+ V +++INL Y 
Sbjct  305   QEYCPY-KCDKKVPSRVKISDVSFDDIRGTSASKVAVRLRCSSASPCENVGLSNINLAYH  363

Query  1153  GKDGSAVSKCTNVKPSIIGKVVPAACSV  1236
             G DG A S+C NVKP + G++ P AC+V
Sbjct  364   GSDGKATSECANVKPKVTGQLFPPACAV  391



>gb|KFK38239.1| hypothetical protein AALP_AA3G087400 [Arabis alpina]
Length=510

 Score =   399 bits (1024),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/371 (54%), Positives = 259/371 (70%), Gaps = 6/371 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPITID  309
              DV+  GAKGDGK DDS AFT AW  AC A G  T+   G ++   +  +GPCKGPIT++
Sbjct  132   LDVVALGAKGDGKTDDSAAFTSAWEKACAAGGTITV-PKGDYLVNSLMLKGPCKGPITME  190

Query  310   AQKMNLLALPDPF-AFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHIC  480
                 N+ A P  F   K H GW+   +V   T+NG   IFDG GA  W   DC K G   
Sbjct  191   LNG-NMKA-PTTFDQAKKHCGWIEIMKVADFTLNGNGAIFDGQGAAAWKANDCAKTGKCN  248

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++F  +T  ++IG+T+ NSK FH+ I    ++T++   +DAP  S NTDG+HIG+
Sbjct  249   NLPINIRFTGLTNAKIIGITSTNSKLFHINIHGCNNMTLQDIGIDAPPESLNTDGIHIGR  308

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             ++ V++IGA IKTGDDCVS+G G Q++ +E V CGPGHG++IGSLGKYPNE+P+ GV V+
Sbjct  309   SNGVNLIGAKIKTGDDCVSIGHGTQNLVIENVECGPGHGISIGSLGKYPNEEPLKGVVVR  368

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
              C + NT NG RIKTWPGSP G A+N+ FEDI M+NV+ PILIDQ+YCP  +CKAG+ SK
Sbjct  369   KCIIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVTTPILIDQEYCPHGKCKAGVPSK  428

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS + FKNIKGTS+SK+A+KI CS   PC  + + DINL+  GK+G AVS C N+KP 
Sbjct  429   VKLSDVTFKNIKGTSASKIAVKIICSKGCPCTNIALTDINLVSSGKEGPAVSACANMKPV  488

Query  1201  IIGKVVPAACS  1233
             + GKVVPAAC+
Sbjct  489   VSGKVVPAACT  499



>ref|XP_009147020.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
 gb|ADJ68232.1| exo-polygalacturonase [Brassica rapa subsp. oleifera]
Length=476

 Score =   397 bits (1020),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 259/371 (70%), Gaps = 4/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDG  DD+ AFT  W  AC+APG +TIT   G ++   I F GPCKGP+T 
Sbjct  100   LDVKAAGAKGDGTTDDTAAFTAVWKTACEAPGPSTITVPKGDYLVNNIEFLGPCKGPVTF  159

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHIC  480
             +    N+ A     A K + GWV F+ +   T+NG   IFDG G+  W   DC K G   
Sbjct  160   EMSG-NMKAPATVAAVKPNSGWVDFTNLADFTLNGNGAIFDGQGSLAWKANDCAKTGKCN  218

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++F  +T  ++IG+T+ NSK FH+ + + K+VT+E   +DAP  S NTDG+HIG+
Sbjct  219   SLPINIRFTGLTNSKIIGITSTNSKLFHMNVLNCKNVTLENIGIDAPPESLNTDGIHIGR  278

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V++IGA +KTGDDCVS+GDG +++ VE V CGPGHG+A+GSLG+YPNE+PV GVTV+
Sbjct  279   SVGVNLIGAKVKTGDDCVSIGDGTENLIVENVECGPGHGIAVGSLGRYPNEQPVRGVTVR  338

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
              C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS PILIDQ+YCP+  CKAG+ SK
Sbjct  339   KCLIKNTSNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPILIDQEYCPYADCKAGVPSK  398

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS + FKNIKGTS++K A+K+ CS   PC  V + +INL++ G +G AV  C N+KP 
Sbjct  399   VKLSDVTFKNIKGTSATKTAVKLICSVGTPCTNVALANINLVHNGPEGPAVGACANMKPV  458

Query  1201  IIGKVVPAACS  1233
             + G+++P AC+
Sbjct  459   LTGQMIPPACT  469



>ref|XP_010464428.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   390 bits (1003),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 191/378 (51%), Positives = 261/378 (69%), Gaps = 4/378 (1%)
 Frame = +1

Query  106   VTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGP  285
             V G   A  DV   GAK DGK DD  AF+ AW   C A G   +   G+++ G +  +GP
Sbjct  62    VPGGPKASCDVKILGAKADGKTDDCAAFSKAWTDVCAA-GGTLVVPKGEYLVGKLALKGP  120

Query  286   CKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDC  459
             CKGP+T++    NL A     A + H GW+    V   T+NG   I DG GA  W + DC
Sbjct  121   CKGPVTLELNG-NLKAPATVAANEPHAGWIEIDNVCDFTLNGNNAILDGQGALAWKVNDC  179

Query  460   GKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNT  639
              K G    LP N++   +T  +++G+T+ NSK FH+ I + K++T+E   +DAP  S NT
Sbjct  180   AKTGKCNSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNT  239

Query  640   DGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKP  819
             DG+HIG+++ V++IGA I+TGDDCVS+GDG +++ +E V CGPGHG++IGSLG YPNE+P
Sbjct  240   DGIHIGRSNGVNLIGAKIRTGDDCVSIGDGTENLLIENVVCGPGHGISIGSLGLYPNEQP  299

Query  820   VLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQC  999
             V GVTV+ CT+ NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP  +C
Sbjct  300   VRGVTVRKCTIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPHGKC  359

Query  1000  KAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSK  1179
             KAG+ S+VKLS +  KNIKGTS++K+A+K+ CS   PC  + ++DINL++ GK+G AVS 
Sbjct  360   KAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALSDINLVHNGKEGPAVSA  419

Query  1180  CTNVKPSIIGKVVPAACS  1233
             C+N+KP I GK++P AC+
Sbjct  420   CSNIKPVITGKLIPEACT  437



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   389 bits (999),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 264/386 (68%), Gaps = 5/386 (1%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGK-FMAG  264
             + L +F    +AA FDV K+GAK DGK DDS+A   AW  AC A   +T+    + ++ G
Sbjct  12    LFLVAFSLTANAADFDVRKYGAKADGKTDDSQAINKAWTDACTATSQSTVVIEKRNYLVG  71

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATT  441
             P+ F GPCK PI+I      L+A  +P   K   GWV F  V  +++ GG +FDG G   
Sbjct  72    PVRFGGPCKAPISIKVAGT-LVAPAEPEKLKSQDGWVVFQNVDNLSVFGGXVFDGQGKLA  130

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W+  D  K G    LP N++   VT   +   T+ NSK FH+ + +SK +T++R T+DAP
Sbjct  131   WSRNDFAKTGKCNSLPINIRITGVTNSHIQDKTSLNSKLFHINVINSKHLTLQRITIDAP  190

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
               S NTDG+HIG++S +++  A IKTGDDCVSLGDG Q+++VEKVTCG GHG++IGSLG+
Sbjct  191   QESLNTDGIHIGRSSYINVTDANIKTGDDCVSLGDGSQNINVEKVTCGSGHGISIGSLGR  250

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNV-SNPILIDQQ  978
             Y +E+PV GVTV+ C ++NT NG RIKTWP SP G A+++HFEDI M+NV +NP+L+DQ+
Sbjct  251   YHDEQPVQGVTVRYCQISNTTNGVRIKTWPASPNGVASDLHFEDISMDNVKTNPVLVDQE  310

Query  979   YCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKG-  1155
             YCP+ QC+A L SKVK+S + FKNI+GT+   +A+K+ CS  +PCQ V + DINL Y G 
Sbjct  311   YCPYGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVADINLTYNGN  370

Query  1156  KDGSAVSKCTNVKPSIIGKVVPAACS  1233
             K+G+A+S+C NVKP++ G   P  C+
Sbjct  371   KNGTAISECANVKPTVSGFNHPQVCA  396



>ref|XP_006375551.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
 gb|ERP53348.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
Length=387

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 203/394 (52%), Positives = 266/394 (68%), Gaps = 22/394 (6%)
 Frame = +1

Query  73    AAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAG  249
             A   C LL   VT +   FFDV  +GAK +G  DDSK        AC A  A+T+  A G
Sbjct  6     AYHLCFLL--LVTQVQG-FFDVKAYGAKANGMTDDSKRLERY---ACAAKEASTVVIAKG  59

Query  250   KFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDG  426
              +M GP+ F+GPC  P+T+  Q   L A  DP   +    WV F  V G+T++GG IFDG
Sbjct  60    NYMVGPLKFEGPCTAPVTVKVQGT-LKAPADPKRLRDD--WVAFRNVEGLTVSGGGIFDG  116

Query  427   NGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNR-----NSKQFHLRIGSSKDV  591
              GA  W++ +C        L      +  T  +   L NR     NSK FH+ I +  +V
Sbjct  117   QGAIAWSVNNCAN------LEMQFLAHKFTIHKADQLENRRDYVLNSKLFHMNILNCNNV  170

Query  592   TIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPG  771
             T +   ++AP NS NTDG+HIG+++ V+I GATI+TGDDCVSLGDG Q ++VEKVTCGPG
Sbjct  171   TFQNIVINAPKNSLNTDGIHIGRSTMVNITGATIRTGDDCVSLGDGCQQINVEKVTCGPG  230

Query  772   HGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNV  951
             HG++IGSLG+Y +E+PV+GVTV+NCTLTNT NG RIKTWP SP G A+N++FEDIIMNNV
Sbjct  231   HGISIGSLGRYHDEQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNV  290

Query  952   SNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMN  1131
             SNPILIDQ+YCP+N C A + S+VK+S + F+ I+GTS++++A+KI CS  +PCQ V + 
Sbjct  291   SNPILIDQEYCPYNNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVSVE  350

Query  1132  DINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             DINL+Y GK+GS+ S C NVKP + GKV PA C+
Sbjct  351   DINLVYNGKEGSSTSLCANVKPQVSGKVFPATCT  384



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   387 bits (995),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 259/371 (70%), Gaps = 4/371 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPIT  303
              FDV K+GA+ DG +D S+A   AWG AC +P A+T+    G +  G I   GPCK PI 
Sbjct  27    IFDVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPIN  86

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHIC  480
                Q   ++A  D   F+   GW+TF Q+   T++G G+FDG G T W    C  + +  
Sbjct  87    FVVQGT-VMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGT-KCLSSSYCN  144

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FN +T   +  +T+R+SKQFH+ +   K++T     + AP  S NTDG+HIG+
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHIGR  204

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S ++I  +TI+TGDDCVS+GDG + +++++VTCGPGHG+++GSLGKYPNE+PV+G++VK
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTLTNT NG R+KTWP S  G+A+ MHFEDI+MNNV NPI+IDQ+YCP NQC     S+
Sbjct  265   NCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +K+S + F+NI+GT+S+++A+K+ CS   PCQ V + DINL Y G +G A+S+C N+KP+
Sbjct  325   IKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCKNIKPN  384

Query  1201  IIGKVVPAACS  1233
             ++G  +P  CS
Sbjct  385   LLGVQLPRICS  395



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   386 bits (992),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 181/371 (49%), Positives = 258/371 (70%), Gaps = 4/371 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPIT  303
              FDV K+GA+ DG +D S+A   AWG AC +P A+T+    G +  G I   GPCK PI 
Sbjct  27    IFDVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPIN  86

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHIC  480
                Q   ++A  D   F+   GW+TF Q+   T++G G+FDG G   W    C  + +  
Sbjct  87    FVVQG-TVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWGT-KCLSSAYCN  144

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FN +T   +  +T+R+SKQFH+ +   K++T     + AP  S NTDG+HIG+
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHIGR  204

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S ++I  +TI+TGDDCVS+GDG + +++++VTCGPGHG+++GSLGKYPNE+PV+G++VK
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTLTNT NG R+KTWP S  G+A+ MHFEDI+MNNV NPI+IDQ+YCP NQC     S+
Sbjct  265   NCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +K+S + F+NI+GT+S+++A+K+ CS  VPC  V + DINL Y G +G A+S+C N+KP+
Sbjct  325   IKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPN  384

Query  1201  IIGKVVPAACS  1233
             ++G  +P  CS
Sbjct  385   LLGVQLPRICS  395



>ref|XP_010486356.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
 ref|XP_010486357.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   388 bits (996),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 192/378 (51%), Positives = 258/378 (68%), Gaps = 4/378 (1%)
 Frame = +1

Query  106   VTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGP  285
             V G   A  DV   GAKGDGK DD  AF  AW   C A G   I   G+++ G +  +GP
Sbjct  62    VPGGPKASCDVKVLGAKGDGKTDDCAAFAKAWTDVCAA-GGTLIVPKGEYLVGSLELKGP  120

Query  286   CKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI--NGGIFDGNGATTWNLPDC  459
             CKGP+T++    NL A     A K H GW+    V   T+  N  I DG GA  W + DC
Sbjct  121   CKGPVTLELNG-NLKAPATVAATKPHAGWIEIDNVCDFTLKGNNAILDGQGALAWKVNDC  179

Query  460   GKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNT  639
              K G    LP N++   +T  +++G+T+ NSK FH+ I + K++T+E   +DAP  S NT
Sbjct  180   AKTGKCNSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNT  239

Query  640   DGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKP  819
             DG+HIG+++ V++IGA I+TGDDCVS+GDG +++ +E V CGPGHG++IGSLG YPNE+P
Sbjct  240   DGIHIGRSNGVNLIGAKIRTGDDCVSIGDGTENLLIENVECGPGHGISIGSLGLYPNEQP  299

Query  820   VLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQC  999
             V GVTV+ C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP  +C
Sbjct  300   VKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPHGKC  359

Query  1000  KAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSK  1179
             KAG+ S+VKLS +  KNIKGTS++K+A+K+ CS   PC  + + DINL++ GK+G AVS 
Sbjct  360   KAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALADINLVHNGKEGPAVSA  419

Query  1180  CTNVKPSIIGKVVPAACS  1233
             C+N+KP + GK+VP AC+
Sbjct  420   CSNIKPVLSGKLVPEACT  437



>ref|XP_010458380.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/372 (51%), Positives = 255/372 (69%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DD  AF  AW   C A G   I   G ++ G +  +GPCKGP+T
Sbjct  63    ASCDVKVLGAKGDGKTDDCAAFATAWKDVCAA-GGTLIVPKGDYLVGSLELKGPCKGPVT  121

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI--NGGIFDGNGATTWNLPDCGKNGHI  477
             ++    NL A     A K H GW+    V   T+  N  I DG GA  W + DC K G  
Sbjct  122   LELNG-NLKAPATVAATKPHAGWIEIDNVCDFTLKGNNAILDGQGALAWKVNDCAKTGKC  180

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++   +T  +++G+T+ NSK FH+ I + K++T+E   +DAP  S NTDG+HIG
Sbjct  181   NSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNTDGIHIG  240

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA I+TGDDCVS+GDG +++ +E V CGPGHG++IGSLG YPNE+PV GVTV
Sbjct  241   RSNGVNLIGAKIRTGDDCVSIGDGTENLIIENVECGPGHGISIGSLGLYPNEQPVRGVTV  300

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP  +CKAG+ S
Sbjct  301   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPHGKCKAGVPS  360

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             +VKLS +  KNIKGTS++K+A+K+ CS   PC  + + DINL++ GK+G AVS C+N+KP
Sbjct  361   QVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPAVSACSNIKP  420

Query  1198  SIIGKVVPAACS  1233
              + GK+VP AC+
Sbjct  421   ILSGKLVPEACT  432



>ref|XP_010458261.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 190/372 (51%), Positives = 255/372 (69%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DD  AF  AW   C A G   I   G ++ G +  +GPCKGP+T
Sbjct  63    ASCDVKVLGAKGDGKTDDCAAFATAWKDVCAA-GGTLIVPKGDYLVGSLELKGPCKGPVT  121

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG--IFDGNGATTWNLPDCGKNGHI  477
             ++    NL A     A K H GW+    V   T+ G   I DG GA  W + DC K G  
Sbjct  122   LELNG-NLKAPATVAATKPHAGWIEIDNVCDFTLKGNNVILDGQGALAWKVNDCAKTGKC  180

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++   +T  +++G+T+ NSK FH+ I + K++T+E   +DAP  S NTDG+HIG
Sbjct  181   NSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNTDGIHIG  240

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA I+TGDDCVS+GDG +++ +E V CGPGHG++IGSLG YPNE+PV GVTV
Sbjct  241   RSNGVNLIGAKIRTGDDCVSIGDGTENLIIENVECGPGHGISIGSLGLYPNEQPVRGVTV  300

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP  +CKAG+ S
Sbjct  301   RKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPHGKCKAGVPS  360

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             +VKLS +  KNIKGTS++K+A+K+ CS   PC  + + DINL++ GK+G AVS C+N+KP
Sbjct  361   QVKLSDVIIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPAVSACSNIKP  420

Query  1198  SIIGKVVPAACS  1233
              + GK+VP AC+
Sbjct  421   ILSGKLVPEACT  432



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/371 (49%), Positives = 257/371 (69%), Gaps = 4/371 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPIT  303
              FDV K+GA+ DG +D S+A   AWG +C +P A+T+    G +  G I   GPCK PI 
Sbjct  27    IFDVTKYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAPIN  86

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHIC  480
                Q   ++A  D   FK   GW+ F Q+   T++GG +FDG G T W    C    +  
Sbjct  87    FVVQG-TVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKTVWGR-KCPHYAYCK  144

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FN +T   +  +T+R+SKQFH+ +   K++      + AP  S NTDG+HIG+
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHIGR  204

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S ++I  +TI+TGDDCVS+GDG + +++++VTCGPGHG+++GSLGKYPNE+PV+G++VK
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTLTNT NG R+KT+P S  G A+ MHFEDI+MNNV NPI+IDQ+YCP NQC     S+
Sbjct  265   NCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +KLS + F+NI+GT+S+++A+K+ CS  VPCQ V + DINL Y GK+G A+S+C N+KP+
Sbjct  325   IKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQCKNIKPN  384

Query  1201  IIGKVVPAACS  1233
             ++G  +P  C+
Sbjct  385   LLGVQLPRICA  395



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   382 bits (982),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 255/363 (70%), Gaps = 4/363 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPIT  303
              FDV K+GA+ DG +D S+A   AWG AC +P A+T+    G +  G I   GPCK PI 
Sbjct  27    IFDVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPIN  86

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHIC  480
                Q   ++A  D   F+   GW+TF Q+   T++G G+FDG G T W    C  + +  
Sbjct  87    FVVQGT-VMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWGT-KCLSSSYCN  144

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FN +T   +  +T+R+SKQFH+ +   K++T     + AP  S NTDG+HIG+
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHIGR  204

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S ++I  +TI+TGDDCVS+GDG + +++++VTCGPGHG+++GSLGKYPNE+PV+G++VK
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTLTNT NG R+KTWP S  G+A+ MHFEDI+MNNV NPI+IDQ+YCP NQC     S+
Sbjct  265   NCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +K+S + F+NI+GT+S+++A+K+ CS   PCQ V + DINL Y G +G A+S+C N+KP+
Sbjct  325   IKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCKNIKPN  384

Query  1201  IIG  1209
             ++G
Sbjct  385   LLG  387



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score =   385 bits (989),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 196/374 (52%), Positives = 255/374 (68%), Gaps = 5/374 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPI  300
             A  DV   GAK DGK DDS AF  AW  AC +   +TI    G+++   I F+GPCKGPI
Sbjct  147   ASIDVKASGAKADGKTDDSGAFAAAWKEACASASPSTILVPKGEYLVNNIEFKGPCKGPI  206

Query  301   TIDAQKMNLLALPDPFAF-KGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNG  471
             T +    NL A P+     K H GW+ F ++   TING   IFDG GA  W + DC K G
Sbjct  207   TFEVNG-NLKAPPNWLGGGKPHCGWLEFEKLTDFTINGNGAIFDGQGAIAWKVNDCAKTG  265

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
                 LP N++F  +T  ++IG+T+ NSK FH+ I   K+VT +   +DAP  S NTDG+H
Sbjct  266   KCNTLPINIRFTGLTNSKIIGITSTNSKLFHMNIIDCKNVTFQNIGIDAPPESLNTDGIH  325

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             IG+++ V +  + I+TGDDC+S+GDG +++ VE V CGPGHG+AIGSLGKYPNE+PV GV
Sbjct  326   IGRSNGVILRESKIRTGDDCISIGDGTENLLVENVECGPGHGIAIGSLGKYPNEQPVRGV  385

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
             T++   + NT NG RIKTWPGSP G A+N+ F+DI M+NVS PIL+DQ YCP   CK+  
Sbjct  386   TIRKTLIKNTDNGVRIKTWPGSPPGIASNILFDDITMDNVSTPILVDQVYCPHGTCKSQA  445

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              SKVKLS + FKNI+GTS+SK+A+K+ CSP VPC      DINL++ GK+G AVS C+NV
Sbjct  446   PSKVKLSDVSFKNIRGTSASKVAVKLLCSPGVPCTNFAFADINLVHNGKEGPAVSACSNV  505

Query  1192  KPSIIGKVVPAACS  1233
             KP + GK+VP AC+
Sbjct  506   KPVVSGKMVPPACT  519



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/391 (47%), Positives = 260/391 (66%), Gaps = 4/391 (1%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TA  243
             I A    +LLAS         FDV K+GA+ DG  D S+A   AWG AC +P A+T+ T 
Sbjct  7     ITATSLMLLLASAAEVSCDTIFDVTKYGARADGNTDISQALLKAWGDACSSPVASTVMTP  66

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IF  420
              G    G I   GPCK PI    Q  ++ AL D   FK   GW+ F Q+   T++GG +F
Sbjct  67    DGXHALGQITIGGPCKDPINFIVQG-SVKALMDTSRFKAXAGWIAFRQIDQFTLSGGGVF  125

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G T W    C  + +   LP NL+FN +T   +  +T+R+S QFH+ +   K++T  
Sbjct  126   DGQGKTVWG-TKCPSSAYCNQLPINLRFNFITNSMVKNITSRDSNQFHINLLGCKNLTFY  184

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
                + AP    NTDG+HIG++  ++I  +TI+TGDDCVS+GDG + +++++VTCGPGHG 
Sbjct  185   NVAISAPEERLNTDGIHIGRSLGINITYSTIETGDDCVSIGDGSEQINMQRVTCGPGHGT  244

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             ++GSLGKYPNE+PV+G++VKNCT TNT NG R+KTWP S  G+A+ MHFEDI+MNNV NP
Sbjct  245   SVGSLGKYPNEEPVVGISVKNCTRTNTQNGVRVKTWPASHQGTASXMHFEDIVMNNVGNP  304

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             I+IDQ+YCP NQC   + S++ LS + F+NI+GT+S+++A+K+ CS  VPC+   + DIN
Sbjct  305   IIIDQEYCPHNQCNLKIPSRIMLSNVSFRNIRGTTSTQVAVKLVCSQGVPCEDAELGDIN  364

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             L Y GK G A+S+C N+KP+++G  +P  C+
Sbjct  365   LKYNGKVGHAMSQCKNIKPNLLGTQLPRTCA  395



>ref|XP_002862616.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38874.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   381 bits (979),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/372 (52%), Positives = 261/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DDS AF  AW  AC A G+      G+++   + F+GPCKGP+T
Sbjct  69    ASLDVKASGAKGDGKTDDSAAFAAAWKEACAA-GSTITVPKGEYLVESLEFKGPCKGPVT  127

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    NL A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  128   LELNG-NLKAPATVKTSKPHSGWIDFENIADFTLNGNGAIFDGQGSLAWKANDCAKTGKC  186

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+E   +DAP  S NTDG+HIG
Sbjct  187   NSLPINIRFTGLTNSKIKSITSTNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIG  246

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V+++GA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  247   RSNGVNLLGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  306

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  307   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPYGHCKAGVPS  366

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS +  KNIKGTS++K+A+K+ CS  VPC  + + DINL++ GK+G AVS C+N+KP
Sbjct  367   KVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPAVSACSNIKP  426

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  427   ILSGKLVPAACT  438



>ref|XP_002885005.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61264.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 261/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  D+   GAKGDGK DDS AF  AW  AC A G+      G+++   + F+GPCKGP+T
Sbjct  73    ASLDIKASGAKGDGKTDDSAAFAAAWKEACAA-GSTITVPKGEYLVESLEFKGPCKGPVT  131

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    NL A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  132   LELNG-NLKAPATVKTSKPHSGWIDFENIADFTLNGNGAIFDGQGSLAWKANDCAKTGKC  190

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+E   +DAP  S NTDG+HIG
Sbjct  191   NSLPINIRFTGLTNSKIKSITSTNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIG  250

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V+++GA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  251   RSNGVNLLGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  310

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  311   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPYGHCKAGVPS  370

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS +  KNIKGTS++K+A+K+ CS  VPC  + + DINL++ GK+G AVS C+N+KP
Sbjct  371   KVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPAVSACSNIKP  430

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  431   ILSGKLVPAACT  442



>ref|XP_006299516.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
 gb|EOA32414.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
Length=449

 Score =   380 bits (976),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 262/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DD  AF  AW AA  A G   I   G+++   + F+GPCKGP+T
Sbjct  73    ASSDVKALGAKGDGKTDDCAAFGAAWKAA-CAAGGTIIVPKGEYLVEALEFKGPCKGPVT  131

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    NL A     + K H GWV F  +   T+NG   IFDG GA  W   DC K G  
Sbjct  132   MELNG-NLKAPAAVKSTKPHSGWVDFENIADFTLNGNKAIFDGQGALAWKANDCAKTGKC  190

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+E   ++AP  S NTDG+HIG
Sbjct  191   NSLPINIRFTGLTNSKIKSITSTNSKLFHINILNCKNITLEDIGINAPPESLNTDGIHIG  250

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V+I+GA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  251   RSNGVNILGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  310

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  311   RKCLIKNTDNGVRIKTWPGSPPGVASNILFEDITMDNVSTPVLIDQEYCPYGHCKAGVPS  370

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             +VKLS +  KNIKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  371   QVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  430

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  431   VLTGKLVPAACT  442



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 268/406 (66%), Gaps = 16/406 (4%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAF---FDVMKFGAKGDGKADDSKAFTGAWGAACKAP  222
              K I++ A + C  L + +    +A    F+V+ +GAK DGK DD K    AW  AC + 
Sbjct  8     FKFIIVGAVFLCTYLLTCIKNSESAIISNFNVVNYGAKCDGKTDDGKPILEAWKQACNSN  67

Query  223   GANTITAA-GKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPF-AFKGHGGWVTFSQVIG  396
              A+T+    G ++ GP+ FQGPCK  +T+  +    L  P     FK   GW+ F  + G
Sbjct  68    IASTVVIPPGNYILGPVDFQGPCKAAVTVRVE--GYLRAPSMLDVFKLRDGWIVFRDISG  125

Query  397   VTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRI  573
             +TI GG  FDG G   W   +C K+G  C +P N++F  +T   +  +T+ +SK FH+ I
Sbjct  126   LTIEGGGTFDGQGMIAWKENNCAKSGS-CSMPTNIRFTGITNGEVNNITSLDSKMFHMNI  184

Query  574   GSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEK  753
                  +T +  T+DAP +SPNTDG+HIG++S ++I GATI+TGDDCVSLGDG Q + +  
Sbjct  185   IKCNYMTFKGITIDAPVSSPNTDGIHIGRSSMINITGATIRTGDDCVSLGDGSQHISINN  244

Query  754   VTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFED  933
             +TCGPGHG+++GSLGKYP E+PV+GV V+NCTL NT+NG R+KTWP S  G A+ +HF+D
Sbjct  245   ITCGPGHGISVGSLGKYPGEQPVVGVIVRNCTLVNTMNGLRVKTWPNSFNGIASGLHFQD  304

Query  934   IIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPC  1113
             II++NVSNP+LIDQ YCP + CK  + SKVK+S + FKNIKGTS++KMA+++ CS  +PC
Sbjct  305   IIIDNVSNPVLIDQDYCPDDLCKLQVPSKVKVSDVLFKNIKGTSATKMAIQLKCSKIMPC  364

Query  1114  QGVVMNDINLIYKGKDG-------SAVSKCTNVKPSIIGKVVPAAC  1230
             + V ++DI+L Y G  G       +A S+C NV+P+I+GK+ P  C
Sbjct  365   ENVTLDDIDLCYLGNKGNNRNTTSTATSECFNVRPAIMGKLSPPPC  410



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/387 (46%), Positives = 264/387 (68%), Gaps = 3/387 (1%)
 Frame = +1

Query  79    WFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKF  255
             +   L    +T + A  F V ++GA+ +G +DDS+A   AW  AC +   + I    G++
Sbjct  13    FILFLFIGLITNVQAVDFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  72

Query  256   MAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNG  432
             +   + FQGPC  PI +  +   L A  +    +    W+ F  + G+T++G G FDG G
Sbjct  73    VVDSMKFQGPCLAPIHVQVEG-RLQAPTNIKKMRNDASWIVFQYINGLTVSGKGTFDGRG  131

Query  433   ATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTV  612
             +  W    C  +G    LP +L+F ++    +  +T+ +SK FH+ + + ++VT+    +
Sbjct  132   SLAWKQNQCASSGKCGSLPISLRFFSLNNSLIKDITSTDSKFFHMNVHNCRNVTLRNINI  191

Query  613   DAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGS  792
             DAPG+SPNTDG+HIG +S ++I  A IKTGDDCVS+GDG Q ++VEKVTCGPGHG++IGS
Sbjct  192   DAPGDSPNTDGIHIGGSSGITIHDARIKTGDDCVSIGDGSQQINVEKVTCGPGHGISIGS  251

Query  793   LGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILID  972
             LGKY NEKPV G+TV++CT+TNT+ G RIKTWP S  G A+NM FE+I+M+NV  PILID
Sbjct  252   LGKYKNEKPVSGITVRDCTITNTMFGVRIKTWPASTKGIASNMQFENIVMDNVGTPILID  311

Query  973   QQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK  1152
             QQYCP+  C   + S+V++S +GFKNI+GTS++++A+K+ CS   PC+ V +++INL Y 
Sbjct  312   QQYCPYGTCHHQVPSRVQISDVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYS  371

Query  1153  GKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             G +G+A+S+C+NVKP+++G+VVP AC+
Sbjct  372   GTNGTAISECSNVKPAVVGRVVPPACT  398



>emb|CAA51692.1| exopolygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 261/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DDS AF  AW  AC A G+      G+++   + F+GPCKGP+T
Sbjct  69    ASLDVKASGAKGDGKTDDSAAFAAAWKEACAA-GSTITVPKGEYLVESLEFKGPCKGPVT  127

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    N  A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  128   LELNG-NFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKC  186

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+   ++DAP  S NTDG+HIG
Sbjct  187   NSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDISIDAPPESLNTDGIHIG  246

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  247   RSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  306

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  307   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPS  366

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS +  KNIKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  367   KVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  426

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  427   ILSGKLVPAACT  438



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 254/364 (70%), Gaps = 4/364 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPIT  303
              FDV K+GA+ DG +D S+A   AWG +C +P A+T+    G +  G I   GPCK PI 
Sbjct  27    IFDVTKYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAPIN  86

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHIC  480
                Q   ++A  D   FK   GW+ F Q+   T++GG +FDG G T W    C    +  
Sbjct  87    FVVQG-TVMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKTVWGR-KCPHYAYCK  144

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FN +T   +  +T+R+SKQFH+ +   K++      + AP  S NTDG+HIG+
Sbjct  145   QLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHIGR  204

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S ++I  +TI+TGDDCVS+GDG + +++++VTCGPGHG+++GSLGKYPNE+PV+G++VK
Sbjct  205   SSGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVK  264

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTLTNT NG R+KT+P S  G A+ MHFEDI+MNNV NPI+IDQ+YCP NQC     S+
Sbjct  265   NCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSR  324

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +KLS + F+NI+GT+S+++A+K+ CS  VPCQ V + DINL Y GK+G A+S+C N+KP+
Sbjct  325   IKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQCKNIKPN  384

Query  1201  IIGK  1212
             ++G+
Sbjct  385   LLGQ  388



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 179/387 (46%), Positives = 261/387 (67%), Gaps = 3/387 (1%)
 Frame = +1

Query  79    WFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKF  255
             +   L    +T   AA F V ++GA+ +G +DDS+A   AW  AC +   + I    G++
Sbjct  12    FILFLFIGLITNAQAADFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  71

Query  256   MAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNG  432
             +   + FQGPC  PI +  +   L A  +    +    W+ F  + G+T++G G FDG G
Sbjct  72    VVDSMKFQGPCLAPIHVQVEG-RLQAPTNIKKMRNDASWIVFQYINGLTLSGKGTFDGRG  130

Query  433   ATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTV  612
             +  W    C  +G    LP +L+F ++    +  +T+ +SK FH+ + + +++T++   +
Sbjct  131   SLAWKQNQCASSGKCGSLPISLRFYSLNNSLIKDITSTDSKFFHVNVHNCRNLTLQNINI  190

Query  613   DAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGS  792
             DAPG+SPNTDG+HIG +S V+I  A IKTGDDCVS+GDG Q + VEKVTCGPGHG++IGS
Sbjct  191   DAPGDSPNTDGIHIGGSSGVTIHNARIKTGDDCVSIGDGSQQIKVEKVTCGPGHGISIGS  250

Query  793   LGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILID  972
             LGKY NEKPV G+TV++CT+TNT+ G RIK+WP S  G A+NM FE I+MNNV  PILID
Sbjct  251   LGKYKNEKPVSGITVRDCTITNTMFGVRIKSWPASTKGIASNMQFESIVMNNVGTPILID  310

Query  973   QQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK  1152
             QQYCP+  C   + S+V++S +GFKNI+GTS++++A+K+ CS   PC+ V +++INL Y 
Sbjct  311   QQYCPYGTCNRQIPSRVQISNVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYS  370

Query  1153  GKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             G +G+A+S+C+NVKP+I G VVP AC+
Sbjct  371   GTNGTAISECSNVKPAIAGSVVPPACT  397



>ref|NP_188020.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
 dbj|BAB02336.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AEE75458.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
Length=445

 Score =   377 bits (968),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 260/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DDS AF  AW  AC A G+      G+++   + F+GPCKGP+T
Sbjct  69    ASLDVKASGAKGDGKTDDSAAFAAAWKEACAA-GSTITVPKGEYLVESLEFKGPCKGPVT  127

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    N  A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  128   LELNG-NFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKC  186

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+    +DAP  S NTDG+HIG
Sbjct  187   NSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDIGIDAPPESLNTDGIHIG  246

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  247   RSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  306

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  307   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPS  366

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS +  KNIKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  367   KVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  426

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  427   ILSGKLVPAACT  438



>emb|CAA11160.1| polygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   377 bits (968),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 260/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DDS AF  AW  AC A G+      G+++   + F+GPCKGP+T
Sbjct  69    ASLDVKASGAKGDGKTDDSAAFAAAWKEACAA-GSTITVPKGEYLVESLEFKGPCKGPVT  127

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    N  A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  128   LELNG-NFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKC  186

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+    +DAP  S NTDG+HIG
Sbjct  187   NSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDIGIDAPPESLNTDGIHIG  246

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  247   RSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  306

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  307   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPS  366

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS +  KNIKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  367   KVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  426

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  427   ILSGKLVPAACT  438



>gb|AAL32525.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AAM47954.1| polygalacturonase; pectinase [Arabidopsis thaliana]
Length=445

 Score =   377 bits (968),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 193/372 (52%), Positives = 259/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DDS AF  A   AC A G+      G+++   + F+GPCKGP+T
Sbjct  69    ASLDVKASGAKGDGKTDDSAAFAAARKEACAA-GSTITVPKGEYLVESLEFKGPCKGPVT  127

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    N  A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  128   LELNG-NFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKTGKC  186

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+    +DAP  S NTDG+HIG
Sbjct  187   NSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDIGIDAPPESLNTDGIHIG  246

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  247   RSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  306

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  307   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPS  366

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS +  KNIKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  367   KVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  426

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  427   ILSGKLVPAACT  438



>emb|CAA51033.1| exopolygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   375 bits (963),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/372 (52%), Positives = 259/372 (70%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGDGK DDS AF  AW  AC A G+      G++M   + F+GPCKGP+T
Sbjct  68    AAVDVKASGAKGDGKTDDSAAFAAAWKEACAA-GSTITVPKGEYMVESLEFKGPCKGPVT  126

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    N  A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  127   LELNG-NFKAPATVKTTKPHAGWIDFENIADFTLNGNKAIFDGQGSLAWKANDCAKTGKC  185

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+    +DAP  S NTDG+HIG
Sbjct  186   NSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLSDIGIDAPPESLNTDGIHIG  245

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  246   RSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  305

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  306   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPS  365

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             +VKLS +  K IKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  366   QVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  425

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  426   ILSGKLVPAACT  437



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   373 bits (957),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/398 (48%), Positives = 260/398 (65%), Gaps = 8/398 (2%)
 Frame = +1

Query  58    SILIQAAWFCILLASFVTGL---HAAFFDVM-KFGAKGDGKADDSKAFTGAWGAACKAPG  225
             ++L+      +LL  F T +    +   DV+ K+GAK D K D S     AW  AC +  
Sbjct  2     AVLLNIPVLSMLLLLFTTSIPKAQSTVVDVVAKYGAKADEKTDLSTPLLNAWKEACASTT  61

Query  226   ANTIT-AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVT  402
              + I    G +        GPCK  I +    + + A  DP AFK    WV F+ V  +T
Sbjct  62    PSKIVIPKGTYRLSRASLDGPCKSAIELQVSGI-IKAPADPSAFK-DPNWVVFNHVDHLT  119

Query  403   INGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGS  579
             I+GG +FDG GA  W   +C KN +   LP NL+FN V+   + G+T ++SKQFH+ +  
Sbjct  120   ISGGGVFDGQGAAVWGKNNCAKNKYCAALPINLRFNYVSNAIVQGITTKDSKQFHVNVLG  179

Query  580   SKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVT  759
              ++ T + +TV AP NS NTDG+HIG+++ V ++   IKTGDDCVSLGDG ++V VE+VT
Sbjct  180   CRNFTFQHFTVSAPENSINTDGIHIGRSNGVKVLDTNIKTGDDCVSLGDGSKNVIVERVT  239

Query  760   CGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDII  939
             CGPGHG+++GSLGK+ +E+PV G+ V+NCTL+NT+NG R+KTWP S  GSAT+MHFEDII
Sbjct  240   CGPGHGISVGSLGKFNDEEPVSGIFVRNCTLSNTMNGVRVKTWPDSHPGSATDMHFEDII  299

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             +NNV NPILIDQ+YCPWN C   + S++KLS I FK I+GTSS++ A+++ CS  +PC  
Sbjct  300   LNNVGNPILIDQEYCPWNLCNLKVPSRIKLSNISFKKIRGTSSTQQAVRLVCSRGLPCDR  359

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             V + DI++ YKG  G A S+CTNVKP   GK  P ACS
Sbjct  360   VELADIDITYKGPGGPATSECTNVKPRTSGKQNPPACS  397



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 256/375 (68%), Gaps = 4/375 (1%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCK  291
             ++A  F+V  +GAKGDG +D S+A   AW  AC +   A  +   G F    +   GPCK
Sbjct  20    INAQVFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCK  79

Query  292   GPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
              P+  + Q   L A  DP  FK  G WV F ++ G+T++GG  FDG G T W   DC KN
Sbjct  80    APVEFELQG-TLKAPADPSLFKTDG-WVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKN  137

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
              +   LP NL+FN VT   +  +T  +SK F + +  +K++T + + V+AP +S NTDG+
Sbjct  138   TNCRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  V+I+ + IKTGDDCVSLGDG + + V+ VTCGPGHG+++GSLGKY NE+PV G
Sbjct  198   HIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEG  257

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             V V NCT+    NG RIKTWP S  G+A++MHFEDI M+NV NP+++DQ YCP++QCKAG
Sbjct  258   VFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAG  317

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
             + S +K+S + FK I+GTS+S++A+K+ CS +VPCQ V + DI+L+Y G +G A S+C N
Sbjct  318   VPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECAN  377

Query  1189  VKPSIIGKVVPAACS  1233
             VKP + GK+ PAAC+
Sbjct  378   VKPVLSGKLNPAACA  392



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   371 bits (953),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/375 (49%), Positives = 255/375 (68%), Gaps = 4/375 (1%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCK  291
             ++A  F+V  +GAKGDG +D S+A   AW  AC +   A  +   G F    +   GPCK
Sbjct  20    INAQVFNVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCK  79

Query  292   GPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
              P+  + Q   L A  DP  FK  G WV F  + G+T++GG  FDG G T W   DC KN
Sbjct  80    APVEFELQG-TLKAPTDPSLFKTDG-WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKN  137

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
              +   LP NL+FN VT   +  +T  +SK F + +  +K++T + + V+AP +S NTDG+
Sbjct  138   TNCRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  V+I+ + IKTGDDCVSLGDG + + V+ VTCGPGHG+++GSLGKY NE+PV G
Sbjct  198   HIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEG  257

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             V V NCT+    NG RIKTWP S  G+A++MHFEDI M+NV NP+++DQ YCP+NQCKAG
Sbjct  258   VFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAG  317

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
             + S +K+S + FK I+GTS+S++A+K+ CS +VPCQ V + DI+L+Y G +G A S+C N
Sbjct  318   VPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECAN  377

Query  1189  VKPSIIGKVVPAACS  1233
             VKP + GK+ PAAC+
Sbjct  378   VKPVLSGKLNPAACA  392



>ref|NP_187442.1| polygalacturonase-like protein [Arabidopsis thaliana]
 sp|P49063.2|PGLR2_ARATH RecName: Full=Exopolygalacturonase clone GBGA483; Short=ExoPG; 
AltName: Full=Galacturan 1,4-alpha-galacturonidase; AltName: 
Full=Pectinase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF21195.1|AC013483_19 exopolygalacturonase [Arabidopsis thaliana]
 gb|AAL07022.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AAM14139.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AEE74611.1| polygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   373 bits (957),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 192/372 (52%), Positives = 258/372 (69%), Gaps = 4/372 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             A  DV   GAKGD K DDS AF  AW  AC A G+      G++M   + F+GPCKGP+T
Sbjct  68    AAVDVKASGAKGDSKTDDSAAFAAAWKEACAA-GSTITVPKGEYMVESLEFKGPCKGPVT  126

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHI  477
             ++    N  A       K H GW+ F  +   T+NG   IFDG G+  W   DC K G  
Sbjct  127   LELNG-NFKAPATVKTTKPHAGWIDFENIADFTLNGNKAIFDGQGSLAWKANDCAKTGKC  185

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F  +T  ++  +T+ NSK FH+ I + K++T+    +DAP  S NTDG+HIG
Sbjct  186   NSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLSDIGIDAPPESLNTDGIHIG  245

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V++IGA IKTGDDCVS+GDG +++ VE V CGPGHG++IGSLG+YPNE+PV GVTV
Sbjct  246   RSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTV  305

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             + C + NT NG RIKTWPGSP G A+N+ FEDI M+NVS P+LIDQ+YCP+  CKAG+ S
Sbjct  306   RKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPS  365

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             +VKLS +  K IKGTS++K+A+K+ CS  VPC  + ++DINL++ GK+G AVS C+N+KP
Sbjct  366   QVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKP  425

Query  1198  SIIGKVVPAACS  1233
              + GK+VPAAC+
Sbjct  426   ILSGKLVPAACT  437



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   371 bits (952),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 255/380 (67%), Gaps = 4/380 (1%)
 Frame = +1

Query  100   SFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAP-GANTITAAGKFMAGPIWF  276
             SF + ++A  F V  + AKG G  D +++  GAW  AC +   A    A G F    +  
Sbjct  16    SFSSTINAQVFQVENYSAKGGGIPDITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVL  75

Query  277   QGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLP  453
             +GPCK  +  +  +  L A  DP  FK  G WV F ++ G+T++GG  FDG G   W   
Sbjct  76    EGPCKAHVEFEI-RGRLQAPADPSRFKTDG-WVVFQRIDGLTVSGGGTFDGQGKIAWGQN  133

Query  454   DCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSP  633
             DC KN +   LP NL+FN V+   +  +T  +SK FH+ +  +K++T E + V+APG+S 
Sbjct  134   DCDKNTNCRTLPTNLRFNFVSNAIIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSV  193

Query  634   NTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNE  813
             NTDG+HIG++  V+I+   IKTGDDCVSLGDG + + V  VTCGPGHG+++GSLGKY NE
Sbjct  194   NTDGIHIGRSLGVNILDTNIKTGDDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNE  253

Query  814   KPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWN  993
             +PV GV V NCT+T   NGARIKTW  S +G AT+MHF+D+ MN+V+NP+LIDQ YCP+N
Sbjct  254   EPVSGVFVTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFN  313

Query  994   QCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAV  1173
             QC+A + S VK+S + F+ I+GTSS+K+A+KI CS  +PC+GV + DINL+YKG DG A 
Sbjct  314   QCQAQIPSLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPAT  373

Query  1174  SKCTNVKPSIIGKVVPAACS  1233
             S+C+NV+P I G   P AC+
Sbjct  374   SECSNVRPLISGMQNPLACA  393



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   370 bits (951),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 255/375 (68%), Gaps = 4/375 (1%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCK  291
             ++A  F+V  +GAKGDG +D S+A   AW  AC +   A  +   G F    +   GPCK
Sbjct  20    INAQVFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCK  79

Query  292   GPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
              P+  + Q   L A  DP  FK  G WV F  + G+T++GG  FDG G T W   DC KN
Sbjct  80    APVEFELQG-TLKAPADPSLFKTDG-WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKN  137

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
              +   LP NL+FN VT   +  +T  +SK F + +  +K++T + + V+AP +S NTDG+
Sbjct  138   TNCRTLPTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  V+I+ + IKTGDDCVSLGDG + + V+ VTCGPGHG+++GSLGKY NE+PV G
Sbjct  198   HIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEG  257

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             V V NCT+    NG RIKTWP S  G+A++MHFEDI M+NV NP+++DQ YCP+NQCKAG
Sbjct  258   VFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAG  317

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
             + S +K+S + FK I+GTS+S++A+K+ CS +VPC+ V + DI+L+Y G +G A S+C N
Sbjct  318   VPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECAN  377

Query  1189  VKPSIIGKVVPAACS  1233
             VKP + GK+ PAAC+
Sbjct  378   VKPVLSGKLNPAACA  392



>emb|CDX80531.1| BnaC07g29130D [Brassica napus]
Length=421

 Score =   371 bits (953),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 250/371 (67%), Gaps = 4/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDGK DDSKAF  AW  AC++   + I    GK++   + F+GPCK  +T 
Sbjct  45    IDVKASGAKGDGKTDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKSAVTF  104

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHIC  480
             +    +++A       K H GW+ F ++    +NG   IFDG GAT W + DC K G   
Sbjct  105   EMDG-HIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGATAWKINDCAKTGKCN  163

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++   +T  ++ G+ + NSK FH+ I + K++T+E   +DAP  S NTDG+HIG+
Sbjct  164   TLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLNTDGIHIGR  223

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V ++ A IKTGDDC+S+GDG ++  VE V CGPGHG+AIGSLGKYPNE+PV GVT++
Sbjct  224   SDGVRLVRAKIKTGDDCISIGDGTENFLVENVECGPGHGIAIGSLGKYPNEQPVRGVTIR  283

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
                + NT NG RIKTWPGSP G  +N+ F+DI M+NVS PILIDQ YCP   CK G  SK
Sbjct  284   RSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPHGHCKKGGPSK  343

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I +++IKGTS+SK+A+K+ CSP VPC  V +++I+ +Y GK G AVS C++VKP 
Sbjct  344   VKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPK  403

Query  1201  IIGKVVPAACS  1233
             + GK+ P AC+
Sbjct  404   LKGKMEPPACT  414



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   370 bits (950),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 255/375 (68%), Gaps = 4/375 (1%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCK  291
             ++A  F+V  +GAKGDG +D S+A   AW  AC +   A  +   G F    +   GPCK
Sbjct  20    INAQVFNVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCK  79

Query  292   GPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
              P+  + Q   L A  DP  FK  G WV F  + G+T++GG  FDG G T W   DC KN
Sbjct  80    APVEFELQG-TLKAPADPSLFKTDG-WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKN  137

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
              +   LP NL+FN VT   +  +T  +SK F + +  +K++T + + V+AP +S NTDG+
Sbjct  138   TNCRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  V+I+ + IKTGDDCVSLGDG + + V+ VTCGPGHG+++GSLGKY NE+PV G
Sbjct  198   HIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEG  257

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             V V NCT+    NG RIKTWP S  G+A++MHFEDI M+NV NP+++DQ YCP+NQCKAG
Sbjct  258   VFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAG  317

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
             + S +K+S + FK I+GTS+S++A+K+ CS +VPC+ V + DI+L+Y G +G A S+C N
Sbjct  318   VPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECAN  377

Query  1189  VKPSIIGKVVPAACS  1233
             VKP + GK+ PAAC+
Sbjct  378   VKPVLSGKLNPAACA  392



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/375 (49%), Positives = 255/375 (68%), Gaps = 4/375 (1%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCK  291
             ++A  F+V  +GAKGDG +D S+A   AW  AC +   A  +   G F    +   GPCK
Sbjct  20    INAQVFNVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCK  79

Query  292   GPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
              P+  + Q   L A  DP  FK  G WV F  + G+T++GG  FDG G T W   DC KN
Sbjct  80    APVEFELQG-TLKAPADPSLFKTDG-WVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKN  137

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
              +   LP NL+FN VT   +  +T  +SK F + +  +K++T + + V+AP +S NTDG+
Sbjct  138   TNCRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  V+I+ + IKTGDDCVSLGDG + + V+ VTCGPGHG+++GSLGKY NE+PV G
Sbjct  198   HIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEG  257

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             V V NCT+    NG RIKTWP S  G+A++MHFEDI M+NV NP+++DQ YCP++QCKAG
Sbjct  258   VFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAG  317

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
             + S +K+S + FK I+GTS+S++A+K+ CS +VPCQ V + DI+L+Y G +G A S+C N
Sbjct  318   VPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECAN  377

Query  1189  VKPSIIGKVVPAACS  1233
             VKP + GK+ PAAC+
Sbjct  378   VKPVLSGKLNPAACA  392



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 250/371 (67%), Gaps = 4/371 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAP-GANTITAAGKFMAGPIWFQGPCKGPIT  303
             +FDV K+GA+ DGK D S+A   AW AAC +P  +  +  AG +  G +  +GPCK PI 
Sbjct  25    YFDVTKYGAQADGKTDISQALLTAWEAACASPIASRVVIPAGIYALGQVTIEGPCKAPIN  84

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHIC  480
             +   K  + A  D   FK   GWV F  +   T++G G+FDG G + W    C +  +  
Sbjct  85    LIV-KGTVRAPVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWR-QKCSRTKYCH  142

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FN +T   +  +T+++SKQFH+ +   +++T  +  + AP +S NTDG+HIG+
Sbjct  143   QLPINLRFNFLTNSIIKDITSKDSKQFHINVLRCRNITFFQVAITAPEDSQNTDGIHIGR  202

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V+I  +TI+TGDDCVS+GDG + + + KV CGPGHG+++GSLG Y NE PV+G+ VK
Sbjct  203   SRGVNITHSTIQTGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVK  262

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTL++T NG R+KTWP SP G+AT MHF DI+MNNVSNPI+IDQ+YCP NQC   + S+
Sbjct  263   NCTLSDTTNGVRVKTWPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQIPSR  322

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I FKNI+GT+S+++A+ + CS   PCQ V + +I+L Y G +G+A S+C NV+ +
Sbjct  323   VKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEAT  382

Query  1201  IIGKVVPAACS  1233
             + G   P  C+
Sbjct  383   LWGTQQPKTCA  393



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/391 (48%), Positives = 261/391 (67%), Gaps = 4/391 (1%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCK  291
             ++A  F+V  +GAKGDG +D S+A   AW  AC +   A  +   G F    +   GPCK
Sbjct  20    INAQVFNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCK  79

Query  292   GPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
              P+  + Q   L A  DP  FK  G WV F ++ G+T++GG  FDG G T W   DC KN
Sbjct  80    APVEFELQG-TLKAPADPSLFKTDG-WVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKN  137

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
              +   LP NL+FN VT   +  +T  +SK F + +  +K++T + + V+AP +S NTDG+
Sbjct  138   TNCRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  V+I+ + IKTGDDCVSLGDG + + V+ VTCGPGHG+++GSLGKY NE+PV G
Sbjct  198   HIGRSDGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEG  257

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             V V NCT+    NG RIKTWP S  G+A++MHFEDI M+NV NP+++DQ YCP++QCKAG
Sbjct  258   VFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFDQCKAG  317

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
             + S +K+S + FK I+GTS+S++A+K+ CS +VPCQ V + DI+L+Y G +G A S+C N
Sbjct  318   VPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECAN  377

Query  1189  VKPSIIGKVVPAACSVHK*KIPAGISTVLYK  1281
             VKP + GK+ PAAC+         IS V ++
Sbjct  378   VKPVLSGKLNPAACAKPHIPTKVKISDVSFR  408


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = +1

Query  1000  KAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSK  1179
             K  + +KVK+S + F++I+GTS++ +A K+ C   VPCQ + + DINL Y G++G+A S+
Sbjct  393   KPHIPTKVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAATSQ  452

Query  1180  CTNVKPSIIGKVVPAACS  1233
             C NVKP+I GK     C+
Sbjct  453   CANVKPTITGKSSLPLCA  470



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   368 bits (945),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 252/370 (68%), Gaps = 4/370 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
              +V  +GAKGDG +D S+A   AW  AC +   A  +   G F    +   GPCK P+  
Sbjct  25    LNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEF  84

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
             + Q   L A  DP  FK  G WV F ++ G+T++GG  FDG G T W   DC KN +   
Sbjct  85    ELQG-TLKAPADPSLFKTDG-WVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTNCRT  142

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL+FN VT   +  +T  +SK F + +  +K++T + + V+AP +S NTDG+HIG++
Sbjct  143   LPTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHIGRS  202

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
               V+I+ + IKTGDDCVSLGDG + + V+ VTCGPGHG+++GSLGKY NE+PV GV V N
Sbjct  203   DGVNILDSDIKTGDDCVSLGDGSRQITVKGVTCGPGHGISVGSLGKYENEEPVEGVFVTN  262

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT+    NG RIKTWP S  G+A++MHFEDI M+NV NP+++DQ YCP+NQCKAG+ S +
Sbjct  263   CTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPFNQCKAGVPSLI  322

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S + FK I+GTS+S++A+K+ CS +VPCQ V + DI+L+Y G +G A S+C NVKP +
Sbjct  323   KISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVL  382

Query  1204  IGKVVPAACS  1233
              GK+ PAAC+
Sbjct  383   SGKLNPAACA  392



>emb|CDX74027.1| BnaA03g30200D [Brassica napus]
Length=421

 Score =   369 bits (946),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDGK DDSKAF  AW  AC++   + I    GK++   + F+GPCK  +T 
Sbjct  45    IDVKASGAKGDGKTDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKSAVTF  104

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHIC  480
             +    +++A       K H GW+ F ++    +NG   IFDG GA  W + DC K G   
Sbjct  105   EMDG-HIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGAHAWKINDCAKTGKCN  163

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++   +T  ++ G+ + NSK FH+ I + K++T+E   +DAP  S NTDG+HIG+
Sbjct  164   TLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLNTDGIHIGR  223

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V ++ A IKTGDDC+S+GDG ++  VE V CGPGHG+AIGSLGKYPNE+PV GVT++
Sbjct  224   SDGVRLVRAKIKTGDDCISIGDGTENFLVENVECGPGHGIAIGSLGKYPNEQPVRGVTIR  283

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
                + NT NG RIKTWPGSP G  +N+ F+DI M+NVS PILIDQ YCP   CK G  SK
Sbjct  284   RSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPHGHCKKGGPSK  343

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I +++IKGTS+SK+A+K+ CSP VPC  V +++I+ +Y GK G AVS C++VKP 
Sbjct  344   VKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPK  403

Query  1201  IIGKVVPAACS  1233
             + GK+ P AC+
Sbjct  404   LKGKMEPPACT  414



>ref|XP_009134998.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=421

 Score =   369 bits (946),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDGK DDSKAF  AW  AC++   + I    GK++   + F+GPCK  +T 
Sbjct  45    IDVKASGAKGDGKTDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKSAVTF  104

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHIC  480
             +    +++A       K H GW+ F ++    +NG   IFDG GA  W + DC K G   
Sbjct  105   EMDG-HIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGAHAWKINDCAKTGKCN  163

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++   +T  ++ G+ + NSK FH+ I + K++T+E   +DAP  S NTDG+HIG+
Sbjct  164   TLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLNTDGIHIGR  223

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V ++ A IKTGDDC+S+GDG ++  VE V CGPGHG+AIGSLGKYPNE+PV GVT++
Sbjct  224   SDGVRLVRAKIKTGDDCISIGDGTENFLVENVECGPGHGIAIGSLGKYPNEQPVRGVTIR  283

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
                + NT NG RIKTWPGSP G  +N+ F+DI M+NVS PILIDQ YCP   CK G  SK
Sbjct  284   RSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPHGHCKKGGPSK  343

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I +++IKGTS+SK+A+K+ CSP VPC  V +++I+ +Y GK G AVS C++VKP 
Sbjct  344   VKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPK  403

Query  1201  IIGKVVPAACS  1233
             + GK+ P AC+
Sbjct  404   LKGKMEPPACT  414



>emb|CDY07972.1| BnaC03g35510D [Brassica napus]
Length=421

 Score =   368 bits (945),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/371 (50%), Positives = 249/371 (67%), Gaps = 4/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDG  DDSKAF  AW  AC++   + I    GK++   + F+GPCK  +T 
Sbjct  45    IDVKASGAKGDGITDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKSAVTF  104

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING--GIFDGNGATTWNLPDCGKNGHIC  480
             +    +++A       K H GW+ F ++    +NG   IFDG GAT W + DC K G   
Sbjct  105   EMDG-HIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGATAWKINDCAKTGKCN  163

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++   +T  ++ G+ + NSK FH+ I + K++T+E   +DAP  S NTDG+HIG+
Sbjct  164   TLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLNTDGIHIGR  223

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V ++ A IKTGDDC+S+GDG ++  VE V CGPGHG+AIGSLGKYPNE+PV GVT++
Sbjct  224   SDGVRLVRAKIKTGDDCISIGDGTENFLVENVECGPGHGIAIGSLGKYPNEQPVRGVTIR  283

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
                + NT NG RIKTWPGSP G  +N+ F+DI M+NVS PILIDQ YCP   CK G  SK
Sbjct  284   RSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPHGHCKKGGPSK  343

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I +++IKGTS+SK+A+K+ CSP VPC  V +++I+ +Y GK G AVS C++VKP 
Sbjct  344   VKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPK  403

Query  1201  IIGKVVPAACS  1233
             + GK+ P AC+
Sbjct  404   LKGKMEPPACT  414



>gb|KCW46857.1| hypothetical protein EUGRSUZ_K00661 [Eucalyptus grandis]
Length=370

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/399 (47%), Positives = 256/399 (64%), Gaps = 45/399 (11%)
 Frame = +1

Query  61    ILIQAAWFCILL---ASFVTG----LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKA  219
             ++ +AA F  LL   A+  TG    +  A  DV KFGAK DG++DDS+A           
Sbjct  5     MMARAAIFLYLLSLAAAMRTGGVSMIGQAEIDVRKFGAKADGRSDDSQADVN--------  56

Query  220   PGANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGV  399
                             +  +G  K P  ++              FK  G WV F  + G+
Sbjct  57    ----------------LKVEGAVKAPADLNK-------------FKSQGSWVLFQNIDGL  87

Query  400   TINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIG  576
             T++GG  FDG GA  W   +C + G    LP NLQF ++    +  +T+ NSK FH+ + 
Sbjct  88    TLSGGGSFDGQGAAAWKENNCAQTGKCNSLPTNLQFTSINNSHVQDITSLNSKLFHVELL  147

Query  577   SSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKV  756
             +  +VT++  T+DAP +S NTDG+H+G++  V+IIGA I+TGDDCVSLGDG Q VH+E V
Sbjct  148   NCNNVTLQHVTIDAPEDSLNTDGIHVGRSMGVNIIGADIRTGDDCVSLGDGSQQVHIEGV  207

Query  757   TCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDI  936
             TCGPGHG+++GSLGKY +E+PV+GVTV+NCTLTNT+NG R+KTWP SP G A+ MHFEDI
Sbjct  208   TCGPGHGISVGSLGKYHDEQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDI  267

Query  937   IMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQ  1116
              +NNVS PILIDQ YCP+N C+  + SKVK+S + F+NI+GTS++ +A+K+ CS  VPCQ
Sbjct  268   TVNNVSTPILIDQNYCPYNNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQ  327

Query  1117  GVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              V + DINL Y G++G+A S+C NVKP+I GK+    C+
Sbjct  328   KVELADINLRYNGRNGTATSQCENVKPTIAGKLSLPICA  366



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   386 bits (991),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 184/384 (48%), Positives = 263/384 (68%), Gaps = 12/384 (3%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPITI  306
             FDV K+GA+ DG +D S+A   AWG AC +P A+T+    G +  G I   GPCK PI  
Sbjct  28    FDVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINF  87

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
               Q   ++A  D   F+   GW+TF Q+   T++G G+FDG G   W    C  + +   
Sbjct  88    VVQG-TVMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWG-TKCLSSAYCNQ  145

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL+FN +T   +  +T+R+SKQFH+ +   K++T     + AP  S NTDG+HIG++
Sbjct  146   LPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHIGRS  205

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             S ++I  +TI+TGDDCVS+GDG + +++++VTCGPGHG+++GSLGKYPNE+PV+G++VKN
Sbjct  206   SGINITDSTIETGDDCVSIGDGSEQINIQRVTCGPGHGISVGSLGKYPNEEPVVGISVKN  265

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CTLTNT NG R+KTWP S  G+A+ MHFEDI+MNNV NPI+IDQ+YCP NQC     S++
Sbjct  266   CTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPHNQCNLKSPSRI  325

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S + F+NI+GT+S+++A+K+ CS  VPC  V + DINL Y G +G A+S+C N+KP++
Sbjct  326   KISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPNL  385

Query  1204  IGKVVPAACSVHK*KIPAGISTVL  1275
             +G  +P        +I  GIS +L
Sbjct  386   LGVQLP--------RISMGISRIL  401



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 255/384 (66%), Gaps = 4/384 (1%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAG  264
             I L  F +   +   D+ K+GA G   +D ++A   AW  AC A  A+ +   AG ++  
Sbjct  11    IALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKVLVPAGTYVLR  70

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATT  441
              +  +GPCK  I +      L A  DP   K  G WV F  V  +T++G G FDG G T 
Sbjct  71    EVVLEGPCKSSIEVQVDG-TLQAPADPAQMKTDG-WVAFRGVDLLTLSGSGTFDGQGKTA  128

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W   DC        LP N++F++VT   +  +T+ +SKQFH+ + + K++T +  T+ AP
Sbjct  129   WTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNLTFQHVTITAP  188

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
             G+SPNTDG+HIG+++ ++II   IKTGDDC+S+GDG + + +  VTCGPGHG+++GSLGK
Sbjct  189   GDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCGPGHGISVGSLGK  248

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQY  981
             YPNE+PV G+ VKNCT+T T+NG RIKTWP SP G+A++MHFEDI ++NV NP++IDQQY
Sbjct  249   YPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQY  308

Query  982   CPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD  1161
             CPWNQCK+   S++K+S + F  I+GTSS++ A+ + CS  +PC  V ++DI++ Y G +
Sbjct  309   CPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPE  368

Query  1162  GSAVSKCTNVKPSIIGKVVPAACS  1233
             G A S C+NVKP+I GK  PA C+
Sbjct  369   GPATSVCSNVKPTISGKQNPAICT  392



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 184/379 (49%), Positives = 247/379 (65%), Gaps = 3/379 (1%)
 Frame = +1

Query  100   SFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-NTITAAGKFMAGPIWF  276
             SF + + A  F +  +   G G  D +++   AW  AC +      +   G F    +  
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  277   QGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGGIFDGNGATTWNLPD  456
             +GPCK  +  +     LLA P+   FK  G WV F  + G+T+ GG FDG G   W   D
Sbjct  75    EGPCKAHVEFEVHA-RLLAPPELSRFKTDG-WVVFHNIDGLTMLGGTFDGQGKMAWAQND  132

Query  457   CGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPN  636
             C KN +   LP NL+FN V+   +  +T+ +SK FH+ +   K+VT + + V+APGNS N
Sbjct  133   CIKNKNCRMLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPGNSVN  192

Query  637   TDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEK  816
             TDG+HIG++  V+I+   IKTGDDCVSLGDG + V V+ +TCGPGHG+++GSLGKY NE+
Sbjct  193   TDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKYDNEE  252

Query  817   PVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQ  996
             PV GV V NCT+    NG RIKTWP S +G AT+MHFEDI MNNV NP+LIDQ YCPWNQ
Sbjct  253   PVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPWNQ  312

Query  997   CKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVS  1176
             C+A + S VK+S + FK I+GTS++K+A+KI CS  +PC+GV + DINL+YKG DG A S
Sbjct  313   CQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATS  372

Query  1177  KCTNVKPSIIGKVVPAACS  1233
             +C+NV+P I G   P AC+
Sbjct  373   ECSNVRPLISGMQNPRACA  391



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 255/384 (66%), Gaps = 4/384 (1%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAG  264
             I L  F +   +   D+ K+GA G   +D ++A   AW  AC A  A+ +   AG ++  
Sbjct  11    IALLFFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKVLVPAGTYVLR  70

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATT  441
              +  +GPCK  I +      L A  DP   K  G WV F  V  +T++G G FDG G T 
Sbjct  71    EVVLEGPCKSSIEVQVDG-TLQAPADPAQMKTDG-WVAFRGVDLLTLSGSGTFDGQGKTA  128

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W   DC        LP N++F++VT   +  +T+ +SKQFH+ + + K++T +  T+ AP
Sbjct  129   WTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNLTFQHVTITAP  188

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
             G+SPNTDG+HIG+++ ++II   IKTGDDC+S+GDG + + +  VTCGPGHG+++GSLGK
Sbjct  189   GDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGDGSEQMTITGVTCGPGHGISVGSLGK  248

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQY  981
             YPNE+PV G+ VKNCT+T T+NG RIKTWP SP G+A++MHFEDI ++NV NP++IDQQY
Sbjct  249   YPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQY  308

Query  982   CPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD  1161
             CPWNQCK+   S++K+S + F  I+GTSS++ A+ + CS  +PC  V ++DI++ Y G +
Sbjct  309   CPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPE  368

Query  1162  GSAVSKCTNVKPSIIGKVVPAACS  1233
             G A S C+NVKP+I GK  PA C+
Sbjct  369   GPATSVCSNVKPTISGKQNPAICA  392



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 263/409 (64%), Gaps = 6/409 (1%)
 Frame = +1

Query  13    NKRGNTSNQ*REDMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFT  192
             N+      Q   +M  I I  A   +L   F +   +   D+ K+GA G   +D ++A  
Sbjct  53    NEEAEERRQQWVEMGKISILPAAIALLF--FASTARSLVCDIAKYGAGGGTSSDITQALV  110

Query  193   GAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGG  369
              AW  AC A  A+ +   AG ++   +  +GPCK  I +      L A  DP   K  G 
Sbjct  111   SAWKEACAATEASKVLVPAGTYVLREVVLEGPCKSSIEVQVDG-TLQAPADPAQMKTDG-  168

Query  370   WVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNR  546
             WV F  V  +T++G G FDG G T W   DC        LP N++F++VT   +  +T+ 
Sbjct  169   WVAFRGVDLLTLSGSGTFDGQGKTAWTKNDCNLKTDCVTLPINIRFDSVTNGMVKDITSL  228

Query  547   NSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGD  726
             +SKQFH+ + + K++T +  T+ APG+SPNTDG+HIG+++ ++II   IKTGDDC+S+GD
Sbjct  229   DSKQFHVNVLNCKNLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGDDCISIGD  288

Query  727   GVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG  906
             G + + +  VTCGPGHG+++GSLGKYPNE+PV G+ VKNCT+T T+NG RIKTWP SP G
Sbjct  289   GSEQMTITGVTCGPGHGISVGSLGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAG  348

Query  907   SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMK  1086
             +A++MHFEDI ++NV NP++IDQQYCPWNQCK+   S++K+S + F  I+GTSS++ A+ 
Sbjct  349   TASDMHFEDITLDNVGNPVIIDQQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVT  408

Query  1087  IDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             + CS  +PC  V ++DI++ Y G +G A S C+NVKP+I GK  PA C+
Sbjct  409   LACSSRLPCTEVEISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAICT  457



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 246/370 (66%), Gaps = 6/370 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             FDVM FGAK DGK D S+A   AW  AC     +  +   G+++   +   GPCK P+ +
Sbjct  29    FDVMNFGAKADGKTDISQALMAAWRKACAVVSPSKVVIPEGEYILSQVTLAGPCKAPLEV  88

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGA-TTWNLPDCGKNGHIC  480
                +  L A  DP  F     WVTF ++   T++G G FDG G    W   DC + G   
Sbjct  89    QV-RGTLKATADPSKFNNVPTWVTFQRIDRFTLSGAGTFDGQGGKAAWAQNDCKQVGRCN  147

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FNAVT   +  +T+ +SKQ H+ + S K++T    TV+AP  SPNTDG+HIG+
Sbjct  148   KLPINLRFNAVTNGLVRDITSVDSKQTHINLLSCKNLTFANITVNAPAQSPNTDGIHIGR  207

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S ++I  + I TGDDCVSLG+G Q + V +VTCGPGHG+++GSLG+Y  E PV G+TV 
Sbjct  208   SSGINITDSRISTGDDCVSLGEGSQKITVRRVTCGPGHGISVGSLGRY-REDPVFGITVA  266

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTL NT NG R+KTWP S  G A++MHFEDI+M NVSNP+LIDQ+YCP N+C A   S+
Sbjct  267   NCTLINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPGNKC-AKAPSR  325

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VK+S + FKNI+GTS++++A+++ CS  +PC+ V + DINL Y G +G A S+C+NVKP 
Sbjct  326   VKISNVSFKNIRGTSATQVAVELRCSSGIPCENVEIGDINLSYIGTEGPATSRCSNVKPI  385

Query  1201  IIGKVVPAAC  1230
             I GK  P AC
Sbjct  386   ITGKQTPLAC  395



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   364 bits (934),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/393 (47%), Positives = 259/393 (66%), Gaps = 6/393 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVM-KFGAKGDGKADDSKAFTGAWGAACKAPGANTIT  240
             ++ + +  +LL    + +    FDV+ KFGAK DGK D SK F  AW  AC +   +T+ 
Sbjct  7     IVPSMFVLLLLFISASKVQPDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVV  66

Query  241   -AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI-NGG  414
                G ++   +  +GPCK PI I+ Q   + A  DP AFK    WV F  V    +  GG
Sbjct  67    IPKGTYLLSKVNLEGPCKAPIEINVQG-TIQAPADPSAFK-DPNWVRFYSVENFKMFGGG  124

Query  415   IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVT  594
             IFDG G+  +    C        LP N++F+ VT   +  +T+++SK FH+ + + K++T
Sbjct  125   IFDGQGSIAYEKNTCENREFRSKLPVNIRFDFVTNALIQDITSKDSKLFHINVFACKNIT  184

Query  595   IERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGH  774
             +ER  ++AP  SPNTDG+H+G++  V+II + IKTGDDC+S+GDG +++ ++++TCGPGH
Sbjct  185   LERLKIEAPDESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGH  244

Query  775   GLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVS  954
             G++IGSLGK+ NE+PV G+ + NCT+TNT NGARIKTWPG   G+ + +HFEDI MNNVS
Sbjct  245   GISIGSLGKFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVS  304

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             +PILIDQQYCPWN+CK    SKVKLS I FKNI+GTS+   A+K  CS + PCQ V + D
Sbjct  305   SPILIDQQYCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELAD  364

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             I++ + G +  A S+C NVKP  IGK+ P  CS
Sbjct  365   IDIQHNGAE-PATSQCLNVKPITIGKLNPIPCS  396



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   367 bits (942),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 192/398 (48%), Positives = 258/398 (65%), Gaps = 8/398 (2%)
 Frame = +1

Query  58    SILIQAAWFCILLASFVTGL---HAAFFDVM-KFGAKGDGKADDSKAFTGAWGAACKAPG  225
             ++ +  A   ILL  F T +    +   DV+ K+GAK D K D S     AW  AC +  
Sbjct  2     AVQLNIAVLSILLLLFSTSIPKAQSTVVDVVAKYGAKADEKTDLSTPLLHAWKEACASTT  61

Query  226   ANTIT-AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVT  402
              + I    G +        GPCK  I +      + A  DP AFK    WV F+ V  +T
Sbjct  62    PSKIVIPKGTYRLSRATLDGPCKSAIELQVSG-TIKAPADPSAFK-DPNWVVFNHVDHLT  119

Query  403   INGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGS  579
             I+GG +FDG GA  W   +C KN +   LP NL+FN V+   + G+T ++SKQFH+ +  
Sbjct  120   ISGGGVFDGQGAAVWGKNNCAKNKYCAALPINLRFNFVSNAIVQGITTKDSKQFHVNVLG  179

Query  580   SKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVT  759
              K+ T + +TV AP NS NTDG+HIG+++ + I+   IKTGDDCVSLGDG ++V VE+VT
Sbjct  180   CKNFTFQHFTVSAPENSINTDGIHIGRSNGIKILDTNIKTGDDCVSLGDGSKNVIVERVT  239

Query  760   CGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDII  939
             CGPGHG+++GSLGK+  E+PV G+ ++NCT++NT+NG R+KTWP S  GSAT+MHFEDII
Sbjct  240   CGPGHGISVGSLGKFKGEEPVSGIFIRNCTISNTMNGVRVKTWPDSHPGSATDMHFEDII  299

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             +NNV NPILIDQ+YCPWN C   + S+VKLS I FK I GTSS++ A+K+ CS  +PC  
Sbjct  300   LNNVGNPILIDQEYCPWNLCNLKVPSRVKLSNISFKKIWGTSSTQQAVKLVCSRGLPCDR  359

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             V + DI++ YKG  G A+S+C NVKP + GK  P ACS
Sbjct  360   VELADIDITYKGPGGPAISQCINVKPRLSGKQNPPACS  397



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 184/374 (49%), Positives = 250/374 (67%), Gaps = 7/374 (2%)
 Frame = +1

Query  118   HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKG  294
               A FDV K GAK DG +D S+A   AW  AC +P  +++   AG +  G I F+GPCK 
Sbjct  24    EGASFDVTKHGAKADG-SDISQALLAAWKEACASPTPSSVLVPAGTYGLGQICFEGPCKA  82

Query  295   PITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNG  471
             PI +  +   L A  D   FK   GWV F  +   T++G G+FDG G   W    C ++ 
Sbjct  83    PINLIVEG-TLKAPVDTKNFKADAGWVAFQNIDHFTLSGKGVFDGQGPAVWG-KKCARSS  140

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
             +   LP NL+FN +T   +  +T ++SKQFH+ +   K+++   +TV AP  S NTDG+H
Sbjct  141   YCGALPINLKFNFLTNSMVRDVTTKDSKQFHVNVLGCKNLSFYHFTVSAPEESLNTDGIH  200

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             IG++S ++I    IKTGDDC+S+GDG + + +++VTCGPGHG+++GSLGKY NE PV+G+
Sbjct  201   IGRSSGINITNTNIKTGDDCISIGDGSEQITIDQVTCGPGHGISVGSLGKYANEAPVVGI  260

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
              V   TLTNT NG R+KTWP SP G A+NMHFEDIIMNNV NPILIDQ+YCP++QCK  +
Sbjct  261   KVTGSTLTNTQNGIRVKTWPASPAGIASNMHFEDIIMNNVGNPILIDQEYCPYSQCKQQI  320

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              S+VK+S + FKNI+GTSS+++A+K+ CS  VPCQ V + DINL + G  G+  S C NV
Sbjct  321   PSRVKISDVTFKNIRGTSSTELAVKLVCSSGVPCQNVQLTDINLKFNG--GAPTSICKNV  378

Query  1192  KPSIIGKVVPAACS  1233
             KP + G   P +CS
Sbjct  379   KPILGGVQQPRSCS  392



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   362 bits (930),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 183/377 (49%), Positives = 245/377 (65%), Gaps = 3/377 (1%)
 Frame = +1

Query  100   SFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-NTITAAGKFMAGPIWF  276
             SF + + A  F +  +   G G  D +++   AW  AC +      +   G F    +  
Sbjct  15    SFSSTIIAQVFQIENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVL  74

Query  277   QGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGGIFDGNGATTWNLPD  456
             +GPCK  +  +     LLA P+   FK  G WV F  + G+T+ GG FDG G   W   D
Sbjct  75    EGPCKAHVEFEVHA-RLLAPPELSRFKTDG-WVVFHNIDGLTMLGGTFDGQGKMAWAQND  132

Query  457   CGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPN  636
             C KN +   LP NL+FN V+   +  +T+ +SK FH+ +   K+VT + + V+APGNS N
Sbjct  133   CIKNKNCRMLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPGNSVN  192

Query  637   TDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEK  816
             TDG+HIG++  V+I+   IKTGDDCVSLGDG + V V+ +TCGPGHG+++GSLGKY NE+
Sbjct  193   TDGIHIGRSLGVNILDTDIKTGDDCVSLGDGSRQVTVKGLTCGPGHGISVGSLGKYDNEE  252

Query  817   PVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQ  996
             PV GV V NCT+    NG RIKTWP S +G AT+MHFEDI MNNV NP+LIDQ YCPWNQ
Sbjct  253   PVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPWNQ  312

Query  997   CKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVS  1176
             C+A + S VK+S + FK I+GTS++K+A+KI CS  +PC+GV + DINL+YKG DG A S
Sbjct  313   CQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATS  372

Query  1177  KCTNVKPSIIGKVVPAA  1227
             +C+NV+P I G   P A
Sbjct  373   ECSNVRPLISGMQNPRA  389



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/393 (47%), Positives = 259/393 (66%), Gaps = 6/393 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVM-KFGAKGDGKADDSKAFTGAWGAACKAPGANTIT  240
             ++ + +  +LL    + + +  FDV+ KFGAK DGK D SK F  AW  AC +   +T+ 
Sbjct  7     IVPSMFVLLLLFISASKVQSDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTVV  66

Query  241   -AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI-NGG  414
                G ++   +  +GPCK PI I+ Q   + A  DP AFK    WV F  V    +  GG
Sbjct  67    IPKGTYLLSKVNLEGPCKAPIEINVQGT-IQAPADPSAFK-DPNWVRFYSVENFKMFGGG  124

Query  415   IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVT  594
             IFDG G+  +    C        LP N++F+ +T   +  +T+++SK FH+ + + K++T
Sbjct  125   IFDGQGSIAYEKNTCENREFRSKLPVNIRFDFLTNALIQDITSKDSKLFHINVFACKNIT  184

Query  595   IERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGH  774
             +ER  ++AP  SPNTDG+H+G++  V+II + IKTGDDC+S+GDG +++ ++++TCGPGH
Sbjct  185   LERLKIEAPDESPNTDGIHMGKSEGVNIIASDIKTGDDCISIGDGTKNMVIKEITCGPGH  244

Query  775   GLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVS  954
             G++IGSLGK+ NE+PV G+ + NCT+TNT NGARIKTWPG   G+ + +HFEDI MNNVS
Sbjct  245   GISIGSLGKFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVS  304

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             +PILIDQQYCPWN+CK    SKVKLS I FKNI+GTS+   A+K  CS + PCQ V + D
Sbjct  305   SPILIDQQYCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELAD  364

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             I++ + G +  A S+C NVKP   GK+ P  CS
Sbjct  365   IDIKHNGAE-PATSQCLNVKPITSGKLNPIPCS  396



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   365 bits (936),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 249/370 (67%), Gaps = 4/370 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAP-GANTITAAGKFMAGPIWFQGPCKGPITI  306
             F V  + AKG G  D +++  GAW  AC +   A    A G F    +  +GPCK  +  
Sbjct  59    FQVENYSAKGGGIPDITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAHVEF  118

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
             +  +  L A  DP  FK  G WV F ++ G+T++GG  FDG G   W   DC KN +   
Sbjct  119   EI-RGRLQAPADPSRFKTDG-WVVFQRIDGLTVSGGGTFDGQGKIAWGQNDCDKNTNCRT  176

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL+FN V+   +  +T  +SK FH+ +  +K++T E + V+APG+S NTDG+HIG++
Sbjct  177   LPTNLRFNFVSNAIIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIGRS  236

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
               V+I+   IKTGDDCVSLGDG + + V  VTCGPGHG+++GSLGKY NE+PV GV V N
Sbjct  237   LGVNILDTNIKTGDDCVSLGDGSRQITVRGVTCGPGHGISVGSLGKYDNEEPVSGVFVTN  296

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT+T   NGARIKTW  S +G AT+MHF+D+ MN+V+NP+LIDQ YCP+NQC+A + S V
Sbjct  297   CTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPFNQCQAQIPSLV  356

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S + F+ I+GTSS+K+A+KI CS  +PC+GV + DINL+YKG DG A S+C+NV+P I
Sbjct  357   KISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLI  416

Query  1204  IGKVVPAACS  1233
              G   P AC+
Sbjct  417   SGMQNPLACA  426


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
             A  VK+S + F++I+GTS++ +A K+ C   VPCQ + + DINL Y G++G++ S+  N+
Sbjct  426   AEIVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGASTSQSANM  485

Query  1192  KPSIIGKVVPAACS  1233
             KP+I GK     C+
Sbjct  486   KPTITGKSSLPICA  499



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   363 bits (933),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 250/371 (67%), Gaps = 4/371 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAP-GANTITAAGKFMAGPIWFQGPCKGPIT  303
             +FDV K+GA+ DGK D S+A   AW AAC +P  +  +  AG +  G +  +GPCK PI 
Sbjct  216   YFDVTKYGAQADGKTDISQALLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPIN  275

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHIC  480
             +   K  + A  D   FK   GWV F  +   T++G G+FDG G + W    C +  +  
Sbjct  276   LIV-KGTVRAPVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWG-QKCSRTKYCN  333

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP NL+FN +T   +  +T+++SKQFH+ +   +++T  +  + AP +S NTDG+HIG+
Sbjct  334   QLPINLRFNFLTNSIIKDITSKDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGR  393

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V+I  +TI+TGDDCVS+GDG + + + KV CGPGHG+++GSLG Y NE PV+G+ VK
Sbjct  394   SRGVNITHSTIQTGDDCVSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVK  453

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NCTL++T NG R+KT+P SP G+AT MHF DI+MNNVSNPI+IDQ+YCP NQC   + S+
Sbjct  454   NCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSR  513

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I FKNI+GT+S+++A+ + CS   PCQ V + +I+L Y G +G+A S+C NV+ +
Sbjct  514   VKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEAT  573

Query  1201  IIGKVVPAACS  1233
             + G   P  C+
Sbjct  574   LWGTQQPKTCA  584


 Score =   213 bits (542),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +1

Query  589   VTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGP  768
             +T++  T++A  +S NTDG+H+G+++ V+I  A IKTGDD +S+GDG Q ++VEKVTCGP
Sbjct  1     MTLQYVTINATRDSLNTDGIHMGRSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGP  60

Query  769   GHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNN  948
             GHG+++GSLGKY NE+PV+GVTVKNCTL NT+NG R+KTWP SP   AT++HFEDIIMNN
Sbjct  61    GHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNN  120

Query  949   VSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSK  1074
             V NPILI+Q+YCP++QC+A + S+VK+S + F+ I   S ++
Sbjct  121   VGNPILINQEYCPYDQCQAKVPSQVKISDVSFQGICSMSGTQ  162



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   358 bits (918),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 243/369 (66%), Gaps = 3/369 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             F + K+G  G    D +KAF+ AW AAC +P  +  +   G ++   + F+GPCK P+ +
Sbjct  61    FSITKYGLIGTEDEDITKAFSIAWKAACSSPSLSQLVIPNGSYILRQVRFEGPCKAPLEL  120

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                 + + A  DP  F    GW+TF ++   T+ G G FDG G+T W+  DC K G    
Sbjct  121   QVHGI-IKAPEDPSDFIEKAGWITFQRIDHFTLVGNGTFDGQGSTAWSHNDCHKTGECNK  179

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP N++FN +T   +  +T+ NSK FH+ +    ++T +R  + AP +SPNTDG+HIG++
Sbjct  180   LPINIRFNFITNGLVQDITSLNSKLFHINVLGCTNLTFDRVKIKAPEDSPNTDGIHIGRS  239

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
               ++II + + TGDDC+S+G G +++ +E+V CGPGHG+++GSLG+Y  E+PV G+ V+N
Sbjct  240   KNINIIDSEMSTGDDCISMGRGSENITIERVKCGPGHGISVGSLGRYTKEEPVSGIIVRN  299

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT  NT NG R+KTW  S    AT +HF DI + NVSNPI+IDQ+YCP++ CKA   S+V
Sbjct  300   CTFFNTDNGVRVKTWLSSEKAIATGLHFHDITVVNVSNPIVIDQEYCPYDHCKAKKPSQV  359

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             KLS I FKNI GTSS+KMAMK+ CS  VPC+ V +++I++ Y G DG ++S CTNV P  
Sbjct  360   KLSNISFKNIHGTSSTKMAMKLACSSGVPCENVEISNIDIKYIGSDGVSMSDCTNVSPKT  419

Query  1204  IGKVVPAAC  1230
              GK  P+AC
Sbjct  420   FGKQYPSAC  428



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   356 bits (914),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 250/391 (64%), Gaps = 6/391 (2%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAP-GANTITA  243
             I  A+F  LL +  +      FDV  +GA+ +   D ++A + AW  AC +P     +  
Sbjct  7     IIGAYFLSLLLALASARKPLVFDVTTYGAQLN--MDITQALSNAWKDACASPIRGKVLIP  64

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI-NGGIF  420
              G +       +GPCK PI +  Q   L A  DP  F    GWVTF  V G+T+  GG F
Sbjct  65    RGTYKLSRATLEGPCKVPIKVQLQGT-LRAPTDPSGFNEGDGWVTFRNVDGLTLAGGGTF  123

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G+  W   +C +  +   LP N +F+ VT   +  + + NSKQFH+ +   ++VT  
Sbjct  124   DGQGSAVWG-KNCEQQQYCGKLPINFRFDFVTNSLIRDIISLNSKQFHINVLGGQNVTFS  182

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
             R  + AP +SPNTDG+HIG++S +SI    I+TGDDCVSLGDG +++ + +VTCGPGHG+
Sbjct  183   RVKIIAPEDSPNTDGIHIGRSSGISITDTVIQTGDDCVSLGDGCKEISIRRVTCGPGHGI  242

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             ++GSLGKY NE PV GV V+NCT+ NT NG R+KTWP S  G A+N+HFEDI+M NV NP
Sbjct  243   SVGSLGKYSNEDPVEGVIVRNCTIRNTSNGVRVKTWPDSHDGLASNLHFEDIVMENVGNP  302

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             +LIDQ+YCPWNQC A + S++K+S + FKNI+GTS++ +A+ + CS   PCQ V + DI+
Sbjct  303   VLIDQEYCPWNQCNAKVPSRIKISDVSFKNIRGTSTTALAVNLVCSSGFPCQNVEIADID  362

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             L Y G DG  +S+C NVKP+I GK  P  C+
Sbjct  363   LQYSGNDGPIMSQCKNVKPTISGKQNPNPCA  393



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/379 (48%), Positives = 244/379 (64%), Gaps = 4/379 (1%)
 Frame = +1

Query  76    AWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGK  252
             A F  LL++  T      FDV          +D + A   AW  AC +P  +  +  +G 
Sbjct  9     AAFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGT  68

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
             +M     F+GPCK PI I  Q   L A  D         WV F  V  +T++GG  FDG 
Sbjct  69    YMLTEASFKGPCKAPIEIQVQG-KLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGXFDGQ  127

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             GA  W   DC KN     +  N++FN VT   +  +T+ +SK FH+ +    +VT +R  
Sbjct  128   GALAWKKNDCNKNKDCKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFQRVN  187

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             V APG S NTDG+HIG+++ ++I  A I TGDDCVS+GDG +++ V +VTCGPGHG+++G
Sbjct  188   VTAPGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVG  247

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSNPIL  966
             SLG+YPNE+PV+G+ VKNCTLTNT NG RIKTWP SP  G A++MHFEDIIM NVSNP+L
Sbjct  248   SLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVL  307

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQQYCPWNQCK  + SKVK+S + FKNIKG+S++ +A++I CS  +PC+ V + DI+L 
Sbjct  308   IDQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLT  367

Query  1147  YKGKDGSAVSKCTNVKPSI  1203
             Y G  G   S+C+NVKP+I
Sbjct  368   YNGNKGPLTSQCSNVKPTI  386



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/395 (46%), Positives = 250/395 (63%), Gaps = 9/395 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             + S +I  + F +LLAS         FDV K+G+      D ++A T AW  AC +   +
Sbjct  6     VSSAIISFSLF-LLLASTAKAQSKGVFDVTKYGSD----KDITEALTNAWKDACASTNPS  60

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  +G +    +   GPCK  I +    M L A  DP  F G G WV F  V   T++
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGM-LKAPVDPNQFSG-GHWVNFGHVDKFTLS  118

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G FDG G   W+   C K+     LP NL+F+ +T   +  +T R+SK FH+ +   K
Sbjct  119   GSGTFDGQGKAAWSKSTCQKDKDCDSLPMNLRFDFITNALVRDITTRDSKNFHVNVLGCK  178

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T + +TV APG S NTDG+H+GQ++ + II + I TGDDC+S+GDG +++H+  VTCG
Sbjct  179   NLTFQHFTVSAPGESVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITGVTCG  238

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG+++GSLGKYPNEKPV G+ VKNCTL++T NG RIK+WP    G A+NMHFEDI+MN
Sbjct  239   PGHGISVGSLGKYPNEKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMN  298

Query  946   NVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVV  1125
             NV NP++IDQ YCPWNQC     SKVK+SG+ FKNI+GTS++ + ++I CS   PC+ V 
Sbjct  299   NVQNPVIIDQVYCPWNQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVE  358

Query  1126  MNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             + DI + Y G DG A S+C+NVKP I G +    C
Sbjct  359   LADIKVAYSGPDGPAKSQCSNVKPIISGTMSAPGC  393



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 170/384 (44%), Positives = 248/384 (65%), Gaps = 4/384 (1%)
 Frame = +1

Query  88    ILLASFV-TGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMA  261
             +L+ASFV +   +  F +  +G KG    D +KAF+ AW AAC +   +  I   G ++ 
Sbjct  18    LLVASFVQSAADSITFSITNYGLKGTEDEDITKAFSVAWEAACSSTSPSKLIVPKGTYVL  77

Query  262   GPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGAT  438
               + F+GPCK P+ +      + A  DP  F    GW++F ++    + G G FDG G+T
Sbjct  78    RQVVFEGPCKAPLELQVHG-TIKAPEDPSYFIEKAGWISFQRIDRFALVGNGTFDGQGST  136

Query  439   TWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDA  618
              W+  DC K G    LP N++FN +T   +  +T+ NSK FH+ +    ++T  R  + A
Sbjct  137   AWSQNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLTFSRVNIKA  196

Query  619   PGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLG  798
             P +SPNTDG+HIG++  ++I  + + TGDDC+S+G G +++ +E+V CGPGHG+++GSLG
Sbjct  197   PEDSPNTDGIHIGRSKNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGHGISVGSLG  256

Query  799   KYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQ  978
             +Y  E+PV G+ V+NCT  NT NG R+KTW  S    AT ++F+DI + NVSNPI+IDQ+
Sbjct  257   RYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPIVIDQE  316

Query  979   YCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGK  1158
             YCP+N CKA   S+VKLS I F+NI GTSS++MAMK+ CS  VPC+ V ++DI++ Y G 
Sbjct  317   YCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGS  376

Query  1159  DGSAVSKCTNVKPSIIGKVVPAAC  1230
             DG ++S CTNV P I GK  P+ C
Sbjct  377   DGDSMSDCTNVSPKIFGKQYPSPC  400



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 247/387 (64%), Gaps = 4/387 (1%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             M   L   A F  LL++  T      FDV          +D ++A   AW  AC +P  +
Sbjct  1     MARALNILAAFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITQALAKAWTDACASPTPS  60

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  +G +M     F+GPCK PI I  Q   L A  D         WV F  V  +T++
Sbjct  61    KVVVPSGTYMLTEASFKGPCKAPIEIQVQG-KLTAPADGGKLTKPDTWVCFEHVNKLTVS  119

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG  FDG GA  W   DC KN     +  N++F+ VT   +  +T+ +SK FH+ +    
Sbjct  120   GGGTFDGQGALAWKKNDCNKNKDCKSMAINMRFDFVTNSTIQDITSLDSKNFHVNVLGCH  179

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             +VT +R  V APG S NTDG+HIG+++ ++I  A I TGDDCVS+GDG +++ V +VTCG
Sbjct  180   NVTFQRVNVTAPGESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCG  239

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIM  942
             PGHG+++GSLG+YPNE+PV+G+ VKNCTLTNT NG RIKTWP SP  G A++MHFEDIIM
Sbjct  240   PGHGISVGSLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIM  299

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
              NVSNP+LIDQQYCPWNQCK  + SK+K+S + FKNIKG+S++ +A++I CS  + C+ V
Sbjct  300   VNVSNPVLIDQQYCPWNQCKQNVPSKIKISNVSFKNIKGSSATPLAVQIVCSSGIACEKV  359

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSI  1203
              ++DI+L Y G  G   S+C+NVKP+I
Sbjct  360   ELDDIDLTYNGNKGPLTSQCSNVKPTI  386



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   355 bits (911),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 187/385 (49%), Positives = 247/385 (64%), Gaps = 4/385 (1%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN  231
             MKS L     F +LL+  +       FDV  FGA    K D SKA   AW AAC  PGA+
Sbjct  1     MKSKLNILTIF-VLLSISLKIRAEKVFDVKNFGATPSQKNDISKALLDAWKAACSTPGAS  59

Query  232   TITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
              I     K+    +  +GPCKG + +   K  L+A  DP      G W+TF  V  +TI+
Sbjct  60    RILIPHAKYALRDVLLEGPCKGSMVLQI-KGTLMAPSDPSEHHSQG-WITFQHVDHLTIS  117

Query  409   GGIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKD  588
             GG  DG G   W    C  N +   LP NL+F+ VT   +  LT+R+SK FH+ +   ++
Sbjct  118   GGNLDGRGKIAWGKNTCRTNVNCKNLPMNLRFDFVTNTIIEDLTSRDSKNFHMNLIGCQN  177

Query  589   VTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGP  768
              T++R  + APG+S NTDG+HIG+++ V+II + I TGDDC+S+GDG +++ +  V CGP
Sbjct  178   FTLQRIKIIAPGDSANTDGIHIGRSNGVNIIDSKIGTGDDCISIGDGSRNIKITGVRCGP  237

Query  769   GHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNN  948
             GHG++IGSLGKY NE+PV GV VK C L NT NG RIK+WPG   G+AT++HFEDI MNN
Sbjct  238   GHGISIGSLGKYKNEEPVSGVYVKKCDLINTTNGIRIKSWPGLYSGTATDLHFEDISMNN  297

Query  949   VSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVM  1128
             VSN ILIDQ YCPWN C +  +S VK+S + F NIKGTSS    +K+ CS  +PC+GV +
Sbjct  298   VSNAILIDQMYCPWNHCNSKASSNVKISKVTFSNIKGTSSIPTIVKLLCSKGLPCEGVEL  357

Query  1129  NDINLIYKGKDGSAVSKCTNVKPSI  1203
             N+IN++YKG +G A S+CTNVKP I
Sbjct  358   NNINVVYKGPEGPAKSECTNVKPKI  382



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 248/384 (65%), Gaps = 4/384 (1%)
 Frame = +1

Query  88    ILLASFV-TGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMA  261
             +L+ASFV +   +  F +  +G KG    D +KAF+ AW AAC +   +  I   G ++ 
Sbjct  18    LLVASFVQSAADSVTFSIANYGLKGTEDEDITKAFSVAWKAACSSTSPSKLIVPKGTYVL  77

Query  262   GPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGAT  438
               + F+GPCK P+ +      + A  DP  F    GW++F ++    + G G FDG G+T
Sbjct  78    RQVVFEGPCKAPLELQVHG-TIKAPEDPSDFIEKAGWISFQRIDRFALVGNGTFDGQGST  136

Query  439   TWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDA  618
              W+  DC K G    LP N++FN +T   +  +T+ NSK FH+ +    ++T  R  + A
Sbjct  137   AWSQNDCHKTGECNKLPINIRFNFITNGLVQDITSLNSKLFHINVLGCNNLTFSRVNIKA  196

Query  619   PGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLG  798
             P +SPNTDG+HIG++  ++I  + + TGDDC+S+G G +++ +E+V CGPGHG+++GSLG
Sbjct  197   PEDSPNTDGIHIGRSKNINITDSVMSTGDDCISMGRGSENIAIERVKCGPGHGISVGSLG  256

Query  799   KYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQ  978
             +Y  E+PV G+ V+NCT  NT NG R+KTW  S    AT ++F+DI + NVSNP++IDQ+
Sbjct  257   RYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPVVIDQE  316

Query  979   YCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGK  1158
             YCP+N CKA   S+VKLS I F+NI GTSS++MAMK+ CS  VPC+ V ++DI++ Y G 
Sbjct  317   YCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGS  376

Query  1159  DGSAVSKCTNVKPSIIGKVVPAAC  1230
             DG ++S CTNV P I GK  P+ C
Sbjct  377   DGDSMSDCTNVSPKIFGKQYPSPC  400



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   355 bits (911),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 179/371 (48%), Positives = 243/371 (65%), Gaps = 4/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
             FDV      G   +D ++A + AW  AC +   +T+    G F      F+GPCK PI  
Sbjct  27    FDVTSAKYGGKPNSDITQALSKAWTDACASTSPSTLVVPKGTFKFLGTTFKGPCKAPIAF  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
               Q + L A  D         W++F  +  +TI+GG  FDG GA  W   DC KN +   
Sbjct  87    QLQGI-LQAPVDGNQLPKKDTWISFDHIDRLTISGGGTFDGQGAIAWKQNDCHKNKNCKS  145

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             +  NL+FN +T  R+  +T ++SK FH+ +    +V    +TV AP  S NTDG+HIG++
Sbjct  146   IAINLRFNFITNSRIEYITTKDSKNFHVNVLGCTNVAFHHFTVSAPKESINTDGIHIGRS  205

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + +SII +TIKTGDDC+S+GDG ++++V  VTCGPGHG++IGSLG+Y  E+PV G+T+KN
Sbjct  206   TGISIIDSTIKTGDDCISIGDGTKNLNVTNVTCGPGHGISIGSLGRYQKEEPVSGITIKN  265

Query  844   CTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             CTLT+T NG RIKTWP SP  G+A+++HFEDIIM NV NPILIDQ+YCPWNQC   + SK
Sbjct  266   CTLTDTQNGVRIKTWPASPSAGTASDIHFEDIIMVNVGNPILIDQEYCPWNQCTLKVPSK  325

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VK+S + FKNIKGTS++ +A+K+ CS  +PC+ V ++DI+L Y G  G   SKCTNVKP 
Sbjct  326   VKISNVSFKNIKGTSTTPLALKLVCSKGLPCENVELSDIDLKYTGNQGPLTSKCTNVKPK  385

Query  1201  IIGKVVPAACS  1233
             I     P AC+
Sbjct  386   ITRVTKPLACA  396



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 242/368 (66%), Gaps = 4/368 (1%)
 Frame = +1

Query  136   VMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAGKFMAGPIWFQGPCKGPITIDA  312
             V KFGAK D K D SK    AW  AC +   + I    G +        GPCK PI +  
Sbjct  36    VAKFGAKADEKTDLSKPLLDAWKEACASTSPSKIVIPKGIYFLSTATLDGPCKAPIELQV  95

Query  313   QKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLP  489
             Q   + A  DP AFK    W+ F+++    ++GG +FDG G T +    C  + +   LP
Sbjct  96    QG-TVKAPADPGAFK-EPKWIAFNRIENFKLSGGGVFDGQGTTAYKREGCKGHDYCGSLP  153

Query  490   ANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSK  669
              NL+F+ +T   +  +T ++SKQF   +   K++T E +TV AP  SPNTDG+HIG++  
Sbjct  154   INLRFDFLTNAMIQDITTKDSKQFQANVLGCKNITFEHFTVSAPDESPNTDGIHIGRSDG  213

Query  670   VSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCT  849
             V+++ + IKTGDDCVS+GDG +++ +  VTCGPGHG++IGSLG + NE+PV GVTVKNCT
Sbjct  214   VNVLNSEIKTGDDCVSIGDGSKNLVINGVTCGPGHGISIGSLGLFKNEEPVDGVTVKNCT  273

Query  850   LTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKL  1029
             +TNT NG RIKTWPG+  G+ +N+HFEDI + NVS+PI+IDQ+YCPWN+CK    SKVKL
Sbjct  274   MTNTSNGVRIKTWPGAEPGTCSNIHFEDITVTNVSSPIIIDQKYCPWNKCKINEESKVKL  333

Query  1030  SGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIG  1209
             S I FKNI GTS+   A+KI CS  +PC+ V + DI + + G  G AVS+C+NVKP + G
Sbjct  334   SNISFKNIHGTSARPEAVKIICSATLPCENVELADIEITHSGPTGPAVSQCSNVKPKVSG  393

Query  1210  KVVPAACS  1233
             K  PAACS
Sbjct  394   KQNPAACS  401



>ref|XP_009147021.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=517

 Score =   358 bits (919),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/371 (49%), Positives = 246/371 (66%), Gaps = 5/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDGK DD+ AF   W  A +A    TIT   G ++   +  +GP K  IT 
Sbjct  141   IDVKASGAKGDGKTDDTAAFMAVWKKAIEAATPTTITVPKGDYLVNELMLEGPSKCAITF  200

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI--NGGIFDGNGATTWNLPDCGKNGHIC  480
             D    NL A       K H GWV F ++    +  NG IFDG G+  W + DC + G   
Sbjct  201   DMHG-NLKAPSAVTTRKPHSGWVNFRKLKDFKLIGNGAIFDGQGSVAWKVNDCKQTGKCN  259

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++   +    + G+T+ NSK FH+ I    +VT++   +DAP  S NTDG+H+G+
Sbjct  260   NLPINIRLTQLNNSIISGITSTNSKLFHMNIHQCTNVTLQDVHIDAPPESLNTDGIHVGK  319

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V+I G+ IKTGDDC+S+G G +++ VE V CGPGHGL+IGSLGKYPNE+PV G+T++
Sbjct  320   SVGVTIRGSKIKTGDDCISIGGGTENLLVEGVECGPGHGLSIGSLGKYPNEQPVKGITIR  379

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
              C + +T NG RIKTWPGSP G  +   FEDI M+NVS PIL+DQ YCP  +CK+G  SK
Sbjct  380   KCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPHGKCKSG-PSK  438

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             V+L  + FKNI+GTSS+K+A++++CSP  PC+ V + DINL+  GK+G+AVS C+NVKP+
Sbjct  439   VQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAAVSACSNVKPT  498

Query  1201  IIGKVVPAACS  1233
             + GK++PAAC+
Sbjct  499   VTGKMIPAACT  509



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 244/369 (66%), Gaps = 8/369 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
             FDV K+G    GK D ++A   AW  AC +   + +   +G +    +   GPCK  I +
Sbjct  31    FDVTKYG----GKEDITEALNNAWKDACASTNPSKVHIPSGTYSLRQVTLAGPCKAAIEL  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                 + L A  DP  F G G WV FS V  +T++G G FDG G+  W+   C K+ +   
Sbjct  87    QVDGI-LKAPVDPNQFSG-GHWVDFSHVDQLTLSGSGTFDGQGSVAWSKSTCSKDKNCEG  144

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
              P N++F+ +T   +  +T R+SK FH+ +   K++T + +TV AP  S NTDG+HIG++
Sbjct  145   FPMNIRFDFITNGFVRDITTRDSKNFHVNVLECKNLTFQHFTVTAPAESINTDGIHIGRS  204

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + + II + I TGDDC+S+GDG +D+HV  VTCGPGHG+++GSLG+YPNEKPV G+ VKN
Sbjct  205   TGIYIIDSKIGTGDDCISVGDGTEDLHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKN  264

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT++NT NG RIK+WP    G A+NMHFEDI+MNNV NP+ +DQ+YCPWNQC     SKV
Sbjct  265   CTISNTANGVRIKSWPDLYGGDASNMHFEDIVMNNVQNPVAVDQEYCPWNQCSLKAPSKV  324

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S + FKNI+GTS++ + +K+ CS  +PC+ V + DINL+Y G +G A S+C+NVKP I
Sbjct  325   KISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELADINLVYSGSEGPAKSQCSNVKPII  384

Query  1204  IGKVVPAAC  1230
              G +  + C
Sbjct  385   SGIMSASGC  393



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   353 bits (905),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/370 (47%), Positives = 242/370 (65%), Gaps = 5/370 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACK-APGANTITAAGKFMAGPIWFQGPCKGPITI  306
             FDVM FGAK  GK D S+A   AW  AC     +  +   G+++   +   GPCK P+ +
Sbjct  29    FDVMNFGAKAGGKTDISQALMAAWREACALVSPSKVVIPEGEYVLSQVTLAGPCKAPVEV  88

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGA-TTWNLPDCGKNGHIC  480
                + NL A  DP  F     WVTF ++   T++G G FDG G    W   DC ++    
Sbjct  89    QV-RGNLKAPADPSKFNNVPSWVTFQRIDHFTLSGAGTFDGQGGYAAWAQNDCKQSKKCN  147

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++FN VT   +  +T+ +SKQFH+ +   K++T    T++AP  SPNTDG+HIG+
Sbjct  148   KLPINIRFNFVTNGLVRDITSVDSKQFHINLLGCKNLTFANITINAPDQSPNTDGIHIGR  207

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S + I  + I TGDDC+SLG G Q++ + +VTCGPGHG+++GSLGKY +E PV G+ V 
Sbjct  208   SSGIDITDSRISTGDDCISLGGGSQNITISRVTCGPGHGISVGSLGKYKDE-PVFGINVV  266

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             NC L NT NG R+KTWP S  G A++MHFEDI+M NVSNP+LIDQ+YCP N+C     S+
Sbjct  267   NCALINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPSNKCNLKAPSR  326

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VK+S + FKNI+GTS++++A+K+ CS  +PC+ V + DINL Y G  G A S+C+NVKP+
Sbjct  327   VKISNVSFKNIRGTSATQVAVKLACSSGIPCENVEIGDINLSYIGTKGPATSQCSNVKPT  386

Query  1201  IIGKVVPAAC  1230
             I G+  P AC
Sbjct  387   IAGRQTPLAC  396



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   353 bits (905),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 242/379 (64%), Gaps = 4/379 (1%)
 Frame = +1

Query  76    AWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGK  252
             A F  LL++  T      FDV          +D + A   AW  AC +P  +  +  +G 
Sbjct  9     AAFLFLLSASKTQAEPGVFDVTSATYGAKPGSDITHALAKAWIDACASPAPSKVVVPSGT  68

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
             +M     F+GPCK PI I  Q   L A  D         WV F  V  +T++GG  FDG 
Sbjct  69    YMLTEASFKGPCKAPIEIQVQG-KLTAPADGGKLTRPDTWVGFDHVNKLTVSGGGTFDGQ  127

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             GA  W   DC KN     +  N++FN VT   +  +T+ +SK FH+ +    +VT  R  
Sbjct  128   GALAWKKNDCNKNKDCKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCHNVTFXRVN  187

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             V AP  S NTDG+HIG+++ ++I  A I TGDDCVS+GDG +++ V +VTCGPGHG+++G
Sbjct  188   VTAPXESINTDGIHIGRSTGINITDAHIGTGDDCVSIGDGNKEITVTRVTCGPGHGISVG  247

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSNPIL  966
             SLG+YPNE+PV+G+ VKNCTLTNT NG RIKTWP SP  G A++MHFEDIIM NVSNP+L
Sbjct  248   SLGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVL  307

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQQYCPWNQCK  + SKVK+S + FKNIKG+S++ +A++I CS  +PC+ V + DI+L 
Sbjct  308   IDQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLT  367

Query  1147  YKGKDGSAVSKCTNVKPSI  1203
             Y G  G   S+C+NVKP+I
Sbjct  368   YNGNKGPLTSQCSNVKPTI  386



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   352 bits (904),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 178/395 (45%), Positives = 252/395 (64%), Gaps = 9/395 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             + S +I  + F +LLAS         FDV K+GA      D ++A T AW  AC +   +
Sbjct  6     VSSAIISFSLF-LLLASTANAQSKGVFDVTKYGAD----KDITEALTNAWKDACASTNPS  60

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               + ++G +    +   GPCK  I +    + L A  DP  F G G WV F  V   T++
Sbjct  61    KVLISSGTYSLRKLTLAGPCKAAIELQVDGI-LQAPVDPNQFSG-GHWVNFRYVDKFTLS  118

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G FDG G   W+   C K+     LP N++F+ +T   +  +T R+SK FH+ +   K
Sbjct  119   GSGTFDGQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCK  178

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T + +TV APG+S NTDG+H+GQ++ + II + I TGDDC+S+GDG +++H+ +VTCG
Sbjct  179   NLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCG  238

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG+++GSLGKYPNEKPV G+ VK+CT+++T NG RIK+WP    G A+NMHFEDI+MN
Sbjct  239   PGHGISVGSLGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMN  298

Query  946   NVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVV  1125
             NV NP++IDQ YCPWNQC     SKVK+S + FKNI+GTS++ + ++I CS  +PC+ V 
Sbjct  299   NVQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVE  358

Query  1126  MNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             + DI L Y G DG   S+C+NVKP I G +    C
Sbjct  359   LADIKLAYSGPDGPPKSQCSNVKPIISGIMSAPGC  393



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/384 (46%), Positives = 245/384 (64%), Gaps = 6/384 (2%)
 Frame = +1

Query  91    LLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGP  267
             L  + +       F+V+ FGA  DG  D+S+AF  AW  AC     +T+    GK++   
Sbjct  20    LAQNIINAASNGVFNVIDFGAIADGIRDNSRAFENAWREACYWNTYSTVLVPPGKYLVTS  79

Query  268   IWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTW  444
             + F+GPCK PI+   Q + +LA P          W+TF  +   T+ GG  F G G T W
Sbjct  80    VVFKGPCKAPISFQLQGL-ILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAW  138

Query  445   NLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPG  624
                 C KN + C LP +++FN +    + G+ + +SK FH+ I    ++ + +  + AP 
Sbjct  139   PENQCHKNSN-CQLPISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPD  197

Query  625   NSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKY  804
             +SPNTDG+HIG+++ + I  + I TGDDCVSLGDG Q+V V  V+CGPGHG+++GSLGKY
Sbjct  198   DSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVSDVSCGPGHGISVGSLGKY  257

Query  805   PNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYC  984
               E+ V+G+TV NCT T T NG RIKTWP S  G A+N  FED+ MNNV NPI+IDQ+YC
Sbjct  258   KKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYC  317

Query  985   PWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD-  1161
             P NQC   + S+VK+S + F+NI+GTS +K A++I CS  +PCQ V + DINL+Y G D 
Sbjct  318   PHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDD  377

Query  1162  -GSAVSKCTNVKPSIIGKVVPAAC  1230
              G A+S C+NVKP+++GK +PA C
Sbjct  378   KGPAISSCSNVKPTLVGKQIPATC  401



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/368 (48%), Positives = 246/368 (67%), Gaps = 7/368 (2%)
 Frame = +1

Query  133   DVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITID  309
             DV K GAK +  AD S+A   AW  AC A   +  +   G +   P+  +GPCK  I + 
Sbjct  25    DVTKHGAKQN--ADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQ  82

Query  310   AQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPL  486
               K  L AL DP   K  G WV+F+++  +T++GG  FDG GA   +  +C K+ +    
Sbjct  83    V-KGTLKALTDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAPS--ECEKDDYCKKR  139

Query  487   PANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTS  666
             P NL FNA+T   +  +T+ NSKQFH+ +  +K+ T +R TV AP  S NTDG+H+G++S
Sbjct  140   PINLSFNAITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSS  199

Query  667   KVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNC  846
              V+I  + I TGDDC+S+GDG Q + + K+ CGPGHG+++GSLGKY NE+PV+G+ V+ C
Sbjct  200   GVTITDSKIGTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVREC  259

Query  847   TLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVK  1026
              ++NT NG RIKTWP S  G+A+++HFEDI MNNVSNPIL+DQ YCP NQC A + S+VK
Sbjct  260   NISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVK  319

Query  1027  LSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSII  1206
             L  + FKNI+GTS++ +A+K+ CS  VPC+GV + DI+L Y G +G   S+CTN++P   
Sbjct  320   LDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTS  379

Query  1207  GKVVPAAC  1230
             GK+ P  C
Sbjct  380   GKMNPPPC  387



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 183/395 (46%), Positives = 257/395 (65%), Gaps = 9/395 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             +K   I+   F +L+AS ++  +A  FDV K GA  + K D ++A    W  AC     +
Sbjct  3     LKMNTIEIVLF-MLVASNLS--NAQVFDVTKNGA--NAKVDITQALLKTWKQACATKSRS  57

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +   G F      FQGPCK PI  + Q   LLA      FKG   W++F  +  +T+ 
Sbjct  58    QVLIPKGTFKVSQATFQGPCKAPIEFNLQGT-LLAPAVDGNFKGGDSWISFEHIDSLTVT  116

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG  F+G G T W    C  + +   LP N++FN +T   +  +T+ +SKQFH+ +   K
Sbjct  117   GGGTFNGQGKTAWG-KTCTSSQYCGNLPINVRFNFLTNSVVQYVTSLDSKQFHVNVLGCK  175

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T + + V APG+S NTDG+HIG+++ V ++ + I+TGDDC+S+G+G Q V + KV CG
Sbjct  176   NITFQHFKVSAPGDSLNTDGIHIGRSTDVKVLDSNIQTGDDCISIGEGSQQVTINKVNCG  235

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG++IGSLG Y NE+ V GV VK+CTL NT NG RIKTWP S  G+A++MHFEDI ++
Sbjct  236   PGHGISIGSLGMYANEEAVKGVFVKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLD  295

Query  946   NVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVV  1125
             NV NPI+IDQ+YCPWN+C A ++S+VKLS I FKNI+G+SS+ +A+K+ CS   PCQ V 
Sbjct  296   NVGNPIVIDQEYCPWNKCNAKVSSRVKLSNISFKNIRGSSSTAVAVKLVCSKGYPCQNVQ  355

Query  1126  MNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             ++DINL YKG +G+  S+C NVKP + GK  P AC
Sbjct  356   LSDINLSYKGSEGAITSECKNVKPILSGKENPRAC  390



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 246/369 (67%), Gaps = 8/369 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
              DV K+    DGK D ++A   AW  AC +   +  +  +G +    +   GPCK  I +
Sbjct  31    LDVTKY----DGKEDITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIEL  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                 + L A  +P  F G G WV F  V  +T++G G FDG G   W+   C K+ +   
Sbjct  87    QVDGI-LKAPVNPDQFSG-GSWVDFRHVDQLTLSGSGTFDGQGNVAWSKSTCNKDKNCEG  144

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP N++F+ +T   +  +T R+SK FH+ +   K++T + +T+ APG S NTDG+HIGQ+
Sbjct  145   LPMNIRFDFITNGLVRDITTRDSKNFHVNVLGCKNLTFQHFTMTAPGESINTDGIHIGQS  204

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + + II + I TGDDC+S+GDG +++HV  VTCGPGHG+++GSLG+YPNEKPV G+ VKN
Sbjct  205   TGIYIIDSNIGTGDDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKN  264

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT++NT NG RIK+WP    G+A+NMHFEDI+MNNV NP+++DQ+YCPWNQC     SKV
Sbjct  265   CTISNTANGVRIKSWPDLYGGAASNMHFEDIVMNNVQNPVVVDQEYCPWNQCSLKSPSKV  324

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S + FKNI+GTS++ + +K+ CS  +PC+ V + DINL+Y G +G A S+C+NVKP+I
Sbjct  325   KISDVSFKNIRGTSATPVVVKLACSGGIPCEKVELADINLVYSGSEGPAKSQCSNVKPTI  384

Query  1204  IGKVVPAAC  1230
              G +  + C
Sbjct  385   SGIMSASGC  393



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/395 (45%), Positives = 251/395 (64%), Gaps = 9/395 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             + S +I  + F +LLAS         FDV K+GA      D ++A T AW  AC +   +
Sbjct  6     VSSAIISFSLF-LLLASTAKAQSKGVFDVTKYGAD----KDITEALTNAWKDACASTNPS  60

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  +G +    +   GPCK  I +    + L A  DP  F G G WV F  V   T++
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGI-LKAPVDPNQFSG-GHWVNFRYVDKFTLS  118

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G FDG G   W+   C K+     LP N++F+ +T   +  +T R+SK FH+ +   K
Sbjct  119   GSGTFDGQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCK  178

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T + +TV APG+S NTDG+H+GQ++ + II + I TGDDC+S+GDG +++H+ +VTCG
Sbjct  179   NLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCG  238

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG+++GSLGKYPNEKPV G+ VK+CT+++T NG RIK+WP    G A+NMHFEDI+MN
Sbjct  239   PGHGISVGSLGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMN  298

Query  946   NVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVV  1125
             NV NP++IDQ YCPWNQC     SKVK+S + FKNI+GTS++ + ++I CS  +PC+ V 
Sbjct  299   NVQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVE  358

Query  1126  MNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             + DI L Y G DG   S+C+NVKP I G +    C
Sbjct  359   LADIKLAYSGPDGPPKSQCSNVKPMISGIMSAPGC  393



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 237/357 (66%), Gaps = 5/357 (1%)
 Frame = +1

Query  172   DDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPF  348
             D ++A T AW  AC +   +TI    G F  G I  +GPCK  I +  Q   L A  DP 
Sbjct  1     DSTQALTTAWKEACASASPSTILVPKGNFAVGLITLEGPCKSSIGLQLQGT-LKAPADPS  59

Query  349   AFKGHGGWVTFSQVIGVTI-NGGIFDGNGATTWNLPDCGKNGHICP-LPANLQFNAVTGL  522
               KG G W+  +++  +TI  GG+FDG G + W   DC KNG IC  L  NL+  AVT  
Sbjct  60    KIKGLG-WINLNKIDLLTIFGGGVFDGQGKSAWVQNDCHKNGPICKTLSMNLRLYAVTNS  118

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              L  +T  +SK FH+ +   K++T ER+ + A   S NTDG+HIG++  V+II   IKTG
Sbjct  119   ILRDVTTLDSKNFHVNVIGCKNLTFERFKISAAETSINTDGIHIGRSDGVNIINTEIKTG  178

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+SLGDG +++++  +TCGPGHG+++GSLG+Y NE+ V+G+ VKNCT+T + NG RIK
Sbjct  179   DDCISLGDGSKNINITNITCGPGHGISVGSLGRYKNEESVVGIYVKNCTITGSQNGVRIK  238

Query  883   TWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGT  1062
             TWP S  G A+ MHF+DI MN+V  PILIDQ YCP+NQC A + S VKLS I FKNIKGT
Sbjct  239   TWPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPYNQCTAEVPSSVKLSKISFKNIKGT  298

Query  1063  SSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             S++K A+K+ CS + PC GV + DI+L Y GK G A S C N+KP+I GK +PA CS
Sbjct  299   STTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVCENIKPTIKGKQIPAICS  355



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 244/369 (66%), Gaps = 8/369 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
             FDV K+G    GK D + A T AW  AC +   + +   +G +    +   GPCK  I +
Sbjct  31    FDVTKYG----GKQDITAALTNAWKDACASTKPSKVRIPSGTYSLRQVTLAGPCKSAIEL  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                 + L A  +P  F G G WV F  +  +T++G G FDG G   W+   C KN +   
Sbjct  87    QVNGI-LKAPVNPDQFSG-GHWVNFRYIDHLTLSGSGTFDGQGNVAWSKSTCSKNKNCEG  144

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP N++F+ +T   +  +T R+SK FH+ +   K++T + +TV AP  S NTDG+HIG++
Sbjct  145   LPMNIRFDFITNGLVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRS  204

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + + II + I TGDDC+S+GDG +++HV +VTCGPGHG+++GSLG+YPNEKPV G+ VKN
Sbjct  205   TGIYIIDSKIGTGDDCISVGDGTEELHVTRVTCGPGHGISVGSLGRYPNEKPVSGIFVKN  264

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT++NT NG RIK+WP    G A+NMHFEDI+MNNV NPIL+DQ YCPWNQC     SKV
Sbjct  265   CTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKV  324

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S + FKNI+GTS++ + +K+ CS  +PC+ V + +INL+Y G +G A S+C+NVKP I
Sbjct  325   KISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLVYSGSEGPAKSQCSNVKPKI  384

Query  1204  IGKVVPAAC  1230
              G +  + C
Sbjct  385   SGIMSASGC  393



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   349 bits (895),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 239/369 (65%), Gaps = 8/369 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             FDV K+G+      D ++A T AW  AC +   +  +  +G +    +   GPCK  I +
Sbjct  11    FDVTKYGSD----KDITEALTNAWKDACASTNPSKVLIPSGTYSLRKLTLAGPCKAAIEL  66

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                 M L A  DP  F G G WV F  V   T++G G FDG G   W+   C K+     
Sbjct  67    QVDGM-LKAPVDPNQFSG-GHWVNFGHVDKFTLSGSGTFDGQGKAAWSKSTCQKDKDCDS  124

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL+F+ +T   +  +T R+SK FH+ +   K++T + +TV APG S NTDG+H+GQ+
Sbjct  125   LPMNLRFDFITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSAPGESVNTDGIHVGQS  184

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + + II + I TGDDC+S+GDG +++H+  VTCGPGHG+++GSLGKYPNEKPV G+ VKN
Sbjct  185   TGIYIIDSKIGTGDDCISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVSGIFVKN  244

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CTL++T NG RIK+WP    G A+NMHFEDI+MNNV NP++IDQ YCPWNQC     SKV
Sbjct  245   CTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPWNQCSLKAPSKV  304

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+SG+ FKNI+GTS++ + ++I CS   PC+ V + DI L Y G DG + S+C+NVKP I
Sbjct  305   KISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKLAYSGPDGPSKSQCSNVKPII  364

Query  1204  IGKVVPAAC  1230
              G +    C
Sbjct  365   SGIMSAPGC  373



>ref|XP_002526191.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF36195.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=392

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 248/380 (65%), Gaps = 8/380 (2%)
 Frame = +1

Query  82    FCIL----LASFVTGLHAA-FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TA  243
              CIL    L SF+  + A   FDV  FGA    K D SKA   AW AAC  PGA+ I   
Sbjct  5     LCILTIFVLLSFLFNIRAEKVFDVKSFGATPSQKNDISKALLAAWKAACSTPGASRILIP  64

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGGIFD  423
               K+    +  +GPCKG + +   K  L+A  DP      G W+TF  V  +TI+GG  D
Sbjct  65    EAKYALRDVLLEGPCKGSMVLQI-KGTLMAPADPSEHHSQG-WITFQHVDHLTISGGNLD  122

Query  424   GNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIER  603
             G G   W    C  N +   LP NL+F+ VT   +  LT+R+SK FH+ +   ++ T++R
Sbjct  123   GRGKIAWGKNTCRTNVNCKNLPMNLRFDFVTNTIVENLTSRDSKNFHMNLIGCQNFTLQR  182

Query  604   YTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLA  783
               + APG+S NTDG+HIG++++V+II + I TGDDC+S+GDG +++ +  V CGPGHG++
Sbjct  183   IKIIAPGDSANTDGIHIGRSNEVNIIDSKIGTGDDCISIGDGSRNIKITGVRCGPGHGIS  242

Query  784   IGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPI  963
             IGSLGKY NE+PV GV VK C L NT NG RIK+WPG   G+AT+MHFEDI MNNVSN I
Sbjct  243   IGSLGKYKNEEPVSGVYVKKCDLINTSNGIRIKSWPGLYSGAATDMHFEDISMNNVSNAI  302

Query  964   LIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINL  1143
             LIDQ YCPWN C +  +S VK+S + F NIKGTSS+   +K+ CS  +PC+GV +N+IN+
Sbjct  303   LIDQMYCPWNHCNSKASSNVKISKVTFSNIKGTSSTPTIVKLLCSKGLPCEGVELNNINV  362

Query  1144  IYKGKDGSAVSKCTNVKPSI  1203
             +YKG DG A S+CTNVKP I
Sbjct  363   VYKGPDGPAKSECTNVKPKI  382



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/393 (47%), Positives = 252/393 (64%), Gaps = 7/393 (2%)
 Frame = +1

Query  61    ILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT  240
             I + ++W  +LLAS V G  +   DV  FGAKGDG +D S+A   AW AAC +P  +TI 
Sbjct  7     ITLFSSW--LLLASIV-GAQSRPLDVRSFGAKGDGVSDISQALLSAWKAACNSPKPSTIV  63

Query  241   -AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-G  414
                G F       +GPCK PI +  Q   L A  +P   K  G WVT   +   T++G G
Sbjct  64    IPRGTFGLLQATLEGPCKAPIELQVQG-TLKAPQNPNLIK-DGEWVTIQYLDHFTLSGSG  121

Query  415   IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVT  594
              FDG GA  W   DC K      LP N  FN +    + G+ + NSK FH+ I    +VT
Sbjct  122   TFDGQGARAWAQNDCAKASDCSKLPNNFSFNFLNNSIISGIASLNSKLFHMNILGCNNVT  181

Query  595   IERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGH  774
             + R T+ APG S NTDG+H+G++S V+I  +TI TGDDCVSLGDG + V +  V CGPGH
Sbjct  182   LSRLTITAPGTSLNTDGIHVGRSSGVNITDSTIGTGDDCVSLGDGSKQVSITNVVCGPGH  241

Query  775   GLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVS  954
             G++IGSLG+Y NE+PV+GV V+NCTL NTL G R+K+WP +  G+AT++HF+DI M NV+
Sbjct  242   GISIGSLGRYKNEEPVVGVFVRNCTLINTLTGVRVKSWPSATTGAATDVHFDDITMRNVT  301

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             +PI+IDQ+YCP NQC  G  S+VK+S + F NI+GTS+S +A+K+ CS   PC+GV + D
Sbjct  302   SPIVIDQEYCPNNQCTLGAPSRVKISKVSFNNIRGTSASALAVKLVCSKTFPCEGVEIGD  361

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             I+L Y G  G+  + C NV+P+ +G+  P  C+
Sbjct  362   IDLAYHGSLGNITTNCANVQPTFMGRQNPPICA  394



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 248/370 (67%), Gaps = 9/370 (2%)
 Frame = +1

Query  133   DVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITID  309
             DV K GAK +  AD S+A   AW  AC A   +  +   G +   P+  +GPCK  I + 
Sbjct  25    DVTKHGAKQN--ADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQ  82

Query  310   AQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI--C  480
               K  L AL DP   K  G WV+F+++  +T++GG  FDG GA   +  +C K+ +    
Sbjct  83    V-KGTLKALTDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAPS--ECEKDDYCKKR  139

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
             P+ +NL FNA+T   +  +T+ NSKQFH+ +  +K+ T +R TV AP  S NTDG+H+G+
Sbjct  140   PIVSNLSFNAITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGR  199

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +S V+I  + I TGDDC+S+GDG Q + + K+ CGPGHG+++GSLGKY NE+PV+G+ V+
Sbjct  200   SSGVTITDSKIGTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVR  259

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
              C ++NT NG RIKTWP S  G+A+++HFEDI MNNVSNPIL+DQ YCP NQC A + S+
Sbjct  260   ECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSR  319

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKL  + FKNI+GTS++ +A+K+ CS  VPC+GV + DI+L Y G +G   S+CTN++P 
Sbjct  320   VKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPK  379

Query  1201  IIGKVVPAAC  1230
               GK+ P  C
Sbjct  380   TSGKMNPPPC  389



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 178/387 (46%), Positives = 248/387 (64%), Gaps = 5/387 (1%)
 Frame = +1

Query  76    AWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAP-GANTITAAGK  252
             A   +L++S +       FDV + G     ++D + A   AW  AC +   +  +   G 
Sbjct  11    AALLLLVSSNIANAQIVLFDVTENGTILP-QSDITDALLKAWNNACASTIPSKVVVPKGI  69

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
             F       +GPC  PI  D Q + L A P+   F G   WV F  V  +TI+GG IFDG 
Sbjct  70    FKLSGATLEGPCNAPIEFDLQGI-LQAPPEDGNFTGGDTWVAFEYVDLLTISGGGIFDGQ  128

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             G  TW   DC  + +   LP N++FN VT   +  +T+ +SKQFH+ +   ++VT +   
Sbjct  129   GKPTWG-KDCANDEYCGDLPINIRFNYVTNSIIQEITSLDSKQFHINVLGCQNVTFQHVK  187

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             + A  NSP+TDG+HIG+++ + ++ + I+TGDDC+SLGDG + + + KVTCGPGHG++IG
Sbjct  188   IIAAENSPHTDGIHIGRSTDIKVLDSNIQTGDDCISLGDGSKQITIAKVTCGPGHGISIG  247

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILI  969
             SLGKY NE+ V GV VK+CTL NT NG RIKTWP S  G A+++HFEDIIM NV NP++I
Sbjct  248   SLGKYLNEEAVKGVDVKSCTLKNTQNGVRIKTWPDSQEGKASDLHFEDIIMENVGNPVMI  307

Query  970   DQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY  1149
             DQ+YCPWNQC + L S+V++SG+ FKNI+GTSS+ +A+K+ CS  +PCQ V M DI+L Y
Sbjct  308   DQEYCPWNQCVSQLPSRVQISGVRFKNIRGTSSTALAVKLVCSGGLPCQDVEMTDIDLKY  367

Query  1150  KGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
              G +G   S+C NVKP++ G   P AC
Sbjct  368   SGDEGQITSECKNVKPTVSGIQNPPAC  394



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   348 bits (893),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/389 (45%), Positives = 246/389 (63%), Gaps = 11/389 (3%)
 Frame = +1

Query  91    LLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGP  267
             L  + +       F+V+ FGA  DG  D+S+AF  AW  AC     +T+    GK++   
Sbjct  20    LAQNIINAASNGVFNVIDFGAIADGIRDNSRAFENAWREACYWNTYSTVLVPPGKYLVTS  79

Query  268   IWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTW  444
             + F+GPCK PI+   Q + +LA P          W+TF  +   T+ GG  F G G T W
Sbjct  80    VVFKGPCKAPISFQLQGL-ILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAW  138

Query  445   NLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPG  624
                 C KN + C LP +++FN +    + G+ + +SK FH+ I    ++ + +  + AP 
Sbjct  139   PENQCHKNSN-CQLPISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPD  197

Query  625   NSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDG-----VQDVHVEKVTCGPGHGLAIG  789
             +SPNTDG+HIG+++ + I  + I TGDDCVSLGDG     VQ+V V  V+CGPGHG+++G
Sbjct  198   DSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLVSDVSCGPGHGISVG  257

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILI  969
             SLGKY  E+ V+G+TV NCT T T NG RIKTWP S  G A+N  FED+ MNNV NPI+I
Sbjct  258   SLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVI  317

Query  970   DQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY  1149
             DQ+YCP NQC   + S+VK+S + F+NI+GTS +K A++I CS  +PCQ V + DINL+Y
Sbjct  318   DQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVY  377

Query  1150  KGKD--GSAVSKCTNVKPSIIGKVVPAAC  1230
              G D  G A+S C+NVKP+++GK +PA C
Sbjct  378   NGIDDKGPAISSCSNVKPTLVGKQIPATC  406



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   347 bits (891),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 180/397 (45%), Positives = 251/397 (63%), Gaps = 7/397 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN  231
             +KSIL     F  +L    +   ++ +DV      G   +D S+AF+ AW  AC +  A+
Sbjct  5     LKSIL---PMFVFMLLVSTSNAKSSIYDVTSAKYGGKANSDISQAFSKAWTDACASTLAS  61

Query  232   TITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
              I    G +      F+GPCK PI I  Q   L A  D         WV F ++ G+T++
Sbjct  62    KIVVPRGTYKFVGATFKGPCKAPIEIQLQGT-LQAPADGSKLPKADTWVGFERIDGLTLS  120

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG  FDG GAT W   DC KN +   +  NL+FN VT   +  +T ++SK FH+ +    
Sbjct  121   GGGTFDGQGATAWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCN  180

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             +V  + +TV AP  S NTDG+HIG+++ ++I  +TI TGDDC+S+GDG + +HV KVTCG
Sbjct  181   NVVFQHFTVSAPKESMNTDGIHIGRSTGINITDSTIGTGDDCISIGDGTKQLHVTKVTCG  240

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIM  942
             PGHG++IGSLG+Y NE+PV G+ +KNCT+ NT NG RIKTWP SP  G  +++HFEDIIM
Sbjct  241   PGHGISIGSLGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIM  300

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
             +NV NP++IDQ+YCPWNQC   + SKVK+S + FKNIKG+SS+ + +KI CS  +PC+ V
Sbjct  301   DNVGNPVIIDQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSTPVGIKIVCSGGLPCENV  360

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              ++DI+L Y G  G   S+C +VKP+I       AC+
Sbjct  361   QLSDIDLTYSGNKGPITSQCKHVKPTINNVARALACA  397



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/395 (45%), Positives = 250/395 (63%), Gaps = 9/395 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             + S LI  + F +LL+S         FDV K+GA      D ++A T AW  AC +   +
Sbjct  6     VSSALISFSIF-LLLSSTAKAQSKGVFDVTKYGAD----KDITEALTNAWKDACASTNPS  60

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  +G +    +   GPCK  I +    + L A  DP  F G G WV F  V   T++
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGI-LKAPVDPNQFSG-GHWVNFRYVDKFTLS  118

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G FDG G   W+   C K+     LP N++F+ +T   +  +T R+SK FH+ +   K
Sbjct  119   GSGTFDGQGKLAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCK  178

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T + +TV APG+S NTDG+H+GQ++ + II + I TGDDC+S+GDG +++H+ +VTCG
Sbjct  179   NLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCG  238

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG+++GSLGKYPNEKP  G+ VK+CT+++T NG RIK+WP    G A+NMHFEDI+MN
Sbjct  239   PGHGISVGSLGKYPNEKPASGIFVKSCTISDTPNGVRIKSWPALYGGGASNMHFEDIVMN  298

Query  946   NVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVV  1125
             NV NP++IDQ YCPWNQC     SKVK+S + FKNI+GTS++ + ++I CS  +PC+ V 
Sbjct  299   NVQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVE  358

Query  1126  MNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             + DI L Y G DG   S+C+NVKP + G +    C
Sbjct  359   LADIKLAYSGPDGPPKSQCSNVKPIMSGIMSAPGC  393



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 242/369 (66%), Gaps = 8/369 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             FDV K+G    GK D ++A   AW  AC +   +  +  +G +    +   GPCK  I +
Sbjct  31    FDVTKYG----GKEDITEALNNAWKDACASTNPSKVLIPSGTYSLRQVTLAGPCKAAIEL  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                 + L A  +P  F G   WV F  +  +T++G G FDG G   W+   C KN +   
Sbjct  87    QVNGI-LKAPVNPDQFSG-SHWVNFRYIDQLTLSGSGTFDGQGNVAWSKSTCSKNKNCEG  144

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP N++F+ +T   +  +T R+SK FH+ +   K++T + +TV AP  S NTDG+HIG++
Sbjct  145   LPMNIRFDFITNGLVRDITTRDSKNFHVNVLGCKNLTFQHFTVTAPAESINTDGIHIGRS  204

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + + II + I TGDDC+S+GDG +++HV  VTCGPGHG+++GSLG+YPNEKPV G+ VKN
Sbjct  205   TGIYIIDSKIGTGDDCISVGDGTEELHVTGVTCGPGHGISVGSLGRYPNEKPVSGIFVKN  264

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT++NT NG RIK+WP    G A+NMHFEDI+MNNV NPIL+DQ YCPWNQC     SKV
Sbjct  265   CTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPWNQCSLKAPSKV  324

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S + FKNI+GTS++ + +K+ CS  +PC+ V + +INL+Y G +G A S+C+NVKP I
Sbjct  325   KISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLLYSGSEGPAKSQCSNVKPKI  384

Query  1204  IGKVVPAAC  1230
              G +  + C
Sbjct  385   SGIMSASGC  393



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/389 (46%), Positives = 244/389 (63%), Gaps = 11/389 (3%)
 Frame = +1

Query  91    LLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGP  267
             L  + +       F+V+ FGA  DG  D+SKAF  AW  AC     +T+    GK+    
Sbjct  20    LAQNIINAASNGVFNVIDFGAMADGIRDNSKAFENAWREACNWNTYSTVLVPPGKYFVTS  79

Query  268   IWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTW  444
               F+GPCK PI+   Q + +LA P          W+TF  +   T+ GG  F G G T W
Sbjct  80    AVFKGPCKAPISFQLQGL-ILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAW  138

Query  445   NLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPG  624
                 C KN + C LP +++FN +    + G+ + +SK FH+ I    ++ + +  + AP 
Sbjct  139   PENQCHKNSN-CQLPISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPD  197

Query  625   NSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDG-----VQDVHVEKVTCGPGHGLAIG  789
             +SPNTDG+HIG+++ + I  + I TGDDCVSLGDG     VQ+V V  V+CGPGHG+++G
Sbjct  198   DSPNTDGIHIGRSNGIEISNSIIATGDDCVSLGDGSQNVLVQNVLVSDVSCGPGHGISVG  257

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILI  969
             SLGKY  E+ V+G+TV NCT T T NG RIKTWP S  G A+N  FED+ MNNV NPI+I
Sbjct  258   SLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVI  317

Query  970   DQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY  1149
             DQ+YCP NQC   + S+VK+S + F+NI+GTS +K A++I CS  +PCQ V + DINL+Y
Sbjct  318   DQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVY  377

Query  1150  KGKD--GSAVSKCTNVKPSIIGKVVPAAC  1230
              G D  G A+S C+NVKP+++GK +PA C
Sbjct  378   NGIDDKGPAISSCSNVKPTLVGKQIPATC  406



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 240/387 (62%), Gaps = 15/387 (4%)
 Frame = +1

Query  91    LLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAAC-KAPGANTITAAGKFMAGP  267
             LL  F +  +A  FDV   GAK +  AD ++A    W  AC  A  +  +   G F    
Sbjct  12    LLVLFASHANAQVFDVTANGAKPN--ADSTQALLTTWKEACASATRSKIVVPKGVFKVTQ  69

Query  268   IWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTW  444
               FQGPCK PI  + Q   L A P    FKG   W+ F  V  +T++G G+FDG G + W
Sbjct  70    ALFQGPCKAPIEFNLQG-TLQAPPVGGGFKGGDTWIGFEHVDFLTVSGNGVFDGQGKSAW  128

Query  445   -----NLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
                  +   CGK      LP NL+F+ VT   +  +T  +SKQFH+ +   K+VT   + 
Sbjct  129   GKKCDHTEYCGKQ-----LPINLRFDFVTNSLVQDVTTLDSKQFHVNVLGCKNVTFHNFH  183

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             V AP NS NTDG+HIG+++ + I+ + I+TGDDCVS+GDG + +++ +VTCGPGHG  IG
Sbjct  184   VIAPENSVNTDGIHIGRSTDIKILNSIIQTGDDCVSIGDGSKQIYLTQVTCGPGHGFGIG  243

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILI  969
             SLGKY NE PV G+ V  CTL NTLNG RIKTWP S  G+A+++HF DI M NV NP+LI
Sbjct  244   SLGKYLNELPVQGIFVTGCTLKNTLNGVRIKTWPNSYPGTASDIHFADITMENVGNPVLI  303

Query  970   DQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY  1149
             DQ+YCPWNQC   + SKVKLS I FK I GTSS+ +A+ + CS   PCQ VV+ DINL Y
Sbjct  304   DQEYCPWNQCNLKVPSKVKLSNISFKKIHGTSSTPLAVNLVCSSGAPCQNVVIQDINLKY  363

Query  1150  KGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
              G  G   SKC NVKP++ G   PAAC
Sbjct  364   SGSQGPITSKCKNVKPTVGGVQNPAAC  390



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 254/397 (64%), Gaps = 9/397 (2%)
 Frame = +1

Query  46    EDMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG  225
             E + S +I  + F +LLAS         FDV K+GA   GK D ++A T AW +AC +  
Sbjct  4     EVVSSAIISFSLF-LLLASTTQAQSNGVFDVTKYGA---GK-DITEALTNAWKSACASTK  58

Query  226   -ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVT  402
              +  +  +G +    +   GPCK  I +    + L A  DP    G G WV F  V   T
Sbjct  59    PSKVLIPSGTYWLRKVTLAGPCKAAIKLQVDGI-LKAPVDPNKLSG-GHWVNFRYVDQFT  116

Query  403   ING-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGS  579
             ++G G FDG G   W+   C K+ +   LP NL+F+ +T   +  +T  +SK FH+ +  
Sbjct  117   LSGRGTFDGQGKVAWSKSTCHKDKNCKGLPMNLRFDFITNALVRDITTLDSKNFHVNVLG  176

Query  580   SKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVT  759
              K++T + +TV APG S NTDG+HIG+++ + II + I TGDDC+S+GDG +++H+  VT
Sbjct  177   CKNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVT  236

Query  760   CGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDII  939
             CGPGHG+++GSLGKYPNEKPV G+ VKNCT+++T NG RIK+WP    G A+NMHFEDI+
Sbjct  237   CGPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIV  296

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             MNNV NP++IDQ YCPWNQC     SKVK+S + FK+I+GTS++ + ++I CS   PCQ 
Sbjct  297   MNNVQNPVIIDQGYCPWNQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQK  356

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             V + +INL Y+G  G A S+C+NVKP I G +  + C
Sbjct  357   VKLANINLAYRGPGGPAKSQCSNVKPIISGIMSASGC  393



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/384 (46%), Positives = 247/384 (64%), Gaps = 9/384 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             + S LI  + F +LL+S         FDV K+GA      D ++A T AW  AC +   +
Sbjct  6     VSSALISFSIF-LLLSSTAKAQSKGVFDVTKYGAD----KDITEALTNAWKDACASTNPS  60

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  +G +    +   GPCK  I +    + L A  DP  F G G WV F  V   T++
Sbjct  61    KVLIPSGTYSLRKLTLAGPCKAAIELQVDGI-LKAPVDPNQFSG-GHWVNFRYVDKFTLS  118

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G FDG G   W+   C K+     LP N++F+ +T   +  +T R+SK FH+ +   K
Sbjct  119   GSGTFDGQGKVAWSKSTCQKDKDCDSLPMNIRFDFITNALVRDITTRDSKNFHVNVLGCK  178

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T + +TV APG+S NTDG+H+GQ++ + II + I TGDDC+S+GDG +++H+ +VTCG
Sbjct  179   NLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGDDCISVGDGTEELHITRVTCG  238

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG+++GSLGKYPNEKP  G+ VK+CT+++T NG RIK+WP    G A+NMHFEDI+MN
Sbjct  239   PGHGISVGSLGKYPNEKPFSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMN  298

Query  946   NVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVV  1125
             NV NP++IDQ YCPWNQC     SKVK+S + FKNI+GTS++ + ++I CS   PC+ V 
Sbjct  299   NVQNPVIIDQVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVK  358

Query  1126  MNDINLIYKGKDGSAVSKCTNVKP  1197
             + +INL YKG  G A S+C+NVKP
Sbjct  359   LANINLAYKGPGGPAKSQCSNVKP  382



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 173/370 (47%), Positives = 236/370 (64%), Gaps = 3/370 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
              DV++ GAK DG+AD S+    AW  AC +  A+TI    G F+       GPCK PITI
Sbjct  27    IDVIQLGAKRDGRADMSQVLANAWKQACNSTTASTILIPKGTFLLKEASLVGPCKAPITI  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
               Q   + A  DP        W+T   V  +T++GG   DG GA  W   +C        
Sbjct  87    QIQG-TIKAPADPAQISKDKEWITIMYVNQLTLSGGGTLDGQGAKAWTQNECRVKTECSK  145

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP  L  N V    +  LT+ NSK FH+ + +  +VT + +T+ APG+SPNTDG+HIG +
Sbjct  146   LPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFACNNVTFQHFTITAPGDSPNTDGIHIGHS  205

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + V I  + I TGDDC+S+GDG + V++ KVTCGPGHG+++GSLG+Y NE PV G+ V +
Sbjct  206   TGVVITNSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSLGRYDNELPVEGIFVTD  265

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT++ TLNG R+K+WP S  GSATNMHFE IIM NVSNP++IDQ+YCP NQC     S+V
Sbjct  266   CTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQNVSNPVIIDQEYCPNNQCTNTAPSRV  325

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K++ + FK+I GTS++  A+ + CS ++PC+GV +  I+L Y GK G+  SKC NVKP +
Sbjct  326   KIAQVSFKHITGTSATPAAVTLLCSKSIPCEGVEVAHIDLAYNGKQGTLSSKCANVKPVL  385

Query  1204  IGKVVPAACS  1233
              GK+ P  C+
Sbjct  386   SGKLNPPICA  395



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 233/359 (65%), Gaps = 8/359 (2%)
 Frame = +1

Query  118   HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKG  294
             H A  D+ + GAK +G  D ++AF  AW  AC +   +  +   G ++   I  QGPCK 
Sbjct  30    HGAVLDITRHGAKPNG--DATQAFLHAWKVACASTTPSKVLVPRGSYILHAIKLQGPCKS  87

Query  295   PITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING----GIFDGNGATTWNLPDCG  462
              +TI+    N  A  DP  FKG   WV   ++ G+TI      G+FDG G   W   DC 
Sbjct  88    RVTIEILG-NFKAPADPAQFKGEDTWVKIERIDGLTITAPKGAGVFDGAGQIAWKQNDCS  146

Query  463   KNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTD  642
             K G    LP N +FN +T   + G+T+ NSK FH+ I   K + I   TV AP +S NTD
Sbjct  147   KTGKCNSLPYNFRFNFLTNSVINGITSLNSKLFHMAILGCKQLRIHDITVTAPADSLNTD  206

Query  643   GVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPV  822
             G+HIG++  V+I  A I TGDDCVS+GDG ++VH+E++TCGPGHG+++GSLG+YPNE+PV
Sbjct  207   GIHIGRSDGVNITAAHIGTGDDCVSIGDGAKNVHIEQITCGPGHGISVGSLGRYPNEEPV  266

Query  823   LGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCK  1002
              G+TVK CT+ NT NG R+KTW  S  G  T +HFEDII+ NV NPI++DQ+YCP+N CK
Sbjct  267   QGITVKGCTIKNTHNGVRVKTWHNSYEGVVTGLHFEDIIVENVLNPIIVDQEYCPYNHCK  326

Query  1003  AGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSK  1179
                 SKVKLS I F+N++GTSSSK A+K+ CS  VPC+ V + +I+L Y GKDG AV K
Sbjct  327   QKTPSKVKLSDIKFQNVRGTSSSKEAVKVVCSSGVPCEKVQLVNIDLKYTGKDGPAVWK  385



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 180/397 (45%), Positives = 249/397 (63%), Gaps = 7/397 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN  231
             +KSIL     F  LL    +   ++ +DV      G   +D S+AF+ AW  AC +  A+
Sbjct  5     LKSIL---PMFVFLLLVSTSNAKSSIYDVTSATYGGKANSDISQAFSKAWTDACASTLAS  61

Query  232   TITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
              I    G +      F+GPCK PI I  Q   L A  D         WV F ++ G+T++
Sbjct  62    KIVVPRGTYKFVGATFKGPCKAPIEIQLQGT-LQAPVDGSKLSKADTWVGFERIDGLTLS  120

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG  FDG GAT W   DC KN +   +  NL+FN VT   +  +T ++SK FH+ +    
Sbjct  121   GGGTFDGQGATAWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCN  180

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             +V  +R+TV AP  S NTDG+HIG+++ ++I  + I TGDDC+S+GDG + +HV KVTCG
Sbjct  181   NVAFQRFTVSAPKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCG  240

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIM  942
             PGHG++IGSLG+Y NE+PV G+ +KNCT+ NT NG RIKTWP SP  G  +++HFEDIIM
Sbjct  241   PGHGISIGSLGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIM  300

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
             +NV NP++IDQ+YCPWNQC   + SKVK+S + FKNIKG+S   + +KI CS  +PC+ V
Sbjct  301   DNVGNPVIIDQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSVGIVGIKIVCSGGLPCENV  360

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              ++DI+L Y G  G   S+C +VKP+I       AC+
Sbjct  361   QLSDIDLTYTGNKGPITSQCKHVKPTINNVARALACA  397



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 176/398 (44%), Positives = 253/398 (64%), Gaps = 5/398 (1%)
 Frame = +1

Query  49    DMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA  228
             D+K   I   +  +LL S  +   +  +DV      G   +D ++A + AW  AC +  A
Sbjct  2     DLKLKNILPMFVSLLLVS-TSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSA  60

Query  229   NTITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI  405
             + I   +G +      F+GPCK PI    Q   L A  D         W+ F ++ G+T+
Sbjct  61    SKIVVPSGTYKFVGATFKGPCKAPIEFQLQGT-LQAPEDGSQLPKADTWIGFERIDGLTL  119

Query  406   NGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +GG  FDG GAT W   DC KN +   +  NL+FN VT   +  +T ++SK FH+ +   
Sbjct  120   SGGGTFDGLGATAWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNLLGC  179

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
              +V  + +TV AP  S NTDG+HIG+++ ++I   TI TGDDC+S+GDG + +HV  VTC
Sbjct  180   NNVAFQHFTVSAPKESINTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKQLHVTNVTC  239

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDII  939
             GPGHG++IGSLGKY NE+PV G+ +KNCT+TNT NG RIKTWP SP  G  +++HFEDII
Sbjct  240   GPGHGISIGSLGKYENEEPVSGIFIKNCTITNTDNGVRIKTWPASPANGVVSDVHFEDII  299

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             M+NV NP++IDQ+YCP+NQC   + SKVK+S + FKNIKG+SS+ + +K+ CS  +PC+ 
Sbjct  300   MDNVKNPVIIDQEYCPYNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCEN  359

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             V +++I+L Y GK+GS  S+C ++KP+I     P AC+
Sbjct  360   VELSNIDLTYTGKEGSITSECKHIKPTINNVAQPLACA  397



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   345 bits (884),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 180/397 (45%), Positives = 249/397 (63%), Gaps = 7/397 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN  231
             +KSIL     F  LL    +   ++ +DV      G   +D S+ F+ AW  AC +  A+
Sbjct  5     LKSIL---PIFVFLLLVSTSNAKSSIYDVTSATYGGKANSDISRPFSKAWTDACASTLAS  61

Query  232   TITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
              I    G +      F+GPCK PI I  Q   L A  D         WV F ++ G+T++
Sbjct  62    KIVVPRGTYKFVGATFKGPCKAPIEIQLQGT-LQAPVDGSKLSKADTWVGFERIDGLTLS  120

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG  FDG GAT W   DC KN +   +  NL+FN VT   +  +T ++SK FH+ +    
Sbjct  121   GGGTFDGQGATAWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGCN  180

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             +V  + +TV AP  S NTDG+HIG+++ ++I  + I TGDDC+S+GDG + +HV KVTCG
Sbjct  181   NVAFQHFTVSAPKESMNTDGIHIGRSTGINITDSIIGTGDDCISIGDGTKQLHVTKVTCG  240

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIM  942
             PGHG++IGSLG+Y NE+PV G+ +KNCT+ NT NG RIKTWP SP  G  +++HFEDIIM
Sbjct  241   PGHGISIGSLGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIM  300

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
             +NV NP++IDQ+YCPWNQC   + SKVK+S + FKNIKG+SSS + +KI CS  +PC+ V
Sbjct  301   DNVGNPVIIDQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSSPVGIKIVCSGGLPCENV  360

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              ++DI+L Y G  G   S+C +VKP+I       AC+
Sbjct  361   QLSDIDLTYTGNKGPITSQCKHVKPTINNVARALACA  397



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 245/389 (63%), Gaps = 8/389 (2%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVM--KFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGK  252
             F  LL +      +A  DV   K+G K D  +D ++A   AW  AC +   + I    G 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPD--SDITQALEKAWTDACASTAPSKIVVPKGT  69

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
             F      F+GPCK  I    Q   L A  D         W+ F  V G+T++GG  FDG 
Sbjct  70    FKFVGTTFKGPCKAAIEFQLQGT-LQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQ  128

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             GA +W   DC KN        NL+F+ +T  +++ +T+++SK FH+ +   + V I  +T
Sbjct  129   GALSWKNNDCNKNRQCKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLQKCEKVEINGFT  188

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             + AP  S NTDG+HIG+++ + II  TI TGDDC+S+GDG +D+ V  VTCGPGHG+AIG
Sbjct  189   ISAPKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIG  248

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSNPIL  966
             SLG+YP E+PV G+ +K CTLTNT NG RIKTWP SP  G+A+++HFEDI M NV NPIL
Sbjct  249   SLGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPIL  308

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQ+YCPWN+CK G+ SKVK+S + FKNIKGT +  +A+K+ C+P +PC+ V ++DI+L 
Sbjct  309   IDQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDLK  368

Query  1147  YKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             Y G  G   S C+NVKP+I     P AC+
Sbjct  369   YIGDKGPITSVCSNVKPTINRVAQPLACA  397



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 243/378 (64%), Gaps = 8/378 (2%)
 Frame = +1

Query  115   LHAAFFDVM--KFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGP  285
             L    FDV   K+GAK +  +D ++A   AW  AC +   +  I   G +      F GP
Sbjct  15    LGGGVFDVTSGKYGAKPN--SDITQAIANAWKDACASTMPSKVIVPKGIYKLKEANFNGP  72

Query  286   CKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCG  462
             CK PI +      L A PD         W+ FS +   T++G GIFDG G   W   DC 
Sbjct  73    CKAPIELQVCGT-LQASPDGAQLSKPDTWIMFSYLDRFTLSGTGIFDGQGQQAWKANDCH  131

Query  463   KNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTD  642
             KN     +  N++F++V    +  +++ NSK FH+ +   + +T + +TV AP  S NTD
Sbjct  132   KNPKCSSIAINMRFHSVKNSLVRDVSSLNSKNFHVNVLGCERLTFQHFTVTAPETSVNTD  191

Query  643   GVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPV  822
             G+HIG+++ ++I  + I TGDDC+S+GDG + + + KVTCGPGHG++IGSLG+YP E+PV
Sbjct  192   GIHIGRSTGINITDSNISTGDDCISIGDGTKQLTITKVTCGPGHGISIGSLGRYPKEEPV  251

Query  823   LGVTVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQC  999
              G+ +K+CTL+NT+NG RIKTWP SP  S A+++HFEDIIMNNV NPILIDQ+YCPWN C
Sbjct  252   TGIYIKSCTLSNTMNGIRIKTWPNSPAASIASDIHFEDIIMNNVGNPILIDQEYCPWNLC  311

Query  1000  KAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSK  1179
                +ASKVK+S + F+NI+GTSS+ +A+KI C+  +PC  V M DINL Y GK GS  S+
Sbjct  312   NKQVASKVKISNVSFRNIRGTSSTPLALKILCAKGLPCDKVEMTDINLKYNGKQGSLTSQ  371

Query  1180  CTNVKPSIIGKVVPAACS  1233
             C+NV+P+I     P AC+
Sbjct  372   CSNVRPTITRVPNPLACA  389



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 240/390 (62%), Gaps = 11/390 (3%)
 Frame = +1

Query  79    WFCILLASFVTGLHAA-FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GK  252
             +F  L   FV  + +    D+ K GAK +G  D ++    AW  AC AP    I    G 
Sbjct  8     FFISLFYLFVCVVRSQNVIDITKLGAKPNG--DATQGLMAAWKQACAAPAPTKIVVPPGS  65

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN----GGIF  420
             F+   I F GPCK  +TI+    N  A P+P   KG   WV    + G+TIN    GG F
Sbjct  66    FLLNVIKFTGPCKAAVTIEIAG-NFKAPPNPAQMKGSDTWVKIENIQGLTINCLPTGGTF  124

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G   W   +C K G    LP N +FN++T  ++ G+ + NSK +H+ +   K+ T+ 
Sbjct  125   DGQGQMAWKQNNCAKTGSCNNLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLGCKNFTLF  184

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
               T+ AP +S NTDG+HIG+++ + +  A I TGDDC+S+GDG  DVH+E +TCGPGHG+
Sbjct  185   DTTIQAPKDSLNTDGIHIGRSAGIFVTKAKIGTGDDCISMGDGAVDVHIEDITCGPGHGI  244

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             +IGSLG+Y  E PV GVTVK CT+++T NG RIK+W  S    A+N+HFEDI + NV NP
Sbjct  245   SIGSLGRYQKEAPVTGVTVKKCTISDTDNGVRIKSWLNSFEAIASNLHFEDITVKNVLNP  304

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             ILIDQ+YCP+N CKA   SKVKLS I FKNI+GT+ SK A+KI CS   PC  V + DI+
Sbjct  305   ILIDQEYCPYNHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADID  364

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             L + G  G AVS C NVKP   GK  P AC
Sbjct  365   LTFNG--GHAVSMCKNVKPITSGKQNPVAC  392



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   343 bits (879),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/388 (45%), Positives = 244/388 (63%), Gaps = 7/388 (2%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAAC--KAPGANTITAAGKF  255
             F +L    +     A FDV KFGAK D   D SKA   A+  AC  K P +  +   G +
Sbjct  11    FALLFLVHIGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIP-SKVVIPKGTY  69

Query  256   MAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNG  432
             +   +  +G CK PI ++ Q   L A P+P   K    W+T + +   T++GG IFDG G
Sbjct  70    LMNQVRLEGNCKAPIELEIQ-ATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQG  128

Query  433   ATTWNLPDCGKNGHIC-PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
                W   DC KN   C  LP NL FN +T   +  +T+ +SK FH+ +   K++T     
Sbjct  129   EQGWAQNDC-KNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIGVN  187

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             + AP  S NTDG+H+ ++  ++I  + I TGDDC+S+GDG+Q +++  VTCGPGHG+++G
Sbjct  188   IKAPAQSLNTDGIHVARSRGLNITNSQIGTGDDCISIGDGIQQMYITNVTCGPGHGISVG  247

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILI  969
             SLGK P E PV+GV V+NCT  +T NG R+KTWP S  G   ++H+EDII+ NVSNP++I
Sbjct  248   SLGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVI  307

Query  970   DQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY  1149
             DQ YCP+NQCK  L S+VK+S + FKNI+GTS ++ A+KI+CS  VPC+GV + DI++ Y
Sbjct  308   DQLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIKINCSKGVPCEGVEVGDIDITY  367

Query  1150  KGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              G +G A S C NV PS +GK +P  C+
Sbjct  368   NGNEGPAKSTCQNVDPSFVGKQIPPVCA  395



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   343 bits (880),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/373 (48%), Positives = 235/373 (63%), Gaps = 9/373 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKA-PGANTITAAGKFMAGPIWFQGPCKGPITI  306
             FD+   GAK D  AD ++AF  +W AAC +   +  +  AG ++ G I  +GPC+ P  I
Sbjct  36    FDITTKGAKPD--ADVTQAFLDSWTAACASVKPSKVLVPAGNYILGAIKLKGPCQTPTVI  93

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI----NGGIFDGNGATTWNLPDCGKNGH  474
             +    N  A PD  AF     W     V  + +     GG+FDG G   W L +C KN +
Sbjct  94    EILG-NFKAPPDVAAFNKEDTWFKVEYVDSLILITGKGGGVFDGQGQAAWKLNECTKNAN  152

Query  475   I-CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
                 LP N +FN VT  ++ GLT+ NSK +H  +   K + +   T+ AP +SPNTDG+H
Sbjct  153   CGFDLPYNFRFNFVTNSKVSGLTSINSKLYHFALLGCKQLEMSDITITAPADSPNTDGIH  212

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             IG++  V + G TI TGDDCVS GDG ++V VE VTCGPGHGL++GSLGKYPNE+PV  +
Sbjct  213   IGRSDGVIVRGFTIGTGDDCVSFGDGAKNVLVEGVTCGPGHGLSVGSLGKYPNEEPVSNI  272

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
             T++NCT+ NT NG R+KTW  S   + T ++FEDI + NV NP+++DQ+YCPWN CKA  
Sbjct  273   TIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKT  332

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              SKVK+S I FKN+KG SS K A+K+ CS  VPC  V + DI+L Y G DG AVS C  V
Sbjct  333   PSKVKISDIRFKNVKGKSSGKEAVKLICSEGVPCDKVELADIDLQYTGTDGPAVSMCKFV  392

Query  1192  KPSIIGKVVPAAC  1230
             KP + GK  P AC
Sbjct  393   KPLLTGKQSPPAC  405



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 238/374 (64%), Gaps = 11/374 (3%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAAC--KAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             FD+   GAK D  AD ++AF  +W AAC  K P +  +  AG ++ G I  +GPC+ P  
Sbjct  36    FDITTKGAKPD--ADVTQAFLDSWTAACASKKP-SKVLVPAGNYILGAITLKGPCQTPTV  92

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI----NGGIFDGNGATTWNLPDCGKNG  471
             I+    N  A  D  AFK    W     V  + I     GG+FDG G   W   +C KN 
Sbjct  93    IEILG-NFKAPSDVAAFKKEDSWFKVENVDSLIIISGKGGGVFDGQGQAGWKKNECTKNA  151

Query  472   HIC-PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
             +    LP N++FN V+  ++ GLT+ NSK FH+ +   K + +   T+ AP +SPNTDG+
Sbjct  152   NCAFDLPYNIRFNFVSNSKVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPNTDGI  211

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  + + G TI TGDDCVS GDG ++V +E VTCGPGHGL++GSLGKYPNE+PV  
Sbjct  212   HIGRSENIIVRGWTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSN  271

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             +T++NCT+ NT NG R+KTW  S   + T ++FEDI + NV NP+++DQ+YCPWN CKA 
Sbjct  272   ITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAK  331

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
               SKVK+S I FKN+KG SS+K A+K+ CS  VPC  V + DI++ Y G DG AVS C  
Sbjct  332   TPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKF  391

Query  1189  VKPSIIGKVVPAAC  1230
             VKP + GK  P AC
Sbjct  392   VKPLLTGKQSPPAC  405



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   341 bits (875),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/398 (44%), Positives = 251/398 (63%), Gaps = 5/398 (1%)
 Frame = +1

Query  49    DMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA  228
             D+K   I   +  +LL S  +   +  +DV      G   +D ++A + AW  AC +  A
Sbjct  2     DLKLKNILPMFVSLLLVS-TSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSA  60

Query  229   NTITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI  405
               I   +G +      F+GPCK PI    Q   L A  D         W+ F ++ G+T+
Sbjct  61    GKIVVPSGTYKFVGATFKGPCKAPIEFQLQGT-LQAPEDGSQLPKADTWIGFERIDGLTL  119

Query  406   NGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +GG  FDG GAT W   DC KN +   +  NL+FN VT   +  +T ++SK FH+ +   
Sbjct  120   SGGGTFDGLGATAWKQNDCNKNKNCKSIAINLRFNFVTNSIIRDITTKDSKNFHVNLLGC  179

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
              +V  + +TV AP  S NTDG+HIG+++ ++I   TI TGDDC+S+GDG + +HV  VTC
Sbjct  180   NNVAFQHFTVSAPKESINTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKQLHVTNVTC  239

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDII  939
             GPGHG++IGSLGKY NE+PV G+ +KNCT++NT NG RIKTWP SP  G  +++HFEDII
Sbjct  240   GPGHGISIGSLGKYENEEPVSGIFIKNCTISNTDNGVRIKTWPASPANGVVSDVHFEDII  299

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             M+NV NP++IDQ+YCP NQC   + SKVK+S + FKNIKG+SS+ + +K+ CS  +PC+ 
Sbjct  300   MDNVKNPVIIDQEYCPHNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCEN  359

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             V +++I+L Y GK+GS  S+C ++KP+I     P AC+
Sbjct  360   VELSNIDLTYTGKEGSITSECKHIKPTIDNVAQPLACA  397



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   340 bits (873),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/379 (47%), Positives = 240/379 (63%), Gaps = 8/379 (2%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVM--KFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGK  252
             F  LL +      +A  DV   K+G K D  +D ++A   AW  AC +   + I    G 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPD--SDITQALEKAWTDACASTAPSKIVVPKGT  69

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
             F      F+GPCK  I    Q   L A  D         W+ F  V G+T++GG  FDG 
Sbjct  70    FKFVGTTFKGPCKAAIEFQLQGT-LQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQ  128

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             GA +W   DC KN        NL+F+ +T  +++ +T+++SK FH+ +   + V I  +T
Sbjct  129   GALSWKNNDCNKNRQCKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFT  188

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             V AP  S NTDG+HIG+++ + II  TI TGDDC+S+GDG +D+ V  VTCGPGHG+AIG
Sbjct  189   VSAPKESMNTDGIHIGRSTGIDIIDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIG  248

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSNPIL  966
             SLG+YP E+PV G+ +K CTLTNT NG RIKTWP SP  G+A+++HFEDI M NV NPIL
Sbjct  249   SLGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPIL  308

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQ+YCPWN+CK G  SK+K+S + FKNIKGT +  +A+K+ CSP +PC+ V ++DI+L 
Sbjct  309   IDQEYCPWNECKKGAPSKIKISNVSFKNIKGTCTDPVAVKLACSPGLPCENVELSDIDLK  368

Query  1147  YKGKDGSAVSKCTNVKPSI  1203
             Y G  G   S C+NVKP+I
Sbjct  369   YTGDKGPITSVCSNVKPTI  387



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   342 bits (876),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 175/375 (47%), Positives = 244/375 (65%), Gaps = 8/375 (2%)
 Frame = +1

Query  112   GLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPC  288
             GL    FDV K+GA   GK D ++A T AW +AC +   +  +  +G +    +   GPC
Sbjct  66    GLSNGVFDVTKYGA---GK-DITEALTNAWKSACASTKPSKVLIPSGTYWLRKVTLAGPC  121

Query  289   KGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGK  465
             K  I +    + L A  DP    G G WV F  V   T++G G FDG G   W+   C K
Sbjct  122   KAAIKLQVDGI-LKAPVDPNKLSG-GHWVNFRYVDQFTLSGRGTFDGQGKVAWSKSTCHK  179

Query  466   NGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDG  645
             + +   LP NL+F+ +T   +  +T  +SK FH+ +   K++T + +TV APG S NTDG
Sbjct  180   DKNCKGLPMNLRFDFITNALVRDITTLDSKNFHVNVLGCKNLTFQHFTVRAPGESVNTDG  239

Query  646   VHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVL  825
             +HIG+++ + II + I TGDDC+S+GDG +++H+  VTCGPGHG+++GSLGKYPNEKPV 
Sbjct  240   IHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVTCGPGHGISVGSLGKYPNEKPVS  299

Query  826   GVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKA  1005
             G+ VKNCT+++T NG RIK+WP    G A+NMHFEDI+MNNV NP++IDQ YCPWNQC  
Sbjct  300   GIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPWNQCTL  359

Query  1006  GLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCT  1185
                SKVK+S + FK+I+GTS++ + ++I CS   PCQ V + +INL Y+G  G A S+C+
Sbjct  360   KAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPAKSQCS  419

Query  1186  NVKPSIIGKVVPAAC  1230
             NVKP I G +  + C
Sbjct  420   NVKPIISGIMSASGC  434



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   340 bits (872),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 178/397 (45%), Positives = 250/397 (63%), Gaps = 9/397 (2%)
 Frame = +1

Query  46    EDMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG  225
             E + S +I  + F +LLAS         FDV K+GA   GK D ++A   AW  AC +  
Sbjct  4     EVVSSAIISFSLF-LLLASTTQAQSNGVFDVTKYGA---GK-DITEALANAWKDACASTK  58

Query  226   -ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVT  402
              +  +   G +    +   GPCK  I +    + L A  DP    G G WV F  V   T
Sbjct  59    PSKVLIPRGTYWLRKVTIAGPCKAAIKLQVDGI-LQAPVDPNKLSG-GDWVNFRYVDQFT  116

Query  403   ING-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGS  579
             ++G G FDG G   W+   C ++ +   LP N++F+ +T   +  +T  +SK FH+ +  
Sbjct  117   LSGSGTFDGQGKVAWSRSTCHRDKNCKGLPMNMRFDYITNALVRDITTLDSKNFHVNVLG  176

Query  580   SKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVT  759
              K++T + +TV AP  S NTDG+HIG+++ + II + I TGDDC+S+GDG +++H+  VT
Sbjct  177   CKNLTFQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGDDCISVGDGTEELHITGVT  236

Query  760   CGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDII  939
             CGPGHG+++GSLGKYPNEKPV G+ VKNCT+++T NG RIK+WP    G A+NMHFEDI+
Sbjct  237   CGPGHGISVGSLGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIV  296

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             MNNV NP++IDQ YCPWNQC     SKVK+S + FKNI+GTS++ + ++I CS   PC+ 
Sbjct  297   MNNVQNPVIIDQGYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEK  356

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             V + +INL YKG  G A S+C+NVKP I G +  + C
Sbjct  357   VKLANINLAYKGPGGPAKSQCSNVKPIISGIMSASGC  393



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/391 (44%), Positives = 247/391 (63%), Gaps = 10/391 (3%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-A  243
             +  A   + LA F        FD+ K+GA  +  AD S+A   A+  AC++   +TI   
Sbjct  7     VHFALVLLFLAHFGES-QTGVFDITKYGANSN--ADISEALLNAFKEACQSTSPSTIVIP  63

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IF  420
              G F    +  +GPCK P+ +  Q   L A  DP   K  G W+T +++   T++GG I 
Sbjct  64    KGTFTMNQVKLEGPCKSPLELQIQ-ATLKAPSDPSQLKV-GEWLTVNKLDQFTMSGGGIL  121

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG  A  W   +C ++     LP NL FN++T   +  +T  +SK FH+ +   K++T  
Sbjct  122   DGQAAAAW---ECKQSKKCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFI  178

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
             R+ V AP NSPNTDG+H+ ++S V+I  +   TGDDC+S+GD  + +++ +VTCGPGHG+
Sbjct  179   RFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGI  238

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             ++GSLG  P+EKPV+GV V+NCT TNT NG RIKTWP S  G   ++HFEDII+ NVSNP
Sbjct  239   SVGSLGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNP  298

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             ++IDQ YCP+N+C   L S+VK+S + F+NIKGTS ++ A+ + CS  VPC+G+ + DI+
Sbjct  299   VVIDQVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDID  358

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             + Y GK+G A S C N+KPS+ GK  P  C+
Sbjct  359   ITYSGKEGPAKSSCENIKPSLKGKQNPPVCT  389



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 174/388 (45%), Positives = 242/388 (62%), Gaps = 7/388 (2%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAAC--KAPGANTITAAGKF  255
             F ++   +      A FDV KFGAK D   D SKA   A+  AC  K P +  +   G +
Sbjct  11    FALVFLVYTGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIP-SKVVIPKGIY  69

Query  256   MAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNG  432
             +   +  +G CK PI +  Q   L A P+P   K    W+T + +   T++GG IFDG G
Sbjct  70    LMNQVRLEGNCKAPIELQIQAT-LKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQG  128

Query  433   ATTWNLPDCGKNGHIC-PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
                W   DC KN   C  LP NL FN +T   +  +T+ +SK FH+ +   K++T     
Sbjct  129   EQGWAQNDC-KNSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIGVN  187

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             + AP  S NTDG+H+ ++  V+I  + I TGDDC+S+GDGVQ +++  VTCGPGHG+++G
Sbjct  188   IKAPAQSLNTDGIHVARSRGVNITNSEIGTGDDCISIGDGVQQMYITNVTCGPGHGISVG  247

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILI  969
             SLGK P E PV+GV V+NCT  +T NG R+KTWP S  G   ++H+EDII+ NVSNP++I
Sbjct  248   SLGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVI  307

Query  970   DQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY  1149
             DQ YCP+NQCK  L S+VK+S + FKNI+GTS ++ A++I+CS  VPC+GV + DI++ Y
Sbjct  308   DQLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIQINCSKGVPCEGVEVGDIDITY  367

Query  1150  KGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              G +G A S C NV PS +GK  P  C+
Sbjct  368   NGNEGPAKSSCQNVDPSFVGKQNPPVCT  395



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/370 (46%), Positives = 233/370 (63%), Gaps = 7/370 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             FDV KFGA  +G  D SKA   A+  AC +   +  I   G F    +  +GPCK P+  
Sbjct  23    FDVTKFGATPNG--DISKAILDAFKEACASTSPSRVIVPKGTFQMKQVKLEGPCKAPLEF  80

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
               Q   L A PDP A    G W T + V   T++G GIFDG G   W   DC K      
Sbjct  81    QLQGT-LQASPDPKALP-EGEWFTVNYVNQFTLSGTGIFDGQGKAAWAQNDCAKT-KCAH  137

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL FN +    +  +T+++SK FH+ +    + T+ R T+ AP  S NTDG+H+ ++
Sbjct  138   LPYNLSFNYLNSSTIQDITSKDSKNFHMNVNGCNNFTLNRVTISAPKESINTDGIHVARS  197

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
               V+I    I TGDDC+S+GD ++ +H+ KVTCGPGHG+++GSLGK P EKPV+GV VKN
Sbjct  198   KNVNITDCVIGTGDDCISIGDELEQLHITKVTCGPGHGISVGSLGKTPGEKPVVGVYVKN  257

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT  NT NG R+KTWP S  G  T +H+EDI++ NVSNP++IDQ YCP+NQC   L S V
Sbjct  258   CTFINTDNGVRVKTWPASHQGVVTELHYEDIVVQNVSNPVVIDQVYCPYNQCNKDLPSLV  317

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S +  KN+KGTSS++ A+++ CS  VPC+GV + DI++ Y GK+G A + C NVKP+ 
Sbjct  318   KISKVSIKNVKGTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYNGKEGPAKTSCENVKPTF  377

Query  1204  IGKVVPAACS  1233
             +GK  P  C+
Sbjct  378   VGKQNPPVCA  387



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/390 (46%), Positives = 244/390 (63%), Gaps = 8/390 (2%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVM--KFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGK  252
             F  LL +      +A  DV   K+G K D  +D ++A   AW  AC +   + I    G 
Sbjct  12    FVFLLLASTAKAQSAALDVTSAKYGGKPD--SDITQALEKAWTDACASTAPSKIVVPKGT  69

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
             F      F+GPCK  I    Q   L A  D         W+ F  V G+T++GG  FDG 
Sbjct  70    FKFVGTTFKGPCKAAIEFQLQGT-LQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQ  128

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             GA +W   DC KN        NL+F+ +T  +++ +T+++SK FH+ +   + V I  +T
Sbjct  129   GALSWKNNDCNKNRQCKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEINGFT  188

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             V AP  S NTDG+HIG+++ ++I   TI TGDDC+S+GDG +D+ V  VTCGPGHG+AIG
Sbjct  189   VSAPKESMNTDGIHIGRSTGINITDTTIGTGDDCISIGDGTKDLTVTNVTCGPGHGIAIG  248

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSNPIL  966
             SLG+YP E+PV G+ +K CTLTNT NG RIKTWP SP  G+A+++HFEDI M NV NPIL
Sbjct  249   SLGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPIL  308

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQ+YCPWN+CK G+ SKVK+S + FKNIKGT +  +A+K+ C+P +PC+ V ++DI++ 
Sbjct  309   IDQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDIK  368

Query  1147  YKGKDGSAVSKCTNVKPSIIGKVVPAACSV  1236
             Y G  G   S C+NVKP+I       AC+ 
Sbjct  369   YTGDKGPITSVCSNVKPTINRVAQALACAT  398



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/390 (44%), Positives = 245/390 (63%), Gaps = 10/390 (3%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-A  243
             +  A   + LA F        FD+ K+GA  +  AD S+A   A+  AC++   +TI   
Sbjct  7     VHFALVLLFLAHFGES-QTGVFDITKYGANSN--ADISEALLSAFKEACQSTSPSTIVIP  63

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IF  420
              G F    +  +GPCK P+ +  Q   L A  DP   K  G W+T +++   T++GG I 
Sbjct  64    KGTFTMNQVKLEGPCKSPLELQIQ-ATLKAPSDPSQLKV-GEWLTVNKIDQFTMSGGGIL  121

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG  A  W   +C  +     LP NL FN++T   +  +T  +SK FH+ +   K++T  
Sbjct  122   DGQAAAAW---ECKNSKKCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFI  178

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
             R+ V AP NSPNTDG+H+ ++S V+I  +   TGDDC+S+GD  + +++ +VTCGPGHG+
Sbjct  179   RFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGI  238

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             ++GSLG  P+EKPV+GV V+NCT TNT NG RIKTWP S  G   ++HFEDII+ NVSNP
Sbjct  239   SVGSLGGNPDEKPVIGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNP  298

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             ++IDQ YCP+N+C   L S+VK+S + F+NIKGTS ++ A+ + CS  VPC+G+ + DI+
Sbjct  299   VVIDQVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDID  358

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             + Y GK+G A S C N+KPS+ GK  P  C
Sbjct  359   ISYSGKEGPAKSSCENIKPSLKGKQNPPVC  388



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/370 (46%), Positives = 231/370 (62%), Gaps = 3/370 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
              DV + GAK DG AD S+    AW  AC +  A+TI    G F+       GPCK P+ I
Sbjct  27    IDVTQLGAKPDGSADMSQVLADAWKQACNSTTASTILIPKGTFLLKEASLAGPCKAPVEI  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
               Q + + A  DP        W+T   V  +T++GG   DG GA  W   +C        
Sbjct  87    QIQGI-IKAPEDPAQISKDNEWMTIKYVDQLTLSGGGTLDGQGAKAWTQNECRVKTECSK  145

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP  L  N V    +  LT+ NSK FH+ +    ++T + +T+ APG+SPNTDG+HIG +
Sbjct  146   LPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITFQHFTITAPGDSPNTDGIHIGHS  205

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + V I  + I TGDDC+S+GDG + V++ KVTCGPGHG+++GSLG+Y NE PV G+ V +
Sbjct  206   TGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSLGRYDNELPVEGIFVTD  265

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT++ TLNG R+K+WP +  GSATNMHFE IIM NVSNP++IDQ+YCP NQC     S V
Sbjct  266   CTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQNVSNPVIIDQEYCPNNQCTNTAPSSV  325

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K++ + FKNI GTS++  A+ + CS ++PC GV + DI+L Y G  G+  S C NVKP++
Sbjct  326   KIAQVSFKNITGTSATPAAVTLLCSKSIPCDGVEIADIDLAYNGNQGNVSSNCANVKPAL  385

Query  1204  IGKVVPAACS  1233
              GK+ P  C+
Sbjct  386   SGKLNPPICA  395



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/384 (44%), Positives = 245/384 (64%), Gaps = 10/384 (3%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAGKFMAG  264
             + LA F        FD+ K+GA  +  AD S+A   A+  AC++   +TI    G F   
Sbjct  3     LFLAHFGES-QTGVFDITKYGANSN--ADISEALLNAFKEACQSTSPSTIVIPKGTFTMN  59

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATT  441
              +  +GPCK P+ +  Q   L A  DP   K  G W+T +++   T++GG I DG  A  
Sbjct  60    QVKLEGPCKSPLELQIQAT-LKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAA  117

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W   +C ++     LP NL FN++T   +  +T  +SK FH+ +   K++T  R+ V AP
Sbjct  118   W---ECKQSKKCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  174

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
              NSPNTDG+H+ ++S V+I  +   TGDDC+S+GD  + +++ +VTCGPGHG+++GSLG 
Sbjct  175   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  234

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQY  981
              P+EKPV+GV V+NCT TNT NG RIKTWP S  G   ++HFEDII+ NVSNP++IDQ Y
Sbjct  235   NPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  294

Query  982   CPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD  1161
             CP+N+C   L S+VK+S + F+NIKGTS ++ A+ + CS  VPC+G+ + DI++ Y GK+
Sbjct  295   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKE  354

Query  1162  GSAVSKCTNVKPSIIGKVVPAACS  1233
             G A S C N+KPS+ GK  P  C+
Sbjct  355   GPAKSSCENIKPSLKGKQNPPVCT  378



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 237/384 (62%), Gaps = 7/384 (2%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAG  264
             +L  + +    A  FDV KFGA  +G  D SKA   A+  AC +  A+ I    G+F   
Sbjct  1     MLFLARLGAAQAGVFDVTKFGATPNG--DISKAILDAFKEACASTSASRIIVPKGRFQMK  58

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATT  441
              +  +GPCK P+    Q   L A PDP      G W T + +   T++G GIFDG G   
Sbjct  59    QVKLEGPCKAPLEFQLQGT-LEASPDPKILP-EGEWFTVNYLNQFTLSGTGIFDGQGKAA  116

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W   DC K      LP NL FN +    +  +T+++SK FH+ +    ++T  R T+ AP
Sbjct  117   WAQNDCAKT-KCAHLPYNLSFNFLNSSTIQDITSKDSKNFHMNVNGCNNLTFNRITITAP  175

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
               S NTDG+H+ ++  V+I  + I TGDDC+S+GD ++ +H+ KVTCGPGHG+++GSLGK
Sbjct  176   KESINTDGIHVARSKNVNITDSVIGTGDDCISVGDELEQLHITKVTCGPGHGISVGSLGK  235

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQY  981
              P EKPV+GV VKNCT  NT NG R+KTWP S  G  T +H+EDII+ NVSNPI+IDQ Y
Sbjct  236   TPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVIDQVY  295

Query  982   CPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD  1161
             CP+NQC   L S VK+S +  KN+KGTS ++ A+ + CS  VPC+GV + DI++ Y GK+
Sbjct  296   CPYNQCNKDLPSLVKISKVSIKNVKGTSRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKE  355

Query  1162  GSAVSKCTNVKPSIIGKVVPAACS  1233
             G A + C NVKP+ +G   P  C+
Sbjct  356   GPAKTSCENVKPTFVGNQNPPVCA  379



>gb|AFK41055.1| unknown [Lotus japonicus]
Length=394

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 181/390 (46%), Positives = 241/390 (62%), Gaps = 15/390 (4%)
 Frame = +1

Query  88    ILLASFVTGLHAA---FFDVMKFGAKGDGKADDSKAFTGAWGAACKAP-GANTITAAGKF  255
             I   SF+ G   A     ++ KFG  G   AD ++AFT AW  AC++   A  +   G +
Sbjct  10    IAFVSFLYGFSTAQSWVLEISKFG--GAPNADITQAFTNAWKKACESTTSAKIVIPHGTY  67

Query  256   MAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNG  432
               G +  QGPCK  I +      + A  +P  FKG G WV FS +   T++G G+FDG G
Sbjct  68    KMGAVQVQGPCKAHIEVQVDGT-IKAPVNPRNFKGAGTWVQFSYISFFTLSGKGVFDGVG  126

Query  433   ATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTV  612
              T W   DC KN H   LP N  FN V    +  +T+++SK F++ +    + T + + +
Sbjct  127   ETAWKRNDCSKNKHCTLLPMNFAFNYVNNSIVRDITSKDSKSFNVNVLGCNNFTFDGFKI  186

Query  613   DAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGS  792
              A   SPNTDG+H+G+++ V I+   I TGDDCVSLGDG+++V V  V CGPGHG+++GS
Sbjct  187   VALALSPNTDGIHVGRSTDVKILNTNIGTGDDCVSLGDGIKNVLVRNVNCGPGHGVSVGS  246

Query  793   LGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILI  969
             LGKYP+EKPV G  VKNCTLTNT NG RIKTWP +P     T+MHFEDIIM NV NPI+I
Sbjct  247   LGKYPDEKPVEGFYVKNCTLTNTDNGVRIKTWPSTPGTAPITDMHFEDIIMVNVKNPIII  306

Query  970   DQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY  1149
             DQ+YCPWNQC     SK+K+S + FKNI+GTS++   + + CS  VPC  V +N ++L +
Sbjct  307   DQEYCPWNQCSKKSPSKIKISKVSFKNIRGTSATPEGVILICSSGVPCDTVELNGVDLTF  366

Query  1150  KGKDGSAVSKCTNVKPSIIGK----VVPAA  1227
              G    A +KC NVKP + GK    V PAA
Sbjct  367   NG--APATAKCANVKPIVTGKAPTCVAPAA  394



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 169/370 (46%), Positives = 234/370 (63%), Gaps = 5/370 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
             FDV K+GA  +G  D SKA   A+  AC A   +TI    G +    +  QGPCK P+ +
Sbjct  30    FDVTKYGATTNG--DISKAVLDAFKEACAATSPSTIVIPKGTYQMNQVKLQGPCKAPVEL  87

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
               Q + L A  DP        W+T + +   T++GG +FDG G   W   +C  +     
Sbjct  88    QVQAI-LKAPSDPKQLSADIEWLTVNYIDRFTLSGGGVFDGQGKQAWGQNNCKDSKSCSN  146

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL FN +T   +  +T+++SK FH+ +   K++T  R  + AP  S NTDG+H+ ++
Sbjct  147   LPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNLTFIRVNITAPQESINTDGIHVARS  206

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             S V+I    I TGDDC+S+GD ++ +H+ +VTCGPGHG+++GSLGK P EKPV+GV VKN
Sbjct  207   SNVNITDCVIGTGDDCISVGDELEQLHITRVTCGPGHGISVGSLGKTPGEKPVVGVYVKN  266

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT  NT NG R+KTWP S  G  T++H+EDII+ NVSNPI+IDQ YCP+NQC   L SKV
Sbjct  267   CTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVSNPIVIDQVYCPYNQCNKDLPSKV  326

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K+S +  KNI+GTS ++ A+ + CS   PC GV + DI++ Y GK+G A S C NVKP +
Sbjct  327   KISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGDIDITYNGKEGPAKSSCENVKPKL  386

Query  1204  IGKVVPAACS  1233
             +GK  P  C+
Sbjct  387   VGKQNPPICA  396



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 240/373 (64%), Gaps = 9/373 (2%)
 Frame = +1

Query  118   HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAGKFMAGPIWFQGPCKG  294
                 FD+ K+GA  +  AD S+A   A+  AC++   +TI    G F    +  +GPCK 
Sbjct  24    QTGVFDITKYGANSN--ADISEALLNAFKEACQSTSPSTIVIPKGTFTMNQVKLEGPCKS  81

Query  295   PITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNG  471
             P+ +  Q   L A  DP   K  G W+T +++   T++GG I DG  A  W   +C ++ 
Sbjct  82    PLELQIQAT-LKAPSDPSQLK-VGEWLTVNKIDQFTMSGGGILDGQAAAAW---ECKQSK  136

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
                 LP NL FN++T   +  +T  +SK FH+ +   K++T  R+ V AP NSPNTDG+H
Sbjct  137   KCNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAPANSPNTDGIH  196

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             + ++S V+I  +   TGDDC+S+GD  + +++ +VTCGPGHG+++GSLG  P+EKPV+GV
Sbjct  197   VSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGGNPDEKPVVGV  256

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
              V+NCT TNT NG RIKTWP S  G   ++HFEDII+ NVSNP++IDQ YCP+N+C   L
Sbjct  257   FVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPFNKCNKDL  316

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              S+VK+S + F+NIKGTS ++ A+ + CS  VPC+G+ + DI++ Y GK+G A S C N+
Sbjct  317   PSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCENI  376

Query  1192  KPSIIGKVVPAAC  1230
             KPS+ GK  P  C
Sbjct  377   KPSLKGKQNPPVC  389



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/399 (43%), Positives = 242/399 (61%), Gaps = 8/399 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTG---LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAP  222
             M+   I  A+  + LA             FDV K+GA  +G  D SKA   A+  AC A 
Sbjct  1     MELKFISFAFLLLFLARIGDAQPTTSPGVFDVTKYGATTNG--DISKAVLDAFKEACAAT  58

Query  223   GANTIT-AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGV  399
               +TI    G +    +  QGPCK P+ +  Q + L A  DP        W+T + +   
Sbjct  59    SPSTIVIPKGTYQMNQVKLQGPCKAPVELQVQAI-LKAPSDPKQLNADVEWLTVNYIDRF  117

Query  400   TINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIG  576
             T++GG +FDG G   W+  +C  +     LP NL FN +T   +  +T+++SK FH+ + 
Sbjct  118   TLSGGGVFDGQGKQAWDQNNCKDSKSCSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVN  177

Query  577   SSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKV  756
               K++T  R  + AP  S NTDG+H+ ++S V+I    I TGDDC+S+GD ++ +H+ +V
Sbjct  178   GCKNLTFIRVNITAPPESINTDGIHVARSSNVNITDCVIGTGDDCISVGDELEQLHITRV  237

Query  757   TCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDI  936
             TCGPGHG+++GSLGK P EKPV+GV VKNCT  NT NG R+KTWP S  G  T++H+EDI
Sbjct  238   TCGPGHGISVGSLGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDI  297

Query  937   IMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQ  1116
             I+ NVSNPI+IDQ YCP+NQC   L S+VK+S +  KNI+GTS ++ A+ + CS   PC 
Sbjct  298   IVQNVSNPIVIDQVYCPYNQCNKDLPSQVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCD  357

Query  1117  GVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             GV + DI++ Y GK+G A S C NVKP  +GK  P  C+
Sbjct  358   GVEVGDIDITYNGKEGPAKSSCENVKPKFVGKQNPPICA  396



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 244/384 (64%), Gaps = 10/384 (3%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAGKFMAG  264
             + LA F        FD+ K+GA  +  AD S+A   A+  AC++   +TI    G F   
Sbjct  3     LFLAHFGES-QTGVFDITKYGANSN--ADISEALLNAFKEACQSTSPSTIVIPKGTFTMN  59

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATT  441
              +  +GPCK P+ +  Q   L A  DP   K  G W+T +++   T++GG I DG  A  
Sbjct  60    QVKLEGPCKSPLELQIQAT-LKAPSDPSQLKV-GEWLTVNKLDQFTMSGGGILDGQAAAA  117

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W   +C ++     LP NL FN++T   +  +T  +SK FH+ +   K++T  R+ V AP
Sbjct  118   W---ECKQSKKCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  174

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
              NSPNTDG+H+ ++S V+I  +   TGDDC+S+GD  + +++ +VTCGPGHG+++GSLG 
Sbjct  175   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  234

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQY  981
              P+EKPV+GV V+NCT TNT NG RIKTWP S  G   ++HFEDII+ NVSNP++IDQ Y
Sbjct  235   NPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVY  294

Query  982   CPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD  1161
             CP+N+C   L S+VK+S + F+NIKGTS ++ A+ + CS  VPC+G+ + DI++ Y GK+
Sbjct  295   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKE  354

Query  1162  GSAVSKCTNVKPSIIGKVVPAACS  1233
             G A S C N+KPS+  K  P  C+
Sbjct  355   GPAKSSCENIKPSLKDKQNPPVCT  378



>emb|CDY28013.1| BnaC05g44150D [Brassica napus]
Length=493

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 238/371 (64%), Gaps = 19/371 (5%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDGK DD+ AF   W  A +A    TIT   G ++   +  +GP K PIT 
Sbjct  131   IDVKASGAKGDGKTDDTAAFMAVWKKAIEATTPTTITVPKGDYLVEELLLEGPSKSPITF  190

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI--NGGIFDGNGATTWNLPDCGKNGHIC  480
             +    NL A       K H GWV F ++    +  NG IFDG G+  W + DC + G   
Sbjct  191   EMHG-NLKAPSAVTTRKPHSGWVNFRKLKDFNLIGNGAIFDGQGSVAWKVNDCKQTGKCN  249

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++   +   R+ G+T+ NSK FH+ I    +VT++   +DAP  S NTDG+H+G+
Sbjct  250   NLPINIRLTQLDNSRISGITSTNSKLFHMNIHQCTNVTLQDVHIDAPPESLNTDGIHVGK  309

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V+I G+ IKTGDDC+S+G G              HGL+IGSLGKYPNE+PV G+T++
Sbjct  310   SVGVTIRGSKIKTGDDCISIGGG--------------HGLSIGSLGKYPNEEPVKGITIR  355

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
              C + +T NG RIKTWPGSP G  +   FEDI M+NVS PIL+DQ YCP  +CK+G  SK
Sbjct  356   KCIVKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPHGKCKSG-PSK  414

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             V+L  + FKNI+GTSS+K+A++++CSP  PC+ V + DINL+  GK+G+AVS C+NVKP+
Sbjct  415   VQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAAVSACSNVKPT  474

Query  1201  IIGKVVPAACS  1233
             + GK++PAAC+
Sbjct  475   VTGKMIPAACT  485



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   335 bits (859),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/391 (43%), Positives = 246/391 (63%), Gaps = 10/391 (3%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-A  243
             +  A   + LA F        FD+ K+GA  +  AD S+A   A+  AC++   +TI   
Sbjct  7     VHFALVLLFLAHFGES-QTGVFDITKYGANSN--ADISEALLNAFKEACQSTSPSTIVIP  63

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IF  420
              G F    +  +GPCK P+ +  Q   L A  DP   K  G W+T +++   T++GG I 
Sbjct  64    KGTFTMNQVKLEGPCKSPLELQIQ-ATLKAPSDPSQLKV-GEWLTVNKLDQFTMSGGGIL  121

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG  A  W   +C ++     LP NL FN++T   +  +T  +SK FH+ +   K++T  
Sbjct  122   DGQAAAAW---ECKQSKKCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFI  178

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
             R+ V AP NSPNTDG+H+ ++S V+I  +   TGDDC+S+GD  + +++ +VTCGPGHG+
Sbjct  179   RFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGI  238

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             ++GSLG  P+EKPV+GV V+NCT TNT NG RIKTWP S  G   ++HFEDII+ NVSNP
Sbjct  239   SVGSLGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNP  298

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             ++IDQ YCP+N+C   L S+VK+S + F+NIKGTS ++ A+ +  S  VPC+G+ + DI+
Sbjct  299   VVIDQVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLRSKGVPCEGIEVGDID  358

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             + Y GK+G A S C N+KPS+ GK  P  C+
Sbjct  359   ITYSGKEGPAKSSCENIKPSLKGKQNPPVCT  389



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/370 (45%), Positives = 230/370 (62%), Gaps = 3/370 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
              DV + GAK DG AD S+    AW  AC +   +TI    G F+       GPCK P+ +
Sbjct  27    IDVTQLGAKPDGSADMSQVLADAWKQACNSTTPSTILIPKGTFLLKEASLAGPCKAPVEV  86

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
               Q   + A  DP        W++   V  +T++GG   DG GA  W   +C        
Sbjct  87    QIQG-TVKAPEDPAQITKDKEWMSIIYVDQLTLSGGGTLDGQGAKAWTQNECRVKTECSK  145

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP  L  N V    +  LT+ NSK FH+ +    ++T + +T+ APG+SPNTDG+HIG +
Sbjct  146   LPNTLSLNFVNNTVIRDLTSLNSKLFHVNLFGCNNITFQHFTIIAPGDSPNTDGIHIGHS  205

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + V I  + I TGDDC+S+GDG + V++ KVTCGPGHG+++GSLG+Y NE PV G+ V +
Sbjct  206   TGVVITDSNIGTGDDCISIGDGAKQVNISKVTCGPGHGISVGSLGRYDNELPVEGIFVTD  265

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT++ TLNG R+K+WP S  GSATNMHFE IIM NVSNP++IDQ+YCP NQC     S V
Sbjct  266   CTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVSNPVIIDQEYCPNNQCTNTAPSSV  325

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K++ + FKNI GTS++  A+ + CS ++PC+GV + DI+L Y G  GS  S C NVKP++
Sbjct  326   KIAQVSFKNITGTSATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGSVSSNCANVKPAL  385

Query  1204  IGKVVPAACS  1233
              GK+ P  C+
Sbjct  386   SGKLNPPICA  395



>ref|XP_010675951.1| PREDICTED: exopolygalacturonase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 177/371 (48%), Positives = 231/371 (62%), Gaps = 8/371 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPITID  309
              D+ K GAK +G A            A  AP    +  AG +M   I F GPCK P+TI+
Sbjct  36    LDITKLGAKPNGDATQGLVAAWKQACAAAAP-TKILVPAGDYMLNAIKFTGPCKSPVTIE  94

Query  310   AQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN----GGIFDGNGATTWNLPDCGKNGHI  477
                 N  A  DP   KG   WV    + G+T+N    GG FDG G   W   +C K G  
Sbjct  95    IAG-NFKAPADPAQMKGEDTWVKIENIQGLTVNCLPTGGTFDGQGQMAWKQNNCAKTGTC  153

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N +FN++T  ++ G+ + NSK +H+ + S K+ T+   T++AP +S NTDG+HIG
Sbjct  154   DNLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLSCKNFTLFDTTIEAPKDSLNTDGIHIG  213

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ + +  A I TGDDC+S+GDG  DVH+E VTCGPGHG++IGSLG+Y  E PV GVTV
Sbjct  214   RSAGIFVTKAKIGTGDDCISMGDGAVDVHIEDVTCGPGHGISIGSLGRYEKEAPVTGVTV  273

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             K CT+++T NG RIK+W  S V +A+++HFEDI + NV  PILIDQ+YCP+N CKA   S
Sbjct  274   KKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPILIDQEYCPYNHCKAKTPS  333

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS I FKNI+GT+ SK A+KI CS   PC  V + DI+L + G  G  VS C NVKP
Sbjct  334   KVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFSG--GPVVSMCKNVKP  391

Query  1198  SIIGKVVPAAC  1230
                GK  P AC
Sbjct  392   ITSGKQNPVAC  402



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   335 bits (858),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 174/397 (44%), Positives = 249/397 (63%), Gaps = 9/397 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             M +  + +  F + L SF    +A  FD+ KFG    G +D ++AF  A+ AAC++P  +
Sbjct  1     MVAKTLASVLFALYLLSF--SANAEVFDIRKFGHVSVG-SDITQAFRQAFQAACQSPRPS  57

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
             + +   G +  G I   GPCK P+ +    +N     +  A  GH  WV F  + G  +N
Sbjct  58    SVVIPKGTYKLGEINMIGPCKAPVEV---TVNGHLQANGNALAGHEKWVVFRYINGFKLN  114

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG IFDG G   W   DC KN +   LP +++F+ V    +  +T+ ++K FH+ +   K
Sbjct  115   GGGIFDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCK  174

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             + T +   + AP  SPNTDG+H+G++  V+I+ + I TGDDC+S+GDG++++HVE+VTCG
Sbjct  175   NFTFDNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISIGDGMKNLHVERVTCG  234

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIM  942
             PGHG++IGSLG+Y  E+PV G+ +KNCTL  T NG RIKT+P S    + +++HFEDII+
Sbjct  235   PGHGISIGSLGRYTIEEPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIV  294

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
              NVSNPILIDQ+YCPWN+C     S VKL  I FK I+GTS +K A+++ CS  VPC  V
Sbjct  295   KNVSNPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKGVPCTNV  354

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              + DI+L Y G DG A  +C+NV P + G   P ACS
Sbjct  355   EVGDIDLRYGGADGPATFECSNVTPKLSGTQFPKACS  391



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 244/384 (64%), Gaps = 10/384 (3%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAGKFMAG  264
             + LA F        FD+ K+GA  +  AD S+A   A+  AC++   +TI    G F   
Sbjct  3     LFLAHFGES-QTGVFDITKYGANSN--ADISEALLNAFKEACQSTSPSTIVIPKGTFTMN  59

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATT  441
              +  +GPCK P+ +  Q   L A  DP   K  G W+T +++   T++GG I DG  A  
Sbjct  60    QVKLEGPCKSPLELQIQAT-LKAPSDPSQLK-VGEWLTVNKLDQFTMSGGGILDGQAAAA  117

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W   +C ++     LP NL FN++T   +  +T  +SK FH+ +   K++T  R+ V AP
Sbjct  118   W---ECKQSKKCNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIRFNVSAP  174

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
              NSPNTDG+H+ ++S V+I  +   TGDDC+S+GD  + +++ +VTCGPGHG+++GSLG 
Sbjct  175   ANSPNTDGIHVSRSSSVNITDSNFSTGDDCISVGDETEQLYITRVTCGPGHGISVGSLGG  234

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQY  981
              P+EKPV+GV V NCT+TNT NG RIKTWP S  G   ++ FEDII+ NVSNP++IDQ Y
Sbjct  235   NPDEKPVVGVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVIDQVY  294

Query  982   CPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD  1161
             CP+N+C   L S+VK+S + F+NIKGTS ++ A+ + CS  VPC+G+ + DI++ Y GK+
Sbjct  295   CPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKE  354

Query  1162  GSAVSKCTNVKPSIIGKVVPAACS  1233
             G A S C N+KPS+ GK  P  C+
Sbjct  355   GPAKSSCENIKPSLKGKQNPPVCT  378



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 175/397 (44%), Positives = 248/397 (62%), Gaps = 10/397 (3%)
 Frame = +1

Query  49    DMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA  228
             DMK   +      + LA F    +A F D+ K+GA  +  AD S+A   A+  AC +   
Sbjct  2     DMKIKFVYFGLGVLFLAHFGESQNATF-DITKYGATAN--ADISEAVGKAFKEACASTSP  58

Query  229   NTIT-AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI  405
             +TI    G F    +  +GPCKGPI +  Q + L A  DP A K  G W+T +++   T+
Sbjct  59    STIVIPKGTFQMNQVLLEGPCKGPIELQIQAI-LKAPTDPNAIK-TGEWLTVNKLDFFTM  116

Query  406   NGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +GG   DG G   W   +C K+     LP NL FN++T   +  +T  +SK FH+ +   
Sbjct  117   SGGGTLDGQGKEAW---ECKKSKKCTKLPNNLSFNSLTNSIIKDITTLDSKAFHVNVNQC  173

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
             K++T  ++ V AP +SPNTDG+H+ + S V+I  ++  TGDDC+S+GD  + +++ KVTC
Sbjct  174   KNLTFTKFNVSAPADSPNTDGIHVARASSVNITESSFSTGDDCISIGDETEQLYITKVTC  233

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIM  942
             GPGHG+++GSLG  P EKPV+GV VKNCTL +T NG RIKTWP S  G  +++HFEDII+
Sbjct  234   GPGHGISVGSLGGNPGEKPVVGVFVKNCTLVSTDNGVRIKTWPASHPGVVSDIHFEDIIV  293

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
              NVSNPI+IDQ YCP  +C   L S+VK+S +  +NIKGTS ++ A+ + CS   PC+GV
Sbjct  294   QNVSNPIVIDQVYCPSGKCNKDLPSQVKISKVSIQNIKGTSRTQNAISLTCSKGSPCEGV  353

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              + D+++ Y GK+G A S C N+KP+  GK  PA CS
Sbjct  354   EVGDVDISYSGKEGPAKSSCENIKPTFKGKQTPAVCS  390



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/372 (46%), Positives = 238/372 (64%), Gaps = 10/372 (3%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
              FDV K+GAK +  AD ++A   AW  AC +      +   G +  G I  +G CK PI 
Sbjct  54    IFDVTKYGAKPN--ADITQALADAWKEACASTSPCKIVIPTGTYKLGTIELKGECKSPIE  111

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI-NGGIFDGNGATTWNLPDCGKNGHIC  480
             I  Q   L A PD     G   WV F  +  +++ +GG+FDG G   W   DC KN    
Sbjct  112   IQVQGT-LQAPPD---LTGED-WVHFKYIDYLSVTSGGVFDGQGKQAWESNDCDKNPKCA  166

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              +P NL+F+ +    +  +T+++SK FH+++    ++T +   V+AP  S NTDG+HIG+
Sbjct  167   RIPMNLKFSFIKNAIVSDITSKDSKNFHIQVLGCNNLTFQHVNVNAPETSINTDGIHIGR  226

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  ++I+   I TGDDC+SLGDG + V +  VTCGPGHG+++GSLG+Y  E+PV G+ VK
Sbjct  227   SLGINILNTNIGTGDDCISLGDGSKQVTITNVTCGPGHGISVGSLGRYNLEEPVEGLQVK  286

Query  841   NCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             NCTLT T NG RIKTWP SP  G A++MH+ED++MNNV NPILIDQ+YCP+NQC   + S
Sbjct  287   NCTLTGTTNGLRIKTWPASPAAGVASDMHYEDVVMNNVMNPILIDQEYCPYNQCNKQVPS  346

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVK+S + FKNI+GTS +  A+ + CS + PC GV + DI+L Y G +G   S+C NVKP
Sbjct  347   KVKISKVSFKNIRGTSGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGPITSRCANVKP  406

Query  1198  SIIGKVVPAACS  1233
             ++ GK  P AC+
Sbjct  407   TVSGKQNPPACT  418



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 228/357 (64%), Gaps = 9/357 (3%)
 Frame = +1

Query  181   KAFTGAWGAAC--KAPGANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF  354
             +AF  +W AAC  K P +  +  AG ++ G I  +GPC+ P  I+    N  A  D  AF
Sbjct  2     QAFLDSWTAACASKKP-SKVLVPAGNYILGAITLKGPCQTPTVIEILG-NFKAPSDVAAF  59

Query  355   KGHGGWVTFSQVIGVTI----NGGIFDGNGATTWNLPDCGKNGHIC-PLPANLQFNAVTG  519
             K    W     V  + I     GG+FDG G   W   +C KN +    LP N++FN V+ 
Sbjct  60    KKEDSWFKVENVDSLIIISGKGGGVFDGQGQAGWKKNECTKNANCAFDLPYNIRFNFVSN  119

Query  520   LRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKT  699
              ++ GLT+ NSK FH+ +   K + +   T+ AP +SPNTDG+HIG++  + + G TI T
Sbjct  120   SKVSGLTSLNSKSFHVVLLGCKQLELSDMTITAPADSPNTDGIHIGRSENIIVRGWTIGT  179

Query  700   GDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARI  879
             GDDCVS GDG ++V +E VTCGPGHGL++GSLGKYPNE+PV  +T++NCT+ NT NG R+
Sbjct  180   GDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSNITIRNCTIKNTDNGVRV  239

Query  880   KTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             KTW  S   + T ++FEDI + NV NP+++DQ+YCPWN CKA   SKVK+S I FKN+KG
Sbjct  240   KTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPWNHCKAKTPSKVKISDIRFKNVKG  299

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
              SS+K A+K+ CS  VPC  V + DI++ Y G DG AVS C  VKP + GK  P AC
Sbjct  300   KSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKPLLTGKQSPPAC  356



>ref|XP_006845389.1| hypothetical protein AMTR_s00019p00055210 [Amborella trichopoda]
 gb|ERN07064.1| hypothetical protein AMTR_s00019p00055210 [Amborella trichopoda]
Length=410

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/393 (44%), Positives = 247/393 (63%), Gaps = 4/393 (1%)
 Frame = +1

Query  61    ILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTI  237
             + I  A+   + A+      A  F+VM+FGA  DG  D+S+AF  AW AAC+  G +  +
Sbjct  18    VFIAIAYVAAVEAANGNSSSAGEFNVMQFGAIADGTTDNSEAFGAAWKAACEWKGPSRLL  77

Query  238   TAAGKFMAGPIWFQGPCKGPITIDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG  414
                G F+ GP+ F+GPC     +  Q K  + AL D   +     W+ F  V G+ + GG
Sbjct  78    IPEGTFLVGPVLFKGPCPSASPMVVQVKGKVKALTDMSKYPSDE-WIVFQYVDGLVVTGG  136

Query  415   -IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDV  591
               FDG GA+ W L  C K  H   LP +L+FN +T   + G+ + +SK FH+ +   K++
Sbjct  137   GTFDGQGASAWRLNQCPKKAHCKLLPTSLKFNFITNGEIRGIHSVDSKLFHMLLFGCKNL  196

Query  592   TIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPG  771
              ++   + AP +SPNTDG+H+G +S ++I  + I TGDDC+SLG G   V V+ V CGPG
Sbjct  197   NVQSIKISAPADSPNTDGIHVGSSSNITISRSHIGTGDDCISLGPGSTQVTVKNVFCGPG  256

Query  772   HGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNV  951
             HG+++GSLGK+  E+ V G+ V+NCT+++T NG RIKTW GS   SA+N  +EDI+MNNV
Sbjct  257   HGISVGSLGKFSKEEGVQGLHVENCTISDTTNGLRIKTWAGSDSSSASNFTYEDIVMNNV  316

Query  952   SNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMN  1131
             +NPI+IDQQYCP++ C     S+VK++ I FKNI+GTS+SK+A+ + CS A PCQ V ++
Sbjct  317   ANPIIIDQQYCPYSSCPQKGPSRVKINDISFKNIRGTSASKIAVNLLCSEAFPCQNVQLD  376

Query  1132  DINLIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             DI L Y G+  ++ + CTNVK    G  +P  C
Sbjct  377   DIKLEYNGQGEASTASCTNVKGVSTGIQIPPTC  409



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 240/387 (62%), Gaps = 9/387 (2%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-NTITAAGKFM  258
             F  +L  F+  L A   +   F       +D ++A   A+ +AC++P A + +   G+F 
Sbjct  7     FSTILVIFLLSLSA---NAEVFKVSSSSGSDITQALLKAFKSACQSPSASHVVIPKGEFK  63

Query  259   AGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGA  435
              G I   GPCK PI I  Q        D     G   WV FS++ G  +NGG IFDG G 
Sbjct  64    LGEIELMGPCKAPIEITLQGT---VKADGNTKHGRERWVVFSRINGFKLNGGGIFDGEGN  120

Query  436   TTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVD  615
               W + +C K      LP +++F+ VT   +  +T  +SK FH+ +  +K++T     V 
Sbjct  121   AAWRVNNCHKTFECKKLPISIRFDFVTEAEIRDITTLDSKNFHINVLGAKNMTFTNVKVI  180

Query  616   APGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSL  795
             AP  SPNTDG+H+G++  V I+ + I TGDDC+S+GDG++++HVE V CGPGHG+++GSL
Sbjct  181   APAESPNTDGIHLGRSDGVKILNSRISTGDDCISVGDGMKNLHVEGVVCGPGHGISVGSL  240

Query  796   GKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILID  972
             G+Y +E+ V G+TV NCTL  T NG RIKTWP +    +A+ +HFE+II+ NVSNPILID
Sbjct  241   GRYGHEQDVSGITVVNCTLQETDNGLRIKTWPSAACATTASGIHFENIILKNVSNPILID  300

Query  973   QQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK  1152
             Q+YCPWNQC     S +KL  I FKNI+GTS +K A+K+ CS   PCQ V + +IN+ YK
Sbjct  301   QEYCPWNQCNKNKPSTIKLVDIKFKNIRGTSGNKDAVKLLCSKGHPCQNVEIGNINIAYK  360

Query  1153  GKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             G DG A  +C+NVKP ++G   P ACS
Sbjct  361   GADGPATFQCSNVKPKLVGTQNPKACS  387



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/392 (46%), Positives = 247/392 (63%), Gaps = 16/392 (4%)
 Frame = +1

Query  82    FCILLASFVTGLHA---AFFDVMKFGAKGDGKADDSKAFTGAWGAACKA--PGANTITAA  246
             F + L SF     +     F + K+G    G AD ++A   AW  AC +  P A  +   
Sbjct  14    FLMALLSFTVESRSHVDVIFHLRKYGNIVSG-ADVTEALKDAWNDACASLRPSA-VVIPK  71

Query  247   GKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHG-GWVTFSQVIGVTINGG-IF  420
             G F      F+GPCK P+ +  +   L A   P     HG  W+TF+ V  +T++GG +F
Sbjct  72    GTFKVREGEFKGPCKSPVEVRVRG-TLQAPKHP-----HGDSWITFAYVDRMTLSGGGVF  125

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G   W   DC K+     LP +L+FN +T   +  +T+ +SK FH+ I    ++T +
Sbjct  126   DGQGKAGWEKNDCHKHISCARLPISLRFNFITNSIVRRITSLDSKNFHVNILGCNNLTFD  185

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
                + AP +SPNTDG+HIG++  +SI+ + I TGDDC+SLGDG + V +  VTCGPGHG+
Sbjct  186   GVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITNVTCGPGHGI  245

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSN  957
             +IGSLGKY NE+PV GV VKNCT+ NT NG RIKTWP SPV G ATNMHF DI M NVSN
Sbjct  246   SIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMHFLDITMVNVSN  305

Query  958   PILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDI  1137
             PILIDQ+YCPWNQC   + SK+K++ + FKNI+G+S++ +A+K+ CS  +PC+ V + +I
Sbjct  306   PILIDQEYCPWNQCNRKIPSKIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANI  365

Query  1138  NLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             +L+Y G  GS  S+C NVKP I G   P  CS
Sbjct  366   DLVYNGIKGSLTSECMNVKPIISGTQNPPICS  397



>dbj|BAH20364.1| AT3G14040 [Arabidopsis thaliana]
Length=289

 Score =   328 bits (842),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 209/276 (76%), Gaps = 0/276 (0%)
 Frame = +1

Query  406   NGGIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             N  IFDG G+  W   DC K G    LP N++F  +T  ++  +T+ NSK FH+ I + K
Sbjct  7     NKAIFDGQGSLAWKANDCAKTGKCNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCK  66

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T+    +DAP  S NTDG+HIG+++ V++IGA IKTGDDCVS+GDG +++ VE V CG
Sbjct  67    NITLTDIGIDAPPESLNTDGIHIGRSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECG  126

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMN  945
             PGHG++IGSLG+YPNE+PV GVTV+ C + NT NG RIKTWPGSP G A+N+ FEDI M+
Sbjct  127   PGHGISIGSLGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMD  186

Query  946   NVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVV  1125
             NVS P+LIDQ+YCP+  CKAG+ SKVKLS +  KNIKGTS++K+A+K+ CS  VPC  + 
Sbjct  187   NVSLPVLIDQEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIA  246

Query  1126  MNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             ++DINL++ GK+G AVS C+N+KP + GK+VPAAC+
Sbjct  247   LSDINLVHNGKEGPAVSACSNIKPILSGKLVPAACT  282



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 169/370 (46%), Positives = 231/370 (62%), Gaps = 8/370 (2%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
              FD+ K+GAK +  AD + A T AW  AC +   +  +   G +       +GPCK PI 
Sbjct  48    VFDITKYGAKPN--ADITAALTSAWKEACASTTPSKVLIPKGSYGLSQSNLKGPCKSPIE  105

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGGIFDGNGATTWNLPDCGKNGHICP  483
             +  +      L  P   +G G  +  +  +      G+ DG G   W   DC        
Sbjct  106   LQIEG----TLQAPAHPEGEGLLILENTDLLTVSGTGVLDGQGKAGWEKNDCHLKKECTK  161

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL+ N +T   + G+T+ +SK FH+ +   K++T +  T+ APGNSPNTDG+H+  +
Sbjct  162   LPMNLKLNFITNSIVTGITSLDSKNFHINLLGCKNLTFDHVTITAPGNSPNTDGIHVSSS  221

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
              +++I+   I TGDDC+S+GD  + V +  VTCGPGHG++IGSLGKY  EK V+GVTVK 
Sbjct  222   EQINILNTNIATGDDCISVGDSNKQVAISDVTCGPGHGISIGSLGKYTKEKEVVGVTVKK  281

Query  844   CTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             C LT T NG RIKTWP S V   AT+MHFEDI M+NVSNPI+IDQ+YCPWNQC   +ASK
Sbjct  282   CKLTGTTNGVRIKTWPDSAVAFPATDMHFEDIEMDNVSNPIIIDQEYCPWNQCNRKVASK  341

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +K+S + FKNI+GTS++ +A+KI CS ++PC+GV + DI+L Y G +G   S+C NVKP 
Sbjct  342   IKISNVSFKNIRGTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGPIKSQCANVKPV  401

Query  1201  IIGKVVPAAC  1230
             I GK  P  C
Sbjct  402   ITGKQNPPIC  411



>ref|XP_010548800.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   332 bits (851),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 173/397 (44%), Positives = 246/397 (62%), Gaps = 9/397 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             M +  + +  F + L SF    +A  FD+ KFG    G +D ++A   A+ AAC+ P  +
Sbjct  1     MAAKTLASVLFALYLLSF--SANAEVFDIRKFGTASVG-SDITQALRQAFQAACQNPRPS  57

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
             + +   G +  G I   GPCK P+ +    +N     +  A  G   WV F  + G  +N
Sbjct  58    SVVIPKGTYKLGEIDMVGPCKAPVEV---TVNGHLQANGNALVGREKWVVFRYINGFKLN  114

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G GIFDG G   W   DC KN +   LP +++F+ V    +  +T+ ++K FH+ +   K
Sbjct  115   GAGIFDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCK  174

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             + T +   + AP  SPNTDG+H+G++  V+I+ + I TGDDC+S+GDG++++HVE+VTCG
Sbjct  175   NFTFDNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCG  234

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIM  942
             PGHG++IGSLG+Y NE PV G+ +KNCTL  T NG RIKT+P S    + +++HFEDII+
Sbjct  235   PGHGISIGSLGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIV  294

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
              NV NPILIDQ+YCPWN+C     S VKL  I FK I+GTS +K A+++ CS AVPC  V
Sbjct  295   KNVFNPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNV  354

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              + DI+L Y G DG A  +C+NV P + G   P ACS
Sbjct  355   EVGDIDLRYGGADGPATFQCSNVTPKLSGTQFPKACS  391



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/384 (46%), Positives = 241/384 (63%), Gaps = 8/384 (2%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAAC--KAPGANTITAAGKFMA  261
             +LLA   T      +D+ K+GAK +   D ++A   AW AAC  K P +  +   G F  
Sbjct  14    VLLAITATAQCGNVYDITKYGAKSNN--DANQALGQAWKAACASKVP-SKVVVPKGTFRL  70

Query  262   GPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGAT  438
                 F GPCK PI        L A  +P  FK   GWVTF  +  +T++GG  FDGNG  
Sbjct  71    SRAAFFGPCKAPIEFMIVGT-LQAPQNPGGFKDGDGWVTFQDIDRLTLDGGGTFDGNGQN  129

Query  439   TWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDA  618
              W    C +  +   LP NL+FN +    +  +T+ NSKQFH+ +    +++     + A
Sbjct  130   VWG-KHCTRLNYCSKLPINLRFNFIKNSVIKSVTSLNSKQFHIMVLGGVNLSFRNLKIIA  188

Query  619   PGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLG  798
             P +S NTDG+HIG+++ +SI  + I+TGDDC+S+GDG +++ V+ VTCGPGHG++IGSLG
Sbjct  189   PEDSYNTDGIHIGRSTNISITDSYIQTGDDCISVGDGTKNLTVKGVTCGPGHGISIGSLG  248

Query  799   KYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQ  978
             KY NE PV G+TV++CT  NT NG RIKTWP +  GSA+++ FE++ M NV +P+LIDQ+
Sbjct  249   KYRNEAPVQGITVRDCTFKNTQNGVRIKTWPNANEGSASDLRFENLYMQNVGSPVLIDQE  308

Query  979   YCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGK  1158
             YCPWNQC     SKVKLS I FKNI GTSS+ +A+ + CS   PCQ V + +I+L YKGK
Sbjct  309   YCPWNQCNTQNPSKVKLSKISFKNIWGTSSTPLAVNLICSRGYPCQNVEVGNIDLKYKGK  368

Query  1159  DGSAVSKCTNVKPSIIGKVVPAAC  1230
             DG A S C NV   + GK+ P+ C
Sbjct  369   DGPAHSVCKNVNVKVTGKMNPSPC  392



>ref|XP_011099769.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=402

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/395 (43%), Positives = 241/395 (61%), Gaps = 7/395 (2%)
 Frame = +1

Query  61    ILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAA-CKAPGANTI  237
              ++    F  LLA  V       +DV K+GA  +  AD S+A   AW  A      +  +
Sbjct  5     FIVAIFLFSALLACNVNAQIPVLYDVRKYGA--NSGADISQALLKAWKEAIVSVVPSKIL  62

Query  238   TAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF-KGHGGWVTFSQVIGVTINGG  414
                G F    +  +GP K PI ++ Q   L A PDP         W+T + V   T++GG
Sbjct  63    IPQGTFTVSQVKLEGPNKAPIELEVQGT-LKAFPDPNQLPDKKAEWITINYVNYFTLSGG  121

Query  415   -IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDV  591
              +FDG G   W + DC KN +   LP NL FN +    +  +T ++SK FHL   SS +V
Sbjct  122   GVFDGQGQIAWKMNDCHKNKNCPKLPYNLSFNFINNSIIHDVTTKDSKNFHLNCISSHNV  181

Query  592   TIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPG  771
             T   +T+ AP  SPNTDG+H+G++++++II + I+TGDDCVS+GD  ++VH+E VTCGPG
Sbjct  182   TFRHFTISAPDESPNTDGIHLGRSTRINIIDSVIRTGDDCVSIGDDTKEVHIENVTCGPG  241

Query  772   HGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNN  948
             HG++IGSLG Y  EK V G+ VKN T   T NG R+KTWP +P   S TN++FED+IM+N
Sbjct  242   HGISIGSLGGYATEKDVEGIYVKNYTFIGTGNGVRVKTWPTTPAQLSITNLNFEDLIMDN  301

Query  949   VSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVM  1128
             VSNPI+IDQ+YCP N CK    S +K++ +  KNI+GT++S+ A+ + CS   PC+ VV+
Sbjct  302   VSNPIIIDQEYCPHNLCKRDRPSFIKINKVNLKNIRGTTNSEEAVTLLCSKLKPCENVVV  361

Query  1129  NDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              DI+L Y G  G   +KC NV+P+ +GK  P  C+
Sbjct  362   GDIDLKYNGNRGPVTTKCVNVQPTFVGKQNPPICA  396



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/390 (43%), Positives = 240/390 (62%), Gaps = 7/390 (2%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITA  243
             + A +  + L+S         FDV K+G     + D SKAF  AW  AC +   +  +  
Sbjct  7     VSAIFLLLFLSSTDVKAENVVFDVTKYG----DEEDISKAFKSAWEDACASTSPSKVLIP  62

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IF  420
              G ++ GP+   GPCK  I +   K  L A  D   F+G   W+T + V   T+ GG  F
Sbjct  63    RGTYLLGPVIISGPCKAAIELQV-KGKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTF  121

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G +  N  +CGK+ H    P +L+FN +T   +  +T+ +SK FH  +   K++T +
Sbjct  122   DGQGKSASNQNNCGKDKHCKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQ  181

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
              +T+ A   S NTDG+HIG++  + II + I TGDDC+SLG G + + +E VTC PGHG+
Sbjct  182   HFTITAHDESLNTDGIHIGRSKDIKIIDSDIGTGDDCISLGHGSRQITIEGVTCAPGHGI  241

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             +IGSLGK  NE+ V G+ VKNCT++NT NG RIK+WP    GSA+++HFEDIIM NVSNP
Sbjct  242   SIGSLGKSQNEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNP  301

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             I+IDQ YCPWN+C    ASKV +  + FKNI+GTS + +A+++ CS  +PC  V + DI+
Sbjct  302   IVIDQVYCPWNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADID  361

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             L Y G +G A  +C+NV+P   GK+ P+ C
Sbjct  362   LKYTGSEGPAKFQCSNVQPKFHGKINPSKC  391



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/370 (46%), Positives = 240/370 (65%), Gaps = 7/370 (2%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPI  300
             + F+V  +GAKG G  D S+A   AW AAC + G +T+    G +  G +  QGPCKG  
Sbjct  8     SVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGS-  64

Query  301   TIDAQKMNLLALP-DPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGH  474
              I  Q   ++  P DP  FK  G WV+F ++ G+T++G G  DG G T W   +C KN +
Sbjct  65    KIGFQIDGVVKAPADPSKFKSDG-WVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKNPN  123

Query  475   ICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHI  654
                   NL+F+ +    +  +T+ NSK FH+ +   +D+T +  TV APG S NTDG+H+
Sbjct  124   CKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHV  183

Query  655   GQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVT  834
             G +  V+I    I TGDDC+S+G G Q+V + +V CGPGHG++IGSLG+Y NEK V G+T
Sbjct  184   GISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGIT  243

Query  835   VKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             VK CT + T+NG R+KTWP SP G+AT++ F+D+ MNNV NP+++DQ+YCP+ QC     
Sbjct  244   VKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAP  303

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S++KLS I F NI+GTS+ K+A+ I CS  +PC  + + +INL Y+G  G A S C+NVK
Sbjct  304   SRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVK  363

Query  1195  PSIIGKVVPA  1224
             P+  GK VPA
Sbjct  364   PTFSGKQVPA  373



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/393 (46%), Positives = 246/393 (63%), Gaps = 14/393 (4%)
 Frame = +1

Query  82    FCILLASFVTGLHA---AFFDVMKFGAKGDGKADDSKAFTGAWGAACKA--PGANTITAA  246
             F + L SF     +     F + K+G    G AD ++A   AW  AC +  P A  +   
Sbjct  14    FLMSLLSFTIESRSHIDVIFPLEKYGNIVSG-ADVTEALKNAWNDACASVHPSA-VVIPK  71

Query  247   GKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFD  423
             G F      F+GPCK PI I  +   L A   P+       W+TF+ V  +T++GG +FD
Sbjct  72    GIFKVREGKFKGPCKSPIEIRVRGT-LQAPKHPYG----DSWITFAYVDRMTLSGGGVFD  126

Query  424   GNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIER  603
             G G T W   DC K      LP +L+F+ +T   +  +T+ NSK FH+ I    ++T + 
Sbjct  127   GQGKTGWEKNDCHKRIDCANLPISLRFDFITNSIVRRITSLNSKNFHVNILGCNNLTFQG  186

Query  604   YTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLA  783
               + AP +SPNTDG+HIG++  +SI+ + I TGDDC+SLGDG + V V  VTCGPGHG++
Sbjct  187   VNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKQVKVANVTCGPGHGIS  246

Query  784   IGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNP  960
             IGSLGKY NE+PV GV VKNCT+ NT NG RIKTWP SP  G ATNMHF DI M NVSNP
Sbjct  247   IGSLGKYTNEEPVEGVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDITMVNVSNP  306

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             ILIDQ+YCPWNQC   + S +K++ + F+NI+G+S++ +A+K+ CS  +PC  V + +I+
Sbjct  307   ILIDQEYCPWNQCNREIPSNIKINKVSFENIRGSSATPVAVKLICSSNLPCDEVKVANID  366

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAACSVH  1239
             LIY G +GS  S+C NVKP I G   P+ CS +
Sbjct  367   LIYNGINGSITSQCMNVKPIISGIQNPSICSSY  399



>ref|XP_004491599.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=393

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/391 (45%), Positives = 242/391 (62%), Gaps = 12/391 (3%)
 Frame = +1

Query  49    DMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA  228
             +MKSI      F  LL +F     +A FD+ K+GA      D + AF   W AAC + GA
Sbjct  2     NMKSITTIVLSF--LLTTFGIA-QSAVFDIRKYGAPS---GDITTAFGDVWKAACNSTGA  55

Query  229   NTI-TAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI  405
             + +   +G +  G I  +GPC GPI +      ++A  +P A      W+ F  V   T+
Sbjct  56    SKVWIPSGSYKMGAIVVKGPCNGPIEVQVDGT-IIAPANPAALHDAYEWIKFEYVDFFTL  114

Query  406   NG-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +G G+FDG GA  WN  DCGKN +      N  FN +    +  +T+++SK FH+ +   
Sbjct  115   SGKGVFDGQGAIAWNQNDCGKNKNCDMASMNFGFNFLKHATVRDITSKDSKNFHVNVLGC  174

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
              + T + +TV AP  S NTDG+HIG+++ V I+   I TGDDCVSLGDG + + V+ V C
Sbjct  175   TNFTFDHFTVTAPATSLNTDGIHIGRSTDVKILNTNIGTGDDCVSLGDGCKQITVQNVNC  234

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDII  939
             GPGHG+++GSLGKYP E+PV  + VKNCTLTNT NG RIKTWP +P     T+MHFEDI 
Sbjct  235   GPGHGISVGSLGKYPKEEPVEQLLVKNCTLTNTDNGVRIKTWPSTPGTNPITDMHFEDIT  294

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             M +V NP++IDQ+YCPWNQC     SK+K+S + FKNIKGTS +K  + + CS +VPC+G
Sbjct  295   MVDVLNPVIIDQEYCPWNQCSKQSPSKIKISKVTFKNIKGTSKTKDGVILICSKSVPCEG  354

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
             V +N++ L + G +  A  KC NVKP + GK
Sbjct  355   VELNNVALTFNGTEVDA--KCVNVKPIVTGK  383



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/390 (43%), Positives = 239/390 (61%), Gaps = 7/390 (2%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITA  243
             + A +  + L S         FDV K+G     + D SKAF  AW  AC +   +  +  
Sbjct  7     VSAIFLLLFLTSTDVKAENVVFDVTKYG----DEEDISKAFKSAWEDACASTSPSKVLIP  62

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IF  420
              G ++ GP+   GPCK  I +   K  L A  D   F+G   W+T + V   T+ GG  F
Sbjct  63    RGTYLLGPVIISGPCKAAIELQV-KGKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTF  121

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G +  N  +CGK+ H    P +L+FN +T   +  +T+ +SK FH  +   K++T +
Sbjct  122   DGQGKSASNQNNCGKDKHCKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQ  181

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
              +T+ A   S NTDG+HIG++  + II + I TGDDC+SLG G + + +E VTC PGHG+
Sbjct  182   HFTITAHDESLNTDGIHIGRSKDIKIIDSDIGTGDDCISLGHGSRQITIEGVTCAPGHGI  241

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNP  960
             +IGSLGK  NE+ V G+ VKNCT++NT NG RIK+WP    GSA+++HFEDIIM NVSNP
Sbjct  242   SIGSLGKSQNEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNP  301

Query  961   ILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDIN  1140
             I+IDQ YCPWN+C    ASKV +  + FKNI+GTS + +A+++ CS  +PC  V + DI+
Sbjct  302   IVIDQVYCPWNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADID  361

Query  1141  LIYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
             L Y G +G A  +C+NV+P   GK+ P+ C
Sbjct  362   LKYTGSEGPAKFQCSNVQPKFHGKINPSKC  391



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 235/375 (63%), Gaps = 4/375 (1%)
 Frame = +1

Query  118   HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKG  294
             HA+ FDV          +D S A   AW  AC +P A+ +   +G +      F+GPCK 
Sbjct  23    HASVFDVTSATYGAKPGSDVSTALAKAWSDACASPSASKVVVPSGTYKLKEANFRGPCKA  82

Query  295   PITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNG  471
             PI +  Q   L A  D         WV F  +  +T++GG  FDG GA +WN  DC KN 
Sbjct  83    PIEMQVQG-TLQAPADASQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNK  141

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
             +  P+P NL+F  +T  ++  +T+ NSK FH+ +      T ++ T+ AP +S NTDG+H
Sbjct  142   NCKPIPVNLRFEFLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIH  201

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             IG ++ ++I  A I TGDDC+S+GD   ++ V  VTCGPGHG++IGSLGKY +EK V G+
Sbjct  202   IGASTGINITHAKIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGI  261

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
              VKNCTLTNT NG RIKT+P SP  S A+ +H+EDIIM NVSNPIL+DQ YCP+ QC+  
Sbjct  262   IVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQK  321

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
               SKVK+S + FKNIKG+S + +A+K+ C+  +PC+ V + DI+L Y G  G   S C+N
Sbjct  322   PPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGPLTSMCSN  381

Query  1189  VKPSIIGKVVPAACS  1233
             VKP+I G +    C+
Sbjct  382   VKPTITGVIKGLGCA  396



>emb|CDY35969.1| BnaA05g29810D [Brassica napus]
Length=503

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 173/371 (47%), Positives = 236/371 (64%), Gaps = 19/371 (5%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITI  306
              DV   GAKGDGK DD+ AF   W  A +A    TIT   G ++   +  +GP K  IT 
Sbjct  141   IDVKASGAKGDGKTDDTAAFMAVWKKAIEAATPTTITVPKGDYLVNELMLEGPSKCAITF  200

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI--NGGIFDGNGATTWNLPDCGKNGHIC  480
             D    NL A       K H GWV F ++    +  NG IFDG G+  W + DC + G   
Sbjct  201   DMHG-NLKAPSAVTTRKPHSGWVNFRKLKDFKLIGNGAIFDGQGSVAWKVNDCKQTGKCN  259

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP N++   +    + G+T+ NSK FH+ I    +VT++   +DAP  S NTDG+H+G+
Sbjct  260   NLPINIRLTQLNNSIISGITSTNSKLFHMNIHQCTNVTLQDVHIDAPPESLNTDGIHVGK  319

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V+I G+ IKTGDDC+S+G G              HGL+IGSLGKYPNE+PV G+T++
Sbjct  320   SVGVTIRGSKIKTGDDCISIGGG--------------HGLSIGSLGKYPNEQPVKGITIR  365

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
              C + +T NG RIKTWPGSP G  +   FEDI M+NVS PIL+DQ YCP  +CK+G  SK
Sbjct  366   KCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPHGKCKSG-PSK  424

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             V+L  + FKNI+GTSS+K+A++++CSP  PC+ V + DINL+  GK+G+AVS C+NVKP+
Sbjct  425   VQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAAVSACSNVKPT  484

Query  1201  IIGKVVPAACS  1233
             + GK++PAAC+
Sbjct  485   VTGKMIPAACT  495



>ref|XP_009333810.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=420

 Score =   331 bits (849),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/373 (46%), Positives = 235/373 (63%), Gaps = 4/373 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
              F+V  FGA+ DG+ DDS AFT AW  AC++ G  + I   G +  GP+ F GPC    +
Sbjct  48    LFNVKSFGARADGRTDDSDAFTAAWKEACQSTGRVHLIIPKGTYTIGPLRFSGPCVNVTS  107

Query  304   IDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI  477
             ++ + K  L A  D   +   GGW+ F+ + G+T+ GG  FDG GA  W    C  N + 
Sbjct  108   LNFRVKGYLKATTDLRKYGSGGGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCVTNSNC  167

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP NL+F A+    + GLT+ NSK FH+ +    +    R  + AP  SPNTDG+HI 
Sbjct  168   KLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHIE  227

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             ++S V    + I TGDDC+S+G G   V +  +TCGPGHG+++GSLGKYP+E+ V G+ V
Sbjct  228   RSSSVYFSSSRIATGDDCISVGQGNSQVTITSITCGPGHGISVGSLGKYPDERDVSGLVV  287

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             K+CT+T T NG RIKTW  SP  S ATNM FE+I+MNNV+NPI+IDQ YCP+  C +   
Sbjct  288   KDCTMTGTTNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQSYCPFTACTSKAP  347

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S+VKLS I FKNI+GTSSS+MA+ ++CS  +PCQ + + D++L     +  A S C+NVK
Sbjct  348   SRVKLSDIYFKNIRGTSSSEMAVLLECSKGIPCQNIFLEDVHLDLSSGEKLATSSCSNVK  407

Query  1195  PSIIGKVVPAACS  1233
                IG  +P  C+
Sbjct  408   AKFIGTQIPPPCT  420



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 230/374 (61%), Gaps = 4/374 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPI  300
             + FDV          +D +KA   AW  AC +P A+ +   +G +      F+GPCK PI
Sbjct  25    SVFDVTSETYSAKPGSDVTKALAKAWSDACASPSASKVVVPSGTYKLKEATFRGPCKAPI  84

Query  301   TIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI  477
              +   +  L A  +   F     WV F  +   T++GG  FDG GA  W   DC KN + 
Sbjct  85    EMQV-RGTLQAPANAGQFTRPDTWVGFQYIDKFTLSGGGTFDGQGALVWGQNDCHKNKNC  143

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
              P+P NL+F  +T  R+  +T+ NSK FH+ +   K  T +  T+ AP  S NTDG+HIG
Sbjct  144   KPIPINLRFEFITNSRVQDITSLNSKNFHMHVFRCKHTTFQHLTITAPEESRNTDGIHIG  203

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
              ++ ++I  A I+TGDDCVS+GD    + V  VTCGPGHG++IGSLG+Y  EK V G+ V
Sbjct  204   ASTGINITHAKIRTGDDCVSIGDDSHQITVTDVTCGPGHGISIGSLGRYKEEKAVTGIIV  263

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             KNCTLTNT NG RIKTWP SP  S A+++H+E+IIM NVSNPILIDQ YCP+ +C     
Sbjct  264   KNCTLTNTQNGVRIKTWPDSPSSSTASDIHYENIIMVNVSNPILIDQLYCPYTRCDQKPP  323

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             SKVK++ + FKNIKG+S + +A+K+ CS  +PC+ V + DI+L Y G  G   S C+NVK
Sbjct  324   SKVKINNVSFKNIKGSSFTPLAVKLVCSRGLPCENVKLTDIDLTYGGDQGPLTSLCSNVK  383

Query  1195  PSIIGKVVPAACSV  1236
             P+I G     AC+ 
Sbjct  384   PTITGMKKALACAT  397



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score =   330 bits (845),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 245/401 (61%), Gaps = 15/401 (4%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGL--HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKA--  219
             +K +++    F + L SF      H   F + K+G    G AD ++A   AW  AC +  
Sbjct  4     IKHLILLVTTFLMSLLSFTIEARSHVDIFSLRKYGNIVSG-ADVTEALKDAWNDACASDR  62

Query  220   PGANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHG-GWVTFSQVIG  396
             P A  +   G F      F+GPCK PI        L A   P     HG  W+TF+ V  
Sbjct  63    PSA-VVIPKGTFKVREGEFKGPCKSPIEFRVHGT-LQAPKHP-----HGDSWITFAYVDR  115

Query  397   VTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRI  573
             + ++GG +FDG G   W   DC K      LP +L+F+ +T   +  +T+ +SK FH+ I
Sbjct  116   LRLSGGGVFDGQGKAGWEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNI  175

Query  574   GSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEK  753
                 ++T +   + AP NSPNTDG+HIG++  +SI+ + I TGDDC+SLGDG + + V  
Sbjct  176   LGCNNLTFQGVNIIAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNN  235

Query  754   VTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFE  930
             V CGPGHG++IGSLGKY NE+PV GV V NCT+ NT NG RIKTWP SPV G ATNMHF 
Sbjct  236   VICGPGHGISIGSLGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFS  295

Query  931   DIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVP  1110
             DI M NVSNPILIDQ+YCPWNQC   + S +K++ + FKNI+G+S++ +A+K+ CS  +P
Sbjct  296   DITMVNVSNPILIDQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLP  355

Query  1111  CQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             C+ V + +I+L+Y G  GS  S+C NVKP I G   P  CS
Sbjct  356   CEEVKVANIDLVYNGIKGSITSECMNVKPIISGIQNPPICS  396



>ref|XP_010548798.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   330 bits (845),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 173/397 (44%), Positives = 246/397 (62%), Gaps = 9/397 (2%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-A  228
             M +  + +  F + L SF    +A  FD+ KFG    G +D ++A   A+ AAC+ P  +
Sbjct  1     MAAKTLASVLFALYLFSFWA--NAEVFDIRKFGTASVG-SDITQALRQAFQAACQNPRPS  57

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
             + +   G +  G I   GPCK P+ +    +N     +  A  G   WV F  + G  +N
Sbjct  58    SVVIPKGTYKLGEIDMVGPCKAPVEV---TVNGHLQANGNALVGREKWVVFRYINGFKLN  114

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G GIFDG G   W   DC KN +   LP +++F+ V    +  +T+ ++K FH+ +   K
Sbjct  115   GAGIFDGQGNAAWKSNDCHKNNNCKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCK  174

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             + T +   + AP  SPNTDG+H+G++  V+I+ + I TGDDC+S+GDG++++HVE+VTCG
Sbjct  175   NFTFDNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGDDCISVGDGMKNLHVERVTCG  234

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIM  942
             PGHG++IGSLG+Y NE PV G+ +KNCTL  T NG RIKT+P S    + +++HFEDII+
Sbjct  235   PGHGISIGSLGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIV  294

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
              NV NPILIDQ+YCPWN+C     S VKL  I FK I+GTS +K A+++ CS AVPC  V
Sbjct  295   KNVFNPILIDQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNV  354

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              + DI+L Y G DG A  +C+NV P + G   P ACS
Sbjct  355   EVGDIDLRYGGADGPATFQCSNVTPKLSGTQFPKACS  391



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score =   330 bits (845),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 245/401 (61%), Gaps = 15/401 (4%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGL--HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKA--  219
             +K +++    F + L SF      H   F + K+G    G AD ++A   AW  AC +  
Sbjct  4     IKHLILLVTTFLMSLLSFTIEARSHVDIFSLRKYGNIVSG-ADVTEALKDAWNDACASDR  62

Query  220   PGANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHG-GWVTFSQVIG  396
             P A  +   G F      F+GPCK PI        L A   P     HG  W+TF+ V  
Sbjct  63    PSA-VVIPKGTFKVREGEFKGPCKSPIEFRVHGT-LQAPKHP-----HGDSWITFAYVDR  115

Query  397   VTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRI  573
             + ++GG +FDG G   W   DC K      LP +L+F+ +T   +  +T+ +SK FH+ I
Sbjct  116   MRLSGGGVFDGQGKAGWEKNDCHKRIDCAKLPISLRFDFITNSIVRRITSLDSKNFHVNI  175

Query  574   GSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEK  753
                 ++T +   + AP NSPNTDG+HIG++  +SI+ + I TGDDC+SLGDG + + V  
Sbjct  176   LGCNNLTFQGVNIIAPENSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRIKVNN  235

Query  754   VTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFE  930
             V CGPGHG++IGSLGKY NE+PV GV V NCT+ NT NG RIKTWP SPV G ATNMHF 
Sbjct  236   VICGPGHGISIGSLGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFS  295

Query  931   DIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVP  1110
             DI M NVSNPILIDQ+YCPWNQC   + S +K++ + FKNI+G+S++ +A+K+ CS  +P
Sbjct  296   DITMVNVSNPILIDQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLP  355

Query  1111  CQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             C+ V + +I+L+Y G  GS  S+C NVKP I G   P  CS
Sbjct  356   CEEVKVANIDLVYNGIKGSITSECMNVKPIISGIQNPPICS  396



>ref|XP_009341510.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=420

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 170/373 (46%), Positives = 235/373 (63%), Gaps = 4/373 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
              F+V  FGA+ DG+ DDS AFT AW  AC++ G  + I   G +  GP+ F GPC    +
Sbjct  48    LFNVKSFGARADGRTDDSDAFTAAWKEACQSTGRVHLIIPKGTYTIGPLRFSGPCVNVTS  107

Query  304   IDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI  477
             ++ + K  + A  D   +   GGW+ F+ + G+T+ GG  FDG GA  W    C  N + 
Sbjct  108   LNFRVKGYVKATTDLRKYGSGGGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCVTNSNC  167

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP NL+F A+    + GLT+ NSK FH+ +    +    R  + AP  SPNTDG+HI 
Sbjct  168   KLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHIE  227

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             ++S V    + I TGDDC+S+G G   V +  +TCGPGHG+++GSLGKYP+E+ V G+ V
Sbjct  228   RSSSVYFSSSRIATGDDCISVGQGNSQVTITSITCGPGHGISVGSLGKYPDERDVSGLVV  287

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             K+CT+T T NG RIKTW  SP  S ATNM FE+I+MNNV+NPI+IDQ YCP+  C +   
Sbjct  288   KDCTMTGTTNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQSYCPFTACTSKAP  347

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S+VKLS I FKNI+GTSSS+MA+ ++CS  +PCQ + + D++L     +  A S C+NVK
Sbjct  348   SRVKLSDIYFKNIRGTSSSEMAVLLECSKGIPCQNIFLEDVHLDLSSGEKLATSSCSNVK  407

Query  1195  PSIIGKVVPAACS  1233
                IG  +P  C+
Sbjct  408   AKFIGTQIPPPCT  420



>ref|XP_008377875.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=421

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/373 (46%), Positives = 234/373 (63%), Gaps = 4/373 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
              F+V  FGA+ DG+ DDS AFT  W  AC++ G  + I   G +  GP+ F GPC    +
Sbjct  49    LFNVKSFGARADGRTDDSDAFTATWKEACQSTGRVHLIIPKGTYTIGPLKFSGPCVNVTS  108

Query  304   IDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI  477
             ++ + K  L A  D   +   GGW+ F+ + G+T+ GG  FDG GA  W    C  N + 
Sbjct  109   LNFRVKGYLKATTDLRKYGSGGGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCITNSNC  168

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP NL+F A+    + GLT+ NSK FH+ +    +    R  + AP  SPNTDG+HI 
Sbjct  169   KLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHIE  228

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             ++S V    + I TGDDC+S+G G   V +  +TCGPGHG+++GSLGKYP+E+ V G+ V
Sbjct  229   RSSSVYFSSSRIATGDDCISVGQGNSXVTITSITCGPGHGISVGSLGKYPDERDVSGLVV  288

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             K+CT+T T NG RIKTW  SP  S ATNM FE+I+MNNV+NPI+IDQ YCP+  C +   
Sbjct  289   KDCTMTGTTNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQSYCPFTACTSKAP  348

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S+VKLS I FKNI+GTSSS+MA+ ++CS  +PCQ + + D++L     +  A S C+NVK
Sbjct  349   SRVKLSDIYFKNIRGTSSSEMAVLLECSKGIPCQNIFLEDVHLDLSSGEKXATSSCSNVK  408

Query  1195  PSIIGKVVPAACS  1233
                IG  +P  C+
Sbjct  409   AKFIGTQIPPPCT  421



>ref|XP_008357338.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
 ref|XP_008357339.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=421

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 236/385 (61%), Gaps = 4/385 (1%)
 Frame = +1

Query  91    LLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGP  267
             LL        +  F+V  FGA+ DG+ DDS AFT AW  AC++ G  + I   G +  GP
Sbjct  37    LLQHHSKAKSSNLFNVKSFGARADGRTDDSDAFTAAWKEACQSIGRVHLIIPKGTYTIGP  96

Query  268   IWFQGPCKGPITIDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATT  441
             + F GPC    +++ + K  L A  D   +    GW+ F+ + G+T+ GG  FDG GA  
Sbjct  97    LRFSGPCVNVTSLNFRVKGYLKATTDLRKYGSGSGWIEFAWMKGLTLTGGGTFDGRGAHA  156

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W    C  N +   LP NL+F A+    + GLT+ NSK FH+ +    +    R  + AP
Sbjct  157   WPHNKCITNSNCKLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAP  216

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
               SPNTDG+HI ++S      + I TGDDC+S+G G   V +  +TCGPGHG+++GSLGK
Sbjct  217   ETSPNTDGIHIERSSSXYFSSSRIATGDDCISVGQGNSQVTITSITCGPGHGISVGSLGK  276

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQ  978
             YP+E+ V G+ VK+CT+T T NG RIKTW  SP  S ATNM FE+I+MNNV+NPI+IDQ 
Sbjct  277   YPDERDVSGLVVKDCTMTGTTNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQS  336

Query  979   YCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGK  1158
             YCP+  C +   S+VKLS I FKNI+GTSSS+MA+ ++CS  +PCQ + + D++L     
Sbjct  337   YCPFTACTSKAPSRVKLSDIYFKNIRGTSSSEMAVLLECSKGIPCQNIFLEDVHLDLSSG  396

Query  1159  DGSAVSKCTNVKPSIIGKVVPAACS  1233
             +  A S C+NVK   IG  +P  C+
Sbjct  397   EKLATSSCSNVKAKFIGTQIPPPCT  421



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/392 (44%), Positives = 244/392 (62%), Gaps = 13/392 (3%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN-TITA  243
             I A  F I L  F    +A  F+V      G   +D ++A   A+ +AC+AP A+  +  
Sbjct  7     ISAVLFVISLLGF--SANAEVFNV-----GGSPGSDITQALLKAFTSACQAPTASKVVIT  59

Query  244   AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IF  420
              G+F  G I   GPCK P+ I+ Q        D  A +G   WV F ++ G  +NGG IF
Sbjct  60    KGEFKLGEIEMTGPCKAPVEINLQGT---LKADGKAIQGKERWVVFLRINGFKLNGGGIF  116

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G   W + +C K      LP +++F+ V    +  +++ ++K FH+ +  +K++T +
Sbjct  117   DGEGNAAWRVNNCHKTFECKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMTFD  176

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
                V AP  SPNTDG+H+G++  V I+ + I TGDDC+S+GDG++++HVE V CGPGHG+
Sbjct  177   NVKVIAPAESPNTDGIHLGRSEGVKILNSKIATGDDCISVGDGMKNLHVENVMCGPGHGI  236

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSN  957
             ++GSLG+Y +E+ V G+TV NCTL  T NG RIKTWP +    +A+ +HFE+II+NNVSN
Sbjct  237   SVGSLGRYVHEQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSN  296

Query  958   PILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDI  1137
             PILIDQ+YCPWNQC     S +KL  I FKNI+GTS +K A+K+ CS A PC  V + +I
Sbjct  297   PILIDQEYCPWNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNI  356

Query  1138  NLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             NL YKG DG     C+NV P ++G   P ACS
Sbjct  357   NLEYKGADGPPTFMCSNVSPKLVGTQNPKACS  388



>ref|XP_010482057.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 240/383 (63%), Gaps = 16/383 (4%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGKA---------DDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPI  270
             +AFF     G   + K          D +KA   A+  AC+ P  +T+    G++  G I
Sbjct  9     SAFFVFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPKGEYKLGEI  68

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWN  447
                GPCK PI I  Q        D  A      W+ F  + G  +NGG +FDG G   W 
Sbjct  69    EMMGPCKAPIRIALQGT---VKADGNAVHSEK-WIAFRNIDGFKLNGGGVFDGEGNAAWR  124

Query  448   LPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGN  627
             + +C        LP +++F+ VT  ++ G+T+ ++K FH+ +  +K++T E   + AP  
Sbjct  125   VNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEVKIVAPAE  184

Query  628   SPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYP  807
             SPNTDG+H+G++  + II + I TGDDCVS+GDG++++ VE+VTCGPGHG++IGSLG+Y 
Sbjct  185   SPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYG  244

Query  808   NEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYC  984
             +E+ V+G+ + NCTL  T NG RIKTWP +    SA+++HFE+I++ NVSNPILIDQ+YC
Sbjct  245   HEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPILIDQEYC  304

Query  985   PWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDG  1164
             PWNQC    AS +KLS I FKNI+GTS +K A+K+ CS A PCQ V + +IN+ Y G DG
Sbjct  305   PWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKAHPCQNVELGNINIKYTGADG  364

Query  1165  SAVSKCTNVKPSIIGKVVPAACS  1233
              A  +C+NV P ++G  VP ACS
Sbjct  365   PATFQCSNVSPKLMGTQVPKACS  387



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 234/375 (62%), Gaps = 4/375 (1%)
 Frame = +1

Query  118   HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKG  294
             HA+ FDV          +D S A   AW  AC +P A+ +   +G +      F+GPCK 
Sbjct  23    HASVFDVTSATYGAKPGSDVSTALAKAWSDACASPSASKVVVPSGTYNLKEANFRGPCKA  82

Query  295   PITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNG  471
             PI +  Q   L A  D         WV F  +  +T++GG  FDG GA +WN  DC KN 
Sbjct  83    PIEMQVQG-TLQAPADAGQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNK  141

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
             +  P+P NL+F  +T  ++  +T+ NSK FH+ +      T ++ T+ AP +S NTDG+H
Sbjct  142   NCKPIPVNLRFEFLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGIH  201

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             IG ++ ++I  A I TGDDC+S+GD   ++ V  VTCGPGHG++IGSLGKY +EK V G+
Sbjct  202   IGASTGINITHAKIGTGDDCISIGDDSHEITVTDVTCGPGHGISIGSLGKYKDEKDVTGI  261

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
              VKNCTLTNT NG RIKT+P SP  S A+ +H+EDIIM NVSNPIL+DQ YCP+ QC+  
Sbjct  262   IVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCPYTQCEQK  321

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
               SKVK+S + FKNIKG+S + +A+K+ C+  +PC+ V + DI+L Y G  G   S C+N
Sbjct  322   PPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELIDIDLTYGGDKGPLTSMCSN  381

Query  1189  VKPSIIGKVVPAACS  1233
             VKP+I G      C+
Sbjct  382   VKPTIAGVTKALGCA  396



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 235/374 (63%), Gaps = 11/374 (3%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAAC--KAPGANTITAAGKFMAGPIWFQGPCKGPIT  303
             FD+   GAK    AD ++AF  +W AAC  K P +  +  AG ++ G I  +GPC+ P  
Sbjct  36    FDITTKGAKPG--ADVTQAFLDSWTAACASKKP-SKVLVPAGNYLLGAITLKGPCQTPTV  92

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG----IFDGNGATTWNLPDCGKNG  471
             I+    N  A  D  AFK    W     V  V I GG    +FDG G   W   +C KN 
Sbjct  93    IEILG-NFKAPSDVAAFKKADSWFKVENVDSVIIIGGKGGGVFDGQGQAGWKKNECSKNA  151

Query  472   HIC-PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
             +    LP N++FN V+  ++ GLT+ NSK FH+ +   K + +   TV AP +SPNTDG+
Sbjct  152   NCAFDLPYNIRFNFVSNSKVSGLTSLNSKSFHIVLMGCKQLELSGMTVTAPADSPNTDGI  211

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG++  + + G TI TGDDCVS GDG ++V +E VTCGPGHGL++GSLGKYPNE+PV  
Sbjct  212   HIGRSENIIVRGWTIGTGDDCVSFGDGAKNVLIEGVTCGPGHGLSVGSLGKYPNEEPVSN  271

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
             +T++NC + NT NG R+KTW  S   + T ++FEDI + NV NP+++DQ+YCPWN CKA 
Sbjct  272   ITIRNCIIKNTDNGVRVKTWHNSYESTVTGLYFEDITLENVRNPVIVDQEYCPWNHCKAR  331

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
               SKVK+S I FKN++G SS+K A+K+ CS  VPC  V + DI++ Y G  G AVS C  
Sbjct  332   TPSKVKISDIRFKNVRGKSSTKEAVKLICSQGVPCDKVELADIDIQYTGPGGPAVSMCKF  391

Query  1189  VKPSIIGKVVPAAC  1230
             VKP + GK  P AC
Sbjct  392   VKPLLTGKQSPPAC  405



>ref|XP_007199143.1| hypothetical protein PRUPE_ppa019563mg [Prunus persica]
 gb|EMJ00342.1| hypothetical protein PRUPE_ppa019563mg [Prunus persica]
Length=387

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/375 (45%), Positives = 234/375 (62%), Gaps = 4/375 (1%)
 Frame = +1

Query  118   HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKG  294
             ++A FDVM FGA+ DG+ DDS AF  AW  AC++ G   IT   G ++ GP+ F GPC  
Sbjct  14    NSAVFDVMSFGARADGRTDDSNAFMAAWKEACQSTGRAHITIPKGTYIIGPLKFSGPCLN  73

Query  295   PITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNG  471
               ++  +   L A  D   +   G W+ F  + G+T+ GG  FDG GA  W    C  + 
Sbjct  74    VSSLTIRGY-LKATTDLRKYGFGGSWLEFGWMEGLTLTGGGTFDGRGARAWPHNKCPTDS  132

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
             +   LP +L+F A+    + GLT+ NSK FH+ +    +    R  + AP  SPNTDG+H
Sbjct  133   NCKLLPTSLKFVAMNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIH  192

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             I ++S V    + I TGDDC+S+G G   + +  +TCGPGHG+++GSLGKYP+E+ V G+
Sbjct  193   IERSSSVYFSLSHIATGDDCISVGQGNSQITITSITCGPGHGISVGSLGKYPDERDVSGL  252

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAG  1008
              VK+CT+T T NG RIKTW  SP  S ATNM FE+I+MNNV+NPI+IDQ YCP+  C + 
Sbjct  253   VVKDCTMTGTTNGIRIKTWANSPGNSAATNMTFENIVMNNVTNPIIIDQLYCPFTSCTSK  312

Query  1009  LASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTN  1188
               S+VKLS I FKNI+GTSSS++A+ ++CS  +PCQ + + D++L     +  A S C+N
Sbjct  313   APSRVKLSDIYFKNIRGTSSSEVAVALECSKGIPCQNIYLEDVHLDLSSGEKQATSSCSN  372

Query  1189  VKPSIIGKVVPAACS  1233
             VK    G  +P  C+
Sbjct  373   VKAKFSGTQIPPPCT  387



>ref|XP_010675960.1| PREDICTED: exopolygalacturonase clone GBGA483-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=334

 Score =   325 bits (832),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/329 (50%), Positives = 215/329 (65%), Gaps = 7/329 (2%)
 Frame = +1

Query  256   MAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN----GGIFD  423
             M   I F GPCK P+TI+    N  A  DP   KG   WV    + G+T+N    GG FD
Sbjct  1     MLNAIKFTGPCKSPVTIEIAG-NFKAPADPAQMKGEDTWVKIENIQGLTVNCLPTGGTFD  59

Query  424   GNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIER  603
             G G   W   +C K G    LP N +FN++T  ++ G+ + NSK +H+ + S K+ T+  
Sbjct  60    GQGQMAWKQNNCAKTGTCDNLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLSCKNFTLFD  119

Query  604   YTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLA  783
              T++AP +S NTDG+HIG+++ + +  A I TGDDC+S+GDG  DVH+E VTCGPGHG++
Sbjct  120   TTIEAPKDSLNTDGIHIGRSAGIFVTKAKIGTGDDCISMGDGAVDVHIEDVTCGPGHGIS  179

Query  784   IGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPI  963
             IGSLG+Y  E PV GVTVK CT+++T NG RIK+W  S V +A+++HFEDI + NV  PI
Sbjct  180   IGSLGRYEKEAPVTGVTVKKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPI  239

Query  964   LIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINL  1143
             LIDQ+YCP+N CKA   SKVKLS I FKNI+GT+ SK A+KI CS   PC  V + DI+L
Sbjct  240   LIDQEYCPYNHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDL  299

Query  1144  IYKGKDGSAVSKCTNVKPSIIGKVVPAAC  1230
              + G  G  VS C NVKP   GK  P AC
Sbjct  300   TFSG--GPVVSMCKNVKPITSGKQNPVAC  326



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score =   327 bits (837),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 170/387 (44%), Positives = 239/387 (62%), Gaps = 11/387 (3%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN-TITAAGKFM  258
             F IL        +A  F V      G   +D ++A   A+ +AC+AP A+  +   G+F 
Sbjct  8     FAILFVLLGVSANAEVFPV-----GGSPGSDITQALLKAFTSACQAPTASKVVIPKGEFK  62

Query  259   AGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGA  435
              G I   GPCK PI I+ Q        D  A  G   WV F++++G  +NGG  FDG G 
Sbjct  63    LGEIEMAGPCKAPIEINLQGT---VKADGTAIHGKERWVVFTKIVGFKLNGGGTFDGEGN  119

Query  436   TTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVD  615
               W + +C +      LP +++F+ V    +  ++  ++K FH+ +  +K++  +   V 
Sbjct  120   AAWRVNNCHQTEACKKLPISIRFDFVEKAEIRDISTIDAKNFHINVIGAKEMVFDNVKVI  179

Query  616   APGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSL  795
             AP  SPNTDG+H+G++  V I+ + I TGDDC+S+GDG++++HVEKV CGPGHG+++GSL
Sbjct  180   APAESPNTDGIHLGRSDGVKILNSKIATGDDCISVGDGMKNLHVEKVVCGPGHGISVGSL  239

Query  796   GKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILID  972
             G+Y +E+ V G+TVKNCTL  T NG RIKTWP +    +A+ +HFEDII+NNVSNPILID
Sbjct  240   GRYGHEQDVAGITVKNCTLIGTDNGLRIKTWPSAACSTTASGIHFEDIILNNVSNPILID  299

Query  973   QQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK  1152
             Q+YCPWN C     S +KL  I FKNI+GTS +K A+K+ CS A PC  V + +INL YK
Sbjct  300   QEYCPWNHCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCVNVEIGNINLEYK  359

Query  1153  GKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             G DG     C+NV P ++G   P ACS
Sbjct  360   GADGPPTFTCSNVTPKLVGTQNPKACS  386



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 182/392 (46%), Positives = 244/392 (62%), Gaps = 16/392 (4%)
 Frame = +1

Query  82    FCILLASFVTGLHA---AFFDVMKFGAKGDGKADDSKAFTGAWGAACKA--PGANTITAA  246
             F + L SF     +     F + K+G    G  D ++A   AW  AC +  P A  +   
Sbjct  14    FLMSLLSFTIESQSHVDVIFPLRKYGNIVSGD-DVTEALKDAWNDACASVRPSA-VVIPD  71

Query  247   GKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHG-GWVTFSQVIGVTING-GIF  420
             G F      F+GPCK PI I  +   L A   P     HG  W+TF+ V  +TI+G G+F
Sbjct  72    GIFKVREGEFKGPCKSPIEIRVRG-TLQAPKHP-----HGDSWITFAYVDRMTISGKGVF  125

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G   W   DC K      LP +L+F+ +T   + G+T+ +SK FH+ I    ++T +
Sbjct  126   DGQGKAGWEKNDCHKRIDCVNLPISLRFDFITNSIVRGITSLDSKNFHVNILGCNNLTFQ  185

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
                + AP +SPNTDG+HIG++  +SI+ + I TGDDC+SLGDG + V +  VTCGPGHG+
Sbjct  186   GVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITNVTCGPGHGI  245

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSN  957
             +IGSLGKY NE+PV  V VKNCT+ NT NG RIKTWP SPV G ATNMHF DI M NVSN
Sbjct  246   SIGSLGKYTNEEPVDDVVVKNCTIMNTTNGIRIKTWPSSPVAGIATNMHFSDITMVNVSN  305

Query  958   PILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDI  1137
             PILIDQ+YCPWNQC   + S +K++ + FKNIKG+S++ +A+K+ CS   PC+ V + +I
Sbjct  306   PILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNKPCEEVKVANI  365

Query  1138  NLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             +L+Y G +G   S+C NVKP I G   P+ CS
Sbjct  366   DLVYNGINGPVTSQCMNVKPIISGIQNPSICS  397



>ref|XP_011097041.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/394 (43%), Positives = 238/394 (60%), Gaps = 7/394 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA  243
              I   +F  LLA  V       +D+ K+GAK  G  D S+A   AW  AC +   +TI  
Sbjct  5     FITILFFLSLLAINVNAQGPMTYDITKYGAKSGG--DISQALMDAWKEACNSTSPSTIVV  62

Query  244   -AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF-KGHGGWVTFSQVIGVTINGG-  414
               G +    +   GP K P+ +  Q   L A P+P       G W+T + V   T++GG 
Sbjct  63    PRGTWSLSQVKLLGPNKAPLELQVQGT-LQANPNPGQLPNKEGEWITINYVNYFTLSGGG  121

Query  415   IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVT  594
             +FDG G   W   DC KN +   LP NL FN V    +  +T ++SK FH+   SS +VT
Sbjct  122   VFDGQGQQAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVT  181

Query  595   IERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGH  774
               R+TV APG+SPNTDG+H+G+ + ++I  + IKTGDDCVS+GD  +++H++ VTCGPGH
Sbjct  182   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  241

Query  775   GLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNV  951
             G+++GSLG Y  EK V G+ V NCT   T NG R+KTWP +P   + +++HFED+IM+NV
Sbjct  242   GISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNV  301

Query  952   SNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMN  1131
             S+PI+IDQ+YCP N CK    S +K++ +  KN++GT+++  A+   CS   PC+ V + 
Sbjct  302   SSPIIIDQEYCPHNLCKKDRPSSIKITNVSIKNVRGTTNTAEAVTFICSGLKPCENVEVG  361

Query  1132  DINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             DI+L Y G  G   +KC NVKP  +GK  P  C+
Sbjct  362   DIDLTYNGNQGPITTKCANVKPKFVGKQNPPVCA  395



>dbj|BAK05779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=412

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/407 (43%), Positives = 250/407 (61%), Gaps = 14/407 (3%)
 Frame = +1

Query  43    REDMKSILIQAAWFCILLASFVTGLHAA--FFDVMKFGAKGDGKADDSKAFTGAWGAACK  216
             R DM   L+ A +F I     +   HA    FDVM FGA  DG+ DDSKAF  AW  AC 
Sbjct  8     RSDMAFPLV-ALFFMISARWCLEVAHAGRQVFDVMDFGAIADGETDDSKAFIRAWMKACA  66

Query  217   APG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFA-FKGHGGWVTFSQV  390
             +PG A  +   G++   P+ F+GPCKG   ++ +   +L  PD  A F+G   W+ F+ +
Sbjct  67    SPGRAAVVIPKGEYRLQPVVFRGPCKG--YMEVRLAGVLRAPDDLAAFRGSHEWINFASI  124

Query  391   IGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHL  567
              G+ + GG  FDG G ++W+L +C  N +  PLP +++   V  + +  +T+ NSK FH+
Sbjct  125   DGLLVTGGGTFDGRGESSWHLNECPTNPNCKPLPVSIKLGRVRNVTITAVTSLNSKFFHV  184

Query  568   RIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHV  747
              I  S+DV+I R T+ AP +SPNTDGVHI  +S V I    I TGDDCVS+G G  D+ V
Sbjct  185   IIIGSQDVSIHRVTIRAPRDSPNTDGVHIQGSSNVRITDTAIATGDDCVSVGPGSADITV  244

Query  748   EKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPG--SPVGSATNM  921
               V+CGPGHG+++GSLG++P E+ V G+ V NCTL  T NG RIKTW G   P    + +
Sbjct  245   SGVSCGPGHGISVGSLGRHPGEEDVRGLRVSNCTLAGTANGVRIKTWRGGLRPGSVVSGL  304

Query  922   HFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK---VKLSGIGFKNIKGTSSSKMAMKID  1092
              FEDI+M  V NPI+IDQ+YCP++       S+   VK+S + FKNI+G S++++A+K+ 
Sbjct  305   VFEDIVMRKVRNPIIIDQEYCPYSSSSCRHESRPSVVKISDVKFKNIRGVSATQVAVKLS  364

Query  1093  CSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSII-GKVVPAAC  1230
             CS A PC G+ + DI+L Y  +  +  S+C NV   +  G +VP +C
Sbjct  365   CSGASPCHGLELRDIDLRYVKRGVATESQCENVDGGVAGGMLVPPSC  411



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/383 (44%), Positives = 239/383 (62%), Gaps = 16/383 (4%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGKA---------DDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPI  270
             +AFF     G   + K          D +KA   A+  AC+ P  +T+    G++  G I
Sbjct  9     SAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPKGEYKLGEI  68

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWN  447
                GPCK PI I  Q        D  A      W+ F  + G  +NGG +FDG G   W 
Sbjct  69    EMTGPCKAPIRIALQGT---VKADGNAVHSEK-WIAFRNIDGFKLNGGGVFDGEGNAAWR  124

Query  448   LPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGN  627
             + +C        LP +++F+ VT  ++ G+T+ ++K FH+ +  +K++T E   + AP  
Sbjct  125   VNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEVKIVAPAE  184

Query  628   SPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYP  807
             SPNTDG+H+G++  + II + I TGDDCVS+GDG++++ VE+VTCGPGHG++IGSLG+Y 
Sbjct  185   SPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYG  244

Query  808   NEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYC  984
             +E+ V+G+ + NCTL  T NG RIKTWP +    SA+++HFE+I++ NVSNPILIDQ+YC
Sbjct  245   HEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPILIDQEYC  304

Query  985   PWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDG  1164
             PWNQC    AS +KLS I FKNI+GTS +K A+K+ CS   PCQ V + +IN+ Y G DG
Sbjct  305   PWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINIKYTGADG  364

Query  1165  SAVSKCTNVKPSIIGKVVPAACS  1233
              A  +C+NV P ++G  VP ACS
Sbjct  365   PATFQCSNVSPKLMGTQVPKACS  387



>ref|XP_011097079.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/394 (43%), Positives = 238/394 (60%), Gaps = 7/394 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA  243
              I   +F  LLA  V       +D+ K+GAK  G  D S+A   AW  AC +   +TI  
Sbjct  5     FITILFFLPLLAINVNAQGPMTYDITKYGAKSGG--DISQALMDAWKEACNSTSPSTIVV  62

Query  244   -AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKG-HGGWVTFSQVIGVTINGG-  414
               G +    +   GP K P+ +  Q   L A P+P       G W+T + V   T++GG 
Sbjct  63    PRGTWSLSQVKLLGPNKAPLELQVQGT-LQANPNPGQLPNKEGEWITINYVNYFTLSGGG  121

Query  415   IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVT  594
             +FDG G   W   DC KN +   LP NL FN V    +  +T ++SK FH+   SS +VT
Sbjct  122   VFDGQGQEAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVT  181

Query  595   IERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGH  774
               R+TV APG+SPNTDG+H+G+ + ++I  + IKTGDDCVS+GD  +++H++ VTCGPGH
Sbjct  182   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  241

Query  775   GLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNV  951
             G+++GSLG Y  EK V G+ V NCT   T NG R+KTWP +P   + +++HFED+IM+NV
Sbjct  242   GISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNV  301

Query  952   SNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMN  1131
             S+PI+IDQ+YCP N CK    S +K++ +  KN++GT+++  A+   CS   PC+ V + 
Sbjct  302   SSPIIIDQEYCPHNLCKKDRPSSIKITNVSIKNVRGTTNTAEAVTFICSGLKPCENVEVG  361

Query  1132  DINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             DI+L Y G  G   +KC NVKP  +GK  P  C+
Sbjct  362   DIDLTYNGNQGPITTKCANVKPKFVGKQNPPVCA  395



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 240/383 (63%), Gaps = 9/383 (2%)
 Frame = +1

Query  94    LASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAAC-KAPGANTITAAGKFMAGPI  270
             +++   G  +  FD+  FGAK +  AD ++A   AW  AC  A  +  +   G +  G  
Sbjct  28    VSNATVGATSGVFDITTFGAKPN--ADATQALADAWKEACASATPSKVLVPKGTYQLGES  85

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWN  447
               +GPCK PI +  +   L A   P   +G G  V    +  +T++G G+FDG G   W 
Sbjct  86    RLKGPCKSPIELLVEG-TLQA--SPTDTEGDGLLV-MEYIDHLTLSGTGVFDGQGKAGWE  141

Query  448   LPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGN  627
               DC        LP NL+FN +T   +  +T+ +SK FH+ + + K++T +   + AP N
Sbjct  142   KNDCHLKKECKKLPMNLKFNFITNSIVKDITSLDSKNFHINVLAGKNLTFDHLKITAPHN  201

Query  628   SPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYP  807
             SPNTDG+H+G +  V I+   I TGDDC+S+G   + + +  VTCGPGHG++IGSLGKY 
Sbjct  202   SPNTDGIHLGDSEDVYILNTAIATGDDCISVGYTNRKITISDVTCGPGHGISIGSLGKYK  261

Query  808   NEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYC  984
              EK V+GVTVK C L  T NG RIK+WP S V   A++MHFEDI M NV+NPI+IDQ+YC
Sbjct  262   TEKEVVGVTVKKCKLIGTTNGVRIKSWPDSAVSYPASDMHFEDIEMENVANPIIIDQEYC  321

Query  985   PWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDG  1164
             PWNQC   + S +K+S + FKNI+GTSS+ +A+K+ CS + PC+GV + DI+L Y GK+G
Sbjct  322   PWNQCNRKVPSAIKISKVSFKNIRGTSSTPVAVKLVCSKSNPCEGVEIADIDLTYSGKEG  381

Query  1165  SAVSKCTNVKPSIIGKVVPAACS  1233
              AVS+C+NVKP+I GK  P  C+
Sbjct  382   PAVSECSNVKPTISGKQNPPICA  404



>gb|AHL24657.1| Sal k 6.01 allergen, partial [Salsola kali]
Length=381

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/371 (46%), Positives = 230/371 (62%), Gaps = 8/371 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPITID  309
              D+ KFGAK +  A  S        A   A  A  +  AG+F+   +  QGPCK P+TI+
Sbjct  4     IDITKFGAKPNADAT-SALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLTIE  62

Query  310   AQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN----GGIFDGNGATTWNLPDCGKNGHI  477
                 N  A  D    KG   WV    V G+TI     GG FDG G   W    C ++G  
Sbjct  63    IAG-NFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGMC  121

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N +FN +T  ++ G+ + NSK +H+ +   K++T+   T+DAP +S NTDG+HIG
Sbjct  122   NSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHIG  181

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ V    + I TGDDC+S+GDG  DVHVE +TCGPGHG++IGS+GK+ NE P  G+ V
Sbjct  182   RSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIFV  241

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             KNC+ T+T NG RIK+W  S   SA+++HFEDI + NV NP++IDQ+YCP+N CK    S
Sbjct  242   KNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTPS  301

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
             KVKLS I FKN+ G + S   +K+ CS AVPC GV + DI+L + G  G+AVS+C NVKP
Sbjct  302   KVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQCKNVKP  359

Query  1198  SIIGKVVPAAC  1230
              + GK  P AC
Sbjct  360   IVTGKQNPVAC  370



>ref|XP_008235914.1| PREDICTED: exopolygalacturonase [Prunus mume]
Length=551

 Score =   330 bits (846),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/376 (45%), Positives = 235/376 (63%), Gaps = 4/376 (1%)
 Frame = +1

Query  118   HAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKG  294
             ++A FDVM FGA+ DG+ DDS AF  AW  AC++ G   IT   G ++ GP+ F GPC  
Sbjct  176   NSAVFDVMSFGARADGRTDDSNAFMAAWKEACQSTGRVHITIPKGTYIIGPLKFSGPCLN  235

Query  295   PITIDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
               ++  + K  L A  D   +   GGW+ F+ + G+T+ GG  FDG GA  W    C  +
Sbjct  236   VSSLTLRVKGYLKATTDLRKYGFGGGWLEFAWMEGLTLTGGGTFDGQGARAWPHNKCPTD  295

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
                  LP +L+F A+    + GLT+ NSK FH+ +    +    R  + AP  SPNTDG+
Sbjct  296   SKCKLLPTSLKFVAMNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGI  355

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HI ++S V    + I TGDDC+S+G G   + +  +TCGPGHG+++GSLGKYP+E+ V G
Sbjct  356   HIERSSSVYFSLSHIATGDDCISVGQGNSHITITSITCGPGHGISVGSLGKYPDERDVSG  415

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKA  1005
             + VK+CT+T T NG RIKTW  SP  S ATNM FE+I+MNNV+NPI+IDQ YCP+  C +
Sbjct  416   LVVKDCTMTGTTNGIRIKTWANSPSNSAATNMTFENIVMNNVTNPIIIDQLYCPFTSCTS  475

Query  1006  GLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCT  1185
                S+VKLS I FKNI+GTSSS++A+ ++CS  +PCQ + + D++L     +  A S C 
Sbjct  476   KAPSRVKLSDIYFKNIRGTSSSEVAVALECSEGIPCQNIYLEDVHLDLSSGEKQATSSCN  535

Query  1186  NVKPSIIGKVVPAACS  1233
             NVK    G  +P  C+
Sbjct  536   NVKAKFSGTQIPPPCT  551



>ref|XP_003560585.2| PREDICTED: exopolygalacturonase-like [Brachypodium distachyon]
Length=404

 Score =   325 bits (833),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 176/403 (44%), Positives = 248/403 (62%), Gaps = 22/403 (5%)
 Frame = +1

Query  61    ILIQAAWFCILLASFVTGLHAA--FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANT  234
              L+ A W C+ +A      HA    FDV  FGA  DG+ DDSKAF  AW  AC APG   
Sbjct  10    FLVTARW-CLEVA------HAGRQVFDVTDFGAVADGQTDDSKAFLRAWMKACAAPGRPA  62

Query  235   ITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFA-FKGHGGWVTFSQVIGVTIN  408
             +    G++   P+ F+GPCKG   ++ +   +L  PD  A F+G   WV F+ + G+ + 
Sbjct  63    VVVPKGEYRLHPVVFRGPCKG--YMELRLAGVLRAPDDLAAFRGSHEWVNFAGIDGLLVT  120

Query  409   GG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             GG  FDG GA++W+L DC +     PLP +++   V  + +  +T+ +SK FH+ I  S+
Sbjct  121   GGGTFDGRGASSWHLNDCPRKPDCTPLPVSIKLGRVRNVTITEVTSLDSKFFHVIIIGSQ  180

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             DV I R T+ AP +SPNTDGVHI  +S V I    + TGDDCVS+G G  D+ V  V+CG
Sbjct  181   DVAIHRVTIRAPRDSPNTDGVHIQGSSNVRITDTAVATGDDCVSVGPGSADITVSGVSCG  240

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPG--SPVGSATNMHFEDII  939
             PGHG+++GSLG++P E+ V G+ V NCTL  T NG RIKTW G   P    + + FEDI+
Sbjct  241   PGHGISVGSLGRHPGEEDVRGLRVSNCTLAGTANGVRIKTWRGGLRPAAGVSGLVFEDIV  300

Query  940   MNNVSNPILIDQQYCPW--NQCK---AGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPA  1104
             M  V NPI+IDQ+YCP+  + C+   A L S VK+S + FKNI+G S++++A+K+ CS A
Sbjct  301   MRKVRNPIIIDQEYCPYSSSSCRHESALLPSVVKISDVKFKNIRGVSATQVAVKLSCSGA  360

Query  1105  VPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSII-GKVVPAAC  1230
              PC G+ + DI+L Y  +  +  S+C NV   +  G +VP +C
Sbjct  361   SPCHGLELRDIDLRYVKRGVATESRCANVAGGVAGGTLVPPSC  403



>ref|XP_011069588.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=401

 Score =   325 bits (832),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 169/394 (43%), Positives = 238/394 (60%), Gaps = 7/394 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-  240
              I    F  LLA  V       +D+ K+GAK  G  D S+A   AW  AC +   +TI  
Sbjct  5     FITILLFLPLLAINVNAQGPMTYDITKYGAKSGG--DISQALMDAWKEACNSTSPSTIVI  62

Query  241   AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF-KGHGGWVTFSQVIGVTINGG-  414
               G +    +   GP K P+ +  Q + L A P+P       G W+T + V   T++GG 
Sbjct  63    PRGTWSLSQVKLLGPNKAPLELQVQGI-LQANPNPGQLPNKEGEWITINYVNYFTLSGGG  121

Query  415   IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVT  594
             +FDG G   W   DC KN +   LP NL FN V    +  +T ++SK FH+    S +VT
Sbjct  122   VFDGQGQQAWKQNDCHKNRNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCIGSHNVT  181

Query  595   IERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGH  774
               R+TV APG+SPNTDG+H+G+ + ++I  + IKTGDDCVS+GD  +++H++ VTCGPGH
Sbjct  182   FLRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGH  241

Query  775   GLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNV  951
             G+++GSLG Y  EK V G+ V NCT   T NG R+KTWP +P   + +++HFED+IM+NV
Sbjct  242   GISVGSLGGYAEEKDVQGIFVTNCTFIGTQNGVRVKTWPSAPAQLTVSDLHFEDLIMDNV  301

Query  952   SNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMN  1131
             S+PI+IDQ+YCP N CK    S +K+S +  KN++GT++S  A+ + CS   PC+ V + 
Sbjct  302   SSPIIIDQEYCPHNLCKKDRPSSIKISNVSIKNVRGTTNSAEAVTLICSGLKPCENVEVG  361

Query  1132  DINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             DI+L Y G  G   +KC NVKP  +GK  P  C+
Sbjct  362   DIDLTYNGNQGPITTKCMNVKPKFVGKQNPPVCA  395



>ref|XP_008381794.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=401

 Score =   325 bits (832),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/399 (42%), Positives = 248/399 (62%), Gaps = 10/399 (3%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN  231
             +K+IL   + F  LL    +   +  +DV      G   +D ++A + AW  AC +  A+
Sbjct  5     LKNIL---SMFVFLLLVSSSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSAS  61

Query  232   TITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPF-AFKGHGGWVTFSQVIGVTI  405
              I   +G +      F+GPCKGPI    Q    L  P+          WV F ++ G+T+
Sbjct  62    KIVVPSGTYKFVGATFKGPCKGPIEFQLQ--GTLQAPEHIKELPKEDTWVAFERIDGLTL  119

Query  406   NGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +GG  FDG GAT W   DC KN        NL+FN +T   + G+T ++SK FH+ +   
Sbjct  120   SGGGTFDGQGATAWKQNDCHKNKDCKFKAVNLRFNFITNSIVRGITTKDSKNFHVNLLGC  179

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
               +  + +TV AP  S NTDG+H+G++++++I   TI TGDDC+S+G G + +HV  VTC
Sbjct  180   NKLAFQDFTVSAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTNVTC  239

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSA-TNMHFEDI  936
             GPGHG++IGSLG+  +E+PV G+ +KNCT+TNT NG RIKTWP SP  G+A +++HF+DI
Sbjct  240   GPGHGISIGSLGRTEDEEPVSGIFIKNCTITNTDNGVRIKTWPASPAKGTAVSDVHFZDI  299

Query  937   IMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQ  1116
             IM+NV NP++IDQ+YCP   C   ++SKVK+S + FKNIKG+SS  + +K+ CS  +PC+
Sbjct  300   IMDNVKNPVVIDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCE  359

Query  1117  GVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              V +++I+L Y G  GS  S+C +VKP+I     P AC+
Sbjct  360   NVELSNIDLTYTGDKGSITSECKHVKPTINNVAKPLACA  398



>ref|XP_003522976.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   324 bits (830),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 173/390 (44%), Positives = 237/390 (61%), Gaps = 10/390 (3%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-  228
             MK  +I   +F + L  F         D+ +FG K +   +  +AF  AW  AC +P A 
Sbjct  1     MKFTII-TIFFSLFLLDFGFAQQGDL-DISRFGGKPN--TNIGQAFLSAWTQACASPTAV  56

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  AG +  G +  +GPCK PI +      + A  +P   K    W     V   T++
Sbjct  57    KIVIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPANPTDLKAAHQWFVVQYVNSFTLS  115

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G+FDG GAT W   DC  N     L  N  FN +    +  +T+++SK FH+ +    
Sbjct  116   GKGVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCN  175

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             + T + + V AP +SPNTDG+HIG+++ V I+   I TGDDCVSLGDG +++ V+ V CG
Sbjct  176   NFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCG  235

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIM  942
             PGHG+++GSLGKY +E+PV G  VKNCTL  T NG RIKTWP +P   + T+MHFED+ M
Sbjct  236   PGHGISVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTM  295

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
             NNV+NPI+IDQ+YCPWNQC     SK+K+S + FKNIKGTS S+  + + CS  VPC+GV
Sbjct  296   NNVTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGV  355

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
              M DI+L + G   +A +KC NVKP+I GK
Sbjct  356   EMADIDLTFNG--AAATAKCANVKPTITGK  383



>gb|KFK31316.1| hypothetical protein AALP_AA6G096900 [Arabis alpina]
Length=395

 Score =   324 bits (830),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/358 (45%), Positives = 231/358 (65%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D +KA   A+  AC+AP  +T+    G++  G I   GPCK PI I  Q        D 
Sbjct  33    SDITKALLKAFTEACQAPTKSTVMIPKGEYKLGEIEMTGPCKAPIRIALQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
                 G   WV F  + G  +NGG +FDG G   W   +C K  +   LP +++F+ VT  
Sbjct  90    NLINGKEKWVAFRNIDGFKLNGGGVFDGEGNNAWRSNNCHKTFNCKKLPISIRFDFVTNA  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
             ++ G+T+ ++K FH+ +  +K++T E   + AP  SPNTDG+H+G++  + II + I TG
Sbjct  150   KIRGITSLDAKHFHINVIGAKNMTFEDVKIVAPAESPNTDGIHVGRSDGIRIINSFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDCVS+GDG++++ VE+VTCGPGHG++IGSLG+Y +E+ V G+ + NCTL  T NG RIK
Sbjct  210   DDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYSHEEDVSGIKIVNCTLQETDNGIRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HF++II+ NV+NPILIDQ+YCPWNQC    +S +KL  I FKNI+G
Sbjct  270   TWPSAACSTTASDIHFQNIILKNVTNPILIDQEYCPWNQCNKQKSSTIKLVNISFKNIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ C+  +PC  V + DIN+ Y G DG A  +C NV P ++G   P ACS
Sbjct  330   TSGNKDAVKLLCAKGLPCTNVELGDINIKYNGADGPATFQCANVSPKLMGTQTPKACS  387



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   324 bits (830),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/360 (44%), Positives = 234/360 (65%), Gaps = 6/360 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+ +AC++   +  +   G+F  G I  +GPCK PI +  Q        D 
Sbjct  33    SDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMRGPCKAPIEVTLQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
              A +G   WV F  + G  +NGG  FDG G + W + +C K  +   LP +++F+ V   
Sbjct  90    NAIQGKEKWVVFGNIDGFKLNGGGAFDGEGNSAWRVNNCHKTFNCKKLPISIRFDFVLNS  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T++   + AP  SPNTDG+H+G++  V I+ + I TG
Sbjct  150   EIRDISSIDAKNFHINVLGAKNMTMDNIKIIAPEESPNTDGIHLGRSDGVKILNSFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y +E+ V G+ + NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQDVSGIKIINCTLQETDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HFEDII+ NVSNPILIDQ+YCPWNQC    AS +KL  I FKNI+G
Sbjct  270   TWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQCNKQKASTIKLVNISFKNIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACSVH  1239
             TS +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS  
Sbjct  330   TSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATFQCSNVSPKLLGSQSPKACSAQ  389



>ref|XP_003522977.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   323 bits (829),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 173/390 (44%), Positives = 237/390 (61%), Gaps = 10/390 (3%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-  228
             MK  +I   +F + L  F         D+ +FG K +   +  +AF  AW  AC +P A 
Sbjct  1     MKFTII-TIFFSLFLLDFGFAQQGDL-DISRFGGKPN--TNIGQAFLSAWTQACASPTAV  56

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  AG +  G +  +GPCK PI +      + A  +P   K    W     V   T++
Sbjct  57    KIVIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPTNPTDLKAAHQWFVVQYVNSFTLS  115

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G+FDG GAT W   DC  N     L  N  FN +    +  +T+++SK FH+ +    
Sbjct  116   GKGVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCN  175

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             + T + + V AP +SPNTDG+HIG+++ V I+   I TGDDCVSLGDG +++ V+ V CG
Sbjct  176   NFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCG  235

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIM  942
             PGHG+++GSLGKY +E+PV G  VKNCTL  T NG RIKTWP +P   + T+MHFED+ M
Sbjct  236   PGHGISVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTM  295

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
             NNV+NPI+IDQ+YCPWNQC     SK+K+S + FKNIKGTS S+  + + CS  VPC+GV
Sbjct  296   NNVTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGV  355

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
              M DI+L + G   +A +KC NVKP+I GK
Sbjct  356   EMADIDLTFNG--AAATAKCANVKPTITGK  383



>ref|XP_010251320.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=399

 Score =   324 bits (830),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 229/371 (62%), Gaps = 3/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-NTITAAGKFMAGPIWFQGPCKGPITI  306
             FDV+K+GA+GDG  DDSKAF  AW AAC++ GA   +     +M GP+ F GPC    +I
Sbjct  28    FDVVKYGARGDGVHDDSKAFLAAWKAACESSGAVKVLIPKANYMVGPVKFYGPCDKVKSI  87

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
                    L         G   W+TF  V G+T+ GG  FDG GA +W+   C    +   
Sbjct  88    TVYMKGYLKATTDLKDYGTYDWITFGFVEGLTLTGGGTFDGQGAASWSFNSCRLKKNCQV  147

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP NL+F ++    + G+T+ NSK FH+ +    +       + AP  SPNTDG+HI ++
Sbjct  148   LPTNLKFVSLNDTVVRGITSLNSKFFHMGLVDCNNFMGRDLKITAPETSPNTDGIHIERS  207

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             + VS+  + I TGDDC+S+G    D+ +  VTCGPGHG++IGSLG+Y  EK V G+ VK+
Sbjct  208   TTVSVYSSIIGTGDDCISIGHSSYDITISGVTCGPGHGISIGSLGRYEKEKDVNGIVVKD  267

Query  844   CTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             CT+T T+NG RIKTW  SPVGS A+NM F +I+M+ VSNPI+IDQ YCP+  C +  +S+
Sbjct  268   CTITETMNGVRIKTWEDSPVGSQASNMTFNNIVMHRVSNPIIIDQTYCPYTSCTSASSSR  327

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKL  I FKNI+GTS++ +A+ ++CS  +PC+ V + +I+L      G   S C NVKP 
Sbjct  328   VKLKDIYFKNIRGTSTTPVAVLLECSKGLPCENVFLENIHLELSPGGGPTNSTCENVKPQ  387

Query  1201  IIGKVVPAACS  1233
               G  +P  C+
Sbjct  388   YSGTQIPPPCN  398



>ref|XP_004490643.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=394

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/364 (44%), Positives = 231/364 (63%), Gaps = 9/364 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             F++ K+GA      D + A   AW  AC++   +  +  +G++    I  +GPCK PI +
Sbjct  28    FNIRKYGAPN---GDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGPCKAPIEV  84

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                 + + A  +PF   G   W+ F  +   T++G G FDG G   W   DCG+N +   
Sbjct  85    KVNGI-IQAPKNPFHLNGQDQWIRFQYINFFTLSGKGTFDGQGEMAWKQNDCGRNTNCKR  143

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             L  N  F  +    +  + +++SK FH  +    +VT   + ++AP +SPNTDG+HIG++
Sbjct  144   LAMNFGFAFLNNSVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESSPNTDGIHIGKS  203

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             S+V I  + I +GDDC+SLGDG   + ++ VTCGPGHG+++GSLGKYPNE PV+ + VKN
Sbjct  204   SRVKISNSKIGSGDDCISLGDGSTQITIQNVTCGPGHGISVGSLGKYPNEDPVVDLIVKN  263

Query  844   CTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             CTL NT NG RIKTWPG+ V S A+++HFEDI+M NVSNPI+IDQQYCPWNQC     SK
Sbjct  264   CTLNNTDNGVRIKTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCPWNQCSKQSPSK  323

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +K+  + FKNI+GTS+++  + + CS  VPC+ VV++DINL + G + +A  KC NV P 
Sbjct  324   IKIRKVIFKNIRGTSATQEGVSLICSRGVPCEAVVLSDINLSFNGSEVTA--KCANVNPK  381

Query  1201  IIGK  1212
             I  K
Sbjct  382   IRRK  385



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/374 (45%), Positives = 236/374 (63%), Gaps = 11/374 (3%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKG-P  297
             + FDV ++GAK +   D ++A   AW  AC +   +  +   G +     + +GPCK  P
Sbjct  20    SLFDVTRYGAKPN--TDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGPCKSVP  77

Query  298   ITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGH  474
             I +         L  P    G G  V F+ +  + ++G G+FDG G   W+  DC K   
Sbjct  78    IQVQVDG----TLKAPLHPNGDG-LVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCHKKKI  132

Query  475   ICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHI  654
                LP NL+F+ +T   +  +T+ +SK FH+ +   K+VT +  T+ AP NSPNTDG+HI
Sbjct  133   CTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTDGIHI  192

Query  655   GQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVT  834
               + +++I+ + I TGDDCVS+GD  + V +  VTCGPGHG+++GSLGKY  EK V+GVT
Sbjct  193   SSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDVVGVT  252

Query  835   VKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
             VK C L NT NG RIKTWP S     A++MHFEDI M NVSNP++IDQ+YCPWNQC   +
Sbjct  253   VKTCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQCNRKV  312

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              SK+K+S + FKNI+GTS++ +A+K+ CS ++PC+GV + DINL Y G  G  +S+C NV
Sbjct  313   PSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSECANV  372

Query  1192  KPSIIGKVVPAACS  1233
             +P I GK  P  C+
Sbjct  373   QPLITGKQSPQICA  386



>ref|XP_009124109.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=396

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/362 (44%), Positives = 233/362 (64%), Gaps = 6/362 (2%)
 Frame = +1

Query  178   SKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF  354
             ++A   A+ +AC++P  +  +   G+F  G I  +GPCK P+ I  Q        D  A 
Sbjct  36    TQALLKAFTSACQSPSPSKVVIPKGEFKLGEIEMRGPCKAPVEITLQGT---VKADGNAI  92

Query  355   KGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLI  531
             +G   WV F  + G  +NGG  FDG G   W + +C K  +   LP +++F+ V    + 
Sbjct  93    QGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFNCKKLPISIRFDFVENAEIK  152

Query  532   GLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDC  711
              +++ ++K FH+ +  +K++T+    + AP +SPNTDG+H+G++  V I+ + I TGDDC
Sbjct  153   DISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNTDGIHLGRSDGVKILDSFISTGDDC  212

Query  712   VSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWP  891
             +S+GDG  ++HVEKVTCGPGHG+++GSLG+Y  E+ V G+ V NCTL  T NG RIKTWP
Sbjct  213   ISVGDGTSNLHVEKVTCGPGHGISVGSLGRYGKEQDVSGIRVVNCTLQETDNGLRIKTWP  272

Query  892   GSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSS  1068
              +    +A+++HFEDII+ NV+NPILIDQ+YCPWNQC    AS +KL  I FKN++GTS 
Sbjct  273   SAACSTTASDIHFEDIIVKNVTNPILIDQEYCPWNQCNKKKASTIKLVNISFKNVRGTSG  332

Query  1069  SKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACSVHK*K  1248
             +K A+K+ CS   PCQ V + DI++ Y G+DG A  +C+NV P ++G   P ACS    K
Sbjct  333   NKDAVKLLCSKGYPCQNVEIGDIDIKYSGEDGPATFQCSNVSPKLLGAQSPEACSSPLTK  392

Query  1249  IP  1254
             +P
Sbjct  393   LP  394



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 178/392 (45%), Positives = 245/392 (63%), Gaps = 16/392 (4%)
 Frame = +1

Query  82    FCILLASFVTGLHA---AFFDVMKFGAKGDGKADDSKAFTGAWGAACKA--PGANTITAA  246
             F + L SF+    +     F + K+G    G AD ++A   AW  AC +  P A  +   
Sbjct  14    FLMSLLSFIIESRSHVDVIFPLRKYGNIVSG-ADVTEALKDAWNDACASVRPSA-VVIPK  71

Query  247   GKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHG-GWVTFSQVIGVTINGG-IF  420
             G F      F+GPCK PI I  +   L A   P     HG  W+TF+ V  +T++GG +F
Sbjct  72    GIFKVREGEFKGPCKSPIEIRVRGT-LQAPKHP-----HGDSWITFAYVDRMTLSGGGVF  125

Query  421   DGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIE  600
             DG G   W   DC K      LP +L+F+ +T   +  +T+ +SK FH+ I    ++T +
Sbjct  126   DGQGKAGWEKNDCHKRIDCANLPISLRFDFITNSIVKRITSLDSKNFHVNILGCNNLTFK  185

Query  601   RYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGL  780
                + AP +SPNTDG+HIG++  +SI+ + I TGDDC+SLGDG + V +  VTCGPGHG+
Sbjct  186   GVNIIAPEDSPNTDGIHIGRSIGISILKSQIATGDDCISLGDGSKRVKITNVTCGPGHGI  245

Query  781   AIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSN  957
             +IGSLGKY NE+PV GV VKNCT+ NT NG RIKTWP SP  G AT+MHF DI M NVSN
Sbjct  246   SIGSLGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPNAGIATDMHFSDITMVNVSN  305

Query  958   PILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDI  1137
             PILIDQ+YCPWNQC   + S +K++ + FKNI+G+S++ +A+K+ CS   PC+ V + +I
Sbjct  306   PILIDQEYCPWNQCNREIPSNIKINNVSFKNIRGSSATPVAVKLICSSNQPCEEVKVANI  365

Query  1138  NLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             +L+Y G +G   S+C NVKP + G   P+ CS
Sbjct  366   DLVYNGINGPITSQCMNVKPIVSGIQNPSICS  397



>ref|XP_003522975.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/390 (44%), Positives = 237/390 (61%), Gaps = 10/390 (3%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-  228
             MK  +I   +F + L  F         D+ +FG K +   +  +AF  AW  AC +P A 
Sbjct  1     MKFTII-TIFFSLFLLDFGFAQQGDL-DISRFGGKPN--TNIGQAFLSAWTQACASPTAV  56

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  AG +  G +  +GPCK PI +      + A  +P   K    W     V   T++
Sbjct  57    KIVIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPANPTDLKAAHQWFVVQYVNSFTLS  115

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G+FDG GAT W   DC  N     L  N  FN +    +  +T+++SK FH+ +    
Sbjct  116   GKGVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCN  175

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             + T + + V AP +SPNTDG+HIG+++ V I+   I TGDDCVSLGDG +++ V+ V CG
Sbjct  176   NFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKNITVQNVNCG  235

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIM  942
             PGHG+++GSLGKY +E+PV G  VKNCTL  T NG RIKTWP +P   + T+MHFED+ M
Sbjct  236   PGHGISVGSLGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNTPGAITITDMHFEDLTM  295

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
             NNV+NPI+IDQ+YCPWNQC     SK+K+S + FKNIKGTS S+  + + CS  VPC+GV
Sbjct  296   NNVTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQDGVVLVCSSGVPCEGV  355

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
              M DI+L + G   +A +KC NVKP+I GK
Sbjct  356   EMADIDLTFNG--AAATAKCANVKPTITGK  383



>ref|XP_004295347.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=412

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/384 (44%), Positives = 236/384 (61%), Gaps = 6/384 (2%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCK  291
             L    FDV      G   +D S+A T AW  AC +   +  I   G +      F GPCK
Sbjct  26    LSDGEFDVTSAKYGGKAGSDISQALTNAWKDACASTSPSKIIIPKGTYPLKEAEFSGPCK  85

Query  292   GPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKN  468
              PI +  Q   L A  D         W+ F  +   T++GG +FDG GA  W   DC KN
Sbjct  86    APIEMQLQG-TLQAPEDSTQLTKPDTWIGFLYISDFTLSGGGVFDGQGAKAWKANDCQKN  144

Query  469   GHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGV  648
                C    N++F+ +    +  +T+ NSK FH  I  ++ +T +  TV APG+SPNTDG+
Sbjct  145   PK-CSSTINIRFHQMKKSLVKDITSLNSKNFHFNIIGAEQLTFDHVTVTAPGDSPNTDGI  203

Query  649   HIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLG  828
             HIG+++ V+I    I TGDDC+S+GDG + + +EKVTCGPGHG+++GSLGKY NE+PV G
Sbjct  204   HIGRSNGVNITNCVIGTGDDCISIGDGTKQLTIEKVTCGPGHGISVGSLGKYDNEEPVAG  263

Query  829   VTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKA  1005
             + VKNCT++ T NG R+KTWP  P   +A+++HFEDIIM+NV NPI++DQ+YCP++QC  
Sbjct  264   IFVKNCTISKTQNGVRVKTWPNGPSAITASDIHFEDIIMDNVQNPIVLDQEYCPYDQCDK  323

Query  1006  GLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCT  1185
               +SK+K+S + FKNI+GTS++ + +K+ CS + PC  VVM+DI+L   G  G   S+CT
Sbjct  324   SASSKIKISNVSFKNIRGTSATALGVKVACSKSNPCDQVVMSDIDLKLSGA-GELTSQCT  382

Query  1186  NVKPSIIGKVVPAACSVHK*KIPA  1257
             N KP+I       AC+  +   PA
Sbjct  383   NTKPTITNVAKALACATDQPVDPA  406



>emb|CDY22137.1| BnaC01g39640D [Brassica napus]
Length=396

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/362 (44%), Positives = 232/362 (64%), Gaps = 6/362 (2%)
 Frame = +1

Query  178   SKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF  354
             ++A   A+ +AC++P  +  +   G+F  G I  +GPCK P+ I  Q        D  A 
Sbjct  36    TQALLKAFTSACQSPSPSKVVIPEGEFKLGEIEMRGPCKAPVEITLQGT---VKADGNAI  92

Query  355   KGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLI  531
             +G   WV F  + G  +NGG  FDG G   W + +C K  +   LP +++F+ V    + 
Sbjct  93    QGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFNCKKLPISIRFDFVENAEIK  152

Query  532   GLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDC  711
              +++ ++K FH+ +  +K++T+    + AP +SPNTDG+H+G++  V I+ + I TGDDC
Sbjct  153   DISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNTDGIHLGRSDGVKILNSFISTGDDC  212

Query  712   VSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWP  891
             +S+GDG  ++HVEKVTCGPGHG+++GSLG+Y  E+ V G+ V NCTL  T NG RIKTWP
Sbjct  213   ISVGDGTNNLHVEKVTCGPGHGISVGSLGRYGKEQDVSGIRVVNCTLQETDNGLRIKTWP  272

Query  892   GSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSS  1068
              +    +A+++HFEDII+ NV+NPILIDQ+YCPWNQC    AS +KL  I FKN++GTS 
Sbjct  273   SAACSTTASDIHFEDIIVKNVTNPILIDQEYCPWNQCNKKKASTIKLVNISFKNVRGTSG  332

Query  1069  SKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACSVHK*K  1248
             +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS    K
Sbjct  333   NKDAVKLLCSKGYPCQNVEIGDIDIKYSGADGPATFQCSNVSPKLLGAQSPEACSSPLTK  392

Query  1249  IP  1254
             +P
Sbjct  393   LP  394



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/374 (45%), Positives = 236/374 (63%), Gaps = 11/374 (3%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKG-P  297
             + FDV ++GAK +   D ++A   AW  AC +   +  +   G +     + +GPCK  P
Sbjct  20    SLFDVTRYGAKPN--TDITQALANAWKEACMSTTPSKLLIPKGVYQLSQSYLKGPCKSVP  77

Query  298   ITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGH  474
             I +         L  P    G G  V F+ +  + ++G G+FDG G   W+  DC K   
Sbjct  78    IQVQVDG----TLKAPLHPNGDG-LVLFAYIDQLMLSGTGVFDGQGKAGWDKNDCHKKKI  132

Query  475   ICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHI  654
                LP NL+F+ +T   +  +T+ +SK FH+ +   K+VT +  T+ AP NSPNTDG+HI
Sbjct  133   CTKLPMNLKFSFITNSIVKDITSLDSKNFHINLLGCKNVTFQHVTISAPENSPNTDGIHI  192

Query  655   GQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVT  834
               + +++I+ + I TGDDCVS+GD  + V +  VTCGPGHG+++GSLGKY  EK V+GVT
Sbjct  193   SSSEQINILDSKISTGDDCVSVGDSNKQVTITNVTCGPGHGISVGSLGKYTKEKDVVGVT  252

Query  835   VKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
             VK C L NT NG RIKTWP S     A++MHFEDI M NVSNP++IDQ+YCPWNQC   +
Sbjct  253   VKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCPWNQCNRKV  312

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              SK+K+S + FKNI+GTS++ +A+K+ CS ++PC+GV + DINL Y G  G  +S+C NV
Sbjct  313   PSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSECANV  372

Query  1192  KPSIIGKVVPAACS  1233
             +P I GK  P  C+
Sbjct  373   QPLITGKQSPQICA  386



>ref|XP_011097055.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/393 (43%), Positives = 237/393 (60%), Gaps = 7/393 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-  240
              I   +F  LLA  +       +D+ K+GAK  G  D S+A   AW  AC +   +TI  
Sbjct  5     FITILFFLPLLAININAQGPMTYDITKYGAKSGG--DISQALMDAWKEACNSTSPSTIVI  62

Query  241   AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-I  417
               G +    +   GP K P+ +  Q   L A P     K  G W+T + V   T++GG +
Sbjct  63    PRGTWSLSQVKLLGPNKAPLELQVQGT-LQANPGQLPNK-EGEWITINYVNYFTLSGGGV  120

Query  418   FDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTI  597
             FDG G   W   DC KN +   LP NL FN V    +  +T ++SK FH+   SS +VT 
Sbjct  121   FDGRGQEAWKQNDCHKNKNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVTF  180

Query  598   ERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHG  777
              R+TV APG+SPNTDG+H+G+ + ++I  + IKTGDDCVS+GD  +++H++ VTCGPGHG
Sbjct  181   LRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGHG  240

Query  778   LAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVS  954
             +++GSLG Y  EK V G+ V NCT   T NG R+KTWP +P   + +++HFED+IM+NVS
Sbjct  241   ISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNVS  300

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             +PI+IDQ+YCP N CK    S +K+S +  KN++GT+++  A+   CS   PC+ V + D
Sbjct  301   SPIIIDQEYCPHNLCKKDRPSSIKISNVSIKNVRGTTNTAEAVTFICSGLKPCENVEVGD  360

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             I+L Y G  G   +KC NVKP  +GK  P  C+
Sbjct  361   IDLTYNGNQGPITTKCANVKPKFVGKQNPPVCA  393



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 230/373 (62%), Gaps = 10/373 (3%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPI  300
             + FDV ++GAK +   D + A   AW  AC +   +  +   G ++      +GPCK  I
Sbjct  25    SVFDVTRYGAKPN--TDITHALLNAWKGACASTSRSKVLIPKGIYLLSQSNLKGPCKSSI  82

Query  301   TIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHI  477
              I  Q   L A PDP   KG G  V    +  +T++G G+FDG G   W   DC K    
Sbjct  83    EIQVQG-TLQAPPDP---KGDG-LVILEYIDQLTLSGTGVFDGQGKAGWEKNDCHKKKIC  137

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP  L+FN VT   +  +T+ +SK FH+ +   K++T E  T+ AP NSPNTDG+HI 
Sbjct  138   TKLPMTLKFNFVTNSIVKDITSLDSKNFHINLLGCKNITFEHVTISAPENSPNTDGIHIS  197

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
              + ++ I+   I TGDDCVS+GD  +D+ +  VTCGPGHG++IGSLGKY  EK V GV V
Sbjct  198   SSEQIRILNTKISTGDDCVSVGDSNKDITIRDVTCGPGHGISIGSLGKYTKEKAVEGVWV  257

Query  838   KNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
               C L  T NG RIKTWP S V  SA++MHFEDI M +VSNPILIDQ+YCPWNQC   + 
Sbjct  258   TKCKLIKTTNGVRIKTWPDSAVKYSASDMHFEDIEMIDVSNPILIDQEYCPWNQCNRKIP  317

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S +K+S + FKNI+GT+ + +A+K+ CS ++PC+ V + DI+L Y G  GS  S+C NVK
Sbjct  318   SSIKISKVSFKNIRGTTVTPVAVKLVCSKSIPCEAVEVADIDLKYNGNKGSITSQCANVK  377

Query  1195  PSIIGKVVPAACS  1233
             P I GK  P  C+
Sbjct  378   PIISGKQNPRICA  390



>ref|XP_006856226.1| hypothetical protein AMTR_s00059p00207710 [Amborella trichopoda]
 gb|ERN17693.1| hypothetical protein AMTR_s00059p00207710 [Amborella trichopoda]
Length=431

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 230/372 (62%), Gaps = 4/372 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-NTITAAGKFMAGPIWFQGPCKGPIT  303
             FF+VM +GAKGDG+ DDSKA    W AAC   G+       G ++ GP+ F GPCKG  T
Sbjct  60    FFNVMNYGAKGDGRTDDSKALMDTWKAACGFKGSVRYYIPPGNYIVGPLNFNGPCKGVTT  119

Query  304   IDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHI  477
             ++   K  L A  D   +     WV F  + G+ + G G FDG GA +W L +C KN + 
Sbjct  120   MNFMIKGTLKASTDLSKYGPTDSWVMFGWLTGLKLTGYGTFDGQGAASWPLNNCPKNKNC  179

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LPA+++F A     +  +T+ NSK FH+ +   K+       + AP  SPNTDG+HI 
Sbjct  180   KVLPASIKFVATDYTEVQAITSLNSKFFHIVLLDCKNFKATNLQITAPATSPNTDGIHIE  239

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             +++ VSI  + I TGDDC+S+G G   V +  VTCGPGHG+++GSLG+YPNE  V+G++V
Sbjct  240   RSTDVSISNSKIGTGDDCISIGHGNTRVFINGVTCGPGHGISVGSLGRYPNEGDVMGLSV  299

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
               C LT T NG RIKTW  SP  S ATNM FE+I+M NV+NPI+IDQ YCP+  C A   
Sbjct  300   TGCVLTGTANGLRIKTWQDSPDTSVATNMTFENIVMYNVANPIIIDQNYCPYTYCTARAP  359

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S+VK+S + FKNI+GTS+++ A+ + CS  +PCQ V + D+ L Y G    A + C NVK
Sbjct  360   SRVKISDVSFKNIRGTSATETAVTLHCSNGLPCQNVRLQDVQLNYYGPGKRAKATCMNVK  419

Query  1195  PSIIGKVVPAAC  1230
              S  G  +P  C
Sbjct  420   ASYSGTQIPPPC  431



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   322 bits (826),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 167/383 (44%), Positives = 238/383 (62%), Gaps = 16/383 (4%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGKA---------DDSKAFTGAWGAACKAPGANTITA-AGKFMAGPI  270
             +AFF     G   + K          D +KA   A+  AC+ P  +T+    G++  G I
Sbjct  9     SAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNQACQFPTKSTVLIPKGEYKLGEI  68

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWN  447
                GPCK PI I  Q        D  A      W+ F  + G  +NGG +FDG G   W 
Sbjct  69    EMMGPCKAPIRIALQGT---VKADGNAVHSEK-WIAFHNIDGFKLNGGGVFDGEGNAAWR  124

Query  448   LPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGN  627
             + +C        LP +++F+ VT  ++ G+T+ ++K FH+ +  +K++T E   + AP  
Sbjct  125   VNNCHHTWKCKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEVKIVAPAE  184

Query  628   SPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYP  807
             SPNTDG+ +G++  + II + I TGDDCVS+GDG++++ VE+VTCGPGHG++IGSLG+Y 
Sbjct  185   SPNTDGILVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYG  244

Query  808   NEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYC  984
             +E+ V+G+ + NCTL  T NG RIKTWP +    SA+++HFE+I++ NVSNPILIDQ+YC
Sbjct  245   HEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPILIDQEYC  304

Query  985   PWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDG  1164
             PWNQC    AS +KLS I FKNI+GTS +K A+K+ CS   PCQ V + +IN+ Y G DG
Sbjct  305   PWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINIKYTGSDG  364

Query  1165  SAVSKCTNVKPSIIGKVVPAACS  1233
              A  +C+NV P ++G  VP ACS
Sbjct  365   PATFQCSNVSPKLMGTQVPKACS  387



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score =   322 bits (826),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 173/389 (44%), Positives = 239/389 (61%), Gaps = 11/389 (3%)
 Frame = +1

Query  82    FCILLASFVTGLHA---AFFDVMKFGAKGDGKADDSKAFTGAWGAACKA-PGANTITAAG  249
             F ++L SF     +     F + K+G    G  D ++A   AW  AC + P +  I   G
Sbjct  12    FLMILLSFTIESRSHVDVIFHLRKYGNIVSG-VDVTEALKDAWNDACASVPPSAVIIPKG  70

Query  250   KFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGGIFDGN  429
              F      F+GPCK PI +  +   L AL  P        W+TF  V  + ++GG+FDG 
Sbjct  71    IFKVREGEFKGPCKSPIEMRVRG-TLQALNHPQG----DSWITFVYVDRMKLSGGVFDGQ  125

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             G   W   DC K  +   LP +L+FN +T   +  +T+ +SK  H+ I    ++T +   
Sbjct  126   GKEGWXKNDCHKCINCANLPISLRFNFITNXIVRRITSLDSKNSHVNILGCNNLTFQGVN  185

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             + AP +SPNTD +HIG++ ++SI+ + I  GDDC+SLG+G + V V  VTCGPGHG++IG
Sbjct  186   IIAPEDSPNTDEIHIGRSIRISILKSRIAIGDDCISLGNGSKRVKVTDVTCGPGHGISIG  245

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDIIMNNVSNPIL  966
             SLGKY NE+PV GV VKNCT+ NT NG RIKTW  SPV G A  MHF DI M NVSNPIL
Sbjct  246   SLGKYTNEEPVEGVVVKNCTIMNTTNGVRIKTWSASPVAGIAIIMHFSDITMINVSNPIL  305

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQ+YCPWNQC   + SK+K++ + FKNI+G S++ +A+K+ CS  +PC+ V + +I+L+
Sbjct  306   IDQEYCPWNQCNRQIPSKIKINKVSFKNIRGCSATSVAVKLICSSNLPCEEVKVANIDLV  365

Query  1147  YKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             Y G  GS  S+C NVKP + G   P+ CS
Sbjct  366   YNGTKGSITSQCMNVKPILSGIQNPSICS  394



>ref|XP_009365183.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=401

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/399 (41%), Positives = 246/399 (62%), Gaps = 10/399 (3%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGAN  231
             +K+IL     F  LL +  +   +  +DV      G   +D ++A + AW  AC +  A+
Sbjct  5     LKNIL---PMFVYLLLASTSNAQSGVYDVTGANYGGKANSDITQALSKAWTDACASTSAS  61

Query  232   TITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPF-AFKGHGGWVTFSQVIGVTI  405
              I   +G +      F+GPCK PI    Q    +  P+          WV F ++ G+T+
Sbjct  62    KIVVPSGTYKFVGATFKGPCKAPIEFQLQ--GTVQAPEHIKELPKEDTWVAFERIDGLTL  119

Query  406   NGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +GG IFDG G T W   DC KN +      NL+FN VT   +  +T ++SK FH+ +   
Sbjct  120   SGGGIFDGQGTTAWKQNDCHKNKNCKSKAVNLRFNFVTNSIVREITTKDSKNFHVNLLGC  179

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
              ++  + +TV AP  S NTDG+H+G++++++I   TI TGDDC+S+G G + +HV  VTC
Sbjct  180   NNLAFQHFTVSAPKESVNTDGIHMGRSTEINITDTTIGTGDDCISIGHGTKQLHVTNVTC  239

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG--SATNMHFEDI  936
             GPGHG++IGSLG+  +E+PV G+ +KNCT++NT NG RIKTWP SP    + +++HFEDI
Sbjct  240   GPGHGISIGSLGRTEDEEPVSGIFIKNCTISNTDNGVRIKTWPASPAKGTAVSDVHFEDI  299

Query  937   IMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQ  1116
             IM+NV NP++IDQ+YCP   C   ++SKVK+S + FKNIKG+SS  + +K+ CS  +PC+
Sbjct  300   IMDNVKNPVVIDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCE  359

Query  1117  GVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              V +++I+L Y G  GS  S+C +VKP+I     P AC+
Sbjct  360   NVELSNIDLTYTGDKGSLTSECKHVKPTINNVAKPLACA  398



>ref|XP_003544118.1| PREDICTED: polygalacturonase-like isoform X1 [Glycine max]
Length=392

 Score =   322 bits (824),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 175/398 (44%), Positives = 236/398 (59%), Gaps = 11/398 (3%)
 Frame = +1

Query  49    DMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA  228
             DMK + I A     LL +  +   +   ++ KFG    G AD ++A T AW  AC A  A
Sbjct  2     DMK-LNIPAINVLFLLLAISSTTQSVDINIKKFG----GGADITQALTKAWEEACAATSA  56

Query  229   NTIT-AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI  405
             + I    G +    +  +GPC  PI I      L A  DP A  G   W+    V   T+
Sbjct  57    SKIVIPGGSYKMEAVDLKGPCMAPIEIQFDGT-LQAPADPNALDGADEWLKVQHVNFFTL  115

Query  406   NG-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +G G+FDG GAT W   DCG N +      N  FN +    +  +T+++SK FH+ +   
Sbjct  116   SGKGVFDGQGATAWKQNDCGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGC  175

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
              + T + + V AP  S NTDG+HIG+++ V I+   I TGDDCVSLGDG + + V+ V C
Sbjct  176   NNFTFDGFHVSAPNTSINTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNC  235

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSA-TNMHFEDII  939
             GPGHG+++GSLGKYP E+PV  + VKNCTLTNT NG RIKTWP SP  S  T+MHFEDI 
Sbjct  236   GPGHGISVGSLGKYPEEEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDIT  295

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             M +V NP++IDQ+YCPWNQC     SK+K+S + FKNI+GTS +K  + + CS  VPC+ 
Sbjct  296   MVDVMNPVIIDQEYCPWNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCED  355

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             V +N++ L + G     V+KC NVKP + GK     C+
Sbjct  356   VELNNVALTFNG--APIVAKCANVKPIVTGKAPACTCT  391



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/394 (44%), Positives = 245/394 (62%), Gaps = 9/394 (2%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVM--KFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFM  258
             +LLAS      ++ FDV   ++GAK    +D + A   AW  +C +P A+ +   +G + 
Sbjct  14    LLLASATKAHESSVFDVTSAEYGAKP--GSDITFALAKAWNDSCASPSASKVVVPSGTYK  71

Query  259   AGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGA  435
                  F+GPCK PI +  Q   L A          G WV F  V  +T++GG  FDG GA
Sbjct  72    LSGASFRGPCKAPIELQVQG-TLQAPEKDSDLTMEGTWVGFQHVDMITVSGGGTFDGQGA  130

Query  436   TTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVD  615
               W+  +  K+ H C    NL+F+ VT   +  +T+ NSK FH+ +    +VT +   + 
Sbjct  131   FVWSQNNSSKSKH-CSGSVNLRFDFVTNSIIQDVTSLNSKNFHVHVYGCNNVTFQHVHIT  189

Query  616   APGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSL  795
             APG+S NTDG+HIG+++ ++I    I TGDDCVS+GDG   + V  V+CGPGHG++IGSL
Sbjct  190   APGDSKNTDGIHIGKSTGINITHTFIGTGDDCVSIGDGNNQIAVTNVSCGPGHGISIGSL  249

Query  796   GKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILID  972
             G+Y NE+ + G+ VKNCTLTNT NG RIKTWP SPV + A+++HFEDIIM NVSNPI+ID
Sbjct  250   GRYDNEESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDIHFEDIIMVNVSNPIVID  309

Query  973   QQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK  1152
             Q YCP+ +C     SKVK+S + FKNI+G+S++ +++KI CS   PC+ + + DI+L Y 
Sbjct  310   QLYCPYKKCDNLPPSKVKISDVSFKNIQGSSATALSLKIVCSSGSPCENMELADIDLTYS  369

Query  1153  GKDGSAVSKCTNVKPSIIGKVVPAACSVHK*KIP  1254
             G  G+  S+C NVKP+I G     AC+     +P
Sbjct  370   GAKGTLTSQCLNVKPTISGLTGALACATSSVMLP  403



>ref|XP_003527123.1| PREDICTED: polygalacturonase-like [Glycine max]
 gb|KHN05204.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 236/390 (61%), Gaps = 10/390 (3%)
 Frame = +1

Query  52    MKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-  228
             MK  +I   +F + L  F         D+ +FG K +  +D S+AF  AW  AC +  A 
Sbjct  1     MKFTII-TIFFSLFLVDFGFAQQGDL-DISRFGGKPN--SDISQAFLSAWTQACASTTAV  56

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTIN  408
               +  AG +  G +  +GPCK PI +      + A  +    KG   W+    V   T++
Sbjct  57    KIVIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPTNVVNLKGADQWLKVQHVNSFTLS  115

Query  409   G-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSK  585
             G G+FDG G T W   DC  N +   L  N  FN +    +  LT+++SK FH+ +    
Sbjct  116   GKGVFDGQGPTAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRDLTSKDSKNFHVNVLGCN  175

Query  586   DVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCG  765
             ++T + + + AP  SPNTDG+HIG+++ V ++   I TGDDC+SLGDG +++ V+ V CG
Sbjct  176   NMTFDGFKISAPAESPNTDGIHIGRSTDVKVLNTNIATGDDCISLGDGNKNITVQNVNCG  235

Query  766   PGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIM  942
             PGHG+++GSLG+Y NE+ V G+ VKNCTL NT NG RIKTWP +P+  + T+MHFEDI M
Sbjct  236   PGHGISVGSLGRYDNEEAVEGLLVKNCTLNNTDNGLRIKTWPSTPLTITVTDMHFEDITM  295

Query  943   NNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGV  1122
              NVSNP++IDQ+YCPWNQC     SK+K+S + FKNIKGTS +K  +   CS   PC+GV
Sbjct  296   ENVSNPVIIDQEYCPWNQCSKKNPSKIKISKVSFKNIKGTSGTKEGVIFICSSVAPCEGV  355

Query  1123  VMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
              M D++L + G   +  +KC NVKP I GK
Sbjct  356   EMTDVDLTFNG--AATTAKCANVKPVITGK  383



>gb|KHN24677.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   321 bits (823),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 171/388 (44%), Positives = 236/388 (61%), Gaps = 11/388 (3%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAF---FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGA-NT  234
             ++ A   IL + F+     A     D+ +FG K +   +  +AF  AW  AC +P A   
Sbjct  1     MKFAIITILFSLFLLDFGFAQQGDLDISRFGGKPN--TNIGQAFLSAWTQACASPTAVKI  58

Query  235   ITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-  411
             +  AG +  G +  +GPCK PI +      + A  +P   K    W     V   T++G 
Sbjct  59    VIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPANPTDLKAAHQWFVVQYVNSFTLSGK  117

Query  412   GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDV  591
             G+FDG GAT W   DC  N     L  N  FN +    +  +T+++SK FH+ +    + 
Sbjct  118   GVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNF  177

Query  592   TIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPG  771
             T + + V AP +SPNTDG+HIG+++ V I+   I TGDDCVSLGDG +++ V+ V CGPG
Sbjct  178   TFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPG  237

Query  772   HGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNN  948
             HG+++GSLGKY  E+PV G+ VKNCTL  T NG RIKTWP +P   + T+MHFED+ MNN
Sbjct  238   HGISVGSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNN  297

Query  949   VSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVM  1128
             V+NPI+IDQ+YCPWNQC     SK+K+S + FKNIKGTS +K  + + CS  VPC+ V M
Sbjct  298   VTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEM  357

Query  1129  NDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
              DI+L + G   +A +KC NVKP+I GK
Sbjct  358   ADIDLTFNGS--AATAKCANVKPTITGK  383



>gb|KHN15656.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   320 bits (819),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 163/347 (47%), Positives = 220/347 (63%), Gaps = 6/347 (2%)
 Frame = +1

Query  181   KAFTGAWGAACKAPGA-NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFK  357
             KAF  AW  AC +P A   +  AG +  G +  +GPCK PI +      + A  +P   K
Sbjct  1     KAFLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPANPTDLK  59

Query  358   GHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIG  534
                 W     V   T++G G+FDG GAT W   DC  N +   L  N  FN +    +  
Sbjct  60    AAHQWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKNCKMLCMNFGFNFLNNSIVRD  119

Query  535   LTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCV  714
             +T+++SK FH+ +    + T + + V AP +SPNTDG+HIG+++ V I+   I TGDDCV
Sbjct  120   ITSKDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCV  179

Query  715   SLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPG  894
             SLGDG +++ V+ V CGPGHG+++GSLGKY +E+PV G  VKNCTL  T NG RIKTWP 
Sbjct  180   SLGDGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPN  239

Query  895   SPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSS  1071
             +P   + T+MHFED+ MNNV+NPI+IDQ+YCPWNQC     SK+K+S + FKNIKGTS S
Sbjct  240   TPGAITITDMHFEDLTMNNVTNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGS  299

Query  1072  KMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
             +  + + CS  VPC+ V M DI+L + G   +A +KC NVKP+I GK
Sbjct  300   QEGVVLVCSSGVPCEAVEMADIDLTFNG--SAATAKCANVKPTITGK  344



>ref|NP_199625.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
 dbj|BAA96994.1| polygalacturonase [Arabidopsis thaliana]
 dbj|BAC43278.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAP81805.1| At5g48140 [Arabidopsis thaliana]
 gb|AED95623.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
Length=395

 Score =   321 bits (823),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 164/383 (43%), Positives = 238/383 (62%), Gaps = 16/383 (4%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGK---------ADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPI  270
             +AFF     G   + K         +D + A   A+  AC+ P  +T+    G++  G I
Sbjct  9     SAFFVFCLLGLSANAKIFNINSPPGSDITNALLKAFNEACQFPTKSTVMIPKGEYKLGEI  68

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWN  447
                GPCK PI I      L  +       G   WV F  + G  +NGG +FDG G   W 
Sbjct  69    VMMGPCKAPIRIAL----LGTVKADGNANGKEKWVAFRNINGFKLNGGGVFDGEGNAAWR  124

Query  448   LPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGN  627
             + +C K  +   LP +++F+ VT  ++ G+T+ ++K FH+ +  +K+VT E   + AP  
Sbjct  125   VNNCHKTFNCKKLPISIRFDFVTDAKIRGITSLDAKHFHINVIGAKNVTFEDVKIIAPAE  184

Query  628   SPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYP  807
             SPNTDG+H+G++  + II + I TGDDCVS+GDG++++ VE+VTCGPGHG++IGSLG+Y 
Sbjct  185   SPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYS  244

Query  808   NEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYC  984
             +E+ V G+ + NCTL  T NG RIKTWP +    +A+++HFE+I++ NVSNPILIDQ+YC
Sbjct  245   HEENVSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPILIDQEYC  304

Query  985   PWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDG  1164
             PWNQC     S +KL+ I FK I+GTS +K A+K+ CS   PCQ V + D+N+ Y G DG
Sbjct  305   PWNQCNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGYPCQNVEVGDVNIQYTGADG  364

Query  1165  SAVSKCTNVKPSIIGKVVPAACS  1233
              A  +C+NV P ++G  +P ACS
Sbjct  365   PATFQCSNVSPKLVGTQIPKACS  387



>ref|NP_187439.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21192.1|AC013483_16 polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAL38715.1| putative polygalacturonase(PGA3 [Arabidopsis thaliana]
 gb|AAM20184.1| putative polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAM65120.1| polygalacturonase PGA3 [Arabidopsis thaliana]
 gb|AEE74608.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 231/358 (65%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+ +AC++   +  +   G+F  G I  +GPCK PI +  Q        D 
Sbjct  33    SDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMRGPCKAPIEVTLQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
              A +G   WV F  + G  +NGG  FDG G   W + +C K      LP +++F+ +   
Sbjct  90    NAIQGKEKWVVFGNIDGFKLNGGGAFDGEGNAAWRVNNCHKTFECKKLPISIRFDFILNS  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T+    + AP +SPNTDG+H+G++  V I+ + I TG
Sbjct  150   EIRDISSIDAKNFHINVLGAKNMTMNNIKIVAPEDSPNTDGIHLGRSDGVKILNSFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y +E+ V G+ V NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQDVSGIKVINCTLQETDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HFEDII+ +VSNPILIDQ+YCPWNQC    AS +KL  I FKNI+G
Sbjct  270   TWPSAACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQCNKQKASTIKLVNISFKNIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ CS   PCQ V + DI++ Y G DG A   C+NV P I+G   P ACS
Sbjct  330   TSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATFHCSNVSPKILGSQSPKACS  387



>ref|XP_008798766.1| PREDICTED: exopolygalacturonase-like [Phoenix dactylifera]
Length=426

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 230/371 (62%), Gaps = 5/371 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
             F+VM FGA  DGK+D S AF  AW AAC   G   I    G+++  PI F+GPC G + +
Sbjct  53    FNVMNFGAAADGKSDSSAAFLKAWEAACPLEGRKRIYIPGGEYLVNPIKFEGPCNGIMEV  112

Query  307   DAQKMNLLALPDPFAF--KGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHI  477
                 + + A PD   F  +GH  W+TF  V  + I G G FDG G+  W    C K    
Sbjct  113   QLSGV-VKAQPDINVFNREGHKEWITFDHVDRLLITGSGTFDGQGSYAWQHNTCSKKKDC  171

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP NL+ N VT   + G++  NSK F + I  S +V I+   + AP ++PNTDG+HIG
Sbjct  172   SLLPGNLRLNFVTKTTVRGISLVNSKSFQMTIFGSNNVRIQHIKIVAPRDAPNTDGIHIG  231

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
              ++ V I  + I TGDDCVS+G G + + V  V CGPGHG++IGSLG+Y NE  V GVTV
Sbjct  232   NSTNVRITDSEIGTGDDCVSVGPGSRRILVSGVFCGPGHGISIGSLGRYLNEPDVSGVTV  291

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             KNCTLT T NG R+KTW  S    A++ HFEDI+M  V NPI++DQ+YCP   C  G  S
Sbjct  292   KNCTLTGTTNGLRVKTWQKSNRSRASDFHFEDIVMRGVQNPIIVDQEYCPVGNCVKGAPS  351

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKP  1197
              V++S + F+NI+GTS+S+MA+ + CS AV C+ +V+ DI+L +   +  ++++C  V+ 
Sbjct  352   LVEISNVTFRNIRGTSASRMAVHLFCSKAVSCKNLVLQDIDLKFMDPNSPSLAQCYYVQG  411

Query  1198  SIIGKVVPAAC  1230
             + +G + P AC
Sbjct  412   TALGYMNPPAC  422



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/399 (46%), Positives = 246/399 (62%), Gaps = 15/399 (4%)
 Frame = +1

Query  58    SILIQAAWFCILLASFVTGLHA-AFFDVMKFGAKGDGKADDSKAFTGAWGAACKA--PGA  228
             ++LI      +L  +  +  H    F + K+G    G  D ++A   AW  AC +  P A
Sbjct  8     NLLITTFLMSLLSFTIESQSHVDVIFPLRKYGNIVSGD-DVTEALKDAWNDACASVRPSA  66

Query  229   NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHG-GWVTFSQVIGVTI  405
               +   G F      F+GPCK PI I  +   L A   P     HG  W+TF+ V  +TI
Sbjct  67    -VVIPDGIFKLREGEFKGPCKSPIEIRVRG-TLQAPKHP-----HGDSWITFAYVDRMTI  119

Query  406   NG-GIFDGNGATTWNLPDCGKNGHICPLP-ANLQFNAVTGLRLIGLTNRNSKQFHLRIGS  579
             +G G+FDG G   W   DC K      LP   L+F+ +T   + G+T+ +SK FH+ I  
Sbjct  120   SGKGVFDGQGKAGWEKNDCHKRIDCVNLPIVILRFDFITNSIVRGITSLDSKNFHVNILG  179

Query  580   SKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVT  759
               ++T +   + AP +SPNTDG+HIG++  +SI+ + I TGDDC+SLGDG + V +  VT
Sbjct  180   CNNLTFQGVNIIAPEDSPNTDGIHIGRSIGISILKSRIATGDDCISLGDGSKRVKITNVT  239

Query  760   CGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPV-GSATNMHFEDI  936
             CGPGHG++IGSLGKY NE+PV  V VKNCT+ NT NG RIKTWP SPV G ATNMHF DI
Sbjct  240   CGPGHGISIGSLGKYTNEEPVDDVVVKNCTIMNTTNGVRIKTWPSSPVAGIATNMHFSDI  299

Query  937   IMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQ  1116
              M NVSNPILIDQ+YCPWNQC   + S +K++ + FKNIKG+S++ +A+K+ CS   PC+
Sbjct  300   TMINVSNPILIDQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNQPCE  359

Query  1117  GVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
              V + +I+L+Y G +G   S+C NVKP I G   P+ CS
Sbjct  360   EVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSICS  398



>emb|CAA05892.1| polygalacturonase [Arabidopsis thaliana]
 emb|CAA06610.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/358 (44%), Positives = 231/358 (65%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+ +AC++   +  +   G+F  G I  +GPCK PI +  Q        D 
Sbjct  33    SDITQALLKAFTSACQSSSPSKVVIPKGEFKLGEIEMRGPCKAPIEVTLQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
              A +G   WV F  + G  +NGG  FDG G   W + +C K      LP +++F+ +   
Sbjct  90    NAIQGKEKWVVFGNIDGFKLNGGGAFDGEGNAAWRVNNCHKTFECKKLPISIRFDFILNS  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T+    + AP +SPNTDG+H+G++  + I+ + I TG
Sbjct  150   EIRDISSIDAKNFHINVLGAKNMTMNNIKIVAPEDSPNTDGIHLGRSDGIKILNSFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y +E+ V G+ V NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQDVSGIKVINCTLQETDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HFEDII+ +VSNPILIDQ+YCPWNQC    AS +KL  I FKNI+G
Sbjct  270   TWPSAACSTTASDIHFEDIILKDVSNPILIDQEYCPWNQCNKQKASTIKLVNISFKNIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ CS   PCQ V + DI++ Y G DG A   C+NV P I+G   P ACS
Sbjct  330   TSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATFHCSNVSPKILGSQSPKACS  387



>gb|EMT33862.1| putative Exopolygalacturonase [Aegilops tauschii]
Length=404

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/402 (43%), Positives = 248/402 (62%), Gaps = 20/402 (5%)
 Frame = +1

Query  61    ILIQAAWFCILLASFVTGLHAA--FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANT  234
              +I A W C+ +A      HA    FDVM FGA  DG+ DDSKAF  AW  AC +PG   
Sbjct  10    FMISARW-CLEVA------HAGRQVFDVMDFGAIADGETDDSKAFIRAWMKACASPGRPA  62

Query  235   ITA-AGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING  411
             +    G++   P+ F+GPCKG + +     +L A  D  AF+G   W+ F+ + G+ + G
Sbjct  63    VVVPKGEYRLQPVVFRGPCKGYMQVRLAG-DLRAPDDLAAFRGSHEWINFASIDGLLVTG  121

Query  412   G-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKD  588
             G  FDG GA++W+L  C  N +  PLP +++   V  + + G+T+ +SK FH+ I  S++
Sbjct  122   GGTFDGRGASSWHLNQCPTNPNCKPLPVSIKLGRVRNVTITGVTSLDSKFFHVIIIGSQN  181

Query  589   VTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGP  768
             V+I R T+ AP +SPNTDGVHI  +S V I    I TGDDC+S+G G  D+ V  V CGP
Sbjct  182   VSIHRVTIRAPRDSPNTDGVHIQGSSNVRITDTAIATGDDCISVGPGSADITVSGVNCGP  241

Query  769   GHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPG--SPVGSATNMHFEDIIM  942
             GHG+++GSLG++P E+ V G+ V NCTL  T NG RIKTW G   P    + + FEDI+M
Sbjct  242   GHGISVGSLGRHPGEEDVRGLRVSNCTLAGTANGVRIKTWRGGLRPGSVVSGLVFEDIVM  301

Query  943   NNVSNPILIDQQYCPW--NQCKAGLASK---VKLSGIGFKNIKGTSSSKMAMKIDCSPAV  1107
               V NPI+IDQ+YCP+  + C+   A +   VK+S + FKNI+G S++++A+K+ CS A 
Sbjct  302   RKVRNPIIIDQEYCPYSSSSCRHESAQRPSVVKISDVKFKNIRGVSATQVAVKLSCSGAS  361

Query  1108  PCQGVVMNDINLIYKGKDGSAVSKCTNVKPSII-GKVVPAAC  1230
             PC G+ + DI+L Y  +  +  S+C NV   +  G +VP +C
Sbjct  362   PCHGLELRDIDLTYVKRGVATESRCENVAGGMAGGMLVPPSC  403



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 231/361 (64%), Gaps = 7/361 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAAGKFMAGPIWFQGPCKGPITID  309
             FD+ K+  K D     S AF     A   A  +  +  AG++  GP+  +GPCK  + + 
Sbjct  27    FDIKKYNPKADIAEALSAAFQK--DACASATPSKVVVPAGEYTMGPVDMKGPCKSTVEVQ  84

Query  310   AQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICPL  486
                 NL A  +P   KG  GWV+F  + G+T +G G+FDG G   W   +C KN +    
Sbjct  85    VDG-NLKAPAEP---KGEPGWVSFEYIDGLTFSGKGVFDGQGHIAWANNNCNKNPNCKSF  140

Query  487   PANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTS  666
             P N +F ++    +  LT+++SK FH+ + + ++VT + + +DAP  S NTDG+H+G++ 
Sbjct  141   PLNFRFTSLKHALIKDLTSKDSKNFHVNVINCENVTFQNFVIDAPAESLNTDGIHMGRSK  200

Query  667   KVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNC  846
              + II + I TGDDC+S+GDG + V V  VTCGPGHG++IGSLG+Y NE+PV GV VKNC
Sbjct  201   GIKIIDSKIGTGDDCISIGDGTEQVTVTGVTCGPGHGISIGSLGRYDNEQPVRGVLVKNC  260

Query  847   TLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVK  1026
              L NT NG RIK+WP    G A+++HFEDI M NV+NP++IDQ+YCPWNQC     SKVK
Sbjct  261   ILKNTDNGVRIKSWPAMKGGEASDIHFEDITMENVTNPVIIDQEYCPWNQCTKDAPSKVK  320

Query  1027  LSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSII  1206
             +S + FKNIKGT+++  A+KI CS A+PC+ V +N I+L Y G  G A S+C N K ++ 
Sbjct  321   ISNVSFKNIKGTTNTPEAVKIICSSALPCEQVQLNGIDLKYTGTQGPAKSECKNAKLTVT  380

Query  1207  G  1209
             G
Sbjct  381   G  381



>gb|KHN10402.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/347 (47%), Positives = 218/347 (63%), Gaps = 6/347 (2%)
 Frame = +1

Query  181   KAFTGAWGAACKAPGA-NTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFK  357
             KAF  AW  AC +P A   +  AG +  G +  +GPCK PI +      + A  +P   K
Sbjct  1     KAFLSAWTQACASPTAVKIVIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPANPTDLK  59

Query  358   GHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIG  534
                 W     V   T++G G+FDG GAT W   DC  N     L  N  FN +    +  
Sbjct  60    AAHQWFVVQYVNSFTLSGKGVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRD  119

Query  535   LTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCV  714
             +T+++SK FH+ +    + T + + V AP +SPNTDG+HIG+++ V I+   I TGDDCV
Sbjct  120   ITSKDSKNFHVNVLGCNNFTFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCV  179

Query  715   SLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPG  894
             SLGDG +++ V+ V CGPGHG+++GSLGKY +E+PV G  VKNCTL  T NG RIKTWP 
Sbjct  180   SLGDGCKNITVQNVNCGPGHGISVGSLGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPN  239

Query  895   SPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSS  1071
             +P   + T+MHFED+ MNNV NPI+IDQ+YCPWNQC     SK+K+S + FKNIKGTS S
Sbjct  240   TPGAITITDMHFEDLTMNNVMNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGS  299

Query  1072  KMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
             +  + + CS  VPC+ V M DI+L + G   +A +KC NVKP+I GK
Sbjct  300   QEGVVLVCSSGVPCEAVEMADIDLTFNG--SAATAKCANVKPTITGK  344



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   340 bits (873),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/354 (46%), Positives = 237/354 (67%), Gaps = 4/354 (1%)
 Frame = +1

Query  178   SKAFTGAWGAACKAP-GANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF  354
             +KA   AW AAC +P  +  +  AG +  G +  +GPCK PI +   K  + A  D   F
Sbjct  906   AKALLTAWEAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIV-KGTVRAPVDTSRF  964

Query  355   KGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLI  531
             K   GWV F  +   T++G G+FDG G + W    C +  +   LP NL+FN +T   + 
Sbjct  965   KPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWG-QKCSRTKYCHQLPINLRFNFLTNSIIK  1023

Query  532   GLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDC  711
              +T+++SKQFH+ +   +++T  +  + AP +S NTDG+HIG++  V+I  +TI+TGDDC
Sbjct  1024  DITSKDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQTGDDC  1083

Query  712   VSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWP  891
             VS+GDG + + + KV CGPGHG+++GSLG Y NE PV+G+ VKNCTL++T NG R+KT+P
Sbjct  1084  VSIGDGSEQIDITKVNCGPGHGISVGSLGLYKNEAPVIGIRVKNCTLSDTTNGVRVKTYP  1143

Query  892   GSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSS  1071
              SP G+AT MHF DI+MNNVSNPI+IDQ+YCP NQC   + S+VKLS I FKNI+GT+S+
Sbjct  1144  SSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPHNQCNLQVPSRVKLSNISFKNIRGTTST  1203

Query  1072  KMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             ++A+ + CS   PCQ V + +I+L Y G +G+A S+C NV+ ++ G   P  C+
Sbjct  1204  ELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPKTCA  1257


 Score =   235 bits (600),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 169/278 (61%), Gaps = 39/278 (14%)
 Frame = +1

Query  178   SKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAF  354
             S+AF  AW  AC     +  +   G ++ GP+ FQGPC+ P+    Q   L A  D   F
Sbjct  666   SRAFMSAWKVACTCTDPSTVVVXGGTYVVGPVQFQGPCRAPMGFRVQG-TLKAPTDLNRF  724

Query  355   KGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLI  531
             +   GWV F  +  + I+GG  F+G G T W   +C + G       NL    VT     
Sbjct  725   ELQDGWVIFQDIDXLIISGGGTFBGQGHTAWGQNNCARTG-----TCNLLLVYVT-----  774

Query  532   GLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDC  711
                                       ++A G+S NTDG+H+G+++ V+I  A IKTGDD 
Sbjct  775   --------------------------INATGDSLNTDGIHMGRSTGVNISDAIIKTGDDS  808

Query  712   VSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWP  891
             +S+GDG Q ++VEKVTCGPGHG+++GSLGKY NE+PV+GVTVKNCTL NT+NG R+KTWP
Sbjct  809   LSIGDGSQHINVEKVTCGPGHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWP  868

Query  892   GSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKA  1005
              SP   AT++HFEDIIMNNV NPILI+Q+YCP++QC+A
Sbjct  869   DSPASVATDLHFEDIIMNNVGNPILINQEYCPYDQCQA  906



>ref|XP_002865611.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41870.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/383 (43%), Positives = 239/383 (62%), Gaps = 16/383 (4%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGK---------ADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPI  270
             +AFF     G   + K         +D + A   A+  AC+ P  +T+    G++  G I
Sbjct  9     SAFFVFCLLGLSANAKVFNIGSPPGSDITNALLKAFNEACQFPTKSTVLIPKGEYKLGEI  68

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWN  447
                GPCK PI I  Q        D  A  G   WV F  + G  +NGG +FDG G   W 
Sbjct  69    VMMGPCKAPIRIALQGT---VKADGNA-NGKEKWVAFRNIDGFKLNGGGVFDGEGNAAWR  124

Query  448   LPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGN  627
             + +C K  +   LP +++F+ VT  ++ G+T+ ++K FH+ +  +K++T E   + AP  
Sbjct  125   VNNCHKTFNCKKLPISIRFDFVTNAKIRGITSLDAKNFHINVIGAKNMTFEDVKIIAPAE  184

Query  628   SPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYP  807
             SPNTDG+H+G++  + II + I TGDDCVS+GDG++++ VE+VTCGPGHG++IGSLG+Y 
Sbjct  185   SPNTDGIHVGRSDGIKIINSFISTGDDCVSVGDGMKNLLVERVTCGPGHGISIGSLGRYS  244

Query  808   NEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYC  984
             +E+ V G+ + NCTL  T NG RIKTWP +    +A+++HFE+I++ NVSNPILIDQ+YC
Sbjct  245   HEENVSGIKIINCTLQETDNGLRIKTWPSAACTTTASDIHFENILLKNVSNPILIDQEYC  304

Query  985   PWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDG  1164
             PWNQC     S +KL+ I FK I+GTS +K A+K+ CS   PCQ V + DIN+ Y G DG
Sbjct  305   PWNQCNKQKPSTIKLANISFKKIRGTSGNKDAVKLLCSKGHPCQNVEVGDINIKYTGADG  364

Query  1165  SAVSKCTNVKPSIIGKVVPAACS  1233
              A  +C+NV P ++G  +P ACS
Sbjct  365   PATFQCSNVSPKLVGTQIPKACS  387



>ref|XP_006299274.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
 gb|EOA32172.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
Length=396

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/396 (41%), Positives = 243/396 (61%), Gaps = 7/396 (2%)
 Frame = +1

Query  76    AWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGK  252
             A+F + +  F+  L     +   F  +    +D ++A   A+ +AC++P  +  +   G+
Sbjct  3     AYFGVSII-FIICLSGFSANAEVFTIRSSSGSDITQALLKAFTSACQSPSPSKVVIPKGE  61

Query  253   FMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
             F    I  +GPCK PI I  Q        D  A +G   WV F  + G  +NGG  FDG 
Sbjct  62    FKLREIEMRGPCKAPIEITIQGT---VKADGNAIQGKDKWVVFGNINGFKLNGGGAFDGE  118

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             G  +W + +C K      LP +++F+ V    +  +++ +SK FH+ +  +K++T++   
Sbjct  119   GNASWRVNNCHKTFQCKKLPISIRFDFVLNSEIRDISSIDSKNFHINVLGAKNMTMDNIK  178

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             + AP  SPNTDG+H+G++  V I+ + I TGDDC+S+GDG++++HVEKVTCGPGHG+++G
Sbjct  179   IIAPEESPNTDGIHLGRSDGVKILNSFISTGDDCISVGDGMKNLHVEKVTCGPGHGISVG  238

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPIL  966
             SLG+Y +E+ V G+ + NCTL  T NG RIKTWP +    +A ++HFEDII+ NVSNPIL
Sbjct  239   SLGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTAFDIHFEDIIVKNVSNPIL  298

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQ+YCPWNQC     S +KL    FKNI+GTS +K A+K+ CS   PCQ V + D+++ 
Sbjct  299   IDQEYCPWNQCNKQKPSTIKLVNTSFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDVDIK  358

Query  1147  YKGKDGSAVSKCTNVKPSIIGKVVPAACSVHK*KIP  1254
             Y G DG A  +C+NV P ++G   P ACS    K P
Sbjct  359   YNGADGPATFQCSNVSPKLLGTQNPKACSAPMTKAP  394



>gb|KHN46909.1| Polygalacturonase [Glycine soja]
Length=390

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 230/385 (60%), Gaps = 10/385 (3%)
 Frame = +1

Query  88    ILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-AAGKFMAG  264
              LL +  +   +   ++ KFG    G AD ++A T AW  AC A  A+ I    G +   
Sbjct  12    FLLLAISSTTQSVDINIKKFG----GGADITQALTKAWEEACAATSASKIVIPGGSYKME  67

Query  265   PIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATT  441
              +  +GPC  PI I      L A  DP A  G   W+    V   T++G G+FDG GAT 
Sbjct  68    AVDLKGPCMAPIEIQFDGT-LQAPADPNALDGADEWLKVQHVNFFTLSGKGVFDGQGATA  126

Query  442   WNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAP  621
             W   DCG N +      N  FN +    +  +T+++SK FH+ +    + T + + V AP
Sbjct  127   WKQNDCGTNKNCKKRSKNFGFNFLNNSMVRDITSKDSKNFHVNVLGCNNFTFDGFHVSAP  186

Query  622   GNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGK  801
               S NTDG+HIG+++ V I+   I TGDDCVSLGDG + + V+ V CGPGHG+++GSLGK
Sbjct  187   NTSINTDGIHIGRSTDVKILNTNIATGDDCVSLGDGSKKITVQNVNCGPGHGISVGSLGK  246

Query  802   YPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVGSA-TNMHFEDIIMNNVSNPILIDQQ  978
             YP E+PV  + VKNCTLTNT NG RIKTWP SP  S  T+MHFEDI M +V NP++IDQ+
Sbjct  247   YPEEEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVIIDQE  306

Query  979   YCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGK  1158
             YCPWNQC     SK+K+S + FKNI+GTS +K  + + CS  VPC+ V +N++ L + G 
Sbjct  307   YCPWNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNG-  365

Query  1159  DGSAVSKCTNVKPSIIGKVVPAACS  1233
                 V+KC NVKP + GK     C+
Sbjct  366   -APIVAKCANVKPIVTGKAPACTCT  389



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/391 (44%), Positives = 236/391 (60%), Gaps = 9/391 (2%)
 Frame = +1

Query  49    DMKSILIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-  225
             D++  +I  A F +L++S  T      FD+ K+GA  +G  D ++A T AW  AC +   
Sbjct  2     DLQLKMITNALFLLLVSSSATA-QFGVFDISKYGAVPNG--DITEALTNAWSDACASTTP  58

Query  226   ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTI  405
             +  + A G +    I F+GPC  PI +      + A  DP    G   W+ F+ +  +T+
Sbjct  59    SKVVIARGIYNLKQIEFKGPCMAPIEVQVDGT-IKAPQDPNQLNGDAQWIKFTYINFLTL  117

Query  406   NG-GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSS  582
             +G G FDG GA  W   +C KN     L  N  F  +    +  +T+++SK FH+ +   
Sbjct  118   SGAGTFDGQGANAWTQNNCAKNKSCKKLSMNFGFGFLNNTIVRDITSKDSKYFHVNVLGC  177

Query  583   KDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTC  762
              ++T   + + AP  SPNTDG+HIG+++ V+I    I TGDDC+SLGDG + + V  VTC
Sbjct  178   NNITFTNFNIVAPATSPNTDGIHIGRSTLVNIDNTNIATGDDCISLGDGSKQITVLNVTC  237

Query  763   GPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDII  939
             GPGHG+++GSLGKYPNEKPV    V NC L NT NG RIKTWP +P   + T MHFEDI 
Sbjct  238   GPGHGISVGSLGKYPNEKPVEDFFVSNCILNNTDNGVRIKTWPDTPATITVTGMHFEDIK  297

Query  940   MNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQG  1119
             M NV NPI+IDQ+YCPWNQC     SK+K+S + FKNI GTS +K  + + CS  VPC+ 
Sbjct  298   MINVKNPIIIDQEYCPWNQCTKQNPSKIKISNVSFKNIIGTSGTKEGVVLICSSGVPCED  357

Query  1120  VVMNDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
             V++ DI+L + G   SA +K +NVKP I GK
Sbjct  358   VMLTDIDLTFNGT--SAAAKLSNVKPIIQGK  386



>ref|XP_010266273.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=428

 Score =   321 bits (822),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 172/374 (46%), Positives = 237/374 (63%), Gaps = 7/374 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKG--PI  300
             F+V+ +GAKGDGK DDS+AF  AW AAC A G  T+      ++ GP+ F GPC     I
Sbjct  57    FNVISYGAKGDGKHDDSQAFAEAWKAACGASGTVTLEIPKATYLVGPVKFSGPCTNVKSI  116

Query  301   TIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHI  477
             T+D  K  L A  D   +     W+ F  V G+T+ G G FDG GA +W+   C    + 
Sbjct  117   TVD-MKGYLKATTDLKMYGKTDDWIEFGWVDGLTLTGDGTFDGQGAESWSFNKCPVTKNC  175

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F A+T   + G+T+ NSK FH+ +   K+       + AP NSPNTDG+HI 
Sbjct  176   QVLPTNVKFVAMTNTVVRGITSLNSKFFHMGLIDCKNFVGSEIRISAPENSPNTDGIHIE  235

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             + + V I  ++I TGDDC+S+G G   V +  VTCGPGHG++IGSLG+Y NE  V GVTV
Sbjct  236   RCTGVEIYHSSIGTGDDCISIGHGNSQVTISGVTCGPGHGISIGSLGRYQNEGDVTGVTV  295

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             ++CT++ T NG RIKTW  SP  + A+NM F+DI++NNV+NPI+IDQ YCP+  C +   
Sbjct  296   RDCTISGTTNGVRIKTWENSPSSTVASNMTFQDIVVNNVANPIIIDQTYCPYVSCSSTAP  355

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S+VKL  + FKNI+GTSSS +A+ ++CS  VPCQ V ++D++ I     G+A S C N+K
Sbjct  356   SRVKLQDLHFKNIRGTSSSPVAVMLECSKGVPCQNVNLHDVH-IELMTGGTAKSSCQNIK  414

Query  1195  PSIIGKVVPAACSV  1236
              +  G  +PA C V
Sbjct  415   ATYSGTQIPAPCPV  428



>ref|XP_010026119.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW58402.1| hypothetical protein EUGRSUZ_H01088 [Eucalyptus grandis]
Length=420

 Score =   320 bits (821),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 233/376 (62%), Gaps = 11/376 (3%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKG-  294
             AA FDV ++GAK DGK D+S AF  AW AAC   G A  +   G F++GP+ FQGPC+G 
Sbjct  49    AAVFDVTQYGAKADGKTDNSMAFVKAWNAACHNSGPAKLVIPTGTFLSGPVVFQGPCEGS  108

Query  295   -PITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGGIFDGNGATTWNLPDCGKNG  471
              PIT++     ++A  D   +    GW +F  + G+ + GGIFDG G T W   DC  N 
Sbjct  109   NPITVEVNGT-IIASTDISEYS-EDGWFSFELIDGLVLKGGIFDGQGQTAWPYNDCKHNK  166

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
                 LP +L+FN V    + G+T+ NSK FH  I  S++ T     + AP  SPNTDG+H
Sbjct  167   DCQHLPVSLKFNKVNNTVVDGVTSLNSKGFHFSITFSENFTGVNLNISAPDESPNTDGIH  226

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             +  + +++I  + I TGDDC+ +  G  +V V ++TCGPGHG++IGSLGKYPNEK V+GV
Sbjct  227   LSSSDRINISSSVIATGDDCLGIIQGATNVSVNEITCGPGHGISIGSLGKYPNEKDVIGV  286

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
              V+N TLTNT NG RIK +PG     A+++ FEDI++N V NPI+IDQ Y      K   
Sbjct  287   HVRNATLTNTTNGVRIKAFPGDRQLLASDIIFEDIVLNYVKNPIIIDQHYGSRKVTK---  343

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGK---DGSAVSKC  1182
              S VKLS + FKNI+GT+ S++A+ + CS + PC+ V ++DI+L + G      +  S C
Sbjct  344   PSSVKLSDVHFKNIRGTTVSEVAVLLQCSSSNPCEQVELSDIDLSFAGAASGSKNVTSLC  403

Query  1183  TNVKPSIIGKVVPAAC  1230
              N KP+ IG   P AC
Sbjct  404   ENTKPTFIGTQNPPAC  419



>ref|XP_006279754.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
 gb|EOA12652.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
Length=395

 Score =   319 bits (818),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/387 (42%), Positives = 237/387 (61%), Gaps = 24/387 (6%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGK---------ADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPI  270
             +AFF     G   + K         +D +KA    +  AC+ P  +T+    G++  G I
Sbjct  9     SAFFVFCLLGLSANAKVFNIGSPPGSDITKALLKTFNEACQFPTKSTVLIPKGEYKLGEI  68

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHG----GWVTFSQVIGVTINGG-IFDGNGA  435
                GPCK PI I        AL       G+      WV F  + G  +NGG +FDG G 
Sbjct  69    EMLGPCKAPIRI--------ALQGTLKADGNAVHNQKWVAFRNINGFKLNGGGVFDGEGN  120

Query  436   TTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVD  615
               W + +C K      LP +++F+ +T  ++ G+T+ ++K FH+ +  +K++T E   + 
Sbjct  121   AAWRVNNCHKTEQCKKLPISIRFDYITDGKVRGITSLDAKNFHINVIGAKNLTFEEVRII  180

Query  616   APGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSL  795
             AP  SPNTDG+H+G++  + II + I TGDDCVS+GDG++++ VE+VTCGPGHG+++GSL
Sbjct  181   APAESPNTDGIHVGRSDGIKIINSVITTGDDCVSVGDGMKNLLVERVTCGPGHGISVGSL  240

Query  796   GKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILID  972
             G+Y +E+ V G+ + NCTL  T NG RIKTWP +    SA+++HFE+I++ NV+NPILID
Sbjct  241   GRYGHEQDVKGIKIINCTLQETDNGIRIKTWPSAACSTSASDIHFENIVLKNVTNPILID  300

Query  973   QQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK  1152
             Q+YCPWN C     S +KLS I FKNI+GTS +K A+K+ CS   PCQ V + +I++ Y 
Sbjct  301   QEYCPWNHCNKAKPSTIKLSNISFKNIRGTSGNKDAVKLLCSKGFPCQNVELGNIDIKYT  360

Query  1153  GKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             G DG A  +C NV P I+G  VP ACS
Sbjct  361   GADGPATFQCANVSPKIMGTQVPKACS  387



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   319 bits (818),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 228/366 (62%), Gaps = 7/366 (2%)
 Frame = +1

Query  145   FGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKM  321
             F   G   +D ++A   A+ +AC+AP  +  +   G++  G I   GPCK P+ I  Q  
Sbjct  25    FRVPGAPGSDITQALLKAFTSACQAPAPSQVLIPKGEYKLGEIAMTGPCKSPVEITLQG-  83

Query  322   NLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANL  498
                 +      +G   WV F ++ G  +NGG IFDG G   W   +C K      LP +L
Sbjct  84    ---TVKADGNMQGKERWVVFEKINGFKLNGGGIFDGEGNAAWRTNNCHKTFECKKLPISL  140

Query  499   QFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSI  678
             +F+ V    +  +T+ +SK FH+ + S K++T +   + AP  SPNTDG+H+G+   V I
Sbjct  141   RFDFVDNADIRDITSMDSKNFHINVISGKNMTFDNIKISAPAESPNTDGIHLGRCDGVKI  200

Query  679   IGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTN  858
             + + I TGDDC+S+GDG++++ VEKV CGPGHG+++GSLG+Y  E+ V GV V NCTL  
Sbjct  201   LNSKIATGDDCISVGDGMKNLLVEKVVCGPGHGISVGSLGRYGFEEDVAGVRVVNCTLVG  260

Query  859   TLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSG  1035
             T NG RIKTWP +    +A+ +HFEDII+ NVSNPILIDQ+YCPWNQC     S +KL  
Sbjct  261   TDNGLRIKTWPSAKCTTTASGIHFEDIILQNVSNPILIDQEYCPWNQCNKQKPSTIKLVD  320

Query  1036  IGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKV  1215
             I F+ I+GTS +K A+K+ CS  +PC+ V + DIN+ YKG DG    +C+NV P ++G  
Sbjct  321   ISFRKIRGTSGNKDAVKLLCSKGIPCENVEIGDINIEYKGADGPPTFQCSNVNPKLVGTQ  380

Query  1216  VPAACS  1233
             VP ACS
Sbjct  381   VPKACS  386



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score =   319 bits (818),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 230/365 (63%), Gaps = 7/365 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAP-GANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D + A    +  AC+ P  A  +   G++  G I   GPCK PI I  Q      +   
Sbjct  33    SDITSALLKTFNEACQFPTKATVMIPKGEYKLGEIEMVGPCKAPIRIALQG----TVKAD  88

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
                KG   WV F ++ G  +NGG +FDG G   W + +C K      LP +++F+ VT  
Sbjct  89    GNIKGKDFWVAFKKINGFKLNGGGVFDGEGNAAWRVNNCHKTFECKKLPISVRFDFVTDA  148

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
             ++ G+T+ +SK FH+ +  +K++T E   + AP  SPNTDG+H+G++  + II + I TG
Sbjct  149   KIRGITSLDSKNFHINVIGAKNMTFEDIKIVAPAGSPNTDGIHVGRSDGIKIINSFISTG  208

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++ VE+VTCGPGHG+++GSLG+Y +E+ V G+ V NCTL NT NG RIK
Sbjct  209   DDCISVGDGMRNLLVERVTCGPGHGISVGSLGRYGHEEDVTGIRVVNCTLQNTDNGVRIK  268

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+ +HFE+I++ NVSNPILIDQ+YCPWNQC     S +KL  I FK I+G
Sbjct  269   TWPSAKCATTASEIHFENILLKNVSNPILIDQEYCPWNQCNKQKPSTIKLVNISFKKIRG  328

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACSVH  1239
             TS +K A+K+ CS   PC+ V + DIN+ Y G DG A   C+NV P + G  VP ACS  
Sbjct  329   TSGNKDAVKLLCSKGYPCKNVEIGDINIKYTGADGPATFSCSNVSPKLKGTQVPKACSSP  388

Query  1240  K*KIP  1254
               K+P
Sbjct  389   VPKLP  393



>ref|XP_006845467.1| hypothetical protein AMTR_s00019p00130680 [Amborella trichopoda]
 gb|ERN07142.1| hypothetical protein AMTR_s00019p00130680 [Amborella trichopoda]
Length=383

 Score =   318 bits (816),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 232/369 (63%), Gaps = 2/369 (1%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             F+VM+FGA  DG  D+++AF  AW AAC+  G ++ +   G F+ GP+ F+GPC     +
Sbjct  14    FNVMQFGAIADGTKDNTEAFGAAWKAACEWKGPSSLVIPEGTFLVGPVLFKGPCPNASPV  73

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
               Q    +      +      W+ F  V G+ + GG  FDG GA+ W+L  C K  H   
Sbjct  74    VVQVKGKVKASTDMSKYPSDDWIVFQYVDGLLLTGGGTFDGQGASAWSLNQCPKKAHCKL  133

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP +L+F+ +T   + G+ + +SK FH+ +   K++ ++   + AP +SPNTDG+HIG +
Sbjct  134   LPTSLKFSFITNGAIRGINSVDSKLFHMLLFGCKNMEVQSIKISAPADSPNTDGIHIGSS  193

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             S ++I  + I TGDDC+SLG G   V V+ V CGPGHG+++GSLGK PNE  V G+ VKN
Sbjct  194   SNITISRSQIGTGDDCISLGPGSTQVTVDNVFCGPGHGISVGSLGKRPNEGDVEGLHVKN  253

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT+++T NG RIKTW  S   SA+N  +EDI+MNNV+NPI+IDQ+YCP+  C     S+V
Sbjct  254   CTISDTTNGLRIKTWEDSDSSSASNFTYEDIVMNNVANPIIIDQEYCPYASCSHKGPSRV  313

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSI  1203
             K++ I FKNI+GTS+SK+A+ + CS A PC+ V ++DI L Y  +   + + CTNV    
Sbjct  314   KINNISFKNIRGTSTSKVAVNLLCSRAFPCENVKLDDIKLKYNDQGEDSTASCTNVNGVS  373

Query  1204  IGKVVPAAC  1230
              G  +P  C
Sbjct  374   AGVQIPPTC  382



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score =   319 bits (817),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/358 (44%), Positives = 230/358 (64%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+ +AC++   +  +   G+F  G I  +GPCK P+ I  Q        D 
Sbjct  33    SDITQALLKAFTSACQSTSPSKVVIPKGEFKLGEIEMRGPCKAPVEITLQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
                 G   WV F  + G  +NGG  FDG G   W + +C K      LP +++F+ V   
Sbjct  90    NTNHGKDKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFECKKLPISVRFDFVENA  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T++   + AP +SPNTDG+H+G++  V I+ + I TG
Sbjct  150   EIKDISSIDAKNFHINVLGAKNMTMDNIKITAPEDSPNTDGIHLGRSDGVKILNSFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKV CGPGHG+++GSLG+Y +E+ V G+ V NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVVCGPGHGISVGSLGRYGHEEDVSGIRVVNCTLQETDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HFEDII+ NVSNPILIDQ+YCPWNQC    AS +KL  I FKNI+G
Sbjct  270   TWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQCNKQKASTIKLVNISFKNIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  330   TSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATFQCSNVSPQLLGSQSPKACS  387



>ref|XP_010269646.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=470

 Score =   322 bits (824),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 167/375 (45%), Positives = 234/375 (62%), Gaps = 15/375 (4%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPI  300
             + F+V+ FGA  +GK + ++AF  AW AAC   G A  +   G F+ G ++F GPC  PI
Sbjct  104   SVFNVVHFGAHPNGKKESTQAFMKAWIAACHWGGKARLVIPTGTFLVGQVFFTGPCNSPI  163

Query  301   TIDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGH  474
              I  Q K  + A+ D   +     W++F  + G+ + GG  FDG GA  W   DC KN  
Sbjct  164   PIIVQVKGTVKAVSDVSEYPS-AEWISFESLNGLILTGGGTFDGQGAAVWQYNDCEKNPD  222

Query  475   ICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHI  654
                LP +++F++V    +  + + NSK FH+ I   ++       + AP +SPNTDG+HI
Sbjct  223   CQILPMSIKFSSVKNANVRRINSVNSKSFHIAINHCENFRAHDLHITAPEDSPNTDGIHI  282

Query  655   GQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVT  834
               +  V I  + I TGDDC+S+G G  ++ + ++TCGPGHG+++GSLGKYP+EK V G+T
Sbjct  283   SSSIDVRISKSYIATGDDCISIGQGSTNISIARITCGPGHGISVGSLGKYPDEKDVKGIT  342

Query  835   VKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             VKNCTLTNT NG RIKTWPGSP   A+ + FEDIIMNNV NPI+IDQ YCP         
Sbjct  343   VKNCTLTNTDNGVRIKTWPGSPPSQASKLRFEDIIMNNVRNPIIIDQLYCP--------P  394

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIY---KGKDGSAVSKCT  1185
             S+VK+S + FKNI+GTS+SK+A+ I CS  +PC+ V + DI+L Y   K  D + ++ C+
Sbjct  395   SRVKISDVHFKNIRGTSASKVAVNIACSEQLPCEDVQLFDIDLKYNSTKPDDLAPLALCS  454

Query  1186  NVKPSIIGKVVPAAC  1230
             N +P   G  +PA C
Sbjct  455   NAQPDFGGTQMPAPC  469



>ref|XP_003552049.1| PREDICTED: polygalacturonase [Glycine max]
Length=389

 Score =   318 bits (816),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 170/388 (44%), Positives = 234/388 (60%), Gaps = 11/388 (3%)
 Frame = +1

Query  67    IQAAWFCILLASFVTGLHAAF---FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANT  234
             ++ A   IL + F+     A     D+ +FG K +   +  +AF  AW  AC +P     
Sbjct  1     MKFAIITILFSLFLLDFGFAQQGDLDISRFGGKPN--TNIGQAFLSAWTQACASPTTVKI  58

Query  235   ITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-  411
             +  AG +  G +  +GPCK PI +      + A  +P   K    W     V   T++G 
Sbjct  59    VIPAGTYQMGAVDVKGPCKAPIEVQVDGT-IQAPANPTDLKAAHQWFVVQYVNSFTLSGK  117

Query  412   GIFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDV  591
             G+FDG GAT W   DC  N     L  N  FN +    +  +T+++SK FH+ +    + 
Sbjct  118   GVFDGQGATAWKQNDCTTNKDCKMLCMNFGFNFLNNSIVRDITSKDSKNFHVNVLGCNNF  177

Query  592   TIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPG  771
             T + + V AP +SPNTDG+HIG+++ V I+   I TGDDCVSLGDG +++ V+ V CGPG
Sbjct  178   TFDGFKVSAPKDSPNTDGIHIGRSTDVKILNTNIATGDDCVSLGDGCKNITVQNVNCGPG  237

Query  772   HGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNN  948
             HG+++GSLGKY  E+PV G+ VKNCTL  T NG RIKTWP +P   + T+MHFED+ MNN
Sbjct  238   HGISVGSLGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNN  297

Query  949   VSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVM  1128
             V NPI+IDQ+YCPWNQC     SK+K+S + FKNIKGTS +K  + + CS  VPC+ V M
Sbjct  298   VMNPIIIDQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEM  357

Query  1129  NDINLIYKGKDGSAVSKCTNVKPSIIGK  1212
              DI+L + G   +A +KC NVKP+I GK
Sbjct  358   ADIDLTFNGS--AATAKCANVKPTITGK  383



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   319 bits (817),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/358 (44%), Positives = 233/358 (65%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+ AAC++P  +  +   G+F  G I  +GPCK PI +  Q        D 
Sbjct  33    SDITQALLKAFTAACQSPSPSKVVIPKGEFKLGEIEMKGPCKAPIEVTIQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
              A +G   WV F  + G  +NGG  FDG G  +W + +C K      LP +++F+ V   
Sbjct  90    NAIQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNCHKTFQCKKLPISIRFDFVLNS  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T+    + AP +SPNTDG+H+G++  V I+ + I TG
Sbjct  150   EIKDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNTDGIHLGRSDGVKILNSFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y +E+ V G+ + NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQDVSGIRIINCTLQQTDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HF+DII+ NVSNPILIDQ+YCPWNQC     S +KL  I FKNI+G
Sbjct  270   TWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCPWNQCNKQKPSTIKLVNISFKNIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ CS   PCQ V + ++++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  330   TSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATFQCSNVSPKLLGTQNPKACS  387



>ref|XP_010259722.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=477

 Score =   322 bits (824),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 236/378 (62%), Gaps = 6/378 (2%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
              F+V  FGAK DG+ D+++AF   W AAC +   A  +   G +  GP+ FQGPC  P  
Sbjct  100   IFNVKLFGAKPDGRKDNTQAFMRTWVAACNSKDQARVLIPEGIYRIGPVIFQGPCNSPDP  159

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHIC  480
             I  Q    +   D  +      WV+F ++ GV + GG  FDG G   W   DC  N +  
Sbjct  160   IIVQVKGTVKATDDISEYPSPEWVSFEKLDGVILTGGGTFDGQGQAVWQYNDCSSNAYCQ  219

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP +++ ++V+   +  + + NSK FH+ I + K++ +    + AP +SPNTDG+HI +
Sbjct  220   LLPTSIKLSSVSNAIIRRIKSINSKSFHIGITNGKNIKVRSVDIVAPEDSPNTDGIHISR  279

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  VSI  A I TGDDC+S+G G  +V + KVTCGPGHG+++GSLGKYP+E+ V G+TVK
Sbjct  280   SFGVSISKAVIGTGDDCISIGQGSNNVTISKVTCGPGHGISVGSLGKYPDEQDVNGITVK  339

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYC-PWNQCKAGLAS  1017
             NCTL NT NG RIKTWPGSP   A+N+ F+DIIM NVS PI+I+QQYC   + C     S
Sbjct  340   NCTLVNTDNGLRIKTWPGSPPSQASNIVFQDIIMENVSRPIIINQQYCASTSSCTNKEPS  399

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINL--IYKGKDGSAVSK-CTN  1188
              VK+S + F+NI+GTS+S +A+KI+CS AVPC+G+ + DINL  I    D +  S  C+N
Sbjct  400   NVKISNVFFQNIRGTSASDVAVKINCSSAVPCEGLQLFDINLVPIAPTTDSTTPSAVCSN  459

Query  1189  VKPSIIGKVVPAACSVHK  1242
              K S  G  VP  C+  +
Sbjct  460   AKISFGGVQVPEPCTSSR  477



>ref|XP_010530386.1| PREDICTED: exopolygalacturonase [Tarenaya hassleriana]
Length=428

 Score =   320 bits (819),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 162/380 (43%), Positives = 236/380 (62%), Gaps = 8/380 (2%)
 Frame = +1

Query  115   LHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCK  291
             +++   +V  +GA+ D + D+SKAF  AW  ACKA G+  +    G +  GP+ F GPC+
Sbjct  48    INSVIVNVHSYGARADARTDNSKAFLAAWNKACKASGSVVLVIPKGVYSLGPLRFAGPCR  107

Query  292   GPITIDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGK  465
                 I    K +L A+ D   ++   GW+ F  + G+T+ GG  FDG GA+ W    C  
Sbjct  108   NVSDITVHLKGHLKAVTDLSKYRSGTGWIEFGWIDGLTLTGGGTFDGQGASAWPFNGCPT  167

Query  466   NGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDG  645
             + +   LP N++F  +    + G+T+ NSK FH+ +   +D    R  + AP +SPNTDG
Sbjct  168   DFNCKLLPTNVKFVGMNRTVIRGITSVNSKFFHIALVECRDFKGTRIKISAPSDSPNTDG  227

Query  646   VHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVL  825
             VHI ++S V    ++I TGDDCVS+G G   + +  + CGPGHG+++GSLG+YPNEK V 
Sbjct  228   VHIERSSNVYFSRSSIATGDDCVSIGQGNSQITITSIRCGPGHGISVGSLGRYPNEKDVK  287

Query  826   GVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCK  1002
             G+ V++C +  T NG RIKTW  SP + SATNM F++IIMNNV+NPI+IDQ YCP++ C 
Sbjct  288   GLVVRDCRMIGTTNGIRIKTWANSPGLSSATNMTFKNIIMNNVTNPIIIDQSYCPFSSCT  347

Query  1003  AGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKG----KDGSA  1170
             + + S+VKLS I FKNI+GTSSS +A+++ CS  +PCQ V + +++L        +  SA
Sbjct  348   SKVPSRVKLSDIYFKNIRGTSSSAIAVQLHCSRGMPCQNVYLENVHLDLSSSGGRRQASA  407

Query  1171  VSKCTNVKPSIIGKVVPAAC  1230
              S C NV+   IG  +P  C
Sbjct  408   SSSCRNVRAKYIGTQIPPPC  427



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 173/386 (45%), Positives = 240/386 (62%), Gaps = 11/386 (3%)
 Frame = +1

Query  88    ILLASFVTGLHAA-FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMA  261
             +LL S      AA  FD+ K+GAK +  AD + A   AW  AC +   +  +   G +  
Sbjct  14    LLLVSNSKAQSAAGVFDITKYGAKPN--ADITAALASAWKEACASTTPSKVLIPKGTYGL  71

Query  262   GPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGAT  438
                  +GPCK  I +  +   + A  D    KG G  +    V  +T++G G+ DG G T
Sbjct  72    TQSNLKGPCKSSIELQLEG-TVQASSD---VKGDG-LLLLEYVDQLTVSGTGVVDGQGKT  126

Query  439   TWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDA  618
              W   DC        LP NL+FN VT   +  +T+ +SK +H  + + K++T +  T+ A
Sbjct  127   AWGKNDCHLKKICTKLPMNLKFNFVTNSIVKDITSLDSKNYHFNLLACKNLTFDHVTITA  186

Query  619   PGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLG  798
             PGNSPNTDG+H+G + +++I+   I TGDDC+S+G   + + +  VTCGPGHG++IGSLG
Sbjct  187   PGNSPNTDGIHVGDSEQINILNTNIATGDDCISVGSSNKQIVISDVTCGPGHGISIGSLG  246

Query  799   KYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQ  975
             KY NEK ++GVTVK C LT T NG RIKTWP S V   A++MHFEDI M NVSNP+LIDQ
Sbjct  247   KYTNEKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQ  306

Query  976   QYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKG  1155
             +YCPWNQC   + SK+K+S + FKNI+GTS++ +A+K+ CS + PC+GV + DI+L Y G
Sbjct  307   EYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSG  366

Query  1156  KDGSAVSKCTNVKPSIIGKVVPAACS  1233
              +G   S+C NVKP I GK  P  C+
Sbjct  367   SEGPIKSQCANVKPVISGKQNPPICA  392



>ref|XP_006856225.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
 gb|ERN17692.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
Length=403

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 239/373 (64%), Gaps = 6/373 (2%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
             FF+V  +GAKGDGK DD+KAF  AW  AC + G    +   G ++ GP+ F+GPCK   T
Sbjct  33    FFNVKDYGAKGDGKTDDTKAFMDAWKEACGSRGPGRLLIPWGAYLVGPLEFRGPCKNVPT  92

Query  304   IDAQKMNLLALP-DPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI  477
             +  Q + +L  P D   F     WV F  V G+T+ GG  FDG G++ W L  C  N   
Sbjct  93    MHIQLIGILKAPRDMSKFGSLDTWVLFGWVDGLTLTGGGTFDGQGSSAWPLNKCTTNTKC  152

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP +++F ++T   + G+++ NSK FH+ I   K        + AP +SPNTDG+H+ 
Sbjct  153   KLLPTSVKFASLTNTVVRGISSLNSKFFHIAILDCKHFKASSIKITAPEDSPNTDGIHLE  212

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
               + ++I  +TI TGDDC+S+G G   V ++ V CGPGHG+++GSLGKY +E  V G++V
Sbjct  213   GNTDITISQSTIGTGDDCISVGPGNSLVSIDNVKCGPGHGISVGSLGKYVDEGDVDGLSV  272

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             ++C+++NT+NG RIKTW GSP  S A NM F++IIMNNV NPI+IDQ YCP++ C     
Sbjct  273   RDCSISNTMNGLRIKTWAGSPGESRARNMTFQNIIMNNVGNPIIIDQSYCPYSFCPDKAP  332

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S+VKLS I FKNI+GTS +++A+K++CS   PC+ +++ D++L Y G  G A + C NVK
Sbjct  333   SQVKLSDITFKNIRGTSKTEVAVKLECSKGHPCKEIILQDVHLEYNG--GPAKASCVNVK  390

Query  1195  PSIIGKVVPAACS  1233
              +  G  +P  CS
Sbjct  391   ATYSGTQIPPPCS  403



>ref|XP_006407792.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49245.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=382

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/360 (44%), Positives = 231/360 (64%), Gaps = 6/360 (2%)
 Frame = +1

Query  163   GKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALP  339
             G + +++A   A+ +AC++   +  +   G+F  G I  +GPCK P+ I  Q        
Sbjct  17    GISANAEALLKAFTSACQSTSPSKVVIPKGEFKLGEIEMRGPCKAPVEITLQGT---VKA  73

Query  340   DPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVT  516
             D     G   WV F  + G  +NGG  FDG G   W + +C K      LP +++F+ V 
Sbjct  74    DGNTNHGKDKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFECKKLPISVRFDFVE  133

Query  517   GLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIK  696
                +  +++ ++K FH+ +  +K++T++   + AP +SPNTDG+H+G++  V I+ + I 
Sbjct  134   NAEIKDISSIDAKNFHINVLGAKNMTMDNIKITAPEDSPNTDGIHLGRSDGVKILNSFIS  193

Query  697   TGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGAR  876
             TGDDC+S+GDG++++HVEKV CGPGHG+++GSLG+Y +E+ V G+ V NCTL  T NG R
Sbjct  194   TGDDCISVGDGMKNLHVEKVVCGPGHGISVGSLGRYGHEEDVSGIRVVNCTLQETDNGLR  253

Query  877   IKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNI  1053
             IKTWP +    +A+++HFEDII+ NVSNPILIDQ+YCPWNQC    AS +KL  I FKNI
Sbjct  254   IKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCPWNQCNKQKASTIKLVNISFKNI  313

Query  1054  KGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             +GTS +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  314   RGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATFQCSNVSPQLLGSQSPKACS  373



>ref|XP_006486583.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
 gb|KDO68374.1| hypothetical protein CISIN_1g047315mg [Citrus sinensis]
Length=417

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 232/373 (62%), Gaps = 4/373 (1%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPIT  303
               +V  FGA+ DG+ DDSKAF  AW  AC+  GA T+    G ++ GPI F GPCK    
Sbjct  45    LVNVKDFGARADGRTDDSKAFEAAWKEACETTGAVTLLVPHGTYLIGPIKFAGPCKNVSN  104

Query  304   IDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI  477
             I  Q K  L+A  +   ++   GWV F  V G+T+ GG  FDG GA  W    C  + + 
Sbjct  105   ITVQMKGYLIASTNLSEYRFGAGWVEFGGVEGLTLTGGGTFDGRGAKAWPYNGCPTHFNC  164

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP N++F A+    +  +T+ NSK FH+ +   K+    +  + AP NSPNTDG+HI 
Sbjct  165   KLLPTNVKFVAMKKTIVRRITSVNSKSFHIALVECKNFRGSKIKISAPANSPNTDGIHIE  224

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
             ++S V +  + I TGDDC+S+G G  +V +  +TCGPGHG+++GSLG+YPNE  V G+ V
Sbjct  225   RSSSVHVSRSHIGTGDDCISVGQGNSEVTIASITCGPGHGISVGSLGRYPNEGDVRGLVV  284

Query  838   KNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLA  1014
             ++ T+T T+NG RIKTW  SP  S ATNM FE+IIMNNVSNPI+IDQ YCP+  C     
Sbjct  285   RDSTMTGTMNGVRIKTWANSPGSSAATNMTFENIIMNNVSNPIIIDQAYCPFTSCPTKPP  344

Query  1015  SKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVK  1194
             S+VKLS I FKNI+GTSSS +A+ ++CS  +PCQ + + +++L     +    S C NV+
Sbjct  345   SRVKLSDIYFKNIRGTSSSAVAVALECSKGIPCQNIYLENVHLDLSSGEKQPTSSCKNVE  404

Query  1195  PSIIGKVVPAACS  1233
                IG  VP  C+
Sbjct  405   AKYIGTQVPPPCA  417



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 231/358 (65%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+  AC++P  +  +   G+F  G I  +GPCK P+ I  Q        D 
Sbjct  33    SDITQALLKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
              A +G   W+ F  + G  +NGG  FDG G   W + +C +  +   LP +++F+ V   
Sbjct  90    NAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFNCKKLPISIRFDFVENA  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T++   + AP +SPNTDG+H+G++  V I+   I TG
Sbjct  150   EIRDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y NE+ V G+ V NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGNEQDVSGIRVINCTLQQTDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HFE+II+ NV NPILIDQ+YCPWNQC     S +KL+ I FK I+G
Sbjct  270   TWPSAACSTTASDIHFENIILKNVMNPILIDQEYCPWNQCNKQKPSTIKLANISFKQIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  330   TSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGPATFQCSNVSPKLMGTQSPKACS  387



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 231/358 (65%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+  AC++P  +  +   G+F  G I  +GPCK P+ I  Q        D 
Sbjct  33    SDITQALLKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGT---VKADG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
              A +G   W+ F  + G  +NGG  FDG G   W + +C +  +   LP +++F+ V   
Sbjct  90    NAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFNCKKLPISIRFDFVENA  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T++   + AP +SPNTDG+H+G++  V I+   I TG
Sbjct  150   EIKDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y NE+ V G+ V NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGNEQDVSGIRVINCTLQQTDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HFE+II+ NV NPILIDQ+YCPWNQC     S +KL+ I FK I+G
Sbjct  270   TWPSAACSTTASDIHFENIILKNVMNPILIDQEYCPWNQCNKQKPSTIKLANISFKQIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  330   TSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGPATFQCSNVSPKLMGTQSPKACS  387



>ref|XP_011097019.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=399

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 236/393 (60%), Gaps = 7/393 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTIT-  240
              I   +F  LLA  V       +D+ K+GAK  G  D S+A   AW  AC +   +TI  
Sbjct  5     FITIMFFLPLLAINVNAQGPVTYDITKYGAKSGG--DISQALMDAWKEACNSTSPSTIVI  62

Query  241   AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-I  417
               G +    +   GP K PI +  Q   L A P     K  G W+T + V   T++GG +
Sbjct  63    PGGTWSLSQVKLLGPNKAPIELQVQGT-LQANPGQLPNK-EGEWITINYVNYFTLSGGGV  120

Query  418   FDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTI  597
             FDG G   W   DC KN +   LP NL FN V    +  +T ++SK FH+   SS +VT 
Sbjct  121   FDGRGQEAWKQNDCHKNKNCAKLPMNLSFNFVNNSIIRDVTTKDSKNFHVNCISSHNVTF  180

Query  598   ERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHG  777
              R+TV APG+SPNTDG+H+G+ + ++I  + IKTGDDCVS+GD  +++H++ VTCGPGHG
Sbjct  181   LRFTVSAPGDSPNTDGIHLGRDTMINIKDSIIKTGDDCVSIGDESKEIHIQNVTCGPGHG  240

Query  778   LAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVS  954
             +++GSLG Y  EK V G+ V NCT   T NG R+KTWP +P   + +++HFED+IM+NVS
Sbjct  241   ISVGSLGGYAEEKDVQGIYVTNCTFIGTTNGVRVKTWPSAPATLTVSDLHFEDLIMDNVS  300

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             +PI+IDQ+YCP N CK    S +K++ +  +N++GT+++  A+   CS   PC+   + D
Sbjct  301   SPIIIDQEYCPHNLCKKDRPSSIKITNVRERNVRGTTNTAEAVTFICSGLKPCERGGVGD  360

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             I+L Y G  G   +KC NVKP  +GK  P  C+
Sbjct  361   IDLTYNGNQGPITTKCANVKPKFVGKQNPPVCA  393



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 230/357 (64%), Gaps = 6/357 (2%)
 Frame = +1

Query  172   DDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPF  348
             D ++A   A+  AC++P  +  +   G+F  G I  +GPCK P+ I  Q        D  
Sbjct  34    DITQALVKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGT---VKADGN  90

Query  349   AFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLR  525
             A +G   W+ F  + G  +NGG  FDG G   W + +C +  +   LP +++F+ V    
Sbjct  91    AIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFNCKKLPISIRFDFVENAE  150

Query  526   LIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGD  705
             +  +++ ++K FH+ +  +K++T++   + AP +SPNTDG+H+G++  V I+   I TGD
Sbjct  151   IRDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFISTGD  210

Query  706   DCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKT  885
             DC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y NE+ V G+ V NCTL  T NG RIKT
Sbjct  211   DCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGNEQDVSGIRVINCTLQQTDNGLRIKT  270

Query  886   WPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGT  1062
             WP +    +A+++HFE+II+ NV NPILIDQ+YCPWNQC     S +KL+ I FK I+GT
Sbjct  271   WPSAACSTTASDIHFENIIVKNVMNPILIDQEYCPWNQCNKQKPSTIKLANISFKQIRGT  330

Query  1063  SSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             S +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  331   SGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGPATFQCSNVSPKLMGTQSPKACS  387



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 170/371 (46%), Positives = 229/371 (62%), Gaps = 10/371 (3%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             FDV ++GAK +   D + A   AW  AC +   +  +   G ++      +GPCK  I I
Sbjct  30    FDVTRYGAKPN--TDITHALLNAWKGACASTSRSKVLIPKGVYLLSQSNLKGPCKSSIEI  87

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHICP  483
                   L A PDP   KG G  V    +  +T++G G+FDG G   W   DC K      
Sbjct  88    QVDGT-LQAPPDP---KGDG-LVILEYIDKLTLSGTGVFDGQGKVGWEKNDCHKKKICTK  142

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP  L+FN VT   +  +T+ +SK FH+ I   K++T +  T+ AP +SPNTDG+HI  +
Sbjct  143   LPMTLKFNFVTNSIVRDITSLDSKNFHINILGCKNLTFQHVTISAPEDSPNTDGIHISSS  202

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
              +++I+   I TGDDCVS+GD  + + +  VTCGPGHG++IGSLGKY  EK V GV V  
Sbjct  203   EQITILNTKISTGDDCVSVGDSNKQITIRDVTCGPGHGISIGSLGKYSKEKAVEGVWVTK  262

Query  844   CTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             C LT+T NG RIKTWP S    SA++MHFEDI MNNVSNPI+IDQ+YCPWNQC   + S 
Sbjct  263   CKLTSTTNGVRIKTWPDSAGEYSASDMHFEDIEMNNVSNPIIIDQEYCPWNQCNPKIPSS  322

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             +K+S + FKNI+GTS++ +A+K+ CS  +PC+ V + DI+L Y G  G   S+C NVKP 
Sbjct  323   IKISKVSFKNIRGTSATPVAVKLVCSKKIPCEAVEVVDIDLKYNGNKGPIKSQCANVKPI  382

Query  1201  IIGKVVPAACS  1233
             I GK  P  C+
Sbjct  383   ISGKQNPRICA  393



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 230/357 (64%), Gaps = 6/357 (2%)
 Frame = +1

Query  172   DDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPF  348
             D ++A   A+  AC++P  +  +   G+F  G I  +GPCK P+ I  Q        D  
Sbjct  34    DITQALVKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGT---VKADGN  90

Query  349   AFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLR  525
             A +G   W+ F  + G  +NGG  FDG G   W + +C +  +   LP +++F+ V    
Sbjct  91    AIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFNCKKLPISVRFDFVENAE  150

Query  526   LIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGD  705
             +  +++ ++K FH+ +  +K++T++   + AP +SPNTDG+H+G++  V I+   I TGD
Sbjct  151   IRDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFISTGD  210

Query  706   DCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKT  885
             DC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y NE+ V G+ V NCTL  T NG RIKT
Sbjct  211   DCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGNEQDVSGIRVINCTLQQTDNGLRIKT  270

Query  886   WPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGT  1062
             WP +    +A+++HFE+II+ NV NPILIDQ+YCPWNQC     S +KL+ I FK I+GT
Sbjct  271   WPSAACSTTASDIHFENIIVKNVMNPILIDQEYCPWNQCNKQKPSTIKLANISFKQIRGT  330

Query  1063  SSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             S +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  331   SGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGPATFQCSNVSPKLMGTQSPKACS  387



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 230/357 (64%), Gaps = 6/357 (2%)
 Frame = +1

Query  172   DDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPF  348
             D ++A   A+  AC++P  +  +   G+F  G I  +GPCK P+ I  Q        D  
Sbjct  34    DITQALLKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGT---VKADGN  90

Query  349   AFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLR  525
             A +G   W+ F  + G  +NGG  FDG G   W + +C +  +   LP +++F+ V    
Sbjct  91    AIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFNCKKLPISIRFDFVENAE  150

Query  526   LIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGD  705
             +  +++ ++K FH+ +  +K++T++   + AP +SPNTDG+H+G++  V I+   I TGD
Sbjct  151   IRDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFISTGD  210

Query  706   DCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKT  885
             DC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y NE+ V G+ V NCTL  T NG RIKT
Sbjct  211   DCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGNEQDVSGIRVINCTLQQTDNGLRIKT  270

Query  886   WPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGT  1062
             WP +    +A+++HFE+II+ NV NPILIDQ+YCPWNQC     S +KL+ I FK I+GT
Sbjct  271   WPSAACSTTASDIHFENIIVKNVMNPILIDQEYCPWNQCNKQKPSTIKLANISFKQIRGT  330

Query  1063  SSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             S +K A+K+ CS   PCQ V + DI++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  331   SGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGPATFQCSNVSPKLMGTQSPKACS  387



>gb|ABY21306.1| pollen allergen Pla o 2 [Platanus orientalis]
Length=378

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 227/368 (62%), Gaps = 7/368 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTI-TAAGKFMAGPIWFQGPCKGPITI  306
             F+V  +GAKG G  D S+A   AW AAC +PG +T+    G ++ G +  +GPCKG   I
Sbjct  11    FNVNDYGAKGSG--DISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCKGS-KI  67

Query  307   DAQKMNLLALP-DPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGHIC  480
               Q   ++  P D  AFK  G WV F+ V G+T++G G FDG G   W   +C K+ +  
Sbjct  68    GFQLDGVVKAPADVSAFKSEG-WVVFNHVDGLTVSGKGTFDGQGQKAWAANNCDKDENCN  126

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
               P N++FN +    +  +T+ NSK FH+ +    +++ +  T+ APG S NTDG+HIG 
Sbjct  127   RPPMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDGIHIGL  186

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V+I    I TGDDCVS+G G Q+V V KV CGPGHG+++GSLGKY +EK V G+TV 
Sbjct  187   SRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVRGITVT  246

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
              CT T T NG R+KTWP SP G AT+M FED+ M NV NP+++DQ+YCP+ QC     S+
Sbjct  247   GCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCSLKAPSR  306

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I F NI+GTSS   A+ I CS   PC  + + +INL        A S CTN KP 
Sbjct  307   VKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTCTNAKPI  366

Query  1201  IIGKVVPA  1224
               GK VPA
Sbjct  367   FSGKQVPA  374



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   317 bits (812),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 233/358 (65%), Gaps = 6/358 (2%)
 Frame = +1

Query  169   ADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDP  345
             +D ++A   A+ AAC++P  +  +   G+F  G I  +GPCK PI +  Q        + 
Sbjct  33    SDITQALLKAFTAACQSPSPSKVVIPKGEFKLGEIEMRGPCKAPIEVTIQGT---VKANG  89

Query  346   FAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGL  522
              A +G   WV F  + G  +NGG  FDG G  +W + +C K      LP +++F+ V   
Sbjct  90    NAIQGKDKWVVFGNINGFKLNGGGAFDGEGNASWRVNNCHKTFQCKKLPISIRFDFVLNS  149

Query  523   RLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTG  702
              +  +++ ++K FH+ +  +K++T+    + AP +SPNTDG+H+G++  V I+ + I TG
Sbjct  150   EIKDISSIDAKNFHINVLGAKNMTMNNIKIIAPEDSPNTDGIHLGRSDGVKILNSFISTG  209

Query  703   DDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIK  882
             DDC+S+GDG++++HVEKVTCGPGHG+++GSLG+Y +E+ V G+ + NCTL  T NG RIK
Sbjct  210   DDCISVGDGMKNLHVEKVTCGPGHGISVGSLGRYGHEQDVSGIRIINCTLQQTDNGLRIK  269

Query  883   TWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKG  1059
             TWP +    +A+++HF+DII+ NVSNPILIDQ+YCPWNQC     S +KL  I FKNI+G
Sbjct  270   TWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCPWNQCNKQKPSTIKLVNISFKNIRG  329

Query  1060  TSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             TS +K A+K+ CS   PCQ V + ++++ Y G DG A  +C+NV P ++G   P ACS
Sbjct  330   TSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATFQCSNVSPKLLGTQNPKACS  387



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   317 bits (813),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 167/374 (45%), Positives = 233/374 (62%), Gaps = 10/374 (3%)
 Frame = +1

Query  121   AAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGP  297
             A  FD+ K+GAK +  AD + A   AW  AC +   +  +   G +       +GPCK  
Sbjct  27    AGVFDITKYGAKPN--ADITAALASAWKEACASTTPSKVLIPKGTYGLTQSNLKGPCKSS  84

Query  298   ITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNGH  474
             I +  +      +      KG G  +    V  +T++G G+ DG G T W   DC     
Sbjct  85    IELQLEG----TVQASVDVKGDG-LLLLEYVDQLTVSGTGVVDGQGKTAWGKNDCHLKKI  139

Query  475   ICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHI  654
                LP NL+FN VT   +  +T+ +SK +H  + + K++T +  T+ APGNSPNTDG+H+
Sbjct  140   CTKLPMNLKFNFVTNSIVKDITSLDSKNYHFNLLACKNLTFDHVTITAPGNSPNTDGIHV  199

Query  655   GQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVT  834
             G + +++I+   I TGDDC+S+G   + + +  VTCGPGHG++IGSLGKY NEK ++GVT
Sbjct  200   GDSEQINILNTNIATGDDCISVGISNKQIVISDVTCGPGHGISIGSLGKYTNEKELVGVT  259

Query  835   VKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
             VK C LT T NG RIKTWP S V   A++MHFEDI M NVSNP+LIDQ+YCPWNQC   +
Sbjct  260   VKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQCNRKV  319

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              SK+K+S + FKNI+GTS++ +A+K+ CS + PC+GV + DI+L Y G +G   S+C NV
Sbjct  320   PSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANV  379

Query  1192  KPSIIGKVVPAACS  1233
             KP I GK  P  C+
Sbjct  380   KPVISGKQNPPICA  393



>ref|XP_004292314.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=416

 Score =   318 bits (814),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 162/371 (44%), Positives = 230/371 (62%), Gaps = 6/371 (2%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPITI  306
             F+V  FGAK DG+ DDSKAFT AW  AC++ G  + I   GK+M GP+ F GPC+    +
Sbjct  49    FNVKSFGAKADGQTDDSKAFTAAWKEACQSKGRVHLIIPRGKYMVGPLKFSGPCR---NV  105

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
              A  + + A  +   ++  GGW+ F+   G+T+ GG  FDG GA  W    C K+ +   
Sbjct  106   SALNLRMNATTELSKYEFGGGWIQFAWTKGLTLTGGGTFDGQGAKAWPHNKCSKDSNCKL  165

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP +L+F  +    + G+++ NS  FH+ +         +  + AP  SPNTDG+HI ++
Sbjct  166   LPTSLKFIGMNKTVIRGISSVNSMFFHIAVVDCHYFKGSKLKIQAPETSPNTDGIHIERS  225

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
             S V    + I TGDDC+S+G+G   V +  + CGPGHG+++GSLGKYPNE  V G+ V++
Sbjct  226   SSVYFSSSHIATGDDCISVGEGNSHVTITSIACGPGHGISVGSLGKYPNEGDVSGLVVRD  285

Query  844   CTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASK  1020
             CT++ T NG RIKTW  SP   +ATNM F +I+MNNV+NPI+IDQ YCP   C +   SK
Sbjct  286   CTISGTTNGIRIKTWANSPGRSAATNMTFTNIVMNNVTNPIIIDQLYCPLRSCASQTPSK  345

Query  1021  VKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNVKPS  1200
             VKLS I FKNI+GTSSS++A+ ++CS  +PCQ + + D++L          S C+NVK  
Sbjct  346   VKLSDIYFKNIRGTSSSQVAVALECSRGIPCQNIYLEDVHLNLASGKKEVTSTCSNVKAK  405

Query  1201  IIGKVVPAACS  1233
              IG  +P  C+
Sbjct  406   FIGTQIPPPCT  416



>ref|XP_002312795.2| hypothetical protein POPTR_0009s17010g [Populus trichocarpa]
 gb|EEE86750.2| hypothetical protein POPTR_0009s17010g [Populus trichocarpa]
Length=419

 Score =   318 bits (814),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 232/377 (62%), Gaps = 6/377 (2%)
 Frame = +1

Query  112   GLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPC  288
             G  +  FDV +FGA+ DG+ DDSKAF  AW  AC+A G    +   G ++ GP+ F GPC
Sbjct  46    GNSSLLFDVKRFGARADGRTDDSKAFIAAWKEACRATGKVELLIPKGTYLIGPVKFAGPC  105

Query  289   KGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGK  465
             K    + +    L A      +    GWV F  +  +T+ GG  FDG GA  W   +C  
Sbjct  106   K---NVSSLTGYLKATAKLSRYGSGTGWVEFGWLERLTLTGGGTFDGQGAKAWPYNNCTN  162

Query  466   NGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDG  645
             +     LP N++F A+    + G+T+ NSK FH+ +   K+    +  + AP +SPNTDG
Sbjct  163   DSKCKLLPTNVKFVAMNQTVVQGITSLNSKFFHIALVECKNFKGTKIKISAPADSPNTDG  222

Query  646   VHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVL  825
             +H+ ++S V I  + I TGDDC+S+G G   V + ++ CGPGHG+++GSLG+Y +E  V 
Sbjct  223   IHVERSSSVYISQSLIGTGDDCISIGQGNSQVTITRIRCGPGHGISVGSLGRYEDEGDVS  282

Query  826   GVTVKNCTLTNTLNGARIKTWPGSPVGS-ATNMHFEDIIMNNVSNPILIDQQYCPWNQCK  1002
             G+ V++C ++ T+NG RIKTW  SP  S ATNM FE+I+MNNV+NPI+IDQ YCP++ C 
Sbjct  283   GLVVRDCAISGTMNGIRIKTWANSPGSSAATNMTFENIVMNNVTNPIIIDQSYCPFSSCI  342

Query  1003  AGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKC  1182
             +   SKVKLS I FK I+GTSSS +A+ ++CS  +PCQ + + +++L     +  A S C
Sbjct  343   STEPSKVKLSDIYFKQIRGTSSSAVAVALECSKGIPCQNIYLENVHLELSSGEKQATSSC  402

Query  1183  TNVKPSIIGKVVPAACS  1233
              NV+   IG+ +P  C+
Sbjct  403   KNVRARYIGEQIPPPCA  419



>ref|XP_006421347.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
 gb|ESR34587.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
Length=380

 Score =   316 bits (810),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/371 (44%), Positives = 226/371 (61%), Gaps = 28/371 (8%)
 Frame = +1

Query  130   FDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITAA-GKFMAGPIWFQGPCKGPITI  306
             F+V+ FGA  DG  D+SKAF  AW  AC     +T+    GK++   + F+GPCK PI+ 
Sbjct  33    FNVIDFGAVADGIRDNSKAFENAWREACNWNTYSTVLVPPGKYLVTSVVFKGPCKAPISF  92

Query  307   DAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHICP  483
               Q + +LA P          W+TF  +   T+ GG  F G G T W    C KN + C 
Sbjct  93    QLQGL-ILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAWPENQCHKNSN-CQ  150

Query  484   LPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQT  663
             LP +++FN +    + G+ + +SK FH+ I    ++ + +  + AP ++           
Sbjct  151   LPISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDT-----------  199

Query  664   SKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVKN  843
                        TGDDCVSLGDG Q+V V  V+CGPGHG+++GSLGKY  E+ V+G+TV N
Sbjct  200   -----------TGDDCVSLGDGSQNVLVSDVSCGPGHGISVGSLGKYKKEEDVVGLTVIN  248

Query  844   CTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLASKV  1023
             CT T T NG RIKTWP S  G A+N  FED+ MNNV NPI+IDQ+YCP NQC   + S+V
Sbjct  249   CTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPHNQCNIKVPSRV  308

Query  1024  KLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD--GSAVSKCTNVKP  1197
             K+S + F+NI+GTS +K A++I CS  +PCQ V + DINL+Y G D  G A+S C+NVKP
Sbjct  309   KISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKP  368

Query  1198  SIIGKVVPAAC  1230
             +++GK +PA C
Sbjct  369   TLVGKQIPATC  379



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   317 bits (811),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 169/396 (43%), Positives = 239/396 (60%), Gaps = 9/396 (2%)
 Frame = +1

Query  64    LIQAAWFCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTIT  240
             L+ + +   LL S    +  A FDV      G   +D S+    AW  AC +   +  I 
Sbjct  5     LVMSIFPIFLLLS----IAYADFDVTSSKYGGKPNSDISQPLAKAWSDACASTSPSRIIV  60

Query  241   AAGKFMAGPIWFQGPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTING-GI  417
               G F      F+GPCKGPI        L A  D         W+ F+ +  +T+ G G 
Sbjct  61    PKGTFQLKGASFKGPCKGPIEFQVDGT-LQAPQDGAQLIKADTWIEFANLERLTLMGTGT  119

Query  418   FDGNGATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTI  597
             FDG G   W   DC KN     +  NL+FN+V    +  +T+ NSK FH+ +   + +T 
Sbjct  120   FDGQGQKAWKENDCNKNPKCSSIAINLRFNSVKHSLVKDVTSLNSKNFHVNVLGCEQLTF  179

Query  598   ERYTVDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHG  777
             + +TV APG+S NTDG+HIG+++ ++I    I TGDDC+S+GDG + + + KVTCGPGHG
Sbjct  180   QHFTVKAPGDSINTDGIHIGRSTGINITDTNIGTGDDCISIGDGTKQLTINKVTCGPGHG  239

Query  778   LAIGSLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVS  954
             ++IGSLG+Y NE  V G+ VK+CT++NT+NG RIKTWP SP+  +A+++HFE I MNNV 
Sbjct  240   ISIGSLGRYNNEDHVTGINVKDCTISNTMNGVRIKTWPNSPIATTASDIHFEHITMNNVG  299

Query  955   NPILIDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMND  1134
             NPILIDQ+YCP+ QC     SKVK+S + FKNI+GT+++  A+KI C+  +PC  VV++D
Sbjct  300   NPILIDQEYCPYGQCNTQTPSKVKISNVSFKNIRGTTTTAEAVKIVCAKGLPCDKVVLSD  359

Query  1135  INLIYKGKDGSAVSKCTNVKPSIIGKVVPAACSVHK  1242
             I+L   GK G+  S+C NV+P+I       AC+  K
Sbjct  360   IDLKLTGK-GTLTSQCANVQPTITQVPQALACATKK  394



>ref|XP_010913952.1| PREDICTED: exopolygalacturonase-like [Elaeis guineensis]
Length=433

 Score =   317 bits (813),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/373 (43%), Positives = 230/373 (62%), Gaps = 5/373 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPI  300
             A F+V KFGA  DGK+DDS AF  AW  AC   G   I    G+++  PI F+GPC G +
Sbjct  60    AAFNVKKFGAAADGKSDDSAAFLKAWETACPLEGRKKIVIPRGEYLVNPIRFEGPCNGLM  119

Query  301   TIDAQKMNLLALPDPFAF--KGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNG  471
              +    + + A PD   F  +GH  W+TF+ +  + I G G FDG G+  W    C K  
Sbjct  120   EVLLSGV-VKAQPDINVFNQQGHKEWITFNHIDRLLITGAGTFDGQGSYAWQHNTCSKKK  178

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
                 LP NL+ N V    + G++  +SK F + I  S +V I R  + AP  +PNTDG+H
Sbjct  179   DCSLLPGNLRLNFVARATVRGISVVDSKSFQMTIFGSNNVRIHRIKIIAPEEAPNTDGIH  238

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             IG ++ V I  + I TGDDC+S+G G + + V  V+CGPGHG++IGSLG+Y NE  V GV
Sbjct  239   IGNSTNVRITDSEIGTGDDCISVGPGSRQILVSGVSCGPGHGISIGSLGRYHNEPDVSGV  298

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
             TVKNCTLT T NG R+KTW  S    A++ HFE+++MN V NPI++DQ+YCP   C+ G 
Sbjct  299   TVKNCTLTGTTNGLRVKTWQNSESSRASDFHFENVVMNGVQNPIIVDQEYCPVGNCEKGA  358

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              S V++S + F+NI+GTS+S+MA+ + CS  V C+ V++ DI+L +   +  ++++C   
Sbjct  359   PSLVEISNVTFQNIRGTSASRMAVHLFCSKTVNCKNVILQDIDLKFVDANSPSLAQCYYA  418

Query  1192  KPSIIGKVVPAAC  1230
             + +  G + P +C
Sbjct  419   QGTATGYMNPPSC  431



>ref|XP_002272193.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI22964.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   317 bits (813),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 228/373 (61%), Gaps = 6/373 (2%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFMAGPIWFQGPCKGPIT  303
              F+V+++GAK  GK D ++AF  AW AAC   G A  +   G F+ G + FQGPC  P  
Sbjct  55    IFNVLQYGAKPGGKKDSTEAFMKAWVAACHWRGKARLLIPQGIFLIGQVTFQGPCNSPTP  114

Query  304   IDAQ-KMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHI  477
             I  Q    L A+ D   F     WVTF  + G+ + GG  FDG G   W   DC +N + 
Sbjct  115   IIVQVAATLKAVTDISEF-ASPEWVTFEDINGLIVTGGGTFDGQGDVVWKYNDCRRNSNC  173

Query  478   CPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIG  657
               LP +++FN++T   L G+ + N+K FH+ +   ++       + AP +SPNTDG+HI 
Sbjct  174   QLLPTSIKFNSITNGNLRGINSVNAKSFHIAMNRCQNFRAFGLHITAPEDSPNTDGIHIS  233

Query  658   QTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTV  837
              ++ V +  + I TGDDC+S+G G  ++ + KVTCGPGHG++IGSLGKYP+EK V+G+ V
Sbjct  234   SSNFVKVSKSIISTGDDCISIGQGSTNISINKVTCGPGHGISIGSLGKYPDEKDVIGIIV  293

Query  838   KNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGLAS  1017
             KN TL NT NG RIKTWPGSP   A+ + F+DIIM NV NPI+IDQ YCP         S
Sbjct  294   KNSTLMNTDNGLRIKTWPGSPPSQASGILFQDIIMKNVKNPIIIDQLYCPSGSSCRTQPS  353

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD--GSAVSKCTNV  1191
             +V++S I ++NI+GTSSS + + + CSP  PCQ V + DINL Y GK    +  S C+NV
Sbjct  354   RVRISNIHYRNIRGTSSSPLGVNLMCSPQFPCQNVELFDINLRYSGKRRVSALTSSCSNV  413

Query  1192  KPSIIGKVVPAAC  1230
             K    G  +P  C
Sbjct  414   KAGFGGVQIPPPC  426



>gb|KGN43365.1| hypothetical protein Csa_7G027810 [Cucumis sativus]
Length=439

 Score =   318 bits (814),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 168/384 (44%), Positives = 226/384 (59%), Gaps = 4/384 (1%)
 Frame = +1

Query  94    LASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANT-ITAAGKFMAGPI  270
             L  + T   +  F V  FGA+ +G  DDS AF  AW  AC + G  T +   G ++ GP+
Sbjct  56    LLRYRTKSSSHVFSVRSFGARANGLTDDSNAFLAAWRMACDSAGVVTFLIPKGTYLVGPV  115

Query  271   WFQGPCKGPITIDAQKMNLLALPDPFAFKGHG-GWVTFSQVIGVTINGG-IFDGNGATTW  444
              F GPCK   ++  +    L      +  G G GW+ F  + G+T+NGG  FDG GA  W
Sbjct  116   IFSGPCKNVSSLTVKMEGYLKASTNLSKYGSGAGWIEFRWMEGLTLNGGGTFDGRGAEAW  175

Query  445   NLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPG  624
                +C  + +   LP NL+F A+    +  +T+ NSK FHL +   K        + AP 
Sbjct  176   PFNNCRDDYNCKLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKRFVGSELKISAPE  235

Query  625   NSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKY  804
             NSPNTDG+HI ++S +    + I+TGDDC+S+G G   V +  V CGPGHG+++GSLG+Y
Sbjct  236   NSPNTDGIHIDRSSNIHFSLSHIQTGDDCISIGQGNSQVTISSVNCGPGHGISVGSLGRY  295

Query  805   PNEKPVLGVTVKNCTLTNTLNGARIKTWPGSP-VGSATNMHFEDIIMNNVSNPILIDQQY  981
              NE  V G+ VKNC+LT T NG RIKTWP SP   SATNM FE+I MNNVSNPI+IDQ Y
Sbjct  296   RNEGDVSGLVVKNCSLTGTANGIRIKTWPNSPGSSSATNMTFENITMNNVSNPIIIDQSY  355

Query  982   CPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKD  1161
             CP+  C     S VKLS I FKNI+GTSSSK+A+ ++CS   PCQ V + +++L     +
Sbjct  356   CPFGFCSFKAPSLVKLSDIYFKNIRGTSSSKVAVALECSKGFPCQNVNLENVHLDLSSGE  415

Query  1162  GSAVSKCTNVKPSIIGKVVPAACS  1233
                 S C  V+   IG  +P  C+
Sbjct  416   NHPSSTCKYVRARYIGTQIPPPCA  439



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score =   316 bits (810),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 165/389 (42%), Positives = 237/389 (61%), Gaps = 9/389 (2%)
 Frame = +1

Query  103   FVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQ  279
             FV  L     +   F       +D +      +  AC+ P  +++    G++    I   
Sbjct  11    FVVCLLGLSANAKDFTITAPPGSDITSLLLKTFNEACQFPTKSSVLIPKGEYKLRQIEMM  70

Query  280   GPCKGPITIDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPD  456
             GPCK PI I  Q      +       G+  WV F ++ G  +NGG +FDG G   W   +
Sbjct  71    GPCKAPIRITLQG----TVKADGNVNGNDFWVAFRRINGFKLNGGGVFDGEGNAAWRANN  126

Query  457   CGKNG--HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNS  630
             C K        LP +++F+ VT  ++ G+T+ +SK FH+ +  ++++T+E  T+ AP  S
Sbjct  127   CHKMALTQCKKLPISIRFDFVTDAKIRGITSMDSKNFHINVLGARNMTLEEITIIAPEES  186

Query  631   PNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPN  810
             PNTDG+H+G++  V II + IKTGDDC+S+GDG +D+ VE+VTCGPGHG++IGSLG Y  
Sbjct  187   PNTDGIHVGRSVGVQIINSNIKTGDDCISIGDGTRDLLVERVTCGPGHGISIGSLGLYVK  246

Query  811   EKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPILIDQQYCP  987
             E+ V G+ V NCTL NT NG RIKTWP +    +A+ +HFE+II+ NV+NPILIDQ+YCP
Sbjct  247   EEDVTGIRVVNCTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  988   WNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGS  1167
             WN+C     S +KL  I FK+I+GTS +K A+K+ CS   PC+ V + DIN+ Y G DG 
Sbjct  307   WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVEIGDINIQYTGADGP  366

Query  1168  AVSKCTNVKPSIIGKVVPAACSVHK*KIP  1254
             A  +C+NV P+++G  VP ACS    K+P
Sbjct  367   ATFQCSNVSPTLMGTQVPKACSSPVTKLP  395



>gb|AAQ63000.1| oil palm polygalacturonase allergen PEST643 [Elaeis guineensis]
Length=433

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/373 (43%), Positives = 230/373 (62%), Gaps = 5/373 (1%)
 Frame = +1

Query  124   AFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPGANTITA-AGKFMAGPIWFQGPCKGPI  300
             A F+V KFGA  DGK+DDS AF  AW  AC   G   I    G+++  PI F+GPC G +
Sbjct  60    AAFNVKKFGAAADGKSDDSAAFLKAWETACPLEGRKKIVIPRGEYLVNPIRFEGPCNGLM  119

Query  301   TIDAQKMNLLALPDPFAF--KGHGGWVTFSQVIGVTING-GIFDGNGATTWNLPDCGKNG  471
              +    + + A PD   F  +GH  W+TF+ +  + I G G FDG G+  W    C K  
Sbjct  120   EVLLSGV-VKAQPDINVFNQQGHKEWITFNHIDRLLITGAGTFDGQGSYAWQHNTCSKKK  178

Query  472   HICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVH  651
                 LP NL+ N V    + G++  +SK F + I  S +V I R  + AP  +PNTDG+H
Sbjct  179   DCSLLPGNLRLNFVARATVRGISVVDSKSFQMTIFGSNNVRIHRIKIIAPEEAPNTDGIH  238

Query  652   IGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGV  831
             IG ++ V I  + I TGDDC+S+G G + + V  V+CGPGHG++IGSLG+Y NE  V GV
Sbjct  239   IGNSTNVRITDSEIGTGDDCISVGPGSRQILVSGVSCGPGHGISIGSLGRYHNEPDVSGV  298

Query  832   TVKNCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYCPWNQCKAGL  1011
             TVKNCTLT T NG R+KTW  S    A++ HFE+++MN V NPI++DQ+YCP   C+ G 
Sbjct  299   TVKNCTLTGTTNGLRVKTWQNSESSRASDFHFENVVMNGVQNPIIVDQEYCPVGNCEKGA  358

Query  1012  ASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYKGKDGSAVSKCTNV  1191
              S V++S + F+NI+GTS+S+MA+ + CS  V C+ V++ DI+L +   +  ++++C   
Sbjct  359   PSLVEISNVTFQNIRGTSASRMAVHLFCSKTVNCKNVILQDIDLKFVDANSPSLAQCYYA  418

Query  1192  KPSIIGKVVPAAC  1230
             + +  G + P +C
Sbjct  419   QGTAAGYMNPPSC  431



>ref|XP_010259724.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=468

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 240/377 (64%), Gaps = 11/377 (3%)
 Frame = +1

Query  127   FFDVMKFGAKGDGKADDSKAFTGAWGAACKA-PGANTITAAGKFMAGPIWFQGPCKGPIT  303
              F+V  FGAK DG+ D+ +AF   W AAC++   A  +   G F+ G + F+GPCK PI 
Sbjct  93    IFNVKSFGAKPDGRTDNVQAFMKTWNAACQSGSKATVLIPDGVFLVGQVIFEGPCKSPIV  152

Query  304   IDAQKMNLLALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGNGATTWNLPDCGKNGHIC  480
             +   K  L A+ D   +     W++F  V G+T+ GG   DG G T W   DC KN +  
Sbjct  153   VQV-KGYLKAVIDVSDYPS-PEWISFEHVNGLTVTGGGTLDGQGKTDWKYNDCSKNAYCQ  210

Query  481   PLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYTVDAPGNSPNTDGVHIGQ  660
              LP++L+ N+VT  ++  L   +SK FH+ I   K +T++   + AP +SPNTDG+H+ +
Sbjct  211   LLPSSLKLNSVTNGQVGQLKLLDSKAFHMVILKGKSITVQDLQISAPEDSPNTDGIHLSR  270

Query  661   TSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIGSLGKYPNEKPVLGVTVK  840
             +  V+I    I TGDDC+S+G G  +V++ +V CGPGHG+++GSLGKY +E+ V GVTV 
Sbjct  271   SIDVTISNVIIGTGDDCISIGQGSNNVNINQVYCGPGHGISVGSLGKYDDEQDVKGVTVN  330

Query  841   NCTLTNTLNGARIKTWPGSPVGSATNMHFEDIIMNNVSNPILIDQQYC-PWNQCKAGLAS  1017
             NCTL NT NG RIKTWPGSP   A+++ F++++M NV  PI+IDQQYC   + C     S
Sbjct  331   NCTLANTQNGLRIKTWPGSPPSQASSILFKNVVMKNVRYPIIIDQQYCASTSHCSNTNPS  390

Query  1018  KVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLIYK------GKDGSAVSK  1179
              VKLS I ++NI+GTSSS++A+KI+CSPAVPC+G+ + D+NL Y+      G+D +A++ 
Sbjct  391   NVKLSDIRYQNIRGTSSSQVAVKINCSPAVPCKGIQLFDVNLKYEPGTNDAGRDTAAMAT  450

Query  1180  CTNVKPSIIGKVVPAAC  1230
             C+  +    G   P  C
Sbjct  451   CSYAQIGYGGIQNPQPC  467



>ref|NP_187440.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21193.1|AC013483_17 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74609.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=397

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/389 (42%), Positives = 239/389 (61%), Gaps = 16/389 (4%)
 Frame = +1

Query  82    FCILLASFVTGLHAAFFDVMKFGAKGDGKADDSKAFTGAWGAACKAPG-ANTITAAGKFM  258
             F I L  F    H    +V++  +     +D ++A   A+  AC++P     +   G+F 
Sbjct  11    FVICLLGFSANAH----EVLRLTSSPG--SDITQALLRAFTTACQSPTPRKVVIPKGQFK  64

Query  259   AGPIWFQGPCKGPITIDAQKMNLL--ALPDPFAFKGHGGWVTFSQVIGVTINGG-IFDGN  429
              G I   GPCK P+ I      LL   L D  +  G   WV F ++ G  +NGG  FDG 
Sbjct  65    LGEIMMSGPCKSPVEI-----TLLGTVLADGNSIHGKEKWVVFQRMDGFRLNGGGTFDGE  119

Query  430   GATTWNLPDCGKNGHICPLPANLQFNAVTGLRLIGLTNRNSKQFHLRIGSSKDVTIERYT  609
             G   W + +C K      LP +++F+ VT   +  +++ ++K FH+ +  +K++T +   
Sbjct  120   GNAAWRVNNCHKTFECKKLPISIRFDFVTNAEIRDISSIDAKNFHINVIGAKNMTFDNVK  179

Query  610   VDAPGNSPNTDGVHIGQTSKVSIIGATIKTGDDCVSLGDGVQDVHVEKVTCGPGHGLAIG  789
             + AP  SPNTDG+H+G++  VSII + I TGDDCVS+GDG+ ++ V+ V CGPGHG+++G
Sbjct  180   IMAPAESPNTDGIHLGRSVGVSIINSRISTGDDCVSVGDGMVNLLVKNVVCGPGHGISVG  239

Query  790   SLGKYPNEKPVLGVTVKNCTLTNTLNGARIKTWPGSPVG-SATNMHFEDIIMNNVSNPIL  966
             SLG+Y +E+ V G+ V NCTL  T NG RIKTWP +    +A+N+HFE+II+ NVSNPIL
Sbjct  240   SLGRYGHEQDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPIL  299

Query  967   IDQQYCPWNQCKAGLASKVKLSGIGFKNIKGTSSSKMAMKIDCSPAVPCQGVVMNDINLI  1146
             IDQ+YCPWNQC    +S +KL+ I F+ I+GTS +K A+K+ CS   PC+ V + DIN+ 
Sbjct  300   IDQEYCPWNQCNKQKSSSIKLANISFRRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQ  359

Query  1147  YKGKDGSAVSKCTNVKPSIIGKVVPAACS  1233
             Y G DG A   C+NV+P ++G   P AC+
Sbjct  360   YTGADGPATFMCSNVRPKLVGTQFPKACN  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3602305440702