BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7784_g1_i1 len=1668 path=[1675:0-1667]

Length=1668
                                                                      Score     E

ref|XP_006347470.1|  PREDICTED: ABC transporter B family member 1...    820   0.0      
ref|XP_009773193.1|  PREDICTED: ABC transporter B family member 1...    809   0.0      
ref|XP_009610807.1|  PREDICTED: ABC transporter B family member 1...    796   0.0      
ref|XP_010322491.1|  PREDICTED: ABC transporter B family member 1...    818   0.0      
ref|XP_009629787.1|  PREDICTED: ABC transporter B family member 1...    816   0.0      
gb|KDO39205.1|  hypothetical protein CISIN_1g048639mg                   780   0.0      
ref|XP_010663007.1|  PREDICTED: ABC transporter B family member 2...    763   0.0      
ref|XP_006420619.1|  hypothetical protein CICLE_v10006992mg             777   0.0      
ref|XP_006489784.1|  PREDICTED: ABC transporter B family member 1...    776   0.0      
ref|XP_007043163.1|  Multidrug/pheromone exporter, MDR family, AB...    773   0.0      
gb|KDP23114.1|  hypothetical protein JCGZ_00541                         774   0.0      
ref|XP_011075975.1|  PREDICTED: ABC transporter B family member 1...    764   0.0      
ref|XP_009352084.1|  PREDICTED: ABC transporter B family member 1...    755   0.0      
ref|XP_008234865.1|  PREDICTED: ABC transporter B family member 1...    761   0.0      
ref|XP_002321339.2|  hypothetical protein POPTR_0015s00250g             761   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002515660.1|  multidrug resistance protein 1, 2, putative        761   0.0      Ricinus communis
gb|EYU45353.1|  hypothetical protein MIMGU_mgv1a022271mg                758   0.0      
ref|XP_007219663.1|  hypothetical protein PRUPE_ppa023953mg             758   0.0      
ref|XP_008382986.1|  PREDICTED: ABC transporter B family member 1...    758   0.0      
ref|XP_010038493.1|  PREDICTED: ABC transporter B family member 1...    743   0.0      
gb|KHN02137.1|  ABC transporter B family member 19                      751   0.0      
ref|XP_007136381.1|  hypothetical protein PHAVU_009G040700g             739   0.0      
ref|XP_010038513.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    739   0.0      
gb|AES72696.2|  ABC transporter B family protein                        736   0.0      
ref|XP_010110461.1|  ABC transporter B family member 19                 736   0.0      
ref|XP_003602445.1|  ABC transporter ATP-binding protein/permease       735   0.0      
emb|CDP04961.1|  unnamed protein product                                732   0.0      
ref|XP_008813553.1|  PREDICTED: ABC transporter B family member 1...    731   0.0      
ref|XP_009788672.1|  PREDICTED: ABC transporter B family member 1...    701   0.0      
emb|CBI23123.3|  unnamed protein product                                719   0.0      
ref|XP_004169290.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    721   0.0      
ref|XP_004151913.1|  PREDICTED: ABC transporter B family member 1...    720   0.0      
ref|XP_006659119.1|  PREDICTED: ABC transporter B family member 1...    721   0.0      
ref|XP_010934699.1|  PREDICTED: ABC transporter B family member 1...    720   0.0      
gb|ACF22786.1|  MDR-like ABC transporter                                716   0.0      Brachypodium distachyon [annual false brome]
gb|KGN63320.1|  hypothetical protein Csa_2G428920                       704   0.0      
ref|XP_009420921.1|  PREDICTED: ABC transporter B family member 1...    711   0.0      
ref|XP_004972835.1|  PREDICTED: ABC transporter B family member 1...    713   0.0      
gb|EMT33289.1|  ABC transporter B family member 19                      711   0.0      
ref|XP_010934697.1|  PREDICTED: ABC transporter B family member 1...    710   0.0      
ref|XP_002443864.1|  hypothetical protein SORBIDRAFT_07g003510          709   0.0      Sorghum bicolor [broomcorn]
dbj|BAC99416.1|  putative MDR-like ABC transporter                      707   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008462855.1|  PREDICTED: ABC transporter B family member 1...    706   0.0      
emb|CAD59579.1|  MDR-like ABC transporter                               705   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006581696.1|  PREDICTED: ABC transporter B family member 1...    677   0.0      
ref|XP_004151914.1|  PREDICTED: ABC transporter B family member 1...    703   0.0      
gb|AFW57329.1|  hypothetical protein ZEAMMB73_128411                    701   0.0      
ref|XP_008662870.1|  PREDICTED: ABC transporter B family member 1...    700   0.0      
ref|XP_004173886.1|  PREDICTED: ABC transporter B family member 1...    648   0.0      
gb|EMT33290.1|  ABC transporter B family member 2                       659   0.0      
gb|EEC82914.1|  hypothetical protein OsI_27835                          656   0.0      Oryza sativa Indica Group [Indian rice]
gb|EEE68060.1|  hypothetical protein OsJ_26066                          655   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAD59578.1|  MDR-like ABC transporter                               655   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659120.1|  PREDICTED: ABC transporter B family member 1...    649   0.0      
ref|XP_003571483.1|  PREDICTED: ABC transporter B family member 1...    647   0.0      
ref|XP_008680218.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    640   0.0      
ref|XP_002443865.1|  hypothetical protein SORBIDRAFT_07g003520          633   0.0      Sorghum bicolor [broomcorn]
ref|XP_004972834.1|  PREDICTED: ABC transporter B family member 1...    632   0.0      
gb|AFW61227.1|  hypothetical protein ZEAMMB73_394985                    626   0.0      
ref|XP_010234412.1|  PREDICTED: ABC transporter B family member 1...    593   0.0      
gb|ACF22787.1|  MDR-like ABC transporter                                600   0.0      Brachypodium distachyon [annual false brome]
ref|XP_006846530.1|  hypothetical protein AMTR_s00018p00193700          530   0.0      
gb|EMT14005.1|  ABC transporter B family member 19                      514   6e-164   
ref|XP_006338462.1|  PREDICTED: ABC transporter B family member 1...    452   2e-141   
gb|ABX82929.1|  LO4                                                     450   1e-140   Solanum pennellii
ref|NP_001234209.1|  L04                                                450   1e-140   
gb|AFW59635.1|  hypothetical protein ZEAMMB73_350646                    431   2e-138   
dbj|BAF01897.1|  putative P-glycoprotein                                425   4e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827168.1|  hypothetical protein AMTR_s00010p00254310          442   7e-138   
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19      441   2e-137   
dbj|BAG96130.1|  unnamed protein product                                435   3e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19      440   6e-137   
gb|EYU34087.1|  hypothetical protein MIMGU_mgv1a000781mg                434   7e-137   
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19      439   1e-136   
ref|XP_010693227.1|  PREDICTED: ABC transporter B family member 19      438   3e-136   
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19      438   3e-136   
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                    437   6e-136   
gb|AFW58472.1|  hypothetical protein ZEAMMB73_248443                    426   9e-136   
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19      436   1e-135   
emb|CDP02220.1|  unnamed protein product                                435   3e-135   
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...    435   5e-135   
ref|XP_010439807.1|  PREDICTED: ABC transporter B family member 1...    433   5e-135   
gb|EEC77398.1|  hypothetical protein OsI_16157                          434   6e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_008804466.1|  PREDICTED: ABC transporter B family member 1...    427   6e-135   
tpg|DAA35747.1|  TPA: hypothetical protein ZEAMMB73_634725              429   7e-135   
ref|NP_001052982.1|  Os04g0459000                                       434   8e-135   Oryza sativa Japonica Group [Japonica rice]
emb|CAD59581.1|  MDR-like ABC transporter                               434   8e-135   Oryza sativa Japonica Group [Japonica rice]
gb|KEH24996.1|  ABC transporter B family protein                        434   8e-135   
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19      434   1e-134   Vitis vinifera
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...    434   1e-134   
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19      433   2e-134   
ref|XP_010108971.1|  ABC transporter B family member 19                 433   2e-134   
ref|XP_009415585.1|  PREDICTED: ABC transporter B family member 19      433   2e-134   
gb|AFW59636.1|  hypothetical protein ZEAMMB73_350646                    430   4e-134   
ref|XP_010439790.1|  PREDICTED: ABC transporter B family member 1...    432   5e-134   
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative        432   6e-134   Ricinus communis
gb|EAZ32166.1|  hypothetical protein OsJ_16371                          431   8e-134   Oryza sativa Japonica Group [Japonica rice]
gb|KDP45498.1|  hypothetical protein JCGZ_09747                         432   8e-134   
ref|XP_010439800.1|  PREDICTED: ABC transporter B family member 1...    432   8e-134   
ref|XP_009395922.1|  PREDICTED: ABC transporter B family member 1...    431   1e-133   
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 1...    431   1e-133   
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19      431   2e-133   
emb|CAD40903.1|  OSJNBa0036B21.21                                       431   2e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg             431   2e-133   
emb|CAD59582.1|  MDR-like ABC transporter                               431   2e-133   Oryza sativa Japonica Group [Japonica rice]
emb|CAC09461.2|  H0423H10.7                                             431   3e-133   Oryza sativa [red rice]
ref|XP_002448624.1|  hypothetical protein SORBIDRAFT_06g030350          431   3e-133   Sorghum bicolor [broomcorn]
ref|XP_010514603.1|  PREDICTED: ABC transporter B family member 1...    430   5e-133   
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860          429   6e-133   Sorghum bicolor [broomcorn]
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             429   6e-133   
ref|XP_008663648.1|  PREDICTED: ABC transporter B family member 1...    429   6e-133   
gb|KHG20565.1|  ABC transporter B family member 19                      429   7e-133   
ref|XP_010425667.1|  PREDICTED: ABC transporter B family member 19      429   7e-133   
ref|XP_010502886.1|  PREDICTED: ABC transporter B family member 1...    429   7e-133   
ref|XP_004977001.1|  PREDICTED: ABC transporter B family member 1...    429   7e-133   
ref|XP_006593671.1|  PREDICTED: ABC transporter B family member 1...    426   8e-133   
ref|XP_006290510.1|  hypothetical protein CARUB_v10016588mg             429   8e-133   
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...    429   1e-132   Vitis vinifera
gb|KCW46711.1|  hypothetical protein EUGRSUZ_K00531                     422   1e-132   
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19      429   1e-132   
ref|XP_002965566.1|  ATP-binding cassette transporter                   428   1e-132   
ref|XP_008668793.1|  PREDICTED: ABC transporter B family member 1...    429   1e-132   
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19      428   1e-132   
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                     428   2e-132   
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19      428   2e-132   
ref|XP_010460562.1|  PREDICTED: ABC transporter B family member 1...    427   2e-132   
ref|XP_002323847.1|  multidrug resistance P-glycoprotein                427   3e-132   Populus trichocarpa [western balsam poplar]
ref|XP_002893495.1|  P-glycoprotein 13                                  427   4e-132   
gb|EPS61919.1|  hypothetical protein M569_12874                         425   4e-132   
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...    427   4e-132   
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19      427   4e-132   
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19      427   4e-132   
ref|NP_174115.1|  ABC transporter B family member 13                    427   5e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AAN28720.2|  MDR-like p-glycoprotein                                 427   5e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877137.1|  P-glycoprotein 19                                  427   5e-132   
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19      426   7e-132   
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...    426   8e-132   
ref|XP_006603863.1|  PREDICTED: ABC transporter B family member 1...    423   9e-132   
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...    426   1e-131   
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...    426   1e-131   
gb|AIU41631.1|  ABC transporter family protein                          426   1e-131   
ref|XP_007032497.1|  ATP binding cassette subfamily B19 isoform 1       426   1e-131   
ref|XP_010552958.1|  PREDICTED: ABC transporter B family member 1...    422   1e-131   
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg             426   1e-131   
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...    426   2e-131   
ref|NP_189528.1|  ABC transporter B family member 19                    426   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...    426   2e-131   
emb|CDY65012.1|  BnaCnng45670D                                          426   2e-131   
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...    425   2e-131   
gb|KGN63323.1|  hypothetical protein Csa_2G428960                       397   3e-131   
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    425   3e-131   
dbj|BAK05967.1|  predicted protein                                      425   3e-131   
ref|XP_010266821.1|  PREDICTED: ABC transporter B family member 1...    425   3e-131   
gb|KFK33760.1|  hypothetical protein AALP_AA5G056700                    425   3e-131   
emb|CDY00109.1|  BnaC09g01920D                                          424   4e-131   
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g             424   4e-131   
ref|NP_001169660.1|  uncharacterized protein LOC100383541               424   7e-131   Zea mays [maize]
gb|KHN45492.1|  ABC transporter B family member 19                      423   7e-131   
ref|XP_006306603.1|  hypothetical protein CARUB_v10008108mg             424   9e-131   
emb|CDX86408.1|  BnaA06g31250D                                          423   1e-130   
ref|XP_010552950.1|  PREDICTED: ABC transporter B family member 1...    423   1e-130   
ref|XP_009151836.1|  PREDICTED: ABC transporter B family member 19      423   1e-130   
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...    423   2e-130   
ref|XP_002890755.1|  P-glycoprotein 14                                  422   2e-130   
ref|NP_174122.1|  ABC transporter B family member 14                    422   2e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52452.1|  Multidrug resistance protein 1, 2                       425   2e-130   
ref|XP_003579371.1|  PREDICTED: ABC transporter B family member 1...    423   2e-130   
ref|XP_011094609.1|  PREDICTED: ABC transporter B family member 1...    425   2e-130   
ref|XP_007032499.1|  ATP binding cassette subfamily B19 isoform 3       422   2e-130   
emb|CAN71068.1|  hypothetical protein VITISV_031708                     424   2e-130   Vitis vinifera
emb|CDP07374.1|  unnamed protein product                                422   2e-130   
ref|XP_006856780.1|  hypothetical protein AMTR_s00055p00102180          423   2e-130   
gb|KHG22495.1|  ABC transporter B family member 19                      422   3e-130   
dbj|BAC41846.1|  putative P-glycoprotein                                422   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010267196.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    423   7e-130   
gb|KHG30028.1|  ABC transporter B family member 1                       423   7e-130   
emb|CDY20012.1|  BnaA09g02390D                                          421   8e-130   
ref|XP_011077318.1|  PREDICTED: ABC transporter B family member 1       422   9e-130   
ref|XP_009111610.1|  PREDICTED: ABC transporter B family member 1...    421   1e-129   
ref|XP_006473688.1|  PREDICTED: ABC transporter B family member 1...    416   1e-129   
ref|XP_010501626.1|  PREDICTED: ABC transporter B family member 1...    420   1e-129   
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...    421   1e-129   
gb|EMT10010.1|  Putative multidrug resistance protein                   407   2e-129   
ref|XP_009113714.1|  PREDICTED: ABC transporter B family member 14      419   2e-129   
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    419   4e-129   
dbj|BAJ96840.1|  predicted protein                                      419   5e-129   
gb|AIU41628.1|  ABC transporter family protein                          421   6e-129   
ref|XP_009396844.1|  PREDICTED: ABC transporter B family member 2...    418   6e-129   
ref|XP_011083466.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    418   1e-128   
emb|CDP06775.1|  unnamed protein product                                418   1e-128   
ref|XP_011085762.1|  PREDICTED: ABC transporter B family member 1...    418   1e-128   
gb|EMT32511.1|  ABC transporter B family member 19                      418   1e-128   
gb|KDO72552.1|  hypothetical protein CISIN_1g000856mg                   412   2e-128   
ref|XP_002981381.1|  hypothetical protein SELMODRAFT_114581             417   2e-128   
gb|KDO84909.1|  hypothetical protein CISIN_1g000851mg                   414   2e-128   
ref|XP_003612850.1|  ABC transporter B family member                    417   2e-128   
gb|KFK33112.1|  hypothetical protein AALP_AA6G332600                    416   4e-128   
ref|XP_002969904.1|  ATP-binding cassette transporter                   416   4e-128   
ref|XP_010499288.1|  PREDICTED: ABC transporter B family member 1...    412   4e-128   
dbj|BAF02132.1|  putative ABC transporter                               406   4e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684039.1|  PREDICTED: ABC transporter B family member 1       418   5e-128   
ref|XP_008387923.1|  PREDICTED: ABC transporter B family member 1...    416   5e-128   
ref|XP_004246624.1|  PREDICTED: ABC transporter B family member 1       417   8e-128   
ref|XP_006415706.1|  hypothetical protein EUTSA_v10006583mg             416   9e-128   
ref|XP_010499287.1|  PREDICTED: ABC transporter B family member 1...    411   9e-128   
ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative        416   9e-128   Ricinus communis
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g             415   1e-127   
ref|XP_008221400.1|  PREDICTED: ABC transporter B family member 1...    414   1e-127   
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...    415   1e-127   
ref|XP_009339155.1|  PREDICTED: ABC transporter B family member 1       416   2e-127   
ref|XP_009339152.1|  PREDICTED: ABC transporter B family member 1...    416   2e-127   
ref|XP_008387548.1|  PREDICTED: ABC transporter B family member 1       416   2e-127   
ref|XP_002266505.1|  PREDICTED: ABC transporter B family member 1       416   2e-127   Vitis vinifera
ref|XP_009789853.1|  PREDICTED: ABC transporter B family member 1...    416   2e-127   
ref|XP_006432793.1|  hypothetical protein CICLE_v100000602mg            410   3e-127   
gb|KDP29159.1|  hypothetical protein JCGZ_16548                         416   3e-127   
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg             414   3e-127   
ref|XP_009609959.1|  PREDICTED: ABC transporter B family member 1       416   3e-127   
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                   414   4e-127   
ref|XP_009376834.1|  PREDICTED: ABC transporter B family member 1...    416   4e-127   
ref|XP_009377013.1|  PREDICTED: ABC transporter B family member 1       416   4e-127   
ref|XP_007204682.1|  hypothetical protein PRUPE_ppa000269mg             416   4e-127   
gb|KDO53161.1|  hypothetical protein CISIN_1g0008301mg                  410   5e-127   
ref|XP_011034998.1|  PREDICTED: ABC transporter B family member 1...    409   6e-127   
ref|XP_007156412.1|  hypothetical protein PHAVU_003G283900g             413   7e-127   
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...    413   7e-127   
gb|KHG25987.1|  ABC transporter B family member 1                       414   8e-127   
ref|XP_004173903.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    399   8e-127   
ref|XP_008369562.1|  PREDICTED: ABC transporter B family member 1...    414   1e-126   
ref|XP_006354367.1|  PREDICTED: ABC transporter B family member 1       414   1e-126   
ref|NP_001275319.1|  P-glycoprotein                                     414   1e-126   
gb|KHN30010.1|  ABC transporter B family member 2                       412   1e-126   
emb|CDY27639.1|  BnaA09g27680D                                          412   1e-126   
dbj|BAD07905.1|  putative MDR-like ABC transporter                      397   2e-126   Oryza sativa Japonica Group [Japonica rice]
gb|AES81895.2|  ABC transporter B family protein                        414   2e-126   
ref|XP_006585887.1|  PREDICTED: ABC transporter B family member 2...    412   2e-126   
ref|XP_011018746.1|  PREDICTED: ABC transporter B family member 1       414   2e-126   
ref|XP_010499286.1|  PREDICTED: ABC transporter B family member 1...    411   2e-126   
ref|XP_010499285.1|  PREDICTED: ABC transporter B family member 1...    411   3e-126   
ref|XP_004512509.1|  PREDICTED: ABC transporter B family member 2...    411   3e-126   
ref|NP_172538.1|  ABC transporter B family member 10                    411   3e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg             411   4e-126   
ref|XP_006482578.1|  PREDICTED: ABC transporter B family member 1...    411   4e-126   
gb|KDO72551.1|  hypothetical protein CISIN_1g000856mg                   411   4e-126   
ref|XP_006381407.1|  P glycoprotein1                                    413   4e-126   
ref|XP_002323485.2|  P glycoprotein1                                    412   4e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1       412   5e-126   
ref|XP_010458427.1|  PREDICTED: ABC transporter B family member 1...    410   5e-126   
emb|CDP13052.1|  unnamed protein product                                411   6e-126   
gb|EPS59348.1|  p-glycoprotein                                          404   6e-126   
gb|AFW66244.1|  hypothetical protein ZEAMMB73_446753                    400   7e-126   
gb|EMS56432.1|  ABC transporter B family member 19                      411   7e-126   
ref|XP_010480688.1|  PREDICTED: ABC transporter B family member 14      410   8e-126   
ref|XP_010478145.1|  PREDICTED: ABC transporter B family member 1...    410   8e-126   
ref|XP_010478144.1|  PREDICTED: ABC transporter B family member 1...    410   1e-125   
dbj|BAJ94109.1|  predicted protein                                      408   1e-125   
ref|XP_006471591.1|  PREDICTED: ABC transporter B family member 2...    410   1e-125   
ref|XP_010491749.1|  PREDICTED: ABC transporter B family member 10      409   1e-125   
ref|XP_007162774.1|  hypothetical protein PHAVU_001G179300g             411   1e-125   
ref|NP_001046147.2|  Os02g0190000                                       397   1e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009113725.1|  PREDICTED: ABC transporter B family member 1...    407   2e-125   
ref|XP_002517423.1|  multidrug resistance protein 1, 2, putative        395   2e-125   Ricinus communis
ref|XP_011013349.1|  PREDICTED: ABC transporter B family member 1...    411   2e-125   
gb|KHN39417.1|  ABC transporter B family member 13                      408   2e-125   
ref|XP_006431131.1|  hypothetical protein CICLE_v10010931mg             409   2e-125   
ref|XP_010677330.1|  PREDICTED: ABC transporter B family member 2...    409   3e-125   
ref|XP_010241797.1|  PREDICTED: ABC transporter B family member 1       410   3e-125   
ref|XP_002519488.1|  multidrug resistance protein 1, 2, putative        410   3e-125   Ricinus communis
gb|KDO51694.1|  hypothetical protein CISIN_1g000687mg                   410   4e-125   
ref|XP_007027421.1|  ATP binding cassette subfamily B1 isoform 3        407   4e-125   
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...    408   4e-125   
ref|XP_006428358.1|  hypothetical protein CICLE_v10010916mg             410   5e-125   
gb|KDO51692.1|  hypothetical protein CISIN_1g000687mg                   410   5e-125   
ref|XP_009113724.1|  PREDICTED: ABC transporter B family member 1...    407   6e-125   
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             407   6e-125   
gb|AIU41630.1|  ABC transporter family protein                          405   7e-125   
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    408   7e-125   
dbj|BAJ99881.1|  predicted protein                                      407   7e-125   
gb|ABG75919.1|  MDR-like ABC transporter                                408   8e-125   
ref|XP_010037650.1|  PREDICTED: ABC transporter B family member 1...    409   8e-125   
ref|XP_009113722.1|  PREDICTED: ABC transporter B family member 1...    407   8e-125   
ref|XP_002992781.1|  hypothetical protein SELMODRAFT_236608             406   1e-124   
ref|XP_009395305.1|  PREDICTED: ABC transporter B family member 1...    409   1e-124   
ref|XP_010101619.1|  ABC transporter B family member 1                  409   1e-124   
ref|XP_010037649.1|  PREDICTED: ABC transporter B family member 1...    409   1e-124   
ref|XP_008800115.1|  PREDICTED: ABC transporter B family member 2...    407   1e-124   
ref|XP_006352948.1|  PREDICTED: ABC transporter B family member 2...    407   1e-124   
gb|KHN12634.1|  ABC transporter B family member 13                      405   2e-124   
gb|KHN09525.1|  ABC transporter B family member 1                       408   2e-124   
ref|XP_008800555.1|  PREDICTED: ABC transporter B family member 1...    409   2e-124   
gb|EYU38561.1|  hypothetical protein MIMGU_mgv1a000268mg                408   2e-124   
dbj|BAJ53110.1|  JHL20J20.17                                            404   2e-124   
dbj|BAJ99824.1|  predicted protein                                      408   2e-124   
ref|XP_004245909.2|  PREDICTED: ABC transporter B family member 2...    406   3e-124   
ref|XP_003571049.1|  PREDICTED: putative multidrug resistance pro...    406   3e-124   
ref|XP_008373592.1|  PREDICTED: ABC transporter B family member 2...    406   3e-124   
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1       407   3e-124   
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    406   3e-124   
ref|XP_002965987.1|  ATP-binding cassette transporter                   405   3e-124   
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...    406   3e-124   
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg             407   4e-124   
gb|AAP72956.1|  putative MDR-like P-glycoprotein                        406   4e-124   
ref|XP_006415715.1|  hypothetical protein EUTSA_v10006582mg             405   4e-124   
ref|XP_010475946.1|  PREDICTED: ABC transporter B family member 1...    405   5e-124   
ref|XP_002989240.1|  hypothetical protein SELMODRAFT_129540             405   6e-124   
gb|KHN38940.1|  ABC transporter B family member 2                       404   7e-124   
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    405   7e-124   
gb|EYU34148.1|  hypothetical protein MIMGU_mgv1a000301mg                405   8e-124   
ref|XP_007027420.1|  ATP binding cassette subfamily B1 isoform 2        407   8e-124   
ref|XP_001774240.1|  ATP-binding cassette transporter, subfamily ...    404   9e-124   
ref|XP_003533440.1|  PREDICTED: ABC transporter B family member 2...    404   1e-123   
gb|KHN39060.1|  ABC transporter B family member 1                       404   1e-123   
ref|XP_010692517.1|  PREDICTED: uncharacterized protein LOC104905624    413   1e-123   
ref|XP_007027419.1|  ATP binding cassette subfamily B1 isoform 1        406   1e-123   
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    404   1e-123   
ref|XP_002879630.1|  ATPGP1                                             405   1e-123   
gb|KGN60047.1|  hypothetical protein Csa_3G873270                       404   1e-123   
ref|XP_003520656.1|  PREDICTED: ABC transporter B family member 1...    405   1e-123   
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...    406   2e-123   
ref|XP_004497537.1|  PREDICTED: ABC transporter B family member 1...    405   2e-123   
gb|KDP36900.1|  hypothetical protein JCGZ_08191                         403   2e-123   
ref|NP_181228.1|  ABC transporter B family member 1                     404   2e-123   
ref|XP_009334844.1|  PREDICTED: ABC transporter B family member 1...    404   2e-123   
gb|KEH42187.1|  ABC transporter B family protein                        405   2e-123   
ref|XP_010908483.1|  PREDICTED: ABC transporter B family member 2...    403   3e-123   
ref|XP_004304461.1|  PREDICTED: ABC transporter B family member 1...    405   3e-123   
ref|XP_002301961.1|  multidrug resistance P-glycoprotein                402   3e-123   
ref|XP_003535149.1|  PREDICTED: ABC transporter B family member 1...    405   4e-123   
gb|KHN48276.1|  ABC transporter B family member 1                       403   4e-123   
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...    404   4e-123   
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...    403   5e-123   
gb|KHN04865.1|  ABC transporter B family member 2                       402   5e-123   
gb|KHN02316.1|  ABC transporter B family member 1                       404   6e-123   
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...    403   6e-123   
ref|XP_010069803.1|  PREDICTED: ABC transporter B family member 1...    402   6e-123   
ref|XP_003517674.1|  PREDICTED: ABC transporter B family member 2...    402   6e-123   
ref|XP_006647008.1|  PREDICTED: LOW QUALITY PROTEIN: putative mul...    402   7e-123   
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    402   7e-123   
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg             404   7e-123   
gb|AFP44681.1|  hypothetical protein                                    404   1e-122   
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1       403   1e-122   
ref|XP_006306598.1|  hypothetical protein CARUB_v10008102mg             402   1e-122   
gb|KCW46688.1|  hypothetical protein EUGRSUZ_K00500                     398   1e-122   
gb|KGN58980.1|  Multidrug resistance protein 1, 2                       403   1e-122   
gb|EEC72653.1|  hypothetical protein OsI_06178                          399   1e-122   
ref|XP_007040641.1|  Multidrug/pheromone exporter, MDR family, AB...    401   2e-122   
ref|XP_003541417.1|  PREDICTED: ABC transporter B family member 1...    403   2e-122   
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...    403   2e-122   
ref|XP_003554389.1|  PREDICTED: ABC transporter B family member 1...    402   2e-122   
ref|XP_004137839.1|  PREDICTED: ABC transporter B family member 1...    403   2e-122   
ref|XP_008777170.1|  PREDICTED: ABC transporter B family member 2...    401   2e-122   
gb|AAM98246.1|  putative ABC transporter                                402   2e-122   
gb|EEE56476.1|  hypothetical protein OsJ_05696                          400   3e-122   
ref|XP_009396182.1|  PREDICTED: ABC transporter B family member 1...    403   3e-122   
ref|XP_011028151.1|  PREDICTED: ABC transporter B family member 2...    397   3e-122   
ref|NP_001288986.1|  ABC transporter B family member 1                  401   4e-122   
gb|AAR10387.1|  P-glycoprotein 1                                        403   4e-122   
sp|Q6YUU5.1|MDR_ORYSJ  RecName: Full=Putative multidrug resistanc...    400   4e-122   
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...    402   4e-122   
ref|XP_007158282.1|  hypothetical protein PHAVU_002G139400g             400   4e-122   
ref|XP_008679898.1|  PREDICTED: putative multidrug resistance pro...    400   5e-122   
ref|XP_002304346.1|  P-glycoprotein                                     400   5e-122   
ref|XP_004951620.1|  PREDICTED: putative multidrug resistance pro...    400   5e-122   
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             399   6e-122   
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                    400   1e-121   
gb|KDO72403.1|  hypothetical protein CISIN_1g0408752mg                  383   1e-121   
ref|XP_009398790.1|  PREDICTED: putative multidrug resistance pro...    381   2e-121   
ref|XP_009764894.1|  PREDICTED: ABC transporter B family member 2...    399   2e-121   
dbj|BAD12941.1|  putative P-glycoprotein 1                              387   2e-121   
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             398   2e-121   
ref|XP_002453447.1|  hypothetical protein SORBIDRAFT_04g006100          398   2e-121   
ref|XP_010906448.1|  PREDICTED: ABC transporter B family member 2...    398   2e-121   
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...    399   2e-121   
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    398   3e-121   
gb|EEC73824.1|  hypothetical protein OsI_08549                          398   3e-121   
ref|XP_010240898.1|  PREDICTED: ABC transporter B family member 2...    398   3e-121   
gb|KDP36504.1|  hypothetical protein JCGZ_09330                         395   3e-121   
ref|XP_002892589.1|  P-glycoprotein 10                                  397   3e-121   
gb|EEE56475.1|  hypothetical protein OsJ_05694                          398   3e-121   
ref|XP_008238211.1|  PREDICTED: ABC transporter B family member 2...    398   4e-121   
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1       399   5e-121   
emb|CDY46744.1|  BnaA03g16880D                                          399   5e-121   
emb|CDX94395.1|  BnaC01g17890D                                          397   7e-121   
ref|XP_007144334.1|  hypothetical protein PHAVU_007G147400g             398   8e-121   
ref|XP_011028150.1|  PREDICTED: ABC transporter B family member 2...    397   8e-121   
ref|XP_006282856.1|  hypothetical protein CARUB_v10006816mg             396   1e-120   
emb|CDX79704.1|  BnaC03g20400D                                          398   1e-120   
emb|CAA71277.1|  P-glycoprotein-2                                       396   1e-120   
emb|CAN63836.1|  hypothetical protein VITISV_036111                     387   1e-120   
ref|XP_006647720.1|  PREDICTED: ABC transporter B family member 2...    396   2e-120   
ref|NP_001047803.1|  Os02g0693700                                       396   2e-120   
emb|CDY48425.1|  BnaCnng16380D                                          382   2e-120   
gb|EPS64351.1|  hypothetical protein M569_10429                         396   2e-120   
gb|AAF17668.1|AC009398_17  F20B24.12                                    397   2e-120   
gb|AAM20507.1|  P-glycoprotein-2                                        395   2e-120   
ref|NP_194326.2|  P-glycoprotein 2                                      396   2e-120   
ref|XP_007017851.1|  P-glycoprotein 13                                  395   2e-120   
ref|XP_010436379.1|  PREDICTED: ABC transporter B family member 2       395   3e-120   
ref|XP_004954680.1|  PREDICTED: putative multidrug resistance pro...    395   4e-120   
emb|CDY37953.1|  BnaC05g08210D                                          394   5e-120   
ref|XP_002869639.1|  multidrug resistance protein 2                     394   5e-120   
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    395   5e-120   
gb|AET03262.2|  ABC transporter B family protein                        383   6e-120   
ref|XP_007210429.1|  hypothetical protein PRUPE_ppa000340mg             394   7e-120   
ref|NP_001130840.1|  uncharacterized protein LOC100191944               382   8e-120   
gb|AES59767.2|  ABC transporter B family protein                        394   8e-120   
ref|XP_010033242.1|  PREDICTED: ABC transporter B family member 1...    394   1e-119   
emb|CDX89380.1|  BnaA01g15130D                                          394   1e-119   
ref|XP_006854029.1|  hypothetical protein AMTR_s00048p00046670          394   1e-119   
gb|KCW52827.1|  hypothetical protein EUGRSUZ_J02160                     393   1e-119   
ref|XP_002973102.1|  ATP-binding cassette transporter                   393   1e-119   
ref|XP_008779540.1|  PREDICTED: putative multidrug resistance pro...    393   2e-119   
ref|XP_003572841.1|  PREDICTED: ABC transporter B family member 2...    393   2e-119   
ref|XP_001766529.1|  ATP-binding cassette transporter, subfamily ...    391   2e-119   
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             393   4e-119   
ref|XP_009139729.1|  PREDICTED: ABC transporter B family member 2       392   4e-119   
gb|AAF23176.1|AF216497_1  P-glycoprotein                                392   7e-119   
gb|EMT33461.1|  ABC transporter B family member 2                       392   9e-119   
ref|XP_002969903.1|  ATP-binding cassette transporter                   390   2e-118   
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      390   2e-118   
ref|XP_002994484.1|  hypothetical protein SELMODRAFT_138662             389   3e-118   
ref|XP_002877103.1|  P-glycoprotein 17                                  390   3e-118   
ref|XP_003628786.1|  ABC transporter B family member                    382   4e-118   
ref|XP_002299180.2|  P-glycoprotein                                     390   4e-118   
gb|KDO72405.1|  hypothetical protein CISIN_1g006496mg                   375   5e-118   
ref|XP_010660995.1|  PREDICTED: ABC transporter B family member 1...    387   6e-118   
gb|ADZ48235.1|  multidrug/pheromone exporter protein                    389   6e-118   
gb|EYU29874.1|  hypothetical protein MIMGU_mgv1a000299mg                389   7e-118   
ref|XP_004165322.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    387   1e-117   
gb|KHG13479.1|  ABC transporter B family member 13                      388   1e-117   
gb|AAL91219.1|  P-glycoprotein, putative                                372   1e-117   
ref|XP_011082358.1|  PREDICTED: ABC transporter B family member 2...    387   2e-117   
ref|XP_009595706.1|  PREDICTED: ABC transporter B family member 2...    387   2e-117   
emb|CDX93393.1|  BnaA06g06550D                                          387   3e-117   
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    389   3e-117   
ref|XP_010274280.1|  PREDICTED: ABC transporter B family member 2...    384   3e-117   
ref|XP_010234205.1|  PREDICTED: ABC transporter B family member 1       389   3e-117   
ref|XP_003633838.1|  PREDICTED: ABC transporter B family member 1...    387   5e-117   
ref|XP_010670369.1|  PREDICTED: ABC transporter B family member 1...    388   5e-117   
ref|XP_004304964.1|  PREDICTED: ABC transporter B family member 1...    387   6e-117   
ref|XP_011018527.1|  PREDICTED: ABC transporter B family member 2...    385   6e-117   
ref|NP_001046144.1|  Os02g0189800                                       375   7e-117   
ref|XP_004954986.1|  PREDICTED: putative multidrug resistance pro...    385   9e-117   
ref|XP_004170679.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    380   9e-117   
gb|KGN60362.1|  hypothetical protein Csa_3G901080                       386   9e-117   
ref|XP_004136398.1|  PREDICTED: ABC transporter B family member 2...    385   1e-116   
ref|XP_009335785.1|  PREDICTED: ABC transporter B family member 1...    386   1e-116   
gb|ELU12561.1|  hypothetical protein CAPTEDRAFT_175467                  369   1e-116   
ref|XP_004232253.1|  PREDICTED: ABC transporter B family member 1...    386   1e-116   
ref|XP_011009046.1|  PREDICTED: ABC transporter B family member 1...    385   1e-116   
ref|XP_011018526.1|  PREDICTED: ABC transporter B family member 2...    385   1e-116   
ref|XP_004509739.1|  PREDICTED: ABC transporter B family member 2...    383   1e-116   
ref|XP_008645880.1|  PREDICTED: uncharacterized protein LOC100384...    387   2e-116   
ref|XP_008465999.1|  PREDICTED: ABC transporter B family member 2...    385   2e-116   
dbj|BAD12940.1|  putative P-glycoprotein 1                              387   2e-116   
gb|EEE69159.1|  hypothetical protein OsJ_28307                          387   2e-116   
ref|XP_009413168.1|  PREDICTED: putative multidrug resistance pro...    385   2e-116   
ref|XP_006293094.1|  hypothetical protein CARUB_v10019381mg             384   2e-116   
ref|XP_008379304.1|  PREDICTED: ABC transporter B family member 1...    385   2e-116   
ref|XP_002877104.1|  P-glycoprotein 18                                  383   3e-116   
gb|KFK33731.1|  hypothetical protein AALP_AA5G052500                    384   3e-116   
emb|CAD59580.1|  MDR-like ABC transporter                               386   3e-116   
ref|XP_010255510.1|  PREDICTED: ABC transporter B family member 1...    384   4e-116   
gb|AES74630.2|  ABC transporter B family protein                        384   4e-116   
ref|XP_003618412.1|  ABC transporter B family member                    384   4e-116   
ref|XP_006338500.1|  PREDICTED: ABC transporter B family member 1...    384   5e-116   
ref|XP_010274279.1|  PREDICTED: ABC transporter B family member 2...    384   5e-116   
ref|XP_010552465.1|  PREDICTED: ABC transporter B family member 1...    384   6e-116   
gb|EEC84043.1|  hypothetical protein OsI_30303                          385   7e-116   
ref|XP_004974253.1|  PREDICTED: ABC transporter B family member 1...    385   8e-116   
ref|XP_004509738.1|  PREDICTED: ABC transporter B family member 2...    383   1e-115   
ref|XP_010425616.1|  PREDICTED: ABC transporter B family member 1...    382   1e-115   
ref|XP_010425615.1|  PREDICTED: ABC transporter B family member 1...    382   1e-115   
ref|XP_003618400.1|  ABC transporter B family member                    372   2e-115   
ref|XP_002452712.1|  hypothetical protein SORBIDRAFT_04g031170          382   2e-115   
ref|XP_011017682.1|  PREDICTED: putative multidrug resistance pro...    375   2e-115   
ref|XP_010055296.1|  PREDICTED: ABC transporter B family member 2...    379   2e-115   
ref|XP_003618404.1|  ABC transporter B family member                    382   2e-115   
ref|XP_008458712.1|  PREDICTED: ABC transporter B family member 1...    382   2e-115   
ref|XP_003618408.1|  ABC transporter B family member                    382   3e-115   
ref|XP_006482501.1|  PREDICTED: ABC transporter B family member 1...    382   3e-115   
ref|XP_010055295.1|  PREDICTED: ABC transporter B family member 2...    380   3e-115   
ref|XP_006482502.1|  PREDICTED: ABC transporter B family member 1...    382   3e-115   
ref|XP_006431028.1|  hypothetical protein CICLE_v10010930mg             382   3e-115   
ref|XP_008788471.1|  PREDICTED: ABC transporter B family member 1...    382   3e-115   
ref|XP_010999324.1|  PREDICTED: ABC transporter B family member 4...    382   4e-115   
gb|EPS73347.1|  hypothetical protein M569_01408                         381   4e-115   
emb|CDY27649.1|  BnaA09g27580D                                          378   5e-115   
gb|AES74622.2|  ABC transporter B family protein                        382   5e-115   
ref|XP_009603539.1|  PREDICTED: ABC transporter B family member 2...    380   6e-115   
ref|XP_010942174.1|  PREDICTED: putative multidrug resistance pro...    380   6e-115   
gb|EYU46879.1|  hypothetical protein MIMGU_mgv1a000296mg                381   6e-115   
ref|XP_004952829.1|  PREDICTED: putative multidrug resistance pro...    381   7e-115   
ref|XP_002453446.1|  hypothetical protein SORBIDRAFT_04g006090          380   8e-115   
ref|XP_004953524.1|  PREDICTED: ABC transporter B family member 2...    380   8e-115   
ref|XP_004167222.1|  PREDICTED: ABC transporter B family member 1...    358   1e-114   
ref|XP_010425612.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    380   1e-114   
ref|XP_009151889.1|  PREDICTED: ABC transporter B family member 15      380   1e-114   
ref|XP_008676453.1|  PREDICTED: uncharacterized protein LOC100191...    380   1e-114   
dbj|BAF00235.1|  P-glycoprotein                                         373   2e-114   



>ref|XP_006347470.1| PREDICTED: ABC transporter B family member 10-like [Solanum tuberosum]
Length=748

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/543 (77%), Positives = 480/543 (88%), Gaps = 4/543 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  D+K KV  YS IFASIG++S F +TLQHYL+GV+GEKAMTNLR +LY+ATL+NELAW
Sbjct  207   YHPDSKEKVALYSAIFASIGVVSLFAHTLQHYLFGVIGEKAMTNLRQALYTATLRNELAW  266

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN++GSLTS+I ++TSTVKIIISDRMSVIVQCISSI+IATTVSM V+WRMGLVAWA
Sbjct  267   FEKPENSIGSLTSKIASDTSTVKIIISDRMSVIVQCISSILIATTVSMKVNWRMGLVAWA  326

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD++ AHSE+V+L SESA NIKTV SFCHEE ++ KA+++
Sbjct  327   VMPCHFIGGLIQAKSAKGFSGDSSLAHSELVALTSESATNIKTVASFCHEEQILQKAKLS  386

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L + + ESIKFGIIQG SLCLWNIAHAVALWYTT+LV R+Q+SF N IR+YQIFSL
Sbjct  387   LKRPLRKGKSESIKFGIIQGISLCLWNIAHAVALWYTTILVDRNQASFENGIRAYQIFSL  446

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +LKPVFQ LDR T I PD P+ S  E+I+GE+EF  ++F 
Sbjct  447   TVPSITELWTLIPTVISAIEVLKPVFQILDRSTEIVPDMPDISKPETIKGEIEFLNVQFC  506

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSR EV VLN F+L+IEAG+KVALVG SGAGKSS++ALLLRFYD +EGKVLIDGKD+RD
Sbjct  507   YPSRREVTVLNNFSLQIEAGLKVALVGESGAGKSSIVALLLRFYDTNEGKVLIDGKDIRD  566

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLRAQIGLVQQEPLLF CSIRENICYGSERASEAEI+EVS++ANIH FISNLP+GY
Sbjct  567   YNLRKLRAQIGLVQQEPLLFSCSIRENICYGSERASEAEIVEVSRSANIHEFISNLPDGY  626

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKGSQLSGGQKQR+AIARALLK+P IMLLDEATSALD+ SERAVVSALES+    
Sbjct  627   DTLVGEKGSQLSGGQKQRVAIARALLKKPRIMLLDEATSALDTESERAVVSALESM----  682

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K   S  +K+TQITVAHRLSTV+NSD IVVMDKG +VE GSHS L ++PDGVYSR V LQ
Sbjct  683   KLNSSGITKVTQITVAHRLSTVINSDTIVVMDKGKIVEKGSHSNLMAEPDGVYSRFVRLQ  742

Query  1622  SMK  1630
             SM+
Sbjct  743   SME  745


 Score =   103 bits (258),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 90/145 (62%), Gaps = 24/145 (17%)
 Frame = +2

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG++G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE+ V  ALE+  Q   
Sbjct  4     THVGQRGLQLSGGQKQRIAIARAILKNPPILLLDEATSALDTESEKQVQEALETAAQ---  60

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGS--HSTLTS------------  1582
              GR      T I +AHR+ST+VN+D+I +++ G +V + S  +S+L S            
Sbjct  61    -GR------TVILIAHRMSTIVNADMIAIVEDGKIVRLNSIPYSSLQSDWLIDNEMHLID  113

Query  1583  QPDGVYSRLVSLQSMKDH*HTQLHE  1657
             + +    +++S+Q      HTQ  E
Sbjct  114   RLEATNRKVLSIQEDSSQDHTQPDE  138



>ref|XP_009773193.1| PREDICTED: ABC transporter B family member 14-like [Nicotiana 
sylvestris]
Length=640

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/543 (76%), Positives = 479/543 (88%), Gaps = 4/543 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y+ D+K KV  YSVIF SIGLLS F +TLQHYL+GV GEKAMTNLR +LY+A L+NELAW
Sbjct  102   YNPDSKEKVARYSVIFTSIGLLSLFAHTLQHYLFGVAGEKAMTNLRQALYTAALRNELAW  161

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE PEN++G LTSRIVNETSTVK II+DRMSVIVQCISSI+IATTVSM V+WRMGLVAWA
Sbjct  162   FENPENSIGPLTSRIVNETSTVKTIIADRMSVIVQCISSILIATTVSMKVNWRMGLVAWA  221

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             +MPCHFIGGL+QAKSAKGFS D+  AHSE+VSLASES  NIKTV +FC+E  ++ KA++ 
Sbjct  222   IMPCHFIGGLVQAKSAKGFSSDSAVAHSELVSLASESTMNIKTVAAFCYETQILEKAKLY  281

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L   L + R ESIK+GIIQG SLC+WN+AHAVALWYTT+LV ++Q+SF + IRSYQIFSL
Sbjct  282   LTRPLRKGRAESIKYGIIQGISLCVWNVAHAVALWYTTVLVDKNQASFEDGIRSYQIFSL  341

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTVLSAIGILKPVFQ+LDRCT I PD P+ + +ESI+GE+EF+ ++F 
Sbjct  342   TVPSITELWTLIPTVLSAIGILKPVFQSLDRCTEIVPDMPDNASTESIKGEIEFQNVQFR  401

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV+VLN F+L+IEAG+K+A+VGPSGAGKSS++ALLLRFYDV+EGKVLID KD+RD
Sbjct  402   YPSRPEVLVLNNFSLQIEAGVKMAIVGPSGAGKSSILALLLRFYDVNEGKVLIDSKDIRD  461

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLRAQIGLVQQEPLLF CSIR NI YGSE+ASE+EIIEVS+ ANIH FISNLP GY
Sbjct  462   YNLRKLRAQIGLVQQEPLLFSCSIRNNIRYGSEKASESEIIEVSREANIHEFISNLPNGY  521

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTV+GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALD+ SERAVV+ALES++ ++
Sbjct  522   DTVLGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDTESERAVVNALESMKLNN  581

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G    +KMTQITVAHRLSTV+NSD IVVMDKG +VE GSHSTL ++ D VYSRLV LQ
Sbjct  582   YGG----TKMTQITVAHRLSTVINSDTIVVMDKGKLVEKGSHSTLMAELDSVYSRLVRLQ  637

Query  1622  SMK  1630
             S++
Sbjct  638   SVE  640



>ref|XP_009610807.1| PREDICTED: ABC transporter B family member 14-like [Nicotiana 
tomentosiformis]
Length=640

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/543 (75%), Positives = 476/543 (88%), Gaps = 4/543 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y+ D+K KV  YS IF SIGLLS F +TLQHYL+GV GEKAMTNLR +LY+A L+NELAW
Sbjct  102   YNPDSKEKVARYSAIFTSIGLLSLFAHTLQHYLFGVAGEKAMTNLRRALYTAALRNELAW  161

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+ GSLTSRIVNETSTVK II+DRMSVIVQCISSI+IATTVSM V+WRMGLVAWA
Sbjct  162   FEKPENSTGSLTSRIVNETSTVKAIIADRMSVIVQCISSILIATTVSMKVNWRMGLVAWA  221

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             V PCHFIGG++QAKSAKGFS D+  AHSE+VSLASES  NIKTV +FC+E  ++ KA++ 
Sbjct  222   VKPCHFIGGMVQAKSAKGFSSDSAVAHSELVSLASESTMNIKTVAAFCYETQILEKAKLC  281

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L + R ESIK+GIIQG SLCLWNIAHAVALWYTT+LV ++Q+SF + IRSYQIFSL
Sbjct  282   LKRPLRKGRTESIKYGIIQGISLCLWNIAHAVALWYTTVLVNKNQASFEDGIRSYQIFSL  341

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTVLSAIG+LKPVF++LD CT I PD P+ + +E+I+GE+EF+ +KF 
Sbjct  342   TVPSITELWTLIPTVLSAIGVLKPVFESLDWCTEIVPDMPDNASTENIKGEIEFQNVKFR  401

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             Y SRPEVMVLN F+++IEAG+K+A+VGPSGAGKSS++ALLLRFYDV+EGKVLID KD+R 
Sbjct  402   YSSRPEVMVLNNFSMQIEAGVKMAIVGPSGAGKSSILALLLRFYDVNEGKVLIDSKDIRG  461

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLR QIGLVQQEPLLF CSIR+NI YGSE+ASEAEIIEVS+ ANIH FISNLP GY
Sbjct  462   YNLRKLRVQIGLVQQEPLLFSCSIRDNIRYGSEKASEAEIIEVSREANIHEFISNLPNGY  521

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTV+GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALD+ SERAVVSALES++ ++
Sbjct  522   DTVLGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDTESERAVVSALESMKLNN  581

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G    +K+TQITVAHRLST++NSD IVVMDKG +VE GSHSTL ++ D VYSRLV LQ
Sbjct  582   YGG----TKVTQITVAHRLSTIINSDTIVVMDKGKLVEKGSHSTLMAELDSVYSRLVRLQ  637

Query  1622  SMK  1630
             S++
Sbjct  638   SVE  640



>ref|XP_010322491.1| PREDICTED: ABC transporter B family member 19-like [Solanum lycopersicum]
Length=1260

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/543 (76%), Positives = 479/543 (88%), Gaps = 4/543 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  D+K KV  YS IFASIG++S F +TLQHYL+GV+GEKAMTNLR +LY+ATL+NELAW
Sbjct  719   YHPDSKEKVALYSAIFASIGVVSLFAHTLQHYLFGVIGEKAMTNLRQALYTATLRNELAW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN++GSLTS+I ++TSTVKIIISDRMSVIVQC+SSI+IATTVSM V+WRMGLVAWA
Sbjct  779   FEKPENSIGSLTSKIASDTSTVKIIISDRMSVIVQCVSSILIATTVSMKVNWRMGLVAWA  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD++ AHS++V+L SESA NIKTV SFCHEE ++ KA+++
Sbjct  839   VMPCHFIGGLIQAKSAKGFSGDSSLAHSKLVALTSESATNIKTVASFCHEEQILEKAKLS  898

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L + + ESIKFGIIQG SLCLWNIAHAVALWYTT+LV R+Q+SF N IR+YQIFSL
Sbjct  899   LKRPLRKGKSESIKFGIIQGISLCLWNIAHAVALWYTTILVDRNQASFENGIRAYQIFSL  958

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +LKPVFQ LDR T I PD P+ +  E+I+GE+EF  ++F 
Sbjct  959   TVPSITELWTLIPTVISAIDVLKPVFQILDRSTEIVPDMPDIAKPETIKGEIEFLNVQFC  1018

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV VLN F+L+IEAG+KVALVG SGAGKSS++ALLLRFYD +EG VLIDGKD+RD
Sbjct  1019  YPSRPEVTVLNNFSLQIEAGLKVALVGESGAGKSSIVALLLRFYDTNEGNVLIDGKDIRD  1078

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLRAQIGLVQQEPLLF CSIRENICYGSERASEAEI+EVS++ANIH FISNLP+GY
Sbjct  1079  YNLRKLRAQIGLVQQEPLLFSCSIRENICYGSERASEAEIVEVSRSANIHEFISNLPDGY  1138

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKGSQLSGGQKQR+AIARALLK+P IMLLDEATSALD+ SER VVSALES+    
Sbjct  1139  DTLVGEKGSQLSGGQKQRVAIARALLKKPRIMLLDEATSALDTESERTVVSALESM----  1194

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K   S  +K+TQITVAHRLSTV+NSD IVVMDKG +VE GSHS L ++P+GVYSR V LQ
Sbjct  1195  KLNSSGITKVTQITVAHRLSTVINSDTIVVMDKGKIVEKGSHSNLMAEPEGVYSRFVRLQ  1254

Query  1622  SMK  1630
             SM+
Sbjct  1255  SME  1257


 Score =   274 bits (701),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 182/513 (35%), Positives = 285/513 (56%), Gaps = 13/513 (3%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ +  LR    +  L+ ++  F+  E   G + + I N  S ++  I +++   + CI+
Sbjct  129   QRQVARLRLKFLNTVLRQDIGAFD-TELTTGKVLTGISNHMSLIQDTIGEKLGHFLSCIA  187

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ +  W + L++  V+P   + G    K     S    A  SE  S+  E+ 
Sbjct  188   TFGSGVLIAFVSCWEVSLLSLIVVPLIMLTGASYTKRMSEISNIKMAYLSEATSMVEETI  247

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
             + I+TV +F  E   +      ++ Q+  S+KE++  G+  GT   +   + ++ +W   
Sbjct  248   SQIRTVFAFVGENLSIKSFSDCIERQMRISKKEALIKGLGTGTFQTITFASWSLIVWVGA  307

Query  656   LLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPD  835
             ++V   +S+  + I +         S+T     I     A    K VFQ +DR   I+ D
Sbjct  308   VVVTAKRSTGGDVIAAVMSILFGAISLTYAAPDIQIFNQAKAAGKEVFQIIDRKPTIDAD  367

Query  836   KPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIA  1015
                 +  E I+G +  + + F YPSR E +VL GF+L I AG  VALVG SG GKS++++
Sbjct  368   SGGITF-EVIDGNINIRDVHFAYPSRQEKLVLQGFSLSIPAGTVVALVGSSGCGKSTIMS  426

Query  1016  LLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEA  1195
             LL+RFYD   G++L+D  +++D +L+ LR  IG+V QEP LF  SI++NI  G+  A++ 
Sbjct  427   LLMRFYDPVRGEILLDNHNIKDLDLKFLRRNIGVVSQEPSLFAGSIKDNIKMGNINANDQ  486

Query  1196  EIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEAT  1375
             +I   +  AN H+FIS LP  Y T VG++G QLSGGQKQRIAIARA+LK P I+LLDEAT
Sbjct  487   QIERAALLANAHSFISQLPNQYLTEVGQRGLQLSGGQKQRIAIARAILKNPPILLLDEAT  546

Query  1376  SALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVE  1555
             SALD+ SE+ V  ALE+  Q    GR      T I +AHR+ST+VN+D+I +++ G VV 
Sbjct  547   SALDTESEKQVQEALETAAQ----GR------TVILIAHRMSTIVNADMIAIVEDGKVVV  596

Query  1556  MGSHSTLTSQPDGVYSRLVSLQSMKDH*HTQLH  1654
              G+H+ L       Y+RL  +QS+     T+L 
Sbjct  597   TGTHNNLLDTSI-FYNRLFCMQSITQDCQTRLE  628



>ref|XP_009629787.1| PREDICTED: ABC transporter B family member 19-like [Nicotiana 
tomentosiformis]
Length=1272

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/542 (77%), Positives = 480/542 (89%), Gaps = 4/542 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  D+K KV  YS IFASIG+LS F NTLQHYL+G+VGEKAMTNLR +LY+ATL+NELAW
Sbjct  718   YHPDSKEKVALYSAIFASIGVLSLFANTLQHYLFGIVGEKAMTNLRRALYTATLRNELAW  777

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN +GSLTSRIV++T TVKIIISDRMSVIVQCISSIVIATTVSMIV+WRM LVAWA
Sbjct  778   FEKPENGIGSLTSRIVSDTFTVKIIISDRMSVIVQCISSIVIATTVSMIVNWRMSLVAWA  837

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFS D T AHSE+V+LASESA NIKTV SFCHEE ++ KA+++
Sbjct  838   VMPCHFIGGLIQAKSAKGFSDDGTLAHSELVALASESATNIKTVASFCHEEQILEKAKLS  897

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L + + ESIKFGIIQGTSLCLWNIAHAVALWYTT+LV R+Q+SF N IR+YQIFSL
Sbjct  898   LKRPLRKGKTESIKFGIIQGTSLCLWNIAHAVALWYTTILVDRNQASFENGIRAYQIFSL  957

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTVLSAI +LKPVFQ LDRCT I PD P+ S  E+I+GE+EF  + F 
Sbjct  958   TVPSITELWTLIPTVLSAIDVLKPVFQNLDRCTEIIPDAPDTSEHETIKGEIEFLNVLFC  1017

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V+VLN F+L++EAG+KVALVG SGAGKSS++ALLLRFYD++EGKVLIDGKD+R 
Sbjct  1018  YPSRPKVIVLNNFSLQVEAGLKVALVGQSGAGKSSIVALLLRFYDINEGKVLIDGKDIRY  1077

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLRAQIGLVQQEPLLF CSIRENICYGSERASEAEI+EVS++ANIH FISNLP+GY
Sbjct  1078  YNLRKLRAQIGLVQQEPLLFSCSIRENICYGSERASEAEIVEVSRSANIHEFISNLPDGY  1137

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKGSQLSGGQKQRIAIARALLK+P IMLLDEATSALD+ SERAVVSAL S++  +
Sbjct  1138  DTLVGEKGSQLSGGQKQRIAIARALLKKPRIMLLDEATSALDTESERAVVSALGSMKL-N  1196

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              FG    +K+TQITVAHRLSTV+NSD I+VMDKG +VE GSHS L ++ DGVYSR V LQ
Sbjct  1197  SFG---GTKVTQITVAHRLSTVINSDTIIVMDKGKIVEKGSHSNLMAETDGVYSRFVRLQ  1253

Query  1622  SM  1627
             S+
Sbjct  1254  SI  1255


 Score =   250 bits (639),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 179/511 (35%), Positives = 277/511 (54%), Gaps = 13/511 (3%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ +  LR    SA L+ ++  F+  +   G + + I N  S ++  I +++   + CI+
Sbjct  128   QRQVAGLRLKFLSAVLRQDIGAFD-TDITSGKVLTGISNHMSLIQDTIGEKLGHFLSCIA  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L++  V+P   + G    K     S       SE  S+  ++ 
Sbjct  187   TFGSGVLIAFISCWEVSLLSLLVVPLIMLTGASYTKRMSLISNKKMTYLSEATSMVEQTI  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
             + I+TV +F  E   +       + Q+  S+KE+   G+  G    +   + A+ +W   
Sbjct  247   SQIRTVFAFVGENLSIKSFSDCTERQMSISKKEAFIKGLGTGMFQTITFSSWALIVWVGA  306

Query  656   LLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPD  835
             ++V   +SS  + I +         S+T     I     A    + VFQ +DR   I  D
Sbjct  307   VVVAARRSSGGDVIAAVMSILFGAISLTYAAPDIQIFNQAKAAGREVFQMIDRKPTINAD  366

Query  836   KPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIA  1015
                 +  E I+G ++ + + F YPSR E +VL GF+L I AG   ALVG SG GKS++++
Sbjct  367   SGRMTF-EVIDGNIKIQDVHFAYPSRQEKLVLQGFSLTIPAGKVAALVGSSGCGKSTIMS  425

Query  1016  LLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEA  1195
             LL+RFYD   G +L+D  +++D +L+ LR  IG+V QEP LF  SI++NI  G+  A + 
Sbjct  426   LLMRFYDPMRGDILLDNHNIKDLDLKFLRRHIGVVSQEPSLFAGSIKDNIKMGNIDADDQ  485

Query  1196  EIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEAT  1375
             +I   +  AN H FIS LP+ Y T VG+ G QLSGGQKQRIAIAR++LK P I+LLDEAT
Sbjct  486   QIERAALLANAHAFISQLPDQYLTEVGQSGRQLSGGQKQRIAIARSILKNPPILLLDEAT  545

Query  1376  SALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVE  1555
             SALD+ SE+ V  ALE+  Q    GR      T I +AHR+ST+VN+D+I +++ G VVE
Sbjct  546   SALDTESEKQVQEALETAAQ----GR------TVILIAHRMSTIVNADMIAIVENGKVVE  595

Query  1556  MGSHSTLTSQPDGVYSRLVSLQSMKDH*HTQ  1648
              G+H  L       Y+ L S+Q + +   T+
Sbjct  596   TGTHHNLLDTST-FYNSLFSMQHISEECQTR  625



>gb|KDO39205.1| hypothetical protein CISIN_1g048639mg [Citrus sinensis]
Length=1139

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/542 (72%), Positives = 464/542 (86%), Gaps = 0/542 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD  AK++VGWYS+ F+ +GL S FT+TLQHY +GVVGEKAMTNLR +LY+  L+NE+AW
Sbjct  595   YDPQAKQEVGWYSLAFSLVGLFSLFTHTLQHYFFGVVGEKAMTNLRRTLYTGVLRNEIAW  654

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N+ GSLTSRIV++TS VK IISDRMSVIVQCISSI+IAT VS++VDWRM LVAWA
Sbjct  655   FEKPQNDAGSLTSRIVSDTSMVKAIISDRMSVIVQCISSILIATIVSLVVDWRMALVAWA  714

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSA+GFSGD+ AAH+E +SL SESA+NI+TV SFCHEE+++ KA+++
Sbjct  715   VMPCHFIGGLIQAKSAQGFSGDSAAAHTEFISLTSESASNIRTVASFCHEENILQKAKIS  774

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+     SRKESIK+G+IQG SLCLWNIAHAVALWYT +L+ + Q++F + IR+YQIFSL
Sbjct  775   LEKTKRSSRKESIKYGVIQGFSLCLWNIAHAVALWYTAVLIDKKQATFRDGIRAYQIFSL  834

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +L P F+ LDR T IEPD PE S S  I+G +EF+ IKF+
Sbjct  835   TVPSITELWTLIPTVISAITVLAPAFEILDRKTEIEPDAPESSESGRIKGRIEFQNIKFN  894

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV VLN F+L+IE G+KVALVGPSGAGKSSV+ALLLRFYD +EG +LIDGK +++
Sbjct  895   YPSRPEVTVLNNFSLQIEPGLKVALVGPSGAGKSSVLALLLRFYDPNEGIILIDGKGIKE  954

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR+LR+QIGLVQQEPLLF CSIR NICYG+E ASEAEI+EVSK ANIH FIS+LP+GY
Sbjct  955   YNLRRLRSQIGLVQQEPLLFSCSIRNNICYGNEAASEAEIVEVSKKANIHDFISSLPDGY  1014

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKG QLSGGQKQRIAIAR LLKRPAIMLLDEATSALD+ SER +VSALE+L    
Sbjct  1015  DTVVGEKGCQLSGGQKQRIAIARTLLKRPAIMLLDEATSALDAESERVIVSALEALNPKS  1074

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                    S+ TQITVAHRL+TV+NSD+IVVMDKG VVEMGSHSTL ++  GVYSRL  LQ
Sbjct  1075  SSCGELASRTTQITVAHRLATVINSDVIVVMDKGEVVEMGSHSTLVAESQGVYSRLYQLQ  1134

Query  1622  SM  1627
             + 
Sbjct  1135  AF  1136


 Score =   273 bits (697),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 169/481 (35%), Positives = 263/481 (55%), Gaps = 20/481 (4%)
 Frame = +2

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
             + G + + + +  S ++  I +++   +   ++      +++I  W + L+ + V+P   
Sbjct  33    STGKVITGVSSHMSVIRDAIGEKLGHFLSSFATFFSGVLIAVICCWEVSLLIFLVVPMIL  92

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
             + G    K     S       SE  S+  ++ + IKTV +F  E   +      +  Q+ 
Sbjct  93    VIGATYTKRMNAVSATKLLYLSEATSMIEQTISQIKTVFAFVGERSEIKSFSDCMDKQII  152

Query  560   RSRKES----IKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
              SR E+    +  G+ Q  + C W    A+ +W   ++V   +S+    + +        
Sbjct  153   ISRGEALIKGVGLGMFQSVTFCCW----ALIIWVGAVVVTAKRSTGGEVLAAVMSILFGA  208

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYP  907
              ++T     +     A      +FQ + R  RI      + L E I+G ++ + + F YP
Sbjct  209   IALTYAAPDMQVFNQAKAAGFEIFQVIQRKPRISYSSKGKEL-EKIDGNIDIRDVCFAYP  267

Query  908   SRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYN  1087
             SRP+ ++L GF+L I AG  VALVG SG GKS+VI+L+ RFYD   G +LID  +++D +
Sbjct  268   SRPDQLILKGFSLSIPAGKMVALVGSSGCGKSTVISLVARFYDPSNGDILIDSLNIKDLD  327

Query  1088  LRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDT  1267
             L+ LR  IG V QEP LF  S+ +NI  G+  A + +I   S  AN H+FIS LP+ Y T
Sbjct  328   LKSLRKNIGAVSQEPSLFTGSLMDNIKVGNMDADDEQIYNASMMANAHSFISQLPDQYST  387

Query  1268  VVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKF  1447
              +G++G QLSGGQKQRIAIARA++K P I+LLDEATSALDS SE+ V  ALE   Q    
Sbjct  388   ELGQRGVQLSGGQKQRIAIARAIVKNPPILLLDEATSALDSESEKLVQEALERAMQ----  443

Query  1448  GRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             GR      T I +AHR+ST+VN+D+I V++ G V E G+H +L    D  Y+RL ++Q++
Sbjct  444   GR------TVILIAHRMSTIVNADMIAVVEDGQVTETGTHHSLLQTSD-FYNRLFTMQNL  496

Query  1628  K  1630
             +
Sbjct  497   R  497



>ref|XP_010663007.1| PREDICTED: ABC transporter B family member 21-like [Vitis vinifera]
Length=783

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/549 (71%), Positives = 465/549 (85%), Gaps = 7/549 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYS----ATLQN  169
             Y  DAK++VG YS++F+ IGLLS FT+TLQHY +GV+GEKAMTNLR +LYS      L N
Sbjct  238   YKEDAKQRVGLYSILFSLIGLLSLFTHTLQHYFFGVIGEKAMTNLRQALYSEILSGILNN  297

Query  170   ELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGL  349
             ELAWFE+PENNVGSLTSRI+N+TSTVK IISDRMSVIVQCISSI+IAT V+M ++WRMGL
Sbjct  298   ELAWFEKPENNVGSLTSRIINDTSTVKTIISDRMSVIVQCISSILIATIVTMKLNWRMGL  357

Query  350   VAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNK  529
             VAWAVMPCHFIGGLIQAK AKGFS  + AAH E+V+LASESA N+KT+ SFCHE+ +++K
Sbjct  358   VAWAVMPCHFIGGLIQAKFAKGFSSGSAAAHCELVALASESATNMKTIASFCHEDFILDK  417

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
             A++AL+P + +SR+ SIK+GIIQG SLCLWNIAHAVALWYT +LV+R Q++F N IRSYQ
Sbjct  418   AKIALEPPMRKSRRASIKYGIIQGFSLCLWNIAHAVALWYTAVLVERDQATFENGIRSYQ  477

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             IFSLTVPSITELWTLIPTV+SAI IL P F+TLDR T IEPD PE S +E I+G +EF+ 
Sbjct  478   IFSLTVPSITELWTLIPTVISAISILTPTFKTLDRKTEIEPDTPENSHAEKIKGRIEFQN  537

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F+YP RPEV VLN F L+IEAG KVALVGPSGAGKSSV+AL+LRFYD   G++LID K
Sbjct  538   VSFNYPLRPEVTVLNNFCLQIEAGSKVALVGPSGAGKSSVLALILRFYDPRAGRILIDRK  597

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R+YNLR+LR++IGLVQQEPLLF  SIR+NICYG++ ASE EIIEV++ A IH FISNL
Sbjct  598   DIRNYNLRRLRSRIGLVQQEPLLFSSSIRDNICYGNDGASETEIIEVAREARIHEFISNL  657

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
               GYDTVVG+KG QLSGGQKQRIAIAR LLKRPAI+LLDEATSALD+ SERAVVSALES 
Sbjct  658   SHGYDTVVGQKGCQLSGGQKQRIAIARTLLKRPAILLLDEATSALDTQSERAVVSALEST  717

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
             + ++       S+ TQITVAHRLSTV+NSD I+VMDKG +VEMG HSTL +  DG+YS+L
Sbjct  718   KLNNN---GDLSRTTQITVAHRLSTVINSDTIIVMDKGEIVEMGPHSTLIAVSDGLYSKL  774

Query  1610  VSLQSMKDH  1636
             V LQS+ ++
Sbjct  775   VQLQSLGEN  783


 Score =   137 bits (346),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 102/148 (69%), Gaps = 11/148 (7%)
 Frame = +2

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + E+  V+  AN H+FI+ LP+ Y T VGE+G QLSGGQKQRIAIARA++K P I+LL
Sbjct  3     ADDQEVQNVALMANAHSFITQLPDQYSTEVGERGVQLSGGQKQRIAIARAIIKNPPILLL  62

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V +A+E   Q    GR      T I +AHR+STV+N+D+I V++ G
Sbjct  63    DEATSALDSESEKLVQAAIEKAMQ----GR------TVILIAHRMSTVINADMIAVIENG  112

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V E G+HS L    +  Y+ L ++Q++
Sbjct  113   QVKETGTHSDLLDTSN-FYNNLFNMQNL  139



>ref|XP_006420619.1| hypothetical protein CICLE_v10006992mg [Citrus clementina]
 gb|ESR33859.1| hypothetical protein CICLE_v10006992mg [Citrus clementina]
Length=1264

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/542 (72%), Positives = 463/542 (85%), Gaps = 0/542 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD  AK++VGWYS+ F+ +GL S FT+TLQHY +GVVGEKAMTNLR +LY+  L+NE+AW
Sbjct  720   YDPQAKQEVGWYSLAFSLVGLFSLFTHTLQHYFFGVVGEKAMTNLRRTLYTGVLRNEIAW  779

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N+ GSLT RIV++TS VK IISDRMSVIVQCISSI+IAT VS++VDWRM LVAWA
Sbjct  780   FEKPQNDAGSLTLRIVSDTSMVKAIISDRMSVIVQCISSILIATIVSLVVDWRMALVAWA  839

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSA+GFSGD+ AAH+E +SL SESA+ I+TV SFCHEE+++ KA+++
Sbjct  840   VMPCHFIGGLIQAKSAQGFSGDSAAAHTEFISLTSESASKIRTVASFCHEENILQKAKIS  899

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+     SRKESIK+G+IQG SLCLWNIAHAVALWYT +L+ + Q++F + IR+YQIFSL
Sbjct  900   LEKTKRSSRKESIKYGVIQGFSLCLWNIAHAVALWYTAVLIDKKQATFRDGIRAYQIFSL  959

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +L P F+ LDR T IEPD PE S S  I+G +EF+ +KF+
Sbjct  960   TVPSITELWTLIPTVISAITVLAPAFEILDRKTEIEPDAPESSESGRIKGRIEFQNVKFN  1019

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV VLN F+L++E G+KVALVGPSGAGKSSV+ALLLRFYD +EG++LIDGKD+++
Sbjct  1020  YPSRPEVTVLNNFSLQMEPGLKVALVGPSGAGKSSVLALLLRFYDPNEGRILIDGKDIKE  1079

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR+LR+QIGLVQQEPLLF CSIR NICYG+E ASEAEI+EVSK ANIH FIS+LP GY
Sbjct  1080  YNLRRLRSQIGLVQQEPLLFSCSIRNNICYGNEAASEAEIVEVSKKANIHDFISSLPRGY  1139

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKG QLSGGQKQRIAIAR LLKRPAIMLLDEATSALD+ SER +VSALE+L    
Sbjct  1140  DTVVGEKGCQLSGGQKQRIAIARTLLKRPAIMLLDEATSALDAESERVIVSALEALNPKS  1199

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                    S+ TQITVAHRL+TV+NSD+IVVMDKG VVEMGSHSTL ++  GVYSRL  LQ
Sbjct  1200  SSCGELASRTTQITVAHRLATVINSDVIVVMDKGEVVEMGSHSTLVAESQGVYSRLYQLQ  1259

Query  1622  SM  1627
             + 
Sbjct  1260  AF  1261


 Score =   286 bits (732),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 179/509 (35%), Positives = 277/509 (54%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +T LR +   A L  E+  F+  + + G + + + N  S ++  I +++   +   +
Sbjct  131   ERQVTRLRIAYLRAVLNQEVGAFD-TDLSTGKVITGVSNHMSVIRDAIGEKLGHFLSSFA  189

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      +++I  W + L+ + V+P   + G    K     S       SE  S+  ++ 
Sbjct  190   TFFSGVLIAVICCWEVSLLIFLVVPMILVIGATYTKRMNAVSATKLLYLSEATSMIEQTI  249

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   +      +  Q+  SR E+    +  G+ Q  + C W    A+ +
Sbjct  250   SQIKTVFAFVGERSEIKSFSDCMDKQIIISRGEALIKGVGLGMFQSVTFCCW----ALII  305

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   +S+    + +         ++T     +     A      +FQ + R  R
Sbjct  306   WVGAVVVTAKRSTGGEVLAAVMSILFGAIALTYAAPDMQVFNQAKAAGFEIFQVIQRKPR  365

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I      + L E I+G ++ + + F YPSRP+ ++L GF+L I AG  VALVG SG GKS
Sbjct  366   ISYSSKGKEL-EKIDGNIDIRDVCFAYPSRPDQLILKGFSLSIPAGKMVALVGSSGCGKS  424

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+L+ RFYD   G +LID  +++D +L+ LR  IG V QEP LF  S+ +NI  G+  
Sbjct  425   TVISLVARFYDPSNGDILIDSHNIKDLDLKSLRKNIGAVSQEPSLFAGSLMDNIKVGNMD  484

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + +I   S  AN H+FIS LP+ Y T +G++G QLSGGQKQRIAIARA++K P I+LL
Sbjct  485   ADDEQIYNASMMANAHSFISQLPDQYSTELGQRGVQLSGGQKQRIAIARAIVKNPPILLL  544

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE   Q    GR      T I +AHR+ST+VN+D+I V++ G
Sbjct  545   DEATSALDSESEKLVQEALERAMQ----GR------TVILIAHRMSTIVNADMIAVVEDG  594

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V E G+H TL    D  Y+RL ++Q+++
Sbjct  595   QVTETGTHHTLLQTSD-FYNRLFTMQNLR  622



>ref|XP_006489784.1| PREDICTED: ABC transporter B family member 19-like [Citrus sinensis]
Length=1264

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/542 (72%), Positives = 464/542 (86%), Gaps = 0/542 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD  AK++VGWYS+ F+ +GL S FT+TLQHY +GVVGEKAMTNLR +LY+  L+NE+AW
Sbjct  720   YDPQAKQEVGWYSLAFSLVGLFSLFTHTLQHYFFGVVGEKAMTNLRRTLYTGVLRNEIAW  779

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N+ GSLTSRIV++TS VK IISDRMSVIVQCISSI+IAT VS++VDWRM LVAWA
Sbjct  780   FEKPQNDAGSLTSRIVSDTSMVKAIISDRMSVIVQCISSILIATIVSLVVDWRMALVAWA  839

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSA+GFSGD+ AA++E +SL SESA+NI+TV SFCHEE+++ KA+++
Sbjct  840   VMPCHFIGGLIQAKSAQGFSGDSAAANTEFISLTSESASNIRTVASFCHEENILQKAKIS  899

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+     SRKESIK+G+IQG SLCLWNIAHAVALWYT +L+ + Q++F + IR+YQIFSL
Sbjct  900   LEKTKRSSRKESIKYGVIQGFSLCLWNIAHAVALWYTAVLIDKKQATFRDGIRAYQIFSL  959

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +L P F+ LDR T IEPD PE S S  I+G +EF+ IKF+
Sbjct  960   TVPSITELWTLIPTVISAITVLAPAFEILDRKTEIEPDAPESSESGRIKGRIEFQNIKFN  1019

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV VLN F+L+IE G+KVALVGPSGAGKSSV+ALLLRFYD +EG +LIDGK +++
Sbjct  1020  YPSRPEVTVLNNFSLQIEPGLKVALVGPSGAGKSSVLALLLRFYDPNEGIILIDGKGIKE  1079

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR+LR+QIGLVQQEPLLF CSIR NICYG+E ASEAEI+EVSK ANIH FIS+LP+GY
Sbjct  1080  YNLRRLRSQIGLVQQEPLLFSCSIRNNICYGNEAASEAEIVEVSKKANIHDFISSLPDGY  1139

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKG QLSGGQKQRIAIAR LLKRPAI++LDEATSALD+ SER +VSALE+L    
Sbjct  1140  DTVVGEKGCQLSGGQKQRIAIARTLLKRPAIIVLDEATSALDAESERVIVSALEALNPKS  1199

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                    S+ TQITVAHRL+TV+NSD+IVVMDKG VVEMGSHSTL ++  GVYSRL  LQ
Sbjct  1200  SSCGELASRTTQITVAHRLATVINSDVIVVMDKGEVVEMGSHSTLVAESQGVYSRLYQLQ  1259

Query  1622  SM  1627
             + 
Sbjct  1260  AF  1261


 Score =   281 bits (718),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 177/509 (35%), Positives = 277/509 (54%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +T LR +   A L  E+  F+  + + G + + + +  S ++  I +++   +   +
Sbjct  131   ERQVTRLRIAYLRAVLNQEVGAFD-TDLSTGKVITGVSSHMSVIRDAIGEKLGHFLSSFA  189

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      +++I  W + L+ + V+P   + G    K     S       SE  S+  ++ 
Sbjct  190   TFFSGVLIAVICCWEVSLLIFLVVPMILVIGATYTKRMNAVSATKLLYLSEATSMIEQTI  249

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   +      +  Q+  SR E+    +  G+ Q  + C W    A+ +
Sbjct  250   SQIKTVFAFVGERSEIKSFSDCMDKQIIISRGEALIKGVGLGMFQSVTFCCW----ALII  305

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   +S+    + +         ++T     +     A      +FQ + R  R
Sbjct  306   WVGAVVVTAKRSTGGEVLAAVMSILFGAIALTYAAPDMQVFNQAKAAGFEIFQVIQRKPR  365

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I      + L + I+G ++ + I F YPSRP+ ++L GF+L I AG  VALVG SG GKS
Sbjct  366   ISYSSKGKEL-DKIDGNIDIRDICFAYPSRPDQLILKGFSLSIPAGKMVALVGSSGCGKS  424

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+L+ RFYD   G +LID  +++D +L+ LR  IG V QEP LF  S+ +NI  G+  
Sbjct  425   TVISLVARFYDPSNGDILIDSLNIKDLDLKSLRKNIGAVSQEPSLFAGSLMDNIKVGNMD  484

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + +I   S  AN H+FIS LP+ Y T +G++G QLSGGQKQRIAIARA++K P I+LL
Sbjct  485   ADDEQIYNASMMANAHSFISQLPDQYSTELGQRGVQLSGGQKQRIAIARAIVKNPPILLL  544

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE   Q    GR      T I +AHR+ST+VN+D+I V++ G
Sbjct  545   DEATSALDSESEKLVQEALERAMQ----GR------TVILIAHRMSTIVNADMIAVVENG  594

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V E G+H +L    D  Y+RL ++Q+++
Sbjct  595   QVTETGTHHSLLQTSD-FYNRLFTMQNLR  622



>ref|XP_007043163.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
[Theobroma cacao]
 gb|EOX98994.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
[Theobroma cacao]
Length=1256

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/541 (73%), Positives = 463/541 (86%), Gaps = 2/541 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DA++ VG YS+IF+ IGLL+   +TLQHY YGVVGEKAM NLR +LYS  L+NEL W
Sbjct  714   YKKDARQLVGRYSIIFSLIGLLALVMHTLQHYFYGVVGEKAMANLRQALYSGILRNELTW  773

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+VGSLTSR++N+TS VK IISDRMSVIVQCISSI+IAT VSMIVDWRMGLVAWA
Sbjct  774   FEKPENSVGSLTSRVINDTSMVKTIISDRMSVIVQCISSILIATVVSMIVDWRMGLVAWA  833

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF+G++ A H EVV+LASESAANI+T+ SFCHEEH++ KA  +
Sbjct  834   VMPCHFIGGLIQAKSAKGFAGNSAATHREVVALASESAANIRTIASFCHEEHIIRKAAKS  893

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    RSRKESIK+GIIQG SLCLWNIAHAVALWYTT+LV R Q+SF+NAIRSYQIFSL
Sbjct  894   LEKPKKRSRKESIKYGIIQGFSLCLWNIAHAVALWYTTILVGRRQASFVNAIRSYQIFSL  953

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP  +SAI +L P F+TLDR T IEPD PE+S  E I+G++EF+ +KF+
Sbjct  954   TVPSITELWTLIPAAISAINVLTPAFETLDRRTEIEPDTPEDSRLERIKGKIEFQNVKFN  1013

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RPEV VLN F+L+IE G K+ALVGPSGAGKSSV+A+LLRFYD  +G+VLIDGK++++
Sbjct  1014  YPLRPEVTVLNNFSLQIEPGTKIALVGPSGAGKSSVLAILLRFYDPWKGRVLIDGKNIKE  1073

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SIR+NICYG+E ASE EI+EVS+ ANIH FISNLP+G+
Sbjct  1074  YNLRMLRRQIGLVQQEPLLFSSSIRDNICYGTEHASETEIVEVSREANIHEFISNLPDGF  1133

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKG Q+SGGQKQRIAIAR LLKRPAI+LLDEATSALD  SER +V+ALES+ +  
Sbjct  1134  DTVVGEKGCQVSGGQKQRIAIARTLLKRPAILLLDEATSALDVESERTIVNALESIDKKG  1193

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G    S+ TQITVAHRLSTV+NSD+IVVMDKG +VE+GSHSTL S  +GVYSRLV LQ
Sbjct  1194  NGG--FLSRPTQITVAHRLSTVINSDVIVVMDKGEIVEIGSHSTLISASEGVYSRLVQLQ  1251

Query  1622  S  1624
             S
Sbjct  1252  S  1252


 Score =   270 bits (689),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 268/508 (53%), Gaps = 21/508 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ M  LR +   A L  ++  F+  +   G + S +  + S ++  I +++   +   +
Sbjct  122   ERQMARLRLAFLRAMLNQDIGAFD-TDLTSGKIISGMSYDMSIIQDAIGEKLGHFLSSFA  180

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +   A  ++ I  W + L+ + V P   + G    K     S       SE  SL  ++ 
Sbjct  181   TFFSAIFIAAICCWEVSLLMFVVAPMILVIGGTYTKKMNAISATKMLYISEATSLVEQTV  240

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   +      L+ Q   S+ E+    +  G+ Q  + C W    A+ +
Sbjct  241   SQIKTVFAFVGENSAIKSFSECLEKQFSLSKGEALIKGVGTGMFQTVTFCAW----ALII  296

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V   ++   + I +         S+T     I     A      VF+ + R   
Sbjct  297   WIGAIAVTSRKAKGGDVIAAVMSILFGSVSLTFAAPDIEIFNQAKAAGYEVFKVIRRKPA  356

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  D   + + E I G ++ + + F YPSRPE ++L GF+L I AG   ALVG SG GKS
Sbjct  357   ISYDSRGKEV-EKIGGNIKIRDVYFAYPSRPEKLILQGFSLSIPAGKMAALVGSSGCGKS  415

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+L+ RFYD  +G++LI   +++D +L+ LR  IG V QEP LF  +I++NI  G+  
Sbjct  416   TVISLVERFYDPSKGEILIGNHNIKDLDLKFLRKNIGAVSQEPSLFAGTIKDNIKVGNMD  475

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A++ +I + +  AN HTF+S LP  Y T VG++G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  476   ANDRQIQDAAILANAHTFVSQLPNQYSTEVGQRGVQLSGGQKQRIAIARAILKNPPILLL  535

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALD  SE+ V  ALE   Q    GR      T I +AHR+ST++N+DII V++ G
Sbjct  536   DEATSALDLESEKLVQDALEKAMQ----GR------TVILIAHRMSTIINADIIAVVENG  585

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V E G+H +L       Y  L S+Q +
Sbjct  586   QVTETGTHRSLLDSSR-FYKNLFSIQDI  612



>gb|KDP23114.1| hypothetical protein JCGZ_00541 [Jatropha curcas]
Length=1292

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/544 (73%), Positives = 468/544 (86%), Gaps = 2/544 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DAKR+VGWYS+IFA IGLLS+FT+TLQHY +G+VGEKAMTNLR +LYS  L+NELAW
Sbjct  750   YKKDAKRQVGWYSIIFALIGLLSFFTHTLQHYFFGIVGEKAMTNLRVALYSGILRNELAW  809

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+VGSLTSRI+++TS VK IISDRMSVIVQCISSI+IAT VSM+V+WRMGLVAWA
Sbjct  810   FEKPENSVGSLTSRIIHDTSMVKTIISDRMSVIVQCISSILIATVVSMVVNWRMGLVAWA  869

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAK A+GFSGD+ AAH E+V+LASESAANI+T+ SFCHEEH++ KA++ 
Sbjct  870   VMPCHFIGGLIQAKFARGFSGDSAAAHYELVALASESAANIRTIASFCHEEHILKKAKIC  929

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    +SRK+SIK+G+IQG SLCLWNIAHAVALWYTT LV+RHQ+SF + IRSYQIFSL
Sbjct  930   LEKPKKKSRKQSIKYGLIQGVSLCLWNIAHAVALWYTTRLVERHQASFEDGIRSYQIFSL  989

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T+PSITELWTLIPTV+SAI +L PVF+TLDR T IEPD P+ S  + I G+VEF+ +KF 
Sbjct  990   TIPSITELWTLIPTVISAISVLTPVFETLDRETEIEPDAPKNSHVKQIMGKVEFQNVKFK  1049

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RPEV+VLN F+L+IE+G +VALVGPSGAGKSSV+ALL RFYD ++G+VLID  D+++
Sbjct  1050  YPLRPEVVVLNNFSLKIESGSRVALVGPSGAGKSSVLALLTRFYDPEKGRVLIDEMDIKE  1109

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SIR+NI YGSE ASE EII+VS+ ANIH FISNLP+GY
Sbjct  1110  YNLRMLRTQIGLVQQEPLLFSSSIRDNIIYGSEGASETEIIKVSREANIHEFISNLPDGY  1169

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +TVVGEKG QLSGGQKQRIA+AR LLKRPAI+LLDEATSALD+ SER+VVSALES+  + 
Sbjct  1170  NTVVGEKGCQLSGGQKQRIAVARTLLKRPAILLLDEATSALDAESERSVVSALESINLNS  1229

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                 SS  + TQITVAHRLSTV NSD IVVMDKG +VE GSHSTL +   GVY+RL  LQ
Sbjct  1230  N--ESSLYRTTQITVAHRLSTVKNSDTIVVMDKGEIVERGSHSTLVTMSGGVYARLYQLQ  1287

Query  1622  SMKD  1633
             ++ +
Sbjct  1288  NLTE  1291


 Score =   266 bits (681),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 176/534 (33%), Positives = 278/534 (52%), Gaps = 43/534 (8%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L  E+  F+    + G + + + N  S ++  I +++   +   +
Sbjct  132   ERQLARLRLAFMEAVLSQEIGAFDTDLTS-GKIITGVTNHMSIIEDAIGEKLGHFLSSFA  190

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + LV   V+P   + G    K     S       SE  ++  ++ 
Sbjct  191   AFFSGILIAAICSWEVALVTLLVVPMILVIGATYTKKMNAISAAKMLYLSEATAMVEQAI  250

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
               IKTV SF  E H +     ++  QL   + E++  G+  G    +   + A+ +W   
Sbjct  251   CQIKTVFSFVGENHEIKSFSQSMFKQLSLGKGEALVKGVGTGMFQTVTFTSWALIIWVGA  310

Query  656   LLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPD  835
             ++V  ++SS    I           S+T     +     A      VFQ + R + I  +
Sbjct  311   IVVTANRSSGGEVIAVVMSILFGAISLTHAAPDMQIFNQAKAAGTEVFQIIQRKSLINHN  370

Query  836   KPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIA  1015
                + L+E +EG ++ + + F YPSR E ++L GF+L I AG  VALVG SG GKS++I+
Sbjct  371   SKGKMLNE-VEGNIDIREVHFAYPSRQENLILKGFSLSIPAGKMVALVGSSGCGKSTIIS  429

Query  1016  LLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEA  1195
             L+ RFYD  +G++LID  ++++++L+ LR  IG V QEP LF  +I++N+  G+  A++ 
Sbjct  430   LVARFYDPQKGEILIDNHNIKEFDLKFLRRNIGAVSQEPSLFAGTIKDNLKVGNMDANDQ  489

Query  1196  EIIEVSKAANIHTFISNLPEGYDT------------------------------VVGEKG  1285
             +I + +  AN H+FIS LP+ Y T                              + GE+G
Sbjct  490   QIQDAALMANAHSFISQLPDQYLTQMGASNTVCNSLKDLKLQKLLLVCKDIALMLTGERG  549

Query  1286  SQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPS  1465
              QLSGGQKQRIAIARA+LK P I+LLDEATSALDS SE+ V  ALE   +    GR    
Sbjct  550   VQLSGGQKQRIAIARAILKNPPILLLDEATSALDSESEKQVQDALERAME----GR----  601

Query  1466  KMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
               T I +AHRLST+VN+D+I V++ G V E G+HS+L +  +  Y  L ++Q++
Sbjct  602   --TVILIAHRLSTIVNADMIAVVENGQVTETGTHSSLLA-TNNFYINLFNMQNI  652



>ref|XP_011075975.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1228

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/545 (72%), Positives = 465/545 (85%), Gaps = 11/545 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y ++AK  VG YS+IF+SIG LS F +TLQHY +GVVGE AMTNLR +LY+A L+NELAW
Sbjct  695   YKNNAKHIVGMYSIIFSSIGFLSLFAHTLQHYFFGVVGENAMTNLRRALYAAILRNELAW  754

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+VGS+TSR++NETSTVK IISDRMSVIVQCISSIVIAT VS+ V+WRMGLVAWA
Sbjct  755   FEKPENSVGSITSRVINETSTVKTIISDRMSVIVQCISSIVIATIVSIKVNWRMGLVAWA  814

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFS  ++AA+SE+V+LASES +NIKT+ SFC E+HV+ KA+V 
Sbjct  815   VMPCHFIGGLIQAKSAKGFSSGSSAAYSELVALASESTSNIKTIASFCQEDHVIMKAKVT  874

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L +SRK+S+K+GIIQG SLCLWNIAHAVALWYTT+LV+R Q+SF + IRSYQIFSL
Sbjct  875   LKKPLMQSRKQSVKYGIIQGVSLCLWNIAHAVALWYTTILVERGQASFEDGIRSYQIFSL  934

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV SAI IL PVFQTLDR T IEPD P++S  +SI+GE+EF+ + F 
Sbjct  935   TVPSITELWTLIPTVFSAISILTPVFQTLDRQTEIEPDSPKQSPHKSIKGEIEFRNVNFF  994

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             +PSRPEV VL+ F+L+IEAG KVALVGPSGAGKSSV+ALLLRFYDV+EG+V+IDGKD++ 
Sbjct  995   FPSRPEVRVLDDFSLKIEAGSKVALVGPSGAGKSSVLALLLRFYDVNEGEVVIDGKDIKR  1054

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLR QIGLVQQEPLLF CSIR+NICYG+E ASEAEII+ +  ANIH  ISNLP GY
Sbjct  1055  YNLRKLRTQIGLVQQEPLLFSCSIRDNICYGNEGASEAEIIQAAMDANIHQVISNLPGGY  1114

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGEKG QLSGGQKQRIAIAR LLK+P+IMLLDEATSALD+ SERA++ ALESL+   
Sbjct  1115  ETAVGEKGCQLSGGQKQRIAIARVLLKKPSIMLLDEATSALDAESERAIIYALESLKL--  1172

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                     + T +TVAHR+STV+NSD I VMDKG VVEMGSH+ L +  DGVYSRL  LQ
Sbjct  1173  --------RATHVTVAHRMSTVINSDTIFVMDKGKVVEMGSHAALLA-ADGVYSRLSRLQ  1223

Query  1622  SMKDH  1636
             ++ ++
Sbjct  1224  TVLEN  1228


 Score =   259 bits (663),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 182/525 (35%), Positives = 280/525 (53%), Gaps = 44/525 (8%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +T LR +   A L  E+  F+    + G + S I +  S ++  I +++   + C +
Sbjct  112   ERQITRLRLTFLKAVLSQEIGAFDTDLTS-GKIISGISSHMSIIQDAIGEKLGHFLSCFA  170

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+A  V+P     G    K     S    +  SE  ++  +S 
Sbjct  171   TFFSGVLIAFISCWEVSLLALFVVPMILAIGATYTKKMNAISATRMSFLSEATAMVEQSI  230

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESI----KFGIIQGTSLCLWNIAHAVAL  643
             +++KTV +F  E   +      L  QLH S+ E+       G+ Q  + C W    A+ +
Sbjct  231   SHVKTVFAFVGENSAIKSFSECLARQLHLSKNEAFVKGFGTGMFQIVTFCSW----ALIV  286

Query  644   WYTTLLV---QRHQSSFLNAIRS--YQIFSLT--VPSITELWTLIPTVLSAIGILKPVFQ  802
             +   ++V   + H    + A+ S  +   SLT   P +      I     A G  K VFQ
Sbjct  287   FVGAIVVVAGRAHGGDVIAAVMSILFGAISLTYAAPDMQ-----IFNQAKAAG--KEVFQ  339

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              ++R   I  ++ E  + + + G ++   + F YPSR E ++L GF+L I AG  VALVG
Sbjct  340   VIERKPMIYTNR-EGKILDLVNGSIDIYDVHFAYPSRKETLILQGFSLSIPAGKVVALVG  398

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS++++L+ RFYD  +G +LID   ++D +L+ LR  IGLV QEP LF  +I++N
Sbjct  399   SSGCGKSTIMSLITRFYDPIKGDILIDNHSIKDLDLKFLRRNIGLVSQEPSLFSGNIKDN  458

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             I  G+  A + +I    KAA +       PE Y T VG++G QLSGGQKQRIAIARA+LK
Sbjct  459   IKAGNSNADDDQI---QKAAQM------FPEQYLTEVGQRGVQLSGGQKQRIAIARAILK  509

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALD+ SE+ V +ALE+  Q            T I +AHRLST+VN+D+
Sbjct  510   NPPILLLDEATSALDTESEKVVQAALETAMQER----------TVILIAHRLSTIVNADM  559

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMKDH*HTQLHE  1657
             I V++ G V E G+H  L +  +  Y  L  LQ++    +T++ +
Sbjct  560   IAVVENGIVAETGTHQDLLTN-NKFYHNLFELQNISQESYTRVED  603



>ref|XP_009352084.1| PREDICTED: ABC transporter B family member 19-like [Pyrus x bretschneideri]
Length=1025

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/542 (70%), Positives = 459/542 (85%), Gaps = 6/542 (1%)
 Frame = +2

Query  11    DAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER  190
             DAKR V  YS+ F+ IG LS F++T+QHYL+G++GEKAMTNLR +LYS  L+NE+ W+E+
Sbjct  490   DAKRHVEKYSIAFSLIGFLSLFSHTVQHYLFGIIGEKAMTNLRLALYSGLLRNEIGWYEK  549

Query  191   PENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP  370
             PEN +G LTSRI+N+TS VK II+DRMSVIVQCISSI+IAT VSM V+WRMGLVAWAVMP
Sbjct  550   PENGIGLLTSRIINDTSMVKTIIADRMSVIVQCISSILIATVVSMFVNWRMGLVAWAVMP  609

Query  371   CHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQP  550
             CHFIGGL+QAKSA+GFSGD  A H+E+V+LASESA NI+TV SFCHE+H++ KAR++L+ 
Sbjct  610   CHFIGGLVQAKSAQGFSGDAAATHAELVTLASESATNIRTVASFCHEDHILRKARISLEN  669

Query  551   QLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP  730
                R R+ESIK+GIIQG SLCLWNIAHAVALWYTT+LV ++Q+SF N IR+YQIFSLTVP
Sbjct  670   PKKRCRRESIKYGIIQGISLCLWNIAHAVALWYTTVLVGKNQASFENGIRAYQIFSLTVP  729

Query  731   SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             SITELWTLIPTV+SAIG+L P FQTLDR T IEPD PE S  + I+G++EF+ +KF+YP 
Sbjct  730   SITELWTLIPTVISAIGVLTPAFQTLDRKTEIEPDTPESSNPDRIKGDIEFQNVKFNYPL  789

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RPEV VLN F+L+IEAG KVA VGPSGAGKSSV+ALLLRFYD  EG++LIDGK++R+YNL
Sbjct  790   RPEVTVLNDFSLQIEAGRKVAFVGPSGAGKSSVLALLLRFYDPMEGRILIDGKEIREYNL  849

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR QIGLVQQEPLLF  SI+ NICYG+E ASEAEI+EVS+ ANIH FI NLP+GY+TV
Sbjct  850   RWLRRQIGLVQQEPLLFSSSIKANICYGTEEASEAEIVEVSREANIHEFICNLPDGYETV  909

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGEKG QLSGGQKQRIAIAR LLKRPAI+LLDEATSALD+ SE++VVSALE++       
Sbjct  910   VGEKGCQLSGGQKQRIAIARTLLKRPAILLLDEATSALDAESEQSVVSALEAINLR----  965

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
               S SK TQIT+AHRLST+++SD IVVMDKG +VE GSHS L +  +GVYSRL  LQ++ 
Sbjct  966   --SLSKTTQITIAHRLSTIIHSDTIVVMDKGKIVETGSHSALITASEGVYSRLYQLQNLG  1023

Query  1631  DH  1636
             + 
Sbjct  1024  EE  1025


 Score =   250 bits (638),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 153/384 (40%), Positives = 217/384 (57%), Gaps = 20/384 (5%)
 Frame = +2

Query  482   IKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVALWY  649
             IKTV +F  E   +      +  Q   S+ E+    +  G++Q  S   W    A+ +W 
Sbjct  17    IKTVYAFVGECSAIKSFSDCMAKQYFLSKGEALIKGVGTGMLQSVSFGSW----ALIVWV  72

Query  650   TTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIE  829
               ++V   ++S    + +         S+T     +     A      VFQ ++R   I 
Sbjct  73    GAVVVTAKRASGGEILAAVMSILFGAISLTYAAPDMQIFNQATAAGTAVFQVINRKPVIS  132

Query  830   PDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSV  1009
              +  E  + E I G ++   + F YPSRP+  +L GF+L I AG  VA VG SG GKS++
Sbjct  133   YNS-EGKILEEIHGNIDIHEVHFSYPSRPDRAILQGFSLSIPAGKTVAFVGSSGCGKSTI  191

Query  1010  IALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERAS  1189
             I+L+ RFYD  +G++LID  +++D +L+ LR  +G V QEP LF  SI +N+  G   A 
Sbjct  192   ISLVARFYDPLKGEILIDNHNIKDLDLKFLRKNVGAVSQEPALFAGSISDNMKVGKMDAE  251

Query  1190  EAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDE  1369
             + EI + +  AN HTFIS LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LLDE
Sbjct  252   DEEIQKAAVMANAHTFISQLPDQYSTEVGQRGVQLSGGQKQRIAIARAILKNPPILLLDE  311

Query  1370  ATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCV  1549
             ATSALDS SE+ V  AL+   Q    GR      T I +AHRLST++N+D+I V++ G V
Sbjct  312   ATSALDSESEKVVQDALDKAMQ----GR------TVILIAHRLSTIINADMIAVVESGRV  361

Query  1550  VEMGSHSTLTSQPDGVYSRLVSLQ  1621
              E G+H +L       Y+ L S+Q
Sbjct  362   SETGTHHSLLDSSK-FYNNLFSMQ  384



>ref|XP_008234865.1| PREDICTED: ABC transporter B family member 19-like [Prunus mume]
Length=1246

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/545 (71%), Positives = 464/545 (85%), Gaps = 2/545 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD+DAKR+V  YS+IF+ I  LS F++T+QHY++G+VGEKAMTNLR +LYS  L+NE+AW
Sbjct  704   YDNDAKREVEHYSIIFSLIAFLSLFSHTVQHYIFGMVGEKAMTNLRRALYSGVLRNEIAW  763

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PENN+G LTSRI+N+TS VK II+DRMSVIVQCISSI+IAT VSM V+WRMGLVAWA
Sbjct  764   FEKPENNIGPLTSRIINDTSMVKTIIADRMSVIVQCISSILIATIVSMYVNWRMGLVAWA  823

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD  AAHSE+V+LASESA NI+TV SFCHE+HV+ KA+++
Sbjct  824   VMPCHFIGGLIQAKSAKGFSGDAAAAHSELVTLASESATNIRTVASFCHEDHVLRKAKIS  883

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    + R+ESIK+GIIQG SLCLWNIAHAVALWYTT+L+ RHQ+SF N+IRSYQIFSL
Sbjct  884   LENPRRKCRRESIKYGIIQGVSLCLWNIAHAVALWYTTVLIDRHQASFKNSIRSYQIFSL  943

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +L P FQTLDR T IEP  PE+S  + I+G +EF+ IKF+
Sbjct  944   TVPSITELWTLIPTVISAISVLTPAFQTLDRKTEIEPAIPEDSNLDRIKGSIEFQNIKFN  1003

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RPEV VLN F+L+IEAG KVA VGPSGAGKSSV+ALLLRFYD  EG++LID K++R+
Sbjct  1004  YPLRPEVTVLNNFSLQIEAGRKVAFVGPSGAGKSSVLALLLRFYDPMEGRILIDRKEIRE  1063

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SI+ NICYG++ ASE EI+EVSK ANI  FISNLP+GY
Sbjct  1064  YNLRWLRRQIGLVQQEPLLFSSSIKANICYGTDGASETEIVEVSKEANIDEFISNLPDGY  1123

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +TVVGEKG QLSGGQKQRIAIAR LLKRPAI+LLDEATSALD+ SE++VVSAL ++   +
Sbjct  1124  ETVVGEKGCQLSGGQKQRIAIARTLLKRPAILLLDEATSALDAESEKSVVSALAAINLRN  1183

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G    SK TQITVAHRLST++NSD I+VMDKG +VE+GSHS L +  +GVYSRL  LQ
Sbjct  1184  NGG--ILSKTTQITVAHRLSTIINSDTIIVMDKGKIVEIGSHSALITATEGVYSRLYQLQ  1241

Query  1622  SMKDH  1636
             ++ + 
Sbjct  1242  NLAEE  1246


 Score =   274 bits (700),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 180/508 (35%), Positives = 277/508 (55%), Gaps = 21/508 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L+ E+  F+  +   G + + I N  S ++  I +++   + C++
Sbjct  114   ERQVARLRLAYLRAVLRQEIGAFD-TDLTSGKIITGISNHMSIIQDAIGEKLGHFLSCLA  172

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+ + V+P   I G    K     S       SE  S+  ++ 
Sbjct  173   TFFSGILIAAICCWEVALLTFLVVPLILIIGATYTKKMNAISAARMLYQSEATSMVEQTI  232

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E+  +      +  Q   S+ E+    +  G++Q  S   W    A+ +
Sbjct  233   SQIKTVYAFVGEKSAIKSFSECMGKQYLLSKGEALIKGVGTGMLQSVSFGSW----ALII  288

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   ++S  + I +         S+T     +     A      VF+ L+R   
Sbjct  289   WVGAVVVTATRASGGDIIAAVMSILFGAISLTYAAPDMQIFNQAKAAGTEVFKVLNREPV  348

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  D   ++L+E I G ++   + F YPSRPE  +L GF+L I AG  VA VG SG GKS
Sbjct  349   ISYDSKGKTLNE-IYGSIDIHDVHFSYPSRPERAILQGFSLSIPAGQTVAFVGSSGCGKS  407

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             ++I+L+ RFYD  +G++LID  +V+D +L+ LR  IG V QEP LF  +I++N+  G   
Sbjct  408   TIISLVARFYDPSKGEILIDNHNVKDLDLKFLRKNIGAVSQEPSLFGGTIKDNMKVGKMD  467

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + EI + +  AN H+FIS LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  468   AEDEEIQKAAVMANAHSFISQLPDDYSTEVGQRGVQLSGGQKQRIAIARAILKNPPILLL  527

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  AL+   Q    GR      T I +AHRLST++N+D+I V++ G
Sbjct  528   DEATSALDSESEKVVQDALDKAMQ----GR------TVILIAHRLSTIINADMIAVVENG  577

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V E G+H  L    +  Y+ L ++Q++
Sbjct  578   QVTETGTHRKLLDSSN-FYNNLFAMQNL  604



>ref|XP_002321339.2| hypothetical protein POPTR_0015s00250g [Populus trichocarpa]
 gb|EEF05466.2| hypothetical protein POPTR_0015s00250g [Populus trichocarpa]
Length=1275

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/542 (71%), Positives = 457/542 (84%), Gaps = 2/542 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DA  +V W+S++FA IGLLS FT+TLQHY +G VGEKAM NLR +LYS  L NELAW
Sbjct  733   YKEDANSRVVWFSIMFALIGLLSLFTHTLQHYFFGAVGEKAMANLRQALYSGVLLNELAW  792

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN VGSLTSRI+N+TS VKIIISDRMSVIVQC+SSI+IAT VSM+V+WRMGLVAWA
Sbjct  793   FEKPENTVGSLTSRIINDTSKVKIIISDRMSVIVQCLSSILIATIVSMVVNWRMGLVAWA  852

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD+ AAH E+V LASES ANI+T+ SFCHEE ++ KA++ 
Sbjct  853   VMPCHFIGGLIQAKSAKGFSGDSAAAHYELVELASESTANIRTIASFCHEEQILKKAKIC  912

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    RSRKESIK+G+IQG SLCLWNIAHAVALWYTT LV +HQ++FL+ IRSYQIFSL
Sbjct  913   LENPKRRSRKESIKYGLIQGVSLCLWNIAHAVALWYTTHLVDKHQATFLDGIRSYQIFSL  972

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAIG+L P F+TLDR T I+PD P+    E+I G +EF+ I+F+
Sbjct  973   TVPSITELWTLIPTVISAIGVLAPAFETLDRETEIQPDIPKSPDLETIVGRIEFQNIQFN  1032

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RPEV VL+ F+L+IEAG+KVALVGPSG+GKSSV+ALLLRFYD  EG+VLID KD+R+
Sbjct  1033  YPLRPEVTVLHNFSLQIEAGLKVALVGPSGSGKSSVLALLLRFYDPREGRVLIDKKDIRE  1092

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLR QIG VQQEPLLF  SIR+NI YG+E ASE EI++VS+ ANIH F+SN P+GY
Sbjct  1093  YNLRKLRRQIGWVQQEPLLFSSSIRDNIIYGNEGASETEIVKVSREANIHEFVSNFPDGY  1152

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKG QLSGGQKQRIAIAR LLKRPAI+LLDEATSALD+ +ER++VSAL S++ + 
Sbjct  1153  DTVVGEKGCQLSGGQKQRIAIARTLLKRPAILLLDEATSALDTETERSIVSALGSVKLND  1212

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                R S    TQITVAHR+STV NSD I VMDKG +V+MGSHS L +  DG+YSRL  LQ
Sbjct  1213  N--RGSGYTTTQITVAHRISTVKNSDTIAVMDKGEIVQMGSHSALIATSDGLYSRLYQLQ  1270

Query  1622  SM  1627
             ++
Sbjct  1271  NL  1272


 Score =   275 bits (702),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 176/515 (34%), Positives = 282/515 (55%), Gaps = 35/515 (7%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L  ++  F+   +  G + + + N  S ++  I +++   +   +
Sbjct  130   ERQLARLRFAFLEAVLSQDVGAFDTDLSG-GKIITGVTNHMSIIQDAIGEKLGHFLSSFA  188

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L++  V+P   + G    K     S       SE  S+  ++ 
Sbjct  189   TFFSGILIAAICCWEVALLSLLVVPMILVIGATYTKKMNTVSTVKLLYLSEATSMVEQTV  248

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + I+TV +F  E + +     ++  QL +S+ E+    +  G  Q  + C W    A+ +
Sbjct  249   SQIRTVFAFVGESYAIKTFSESMAKQLSKSKVEALIKGVGIGTFQTVTFCSW----ALII  304

Query  644   WYTTLLV---QRHQSSFLNAIRS--YQIFSLT--VPSITELWTLIPTVLSAIGILKPVFQ  802
             W   ++V   + H    L AI S  +   SLT   P +      I     A G    +F 
Sbjct  305   WVGAVVVTAKRAHGGDVLAAIMSILFGAISLTYAAPDMQ-----IFNQAKAAG--NELFD  357

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              + R   I  D   ++L + ++G ++ + + F YPSR + ++L GF+L I +G  VALVG
Sbjct  358   VIQRKPLITNDSKGKTL-DRVDGNIDIRDVHFAYPSRQDALILKGFSLSIPSGKMVALVG  416

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD  +G++LID  +++D +L+ LR  +G V QEP LF  +I++N
Sbjct  417   SSGCGKSTVISLIARFYDPSKGEILIDNHNIKDLDLKFLRRNVGAVSQEPSLFAGTIKDN  476

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             +  G+  A + E+   +  AN H+FIS LP  Y T VG++G QLSGGQKQRIAIARA+LK
Sbjct  477   LMVGNMGADDQEVENAAMMANAHSFISQLPNQYSTEVGQRGFQLSGGQKQRIAIARAILK  536

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALDS SE+ V  ALE   Q    GR      T I +AHR+ST++N+D+
Sbjct  537   NPPILLLDEATSALDSESEKLVQDALEKAMQ----GR------TVILIAHRMSTIINADM  586

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             I +++ G V+E G+H +L  +   VY +L S+Q++
Sbjct  587   IAIVENGQVIETGTHRSLL-ETSKVYGKLFSMQNI  620



>ref|XP_002515660.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF46712.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1289

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/545 (72%), Positives = 461/545 (85%), Gaps = 2/545 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DAKR+VG YS+IFA IGLLS FT+TLQHY +GVVGEKAM NLR +LYS  L NE+AW
Sbjct  747   YKKDAKRQVGLYSIIFALIGLLSLFTHTLQHYFFGVVGEKAMINLRQALYSGVLHNEIAW  806

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+VGSLTSRI++ T+ VK IISDRMSVIVQCISSI+IAT VSM+V+WRMGLVAWA
Sbjct  807   FEKPENSVGSLTSRIIHATAMVKTIISDRMSVIVQCISSILIATVVSMVVNWRMGLVAWA  866

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFS D+ AAH E+V+LASESAANI+T+ SFCHEEH++ KA+  
Sbjct  867   VMPCHFIGGLIQAKSAKGFSRDSAAAHYELVTLASESAANIRTIASFCHEEHILKKAKTC  926

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    +SRK+SIKFG+IQG SLCLWNIAHAVALWYTT LV+R Q++F + IRSYQIFSL
Sbjct  927   LEKPKKKSRKQSIKFGLIQGVSLCLWNIAHAVALWYTTRLVERRQATFEDGIRSYQIFSL  986

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +L P F+TLDR T IEPD P+ S  + I G VE + +KF+
Sbjct  987   TVPSITELWTLIPTVISAITVLTPAFETLDRETEIEPDAPKSSHLKRIMGRVELQNVKFY  1046

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RPEV VLN F+L IEAG++VALVGPSGAGKSS++ALLLRFYD  EG VLIDGKD+R+
Sbjct  1047  YPLRPEVTVLNNFSLHIEAGLRVALVGPSGAGKSSILALLLRFYDPGEGTVLIDGKDIRE  1106

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SIR+NI YG E ASEA+I++VS  ANIH FIS+LP+GY
Sbjct  1107  YNLRLLRTQIGLVQQEPLLFSSSIRDNIAYGHEGASEADIVKVSMEANIHEFISSLPDGY  1166

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +TVVGEKG QLSGGQKQRIAIAR LLKRPAI+LLDEAT ALD+ SER++VSALES+  + 
Sbjct  1167  NTVVGEKGCQLSGGQKQRIAIARTLLKRPAILLLDEATGALDAESERSIVSALESINLNS  1226

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K   SS  + TQITVAHRLS++ +SDIIVVMDKG +VEMGSH TLT   +G+YSRL  LQ
Sbjct  1227  K--ESSLYRSTQITVAHRLSSIKDSDIIVVMDKGKLVEMGSHLTLTKMSEGMYSRLYHLQ  1284

Query  1622  SMKDH  1636
             ++ ++
Sbjct  1285  NLTEN  1289


 Score =   265 bits (678),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 173/504 (34%), Positives = 270/504 (54%), Gaps = 13/504 (3%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +   R +   A +  E+  F+    + G + + + N  S ++  I ++++  +   +
Sbjct  144   ERQLARFRLAFLEAIINQEIGAFDTDLTS-GKVITGVTNHMSIIQDAIGEKLAHFLSSFA  202

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+   V+P   + G    K     S       SE  ++  ++ 
Sbjct  203   TFFSGILIAAICSWEVSLLTLLVLPMILVIGATYTKKMNTISAAKMVYLSEATAMVEQTI  262

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
             + IKTV SF  E H +      +  QL  ++ E++  G+  G    +  ++ A+ +W   
Sbjct  263   SQIKTVFSFVGESHAIKSFSECMAKQLTLNKGEALIKGVGTGMFQTVTFVSWALIIWIGA  322

Query  656   LLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPD  835
             ++V   +S+    I +         S+T     +     A      VF+ ++R   I   
Sbjct  323   IVVTVQKSNGGEVIAAVMSILFGAISLTYAAPDMQIFNQAKAAGTEVFKVINRKPLIRHI  382

Query  836   KPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIA  1015
                 +L + +EG +E K + F YPSR + ++L G +L I AG  +ALVG SG GKS++I+
Sbjct  383   STGRTLIK-VEGNIEIKDVYFAYPSRQDNLILRGLSLSIPAGKTMALVGSSGCGKSTIIS  441

Query  1016  LLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEA  1195
             L+ RFYD   G +LID  +++D +LR LR  IG V QEP LF  SI++N+  G+  AS+ 
Sbjct  442   LVARFYDPLTGDILIDNNNIKDLDLRFLRRNIGSVFQEPSLFAGSIKDNLKVGNMDASDQ  501

Query  1196  EIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEAT  1375
             ++ + +  AN H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEAT
Sbjct  502   QMQDAAIVANAHSFISQLPNQYLTEVGERGVQLSGGQKQRIAIARAILKSPPILLLDEAT  561

Query  1376  SALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVE  1555
             SALDS SE+ V  AL+        GR      T I +AHRLSTVVN+D+I +++ G V E
Sbjct  562   SALDSESEKLVQYALD----RAMVGR------TVILIAHRLSTVVNADMIAIVENGQVTE  611

Query  1556  MGSHSTLTSQPDGVYSRLVSLQSM  1627
              G+HS+L       Y+ L SL ++
Sbjct  612   TGTHSSLL-DTHKFYNNLFSLHNI  634



>gb|EYU45353.1| hypothetical protein MIMGU_mgv1a022271mg [Erythranthe guttata]
Length=1226

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/545 (71%), Positives = 459/545 (84%), Gaps = 10/545 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y +D ++KVG YS+IF+++G LS   +TLQHYL+GV+GEKAMTNLR +LYS  L+NELAW
Sbjct  692   YKNDPEQKVGVYSLIFSAVGFLSLIAHTLQHYLFGVIGEKAMTNLRQALYSDILRNELAW  751

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+VGS+TSR++NETSTVK +ISDRMSVIVQCISSI+IAT VS+ V+WRMGLVAWA
Sbjct  752   FEKPENSVGSVTSRVINETSTVKTVISDRMSVIVQCISSILIATIVSIKVNWRMGLVAWA  811

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFS    AA+SE+V+LASESA+NI+T+ SFC EEHV  KA++ 
Sbjct  812   VMPCHFIGGLIQAKSAKGFSSGNNAAYSELVALASESASNIRTIASFCQEEHVSEKAKII  871

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L +SR +S+K+GIIQG SLCLWNIAHAVALWYTT+LV+R Q+SF + IRSYQIFSL
Sbjct  872   LEKPLTKSRIQSVKYGIIQGVSLCLWNIAHAVALWYTTILVERRQASFEDGIRSYQIFSL  931

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV SAI IL PVF+TLDR T IEPD+P +S  ESI+GE+EF+ + F 
Sbjct  932   TVPSITELWTLIPTVFSAISILTPVFETLDRQTEIEPDEPRKSPYESIKGEIEFRNVHFS  991

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSR EV VL+ FNL+IE G KVALVGPSGAGKSSV+ALLLRFYDV EG +LIDG+D+R 
Sbjct  992   YPSRAEVTVLDNFNLKIEPGSKVALVGPSGAGKSSVLALLLRFYDVKEGVLLIDGEDIRS  1051

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLR QIGLVQQEPLLF CSIR+NICYG+E ASEAEII+ S  ANIH  ISNLP GY
Sbjct  1052  YNLRKLRTQIGLVQQEPLLFSCSIRDNICYGNEGASEAEIIQASMDANIHEVISNLPRGY  1111

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT VGEKG QLSGGQKQRIAIARALLK PAIMLLDEATSALD+ SERA++ AL+ L+Q  
Sbjct  1112  DTSVGEKGCQLSGGQKQRIAIARALLKNPAIMLLDEATSALDAESERAIIYALKGLKQ--  1169

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                     + T +TVAHRLSTV++SD I VMDKG VV+MG+H++L +  DGVYSRL  LQ
Sbjct  1170  --------RTTHVTVAHRLSTVIDSDTIFVMDKGKVVQMGTHASLAAASDGVYSRLSRLQ  1221

Query  1622  SMKDH  1636
             +  ++
Sbjct  1222  NFPEN  1226


 Score =   267 bits (683),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 177/518 (34%), Positives = 281/518 (54%), Gaps = 21/518 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR     A L  E+  F+    + G + S I +  S ++  I +++   + C +
Sbjct  100   ERQVRRLRLRFLKAVLSQEIGAFDTDLTS-GKIISGISSHMSIIQDAIGEKLGHFLSCFA  158

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      +++I  W + L+A  V+P   I G          S    A  SE  ++  +S 
Sbjct  159   TFFSGVLIALICCWEVSLLALFVVPMILIIGATYTTKMNALSVTRMAFMSEATAMVEQSI  218

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESI----KFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV +F  E+  +      L  Q+  S+ E+       G+ Q  + C W    A+ +
Sbjct  219   SHIKTVFAFVGEKSAIKSFSDCLAKQIGISKNEAFIKGFGTGMFQIVTFCSW----ALIV  274

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   ++   + I +         S+T     +     A    K VF+ + R   
Sbjct  275   WVGAVVVTAGRARGGDVIAAVMSILFGAISLTYAAPDMQIFNQAKAAGKEVFEVIKRKPL  334

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  +   ++L + I G ++   + F YPSR   +VL GF+L I AG  VALVG SG GKS
Sbjct  335   IYSNNEAKTLDQ-INGSIDIYDLHFAYPSRKGTLVLQGFSLSIPAGKVVALVGSSGCGKS  393

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             ++++L+ RFYD  +G++L+D  +++D +L+ LR  IGLV QEP LF   I++NI  G+  
Sbjct  394   TIMSLITRFYDPVKGEILVDNHNIKDLDLKSLRRNIGLVSQEPSLFSGIIKDNIKAGNPN  453

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + +I + ++ AN H+FIS  P+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  454   ADDDQIQKAAQMANAHSFISQFPDQYLTEVGQRGVQLSGGQKQRIAIARAILKNPPILLL  513

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALD+ SE+ V +A+E+  Q    GR      T I +AHRLST+VN+D+I V++ G
Sbjct  514   DEATSALDTESEKIVQTAIEAAMQ----GR------TVILIAHRLSTIVNADMIAVVENG  563

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMKDH*HTQLHE  1657
              V E G+H  L +  +  Y+ L  +Q++     T++ +
Sbjct  564   IVAETGTHDYLLTN-NKFYNNLFEIQNINQESDTRVED  600



>ref|XP_007219663.1| hypothetical protein PRUPE_ppa023953mg [Prunus persica]
 gb|EMJ20862.1| hypothetical protein PRUPE_ppa023953mg [Prunus persica]
Length=1237

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/545 (71%), Positives = 463/545 (85%), Gaps = 2/545 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y++DAKRKV  +S++F+ IG LS F++T+QHY +G+VGEKAMTNLR +LYS  L+NE+AW
Sbjct  695   YENDAKRKVEKFSIVFSVIGFLSLFSHTVQHYFFGMVGEKAMTNLRRALYSGVLRNEIAW  754

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PENN+G LTSRI+N+TS VK II+DRMSVIVQCISSI+IAT VSM V+WRMGLVAWA
Sbjct  755   FEKPENNIGPLTSRIINDTSMVKTIIADRMSVIVQCISSILIATIVSMAVNWRMGLVAWA  814

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD  AAHSE+V+LASESA NI+TV SFCHE+H++ KA+++
Sbjct  815   VMPCHFIGGLIQAKSAKGFSGDAAAAHSELVTLASESATNIRTVASFCHEDHILRKAKIS  874

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    + R+ESIK+GIIQG SLCLWNIAHAVALWYTT+LV RHQ+SF N+IRSYQIFSL
Sbjct  875   LENPRRKCRRESIKYGIIQGVSLCLWNIAHAVALWYTTVLVDRHQASFKNSIRSYQIFSL  934

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI +L P FQTLDR T IEP  PE S  + I+G +EF+ IKF+
Sbjct  935   TVPSITELWTLIPTVISAISVLTPAFQTLDRKTEIEPAIPENSNLDRIKGSIEFQNIKFN  994

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RPEV VLN F+L+IEAG KVA VGPSGAGKSSV+ALLLRFYD  EG++LID K++R+
Sbjct  995   YPLRPEVTVLNNFSLQIEAGRKVAFVGPSGAGKSSVLALLLRFYDPMEGRILIDRKEIRE  1054

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SI+ NICYG++ ASE EI+EVS+ ANI  FISNLP+GY
Sbjct  1055  YNLRWLRRQIGLVQQEPLLFSSSIKANICYGTDGASETEIVEVSREANIDEFISNLPDGY  1114

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +TVVGEKG QLSGGQKQRIAIAR LLKRPAI+LLDEATSALD+ SE++VVSAL ++   +
Sbjct  1115  ETVVGEKGCQLSGGQKQRIAIARTLLKRPAILLLDEATSALDAESEKSVVSALAAINLTN  1174

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G    SK TQITVAHRLST++NSD I+VMDKG +VE+GSHS L +  +GVYSRL  LQ
Sbjct  1175  NGG--ILSKTTQITVAHRLSTIINSDTIIVMDKGKIVEIGSHSALITASEGVYSRLYQLQ  1232

Query  1622  SMKDH  1636
             ++ + 
Sbjct  1233  NLAEE  1237


 Score =   273 bits (699),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 181/508 (36%), Positives = 274/508 (54%), Gaps = 21/508 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L  E+  F+  +   G + + I N  S ++  I +++   + C++
Sbjct  105   ERQVARLRLAYLRAVLSQEIGAFD-TDLTSGKIITGISNHMSIIQDAIGEKLGHFLSCLA  163

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+ + V+P   I G    K     S       SE  S+  ++ 
Sbjct  164   TFFSGILIAAICCWEVALLTFLVVPLILIIGATYTKKMNAISAARMLYQSEATSMVEQTI  223

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E+  +      +  Q   S+ E+    +  G++Q  S   W    A+ +
Sbjct  224   SQIKTVYAFVGEKSAIKSFSECMGKQYLLSKGEALIKGVGTGMLQSVSFGSW----ALVI  279

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   ++S  + I +         S+T     +     A      VF+ L+R   
Sbjct  280   WVGAVVVTATRASGGDIIAAVMSILFGAISLTYAAPDMQIFNQAKAAGTEVFKVLNREPV  339

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  D   ++L E I G ++   + F YPSRPE  +L GF+L I AG  VA VG SG GKS
Sbjct  340   ISYDSKGKTLDE-IYGNIDIHDVHFSYPSRPERAILQGFSLSIPAGQTVAFVGSSGCGKS  398

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             ++I+L+ RFYD  +G++LID  +V+D +L+ LR  IG V QEP LF  +I++N+  G   
Sbjct  399   TIISLVARFYDPSKGEILIDNHNVKDLDLKFLRKNIGAVSQEPSLFGGTIKDNMKVGKMD  458

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + EI + +  AN H+FIS LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  459   AEDEEIQKAAVMANAHSFISQLPDDYSTEVGQRGVQLSGGQKQRIAIARAILKNPPILLL  518

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  AL+   Q    GR      T I +AHRLSTV+N+D+I V++ G
Sbjct  519   DEATSALDSESEKVVQDALDKAMQ----GR------TVILIAHRLSTVINADMIAVVENG  568

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V E G+H  L       Y+ L ++Q++
Sbjct  569   QVTETGTHRNLLDSSK-FYNTLFAMQNL  595



>ref|XP_008382986.1| PREDICTED: ABC transporter B family member 19-like [Malus domestica]
Length=1242

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/542 (71%), Positives = 462/542 (85%), Gaps = 6/542 (1%)
 Frame = +2

Query  11    DAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER  190
             DAKR V  YS+IF+ +G LS F++T+QHYL+G++GEKAMTNLR +LYS  L+NE+ W+E+
Sbjct  707   DAKRHVEIYSIIFSLLGFLSLFSHTVQHYLFGIIGEKAMTNLRLALYSGVLRNEIGWYEK  766

Query  191   PENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP  370
             PEN +GSLTSRI+N+TS VK II+DRMSVIVQCISSI+IAT VSM V+WRMGLVAWAVMP
Sbjct  767   PENGIGSLTSRIINDTSMVKTIIADRMSVIVQCISSILIATGVSMYVNWRMGLVAWAVMP  826

Query  371   CHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQP  550
             CHFIGGL+QAKSAKGFSGD  AAH+E+V+LASESA NI+TV SFCHE+H++ KAR++L+ 
Sbjct  827   CHFIGGLVQAKSAKGFSGDAAAAHAELVTLASESATNIRTVASFCHEDHILRKARISLEN  886

Query  551   QLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP  730
                R R+ESIK+GIIQG SLCLWNIAHAVALWYTT+LV ++Q+SF N IR+YQIFSLTVP
Sbjct  887   PKKRCRRESIKYGIIQGISLCLWNIAHAVALWYTTVLVDKNQASFENGIRAYQIFSLTVP  946

Query  731   SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             SITELWTLIPTV+SAIG+L P FQTLDR T IEPD PE S  + I+G++EF+ +KF+YP 
Sbjct  947   SITELWTLIPTVISAIGVLTPAFQTLDRKTEIEPDTPESSNPDRIKGDIEFQNVKFNYPL  1006

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RPEV VLN F+L+IEAG KVA VGPSGAGKSSV+ALLLRFYD  EG++LIDGK++R+YNL
Sbjct  1007  RPEVTVLNDFSLQIEAGRKVAFVGPSGAGKSSVLALLLRFYDPMEGRILIDGKEIREYNL  1066

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR QIGLVQQEPLLF  SI+ NICYG+E ASEAEI+EVS+ ANI+ FI NLP+GY+TV
Sbjct  1067  RWLRRQIGLVQQEPLLFSSSIKANICYGTEEASEAEIVEVSREANIYEFICNLPDGYETV  1126

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGEKG QLSGGQKQRIAIAR LLKRPAI+LLDEATSALD+ SE++VVSALE++       
Sbjct  1127  VGEKGCQLSGGQKQRIAIARTLLKRPAILLLDEATSALDAESEQSVVSALEAINLR----  1182

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
               S SK TQIT+AHRLST+++SD IVVMDKG +VE GSHS L +  +GVYSRL  LQ++ 
Sbjct  1183  --SLSKTTQITIAHRLSTIIHSDTIVVMDKGKIVETGSHSALITASEGVYSRLYQLQNLG  1240

Query  1631  DH  1636
             + 
Sbjct  1241  EE  1242


 Score =   268 bits (685),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 176/508 (35%), Positives = 269/508 (53%), Gaps = 21/508 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L  E+  F+    + G + S I    S ++  I ++M   + C++
Sbjct  113   ERQVARLRLAYLRAVLSQEIGAFDTDLTS-GKIISGISYHMSIIQDAIGEKMGHFLSCLA  171

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+   V+P   + G    K     S       S+  ++  ++ 
Sbjct  172   TFFSGILIAAICCWEVALLTLVVVPLILVIGGTYTKKMNSISATRVLYQSDATAMVEQTI  231

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   +      +  Q   S+ E+    +  G++Q  S   W    A  +
Sbjct  232   SQIKTVYAFVGESSAIKSFSDCMAKQYLLSKGEALIKGVGTGMLQSVSFGSW----AFII  287

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   ++S  + + +         S+T     +     A      VFQ ++R   
Sbjct  288   WVGAVVVTAKRASGGDVLAAVMCILFGAISLTYAAPDMQIFNQATAAGTAVFQVINRKPV  347

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  +  E  + E I G ++   + F YPSRP+  +L GF+L I AG  VA VG SG GKS
Sbjct  348   ISYNS-EGKILEEIHGNIDIHEVHFSYPSRPDRAILQGFSLSIPAGKTVAFVGSSGCGKS  406

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             ++I+L+ RFYD  +G++LID  +++D +L+ LR  +G V QEP LF  SI +N+  G   
Sbjct  407   TIISLVARFYDPLKGEILIDNHNIKDLDLKFLRKNVGAVSQEPALFAGSISDNMKVGKMD  466

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + EI + +  AN HTFIS LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  467   AEDEEIQKAAVMANAHTFISQLPDQYSTEVGQRGVQLSGGQKQRIAIARAILKNPPILLL  526

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  AL+   Q    GR      T I +AHRLST++N+D+I V++ G
Sbjct  527   DEATSALDSESEKVVQDALDKAMQ----GR------TVILIAHRLSTIINADMIAVVENG  576

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V E G+H +L       Y+ L S+Q++
Sbjct  577   RVSETGTHHSLLDSSK-FYNNLFSMQNI  603



>ref|XP_010038493.1| PREDICTED: ABC transporter B family member 10-like [Eucalyptus 
grandis]
Length=829

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/543 (70%), Positives = 450/543 (83%), Gaps = 2/543 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y   AKR+VGWYS+ F+ IGLLS  ++ LQHY YGVVGEKAMTNLR +L+S  L+NE  W
Sbjct  288   YHKHAKREVGWYSIAFSLIGLLSLVSHILQHYYYGVVGEKAMTNLRKALFSGVLRNEFTW  347

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN++G +TSRI+N+TS VK+IISDRMSVIVQCI+SI+IAT VSMIV+WRMGLVAWA
Sbjct  348   FEKPENSIGMVTSRIINDTSMVKVIISDRMSVIVQCITSILIATVVSMIVNWRMGLVAWA  407

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF+GD++AAH +VVSL SESA NI+TV SFC+EE ++ KA++A
Sbjct  408   VMPCHFIGGLIQAKSAKGFAGDSSAAHGKVVSLTSESATNIRTVASFCYEEQILRKAKLA  467

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  +  SR+ SIK+GIIQG SLCLWNIAHA+ALWYT +L+ R Q++F N IRSYQIFSL
Sbjct  468   LEVPMKESRRTSIKYGIIQGFSLCLWNIAHAIALWYTAVLIDRGQATFENGIRSYQIFSL  527

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTVLSA+ IL P FQTLDR T IEPD  E +    IEG  EF+ +KF 
Sbjct  528   TVPSITELWTLIPTVLSAMSILTPAFQTLDRKTEIEPDVLENTHQGRIEGTAEFQNVKFK  587

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV VL  F L+IEAG KV LVGPSGAGKSS++ALLLRFYD  EGKVLIDGKD+++
Sbjct  588   YPSRPEVTVLKNFTLKIEAGTKVGLVGPSGAGKSSILALLLRFYDPIEGKVLIDGKDIKE  647

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIG VQQEP+LF  SIRENICYG   ASEAEI+E ++ ANIH FIS+LP+GY
Sbjct  648   YNLRWLRTQIGFVQQEPILFSSSIRENICYGYCGASEAEIMEATRQANIHEFISSLPDGY  707

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG QLSGGQKQRIAIAR LLK+PA++LLDEATSALD+ SER++VSALE+  + +
Sbjct  708   DTLVGEKGCQLSGGQKQRIAIARTLLKKPAMLLLDEATSALDAESERSIVSALEAANESN  767

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G    S+ T ITVAHRLST+V SD I+VMDKG +VE+GSHSTL     GVYSRL  LQ
Sbjct  768   NGGLF--SRTTVITVAHRLSTIVKSDSIIVMDKGEIVEIGSHSTLIRSGSGVYSRLYRLQ  825

Query  1622  SMK  1630
             S+K
Sbjct  826   SLK  828


 Score =   174 bits (441),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 128/194 (66%), Gaps = 11/194 (6%)
 Frame = +2

Query  1046  GKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAAN  1225
             G +LID  +++D +L+ LR  IG V QEP LF  +I++N+  G+  A + +I   +  AN
Sbjct  4     GVILIDNHNIKDLDLKCLRQNIGAVSQEPSLFAGTIKDNLKVGNLDADDQQIENAAMMAN  63

Query  1226  IHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERA  1405
              H FIS LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LLDEATSALDS SE+ 
Sbjct  64    AHNFISQLPDKYSTEVGQRGFQLSGGQKQRIAIARAVLKNPPILLLDEATSALDSQSEKL  123

Query  1406  VVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ  1585
             V  ALE   Q    GR      T I +AHRLST+VN+D I V++ G V E G+HSTL   
Sbjct  124   VQEALEKAMQ----GR------TVILIAHRLSTIVNADEIAVVENGQVKETGTHSTLLDT  173

Query  1586  PDGVYSRLVSLQSM  1627
                 Y+ L ++Q++
Sbjct  174   SK-FYNSLFNMQNI  186



>gb|KHN02137.1| ABC transporter B family member 19 [Glycine soja]
Length=1246

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/544 (70%), Positives = 457/544 (84%), Gaps = 2/544 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +D DAK+KVG+YS IFA++GLLS F++T QHY  GVVGEKAM NLR +LYS  L+NE+ W
Sbjct  703   FDEDAKQKVGFYSAIFAAVGLLSLFSHTFQHYFIGVVGEKAMANLRRALYSGVLRNEVGW  762

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F++ EN VGSLTSRI ++T+ VK+II+DRMSVI+QC+SSI+IAT VSM V+WRM LVAWA
Sbjct  763   FDKSENTVGSLTSRITSDTAMVKVIIADRMSVILQCVSSILIATVVSMAVNWRMSLVAWA  822

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD +AAHSE+V+LASES  NI+TV SFCHEE V+ KA+ +
Sbjct  823   VMPCHFIGGLIQAKSAKGFSGDYSAAHSELVALASESTTNIRTVASFCHEEQVLGKAKTS  882

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    + RKESIK+GIIQG SLCLWNIAHAVALWYTT+L+ R Q++F N IRSYQIFSL
Sbjct  883   LEIPKKKYRKESIKYGIIQGFSLCLWNIAHAVALWYTTILIDRGQATFKNGIRSYQIFSL  942

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITEL+TLIPTV+SAI IL P F+TLDR T IEPD P++S  E I G+VEF+ +KF+
Sbjct  943   TVPSITELYTLIPTVISAISILTPAFKTLDRKTEIEPDTPDDSQPERIHGKVEFENVKFN  1002

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP V VL+ F+L+IEAG+KVA VGPSGAGKSSV+ALLLRFYD   GKVLIDGK+++ 
Sbjct  1003  YPSRPTVTVLDNFSLQIEAGLKVAFVGPSGAGKSSVLALLLRFYDPQAGKVLIDGKNIQK  1062

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YN+R LR QIGLVQQEPLLF CS+R+NICYG+  ASE+EI+EV+K ANIH F+SNLP GY
Sbjct  1063  YNIRWLRTQIGLVQQEPLLFNCSVRDNICYGNSGASESEIVEVAKEANIHEFVSNLPNGY  1122

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +TVVGEKG Q SGGQKQRIAIAR LLK+PAI+LLDEATSALD+ SER + +AL+++  H 
Sbjct  1123  NTVVGEKGCQFSGGQKQRIAIARTLLKKPAILLLDEATSALDAESERIIANALKAI--HL  1180

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K      S+ TQITVAHRLSTV+NSD IVVMDKG VVEMGSHSTL +   G+YSR+  LQ
Sbjct  1181  KEDSGLCSRTTQITVAHRLSTVINSDTIVVMDKGKVVEMGSHSTLIAAEAGLYSRIFRLQ  1240

Query  1622  SMKD  1633
             S ++
Sbjct  1241  SFEE  1244


 Score =   270 bits (690),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 181/509 (36%), Positives = 271/509 (53%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L  E+  F+  E     + S I    S ++  I +++       +
Sbjct  110   ERQLFQLRLAYLRAVLNQEIGAFD-TELTSAKVISGISKHMSVIQDAIGEKLGHFTSSCA  168

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+   V+P   I G    K     S      HSE  S+  ++ 
Sbjct  169   TFFAGIVIAAICCWEVTLLCLVVVPLILIIGATYTKKMNSISTTKMLFHSEATSMIEQTI  228

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   +      ++ Q   S+ E+    +  G+ Q  S C W    A+ +
Sbjct  229   SQIKTVYAFVGESSAIKSFTENMEKQYVISKGEALVKGVGTGMFQTVSFCSW----ALIV  284

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V+  +++  + I +         S+T     +     A      VFQ + R   
Sbjct  285   WVGAVVVRAGRATGGDIITAVMSILFGAISLTYAAPDMQIFNQAKAAGYEVFQVIQRKPL  344

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  ++ E  +   I+G++E + + F YPSRPE  +L G +L I AG  +ALVG SG GKS
Sbjct  345   IS-NESEGMMPSKIKGDIELREVHFSYPSRPEKAILQGLSLSIPAGKTIALVGSSGCGKS  403

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+L+ RFYD   G++ ID  +++D NL+ LR  IG V QEP LF  +I++N+  G   
Sbjct  404   TVISLVSRFYDPSRGEIFIDHHNIKDLNLKFLRRNIGAVSQEPSLFAGTIKDNLKVGKMD  463

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + +I + +  +N H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  464   ADDQQIQKAAVMSNAHSFISQLPNQYLTEVGERGVQLSGGQKQRIAIARAILKNPPILLL  523

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE+  Q    GR      T I +AHRLSTVVN+++I V++ G
Sbjct  524   DEATSALDSESEKLVQEALETAMQ----GR------TVILIAHRLSTVVNANMIAVVENG  573

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V E G+H +L       YS L S+Q+++
Sbjct  574   QVAETGTHQSLLDTSR-FYSTLCSMQNLE  601



>ref|XP_007136381.1| hypothetical protein PHAVU_009G040700g [Phaseolus vulgaris]
 gb|ESW08375.1| hypothetical protein PHAVU_009G040700g [Phaseolus vulgaris]
Length=1192

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/544 (69%), Positives = 454/544 (83%), Gaps = 2/544 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +  DAK KVG YS IF ++G+LS F+NT+QHY +GVVGEKAM NLR +LYS  L+NE+ W
Sbjct  649   FKEDAKTKVGLYSAIFTAVGMLSLFSNTIQHYFFGVVGEKAMANLRRALYSGLLRNEVGW  708

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F++ EN VGSLTSRI+++T+ VK+II+DRMS+I+QC+SSI+IAT VSM V+WRM LVAW+
Sbjct  709   FDKSENTVGSLTSRIISDTAMVKVIIADRMSMILQCVSSILIATVVSMAVNWRMSLVAWS  768

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD +AAHSE+V+LASES  NI+T+ SFCHEE V+ KA+++
Sbjct  769   VMPCHFIGGLIQAKSAKGFSGDYSAAHSELVTLASESTTNIRTIASFCHEEQVMRKAKIS  828

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    + RKESIK+GIIQG SLCLWNIAHAVALWYTT+LV R Q+SF N IRSYQIFSL
Sbjct  829   LEIPKKKYRKESIKYGIIQGFSLCLWNIAHAVALWYTTILVDRRQASFENGIRSYQIFSL  888

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITEL+TLIP V+SAI IL P F+TLDR T+IEPD P++S  E I+G VEF+ +KF+
Sbjct  889   TVPSITELYTLIPAVVSAINILTPAFKTLDRKTQIEPDTPDDSQPERIQGNVEFENVKFN  948

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV VL+ F+L+IEAG+KVA VGPSGAGKSSV+ALLLRF+D   GKVLID KD+R 
Sbjct  949   YPSRPEVTVLDNFSLQIEAGLKVAFVGPSGAGKSSVLALLLRFHDPQGGKVLIDKKDIRK  1008

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF CSIR+NICYG+  ASE+E++EV+K ANIH F+SNLP GY
Sbjct  1009  YNLRWLRTQIGLVQQEPLLFNCSIRDNICYGNNGASESEMVEVAKEANIHEFVSNLPNGY  1068

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              TVVGEKG QLSGGQKQRIAIAR +LK+PAI+LLDEATSALD+ SE  +V+AL ++  H 
Sbjct  1069  STVVGEKGCQLSGGQKQRIAIARTILKKPAILLLDEATSALDAESEGIIVNALNAI--HL  1126

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K      SK T+ITVAHRLSTV+NSD I+ MDKG +V+MGSHSTL +    +YSR+  LQ
Sbjct  1127  KEDSGLRSKTTRITVAHRLSTVINSDTIIAMDKGKLVQMGSHSTLIAAESRLYSRMFRLQ  1186

Query  1622  SMKD  1633
             S ++
Sbjct  1187  SFEE  1190


 Score =   269 bits (687),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 180/494 (36%), Positives = 265/494 (54%), Gaps = 21/494 (4%)
 Frame = +2

Query  161   LQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWR  340
             L  ++  F+  E   G + S I    S ++  I +++       ++      ++ I  W 
Sbjct  125   LNQDIGAFDT-ELTSGKVISGISKHMSVIQDAIGEKLGHFTSSCATFFAGIVIAAICCWE  183

Query  341   MGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHV  520
             + L+   V+P   I G    K     S      HSE  S+  ++ + IKTV +F  E   
Sbjct  184   VTLLCLVVVPLILIIGATYTKKMNTISTSKMLFHSEATSMIEQTISQIKTVYAFVGESSA  243

Query  521   VNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFL  688
             +      +  Q   S+ E+    +  G++Q  S C W    A+ +W   ++V+  +++  
Sbjct  244   IKSFTENMDNQYIISKVEAAVKGVGTGMLQTVSFCSW----ALIVWVGAVVVRAGRATAG  299

Query  689   NAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIE  868
             + I +         S+T     +     A      VFQ + R   I  D  E  +   I+
Sbjct  300   DIIAAVMSILFGAISLTYAAPDMQVFNQAKAAGYEVFQVIQRKPLISNDS-EGKMPSKIK  358

Query  869   GEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEG  1048
             G+++F+ + F YPSRP+  +L G +L I AG  VALVG SG GKS+VI+L+ RFYD   G
Sbjct  359   GDIDFQYVHFSYPSRPDKPILQGLSLSIPAGKTVALVGTSGCGKSTVISLVNRFYDPSRG  418

Query  1049  KVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANI  1228
              + ID  +++D NL+ LR  IG+V QEP LF  +I++N+  G   A + EI + +  +N 
Sbjct  419   VIFIDHHNIKDLNLKFLRRNIGVVSQEPSLFAGTIKDNLKVGKMEADDQEIQKAAVMSNA  478

Query  1229  HTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAV  1408
             H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALDS SE+ V
Sbjct  479   HSFISQLPNQYLTEVGERGVQLSGGQKQRIAIARAILKNPPILLLDEATSALDSESEKLV  538

Query  1409  VSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQP  1588
               ALE+  Q    GR      T I +AHRLSTVVN+D+I V++ G V E G+H +L    
Sbjct  539   QEALETATQ----GR------TVILIAHRLSTVVNADMIAVVENGQVAETGTHQSLLDTS  588

Query  1589  DGVYSRLVSLQSMK  1630
                YS L S+Q+++
Sbjct  589   T-FYSTLFSMQNLE  601



>ref|XP_010038513.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Eucalyptus grandis]
Length=1256

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/543 (70%), Positives = 449/543 (83%), Gaps = 2/543 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y   AKR+VGWYS+ F+ IGLLS  ++ LQHY +GVVGEKAMTNLR +L+S  L NE AW
Sbjct  715   YHKHAKREVGWYSIPFSLIGLLSLVSHILQHYYFGVVGEKAMTNLRKALFSGVLHNEFAW  774

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN++G +TSRI+N+TS VK+IISDRMSVIVQCI+SI+IAT VSMIV+WRMGLVAWA
Sbjct  775   FEKPENSIGMVTSRIINDTSMVKVIISDRMSVIVQCITSILIATVVSMIVNWRMGLVAWA  834

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF+GD++AAH +VVSL SESA NI+TV SFC+EE ++ KA++ 
Sbjct  835   VMPCHFIGGLIQAKSAKGFAGDSSAAHGKVVSLTSESATNIRTVASFCYEEQILRKAKLT  894

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  +  SR+ SIK+GIIQG SLCLWNIAHA+ALWYT +L+ R Q++F N IRSYQIFSL
Sbjct  895   LEVPMKESRRTSIKYGIIQGFSLCLWNIAHAIALWYTAVLIDRGQATFENGIRSYQIFSL  954

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTVLSA+ IL P FQTLDR T IEPD  E +    IEG  EF+ +KF 
Sbjct  955   TVPSITELWTLIPTVLSAMSILTPAFQTLDRKTEIEPDVLENTHQGRIEGTAEFQNVKFK  1014

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV VL  F+ +IEAG KVALVGPSGAGKSS++ALLLRFYD  EGKVLIDGKD+++
Sbjct  1015  YPSRPEVTVLKNFSXKIEAGTKVALVGPSGAGKSSILALLLRFYDPIEGKVLIDGKDIKE  1074

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIG VQQEP+LF  SIRENICYG   ASEAEI+E ++ ANIH FIS+LP+GY
Sbjct  1075  YNLRWLRTQIGFVQQEPILFSSSIRENICYGYCGASEAEIMEATRQANIHEFISSLPDGY  1134

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG QLSGGQKQRIAIAR LLK+PA++LLDEATSALD+ SER++VSALE+  + +
Sbjct  1135  DTLVGEKGCQLSGGQKQRIAIARTLLKKPAMLLLDEATSALDAESERSIVSALEAANESN  1194

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G    S+ T ITVAHRLST+V SD I+VMDKG +VE+G HSTL     GVYSRL  LQ
Sbjct  1195  NGGLF--SRTTVITVAHRLSTIVKSDSIIVMDKGEIVEIGPHSTLIRSGSGVYSRLYRLQ  1252

Query  1622  SMK  1630
             S+K
Sbjct  1253  SLK  1255


 Score =   271 bits (693),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 182/504 (36%), Positives = 269/504 (53%), Gaps = 13/504 (3%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+    +R     + L+ E+  F+  E + G + + I    S ++  I +++   + C +
Sbjct  123   ERQTARIRLEFLRSVLRQEIGAFD-TELSSGKIIAGISTHMSVIQDAIGEKLGHFLSCFA  181

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + LV   V+P   + G    K     S       SE  ++  ++ 
Sbjct  182   TFFSGVLIAFICSWEVSLVTLFVVPFILLIGATYTKKMNAISAAKMIYLSEATTVVEQTI  241

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
             ++IKTV +F  E+  +      +  Q   SR E++  G+  G    + N + A+ +W   
Sbjct  242   SHIKTVFAFVGEDRAIKSFSDCMDKQSVISRGEALIKGVGTGMFQAVTNSSWALIIWIGA  301

Query  656   LLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPD  835
             ++V   +SS  N I +         SIT     +     A      VF+ + R   I   
Sbjct  302   IVVTAGRSSGGNVIAAVMSILFGAISITYAAPDMQVFNQAKAAGNEVFKVIRRQPTISNA  361

Query  836   KPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIA  1015
                  L E IEG ++ + I F YPSR + ++L GF L I AG  VALVG SG GKS+VI+
Sbjct  362   SGGIVLKE-IEGNIDIRNIHFAYPSREDKVILQGFTLSIPAGKTVALVGSSGCGKSTVIS  420

Query  1016  LLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEA  1195
             L+ RFYD  +G +LID  +++D +L+ LR  IG V QEP LF  +I++N+  G+  A + 
Sbjct  421   LVARFYDPSKGVILIDNHNIKDLDLKCLRQNIGAVSQEPSLFAGTIKDNLKVGNLDADDQ  480

Query  1196  EIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEAT  1375
             +I   +  AN H FIS LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LLDEAT
Sbjct  481   QIENAAMMANAHYFISQLPDKYSTEVGQRGFQLSGGQKQRIAIARAVLKNPPILLLDEAT  540

Query  1376  SALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVE  1555
             SALDS SE+ V  ALE   Q    GR      T I +AHRLST+VN+D I V++ G V E
Sbjct  541   SALDSQSEKLVQKALEKAMQ----GR------TVILIAHRLSTIVNADEIAVVENGHVKE  590

Query  1556  MGSHSTLTSQPDGVYSRLVSLQSM  1627
              G+HSTL       Y+ L ++Q++
Sbjct  591   TGTHSTLLDTSK-FYNSLFNMQNI  613



>gb|AES72696.2| ABC transporter B family protein [Medicago truncatula]
Length=1249

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/544 (69%), Positives = 448/544 (82%), Gaps = 2/544 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +  DAKRKVG +S IF++IGLLS F++T QHY +GVVGEKAM N R +LYS  L NE+ W
Sbjct  706   FQDDAKRKVGLFSAIFSAIGLLSLFSHTFQHYFFGVVGEKAMANFRRALYSGVLCNEVGW  765

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F++PEN VGSLTSRI+++TS VKIII+DRMSVIVQC+SSI+IAT VSM V+WRM LVAWA
Sbjct  766   FDKPENTVGSLTSRIISDTSMVKIIIADRMSVIVQCVSSILIATGVSMYVNWRMALVAWA  825

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD +A HS++V+LASES  NI+T+ SFCHEE V+ KA+  
Sbjct  826   VMPCHFIGGLIQAKSAKGFSGDYSATHSDLVALASESTTNIRTIASFCHEEQVLEKAKTY  885

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L     + RKESIK+GIIQG SLCLWNIAHAVALWYTT+LV R Q+SF N IR+YQIFSL
Sbjct  886   LDIPKKKYRKESIKYGIIQGFSLCLWNIAHAVALWYTTILVDRRQASFENGIRAYQIFSL  945

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITEL+TLIPTV++AI +L P F+TLDR T IEPD P++S  + I+G VEF+ + F 
Sbjct  946   TVPSITELYTLIPTVITAINMLTPAFKTLDRKTEIEPDIPDDSQPDRIQGNVEFENVNFK  1005

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RP V VL+ F+L+IEAG KVA VGPSGAGKSSV+ALLLRFYD   GKVLIDGKD+R+
Sbjct  1006  YPLRPTVTVLDNFSLQIEAGSKVAFVGPSGAGKSSVLALLLRFYDPVVGKVLIDGKDLRE  1065

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF CSIRENICYG+  A E+EI+EV++ ANIH F+SNLP GY
Sbjct  1066  YNLRWLRTQIGLVQQEPLLFNCSIRENICYGNNGAFESEIVEVAREANIHEFVSNLPNGY  1125

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +TVVGEKG QLSGGQKQRIAIAR LLK+PAI+LLDEATSALD+ SER +V+A++++    
Sbjct  1126  NTVVGEKGCQLSGGQKQRIAIARTLLKKPAILLLDEATSALDAESERTIVNAIKAMNLKE  1185

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             + G    S++TQITVAHRLSTV NSD I+VM+KG +VE GSHSTL     G+YSRL  LQ
Sbjct  1186  ETGLR--SRITQITVAHRLSTVRNSDTIIVMEKGKIVETGSHSTLIEVDAGLYSRLFRLQ  1243

Query  1622  SMKD  1633
             S  +
Sbjct  1244  SFDE  1247


 Score =   265 bits (677),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 178/509 (35%), Positives = 271/509 (53%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ ++ LR +   A L  E+  F+  E   G + + I    S ++  I +++       +
Sbjct  113   ERQLSRLRLAYLKAVLSQEIGAFD-TELTSGKVITGISKHMSVIQDAIGEKLGHFTSSCA  171

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+   V+P   + G    K     S      HSE  S+  ++ 
Sbjct  172   TFFAGMVIATIACWEVALLCLVVVPLILLIGATYTKKMNRISTTKLFYHSEATSMIEQTI  231

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   V      +  Q   S+ E+    +  G+ Q  S C W++     +
Sbjct  232   SQIKTVYAFVGEGLAVKSFTENMDKQYVVSKGEALVKGVGTGMFQTVSFCSWSLI----I  287

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V+  ++   + I +         SIT     +     A      VFQ + R   
Sbjct  288   WVGAVVVRAGRAQGGDIITAVMSILFGAISITYAAPDMQIFNQAKAAGYEVFQVIQRKPL  347

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  ++ +  +   I+G +E + + F YPSR E  +L G +L I AG  VALVG SG GKS
Sbjct  348   IH-NESKGKMPNKIDGSIELRNVYFSYPSRSEKPILQGLSLSIPAGKTVALVGSSGCGKS  406

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             + I+L+ RFYD   G++ ID  +++D +L+ LR+ IG V QEP LF  +I++N+  G   
Sbjct  407   TAISLITRFYDPTRGEIFIDSHNIKDLDLKFLRSNIGAVYQEPSLFTGTIKDNLKLGKMD  466

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             AS+ EI + +  +N H+FIS LP  Y T VG++G Q+SGGQKQRIAIARA+LK P I+LL
Sbjct  467   ASDEEIQKAAVMSNAHSFISQLPNQYLTEVGQRGVQVSGGQKQRIAIARAILKNPPILLL  526

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  AL++  Q    GR      T I +AHRLSTVVN+D+I V++ G
Sbjct  527   DEATSALDSESEKLVQEALDTAMQ----GR------TVILIAHRLSTVVNADMIAVVENG  576

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              +VE G+H +L       YS L S+Q+++
Sbjct  577   QIVETGTHQSLLDTSK-FYSTLFSMQNLE  604



>ref|XP_010110461.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC26459.1| ABC transporter B family member 19 [Morus notabilis]
Length=1266

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/542 (70%), Positives = 458/542 (85%), Gaps = 2/542 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DAKR+VG YS+IF+ IGLLS  ++TLQHY +G+VGEKAM NLR  LYS  L+NE+AW
Sbjct  724   YQKDAKRQVGRYSLIFSVIGLLSLCSHTLQHYFFGLVGEKAMANLRRGLYSEVLRNEVAW  783

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PENN+GSLTSRI+++T+ +KIII+DRMSVIVQCISSI+IATTVSM V+WRMGLVAWA
Sbjct  784   FEKPENNIGSLTSRIISDTTMIKIIIADRMSVIVQCISSILIATTVSMKVNWRMGLVAWA  843

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKS KGFSGD  A+HSE+V+LASES+ NI+TV SFCHEEH++ KA+ +
Sbjct  844   VMPCHFIGGLIQAKSTKGFSGDIAASHSELVALASESSTNIRTVGSFCHEEHILRKAKKS  903

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  + +SR +SIK+GIIQG SLC+WNIAHAVALWYTT+LV R+Q+SF + IRSYQIFSL
Sbjct  904   LESPMRKSRIQSIKYGIIQGLSLCMWNIAHAVALWYTTILVHRNQASFEDGIRSYQIFSL  963

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTL+PTV+SAI +L P FQTLDR T I PD PE    + I+G + F+ +KF 
Sbjct  964   TVPSITELWTLLPTVISAISVLTPAFQTLDRKTEIVPDTPEGPHLDRIKGSIIFQNVKFI  1023

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RPEV VLN F+L+I+AG KVALVGPSGAGKSS++ALLLRFY+  +G++LID +D+R 
Sbjct  1024  YPLRPEVTVLNNFSLQIKAGSKVALVGPSGAGKSSILALLLRFYNPIKGRILIDDEDIRK  1083

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LRAQIGLVQQEPLLF  SIR NICYG++ ASE EI+EVS+ A+IH FIS LP+GY
Sbjct  1084  YNLRWLRAQIGLVQQEPLLFSSSIRSNICYGNDAASETEIVEVSRQASIHEFISTLPDGY  1143

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKG QLSGGQKQR+AIARALLK PAI+LLDEATSALD+ SER++V+ALE +  + 
Sbjct  1144  DTVVGEKGCQLSGGQKQRVAIARALLKSPAILLLDEATSALDAESERSIVNALEKINVNT  1203

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               G  + SK TQITVAHRLSTV+NSD I VMDKG + EMGSHS+L +  +GVYSRL  LQ
Sbjct  1204  S-GGITMSKTTQITVAHRLSTVMNSDTIFVMDKGELAEMGSHSSLITS-EGVYSRLFQLQ  1261

Query  1622  SM  1627
             S+
Sbjct  1262  SL  1263


 Score =   274 bits (701),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 178/513 (35%), Positives = 274/513 (53%), Gaps = 26/513 (5%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L  E+  F+  +   G + S I N  S ++  I +++   +   +
Sbjct  124   ERQLARLRLAYLKAVLSQEIGAFD-TDLTSGKIISGISNHMSIIQDAIGEKLGHFLSSFA  182

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W++ L+ + V+P   + G    K     S      HS+  S+  ++ 
Sbjct  183   TFFSGILIAAICSWQIALLTFMVVPLILVIGATYTKKMNTISAAKMGCHSQATSMVEQTI  242

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   +      +  Q   S+ E+    +  G+ Q  S C W    A+ +
Sbjct  243   SQIKTVYAFVGENSAIKAFSQCMNQQFLISKGEALIKGVGTGMFQTVSFCSW----ALII  298

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W    LV   ++   + I +         ++T     +     A      VFQ ++R   
Sbjct  299   WVGAFLVTDKKAKGGDMIAAVMSILFGAIALTYAAPDMQIFNQAKAAGSEVFQVIERRPV  358

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  D    +L E ++G +E + + F YPSRPE  +L GF+L I AG  VALVG SG GKS
Sbjct  359   ISYDSEGMTL-EKVDGNIEIRDVYFSYPSRPEKEILKGFSLSIPAGKAVALVGSSGCGKS  417

Query  1004  SVIALLLRFYDVDE-----GKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENIC  1168
             ++I+L+ RFYD  +     G++LID  ++++  L+ LR  +GLV QEP LF  ++++N+ 
Sbjct  418   TIISLVSRFYDPSKEVNRVGEILIDDHNIKNLGLKYLRRNVGLVSQEPALFSGTVKDNVR  477

Query  1169  YGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRP  1348
              G+  A + +I +V++ AN H+FIS  P  Y   VGE+G QLSGGQKQRIA+ARA+LK P
Sbjct  478   IGNMDADDQQIQKVAEMANAHSFISQFPNRYFEEVGERGVQLSGGQKQRIAVARAILKNP  537

Query  1349  AIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIV  1528
              I+LLDEATSALD+ SE+ V  ALE   Q    GR      T I VAHRLST+VN+DII 
Sbjct  538   PILLLDEATSALDTESEKLVQDALERAMQ----GR------TVILVAHRLSTIVNADIIA  587

Query  1529  VMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             V+  G ++E G+HS+L       Y+ L  +Q++
Sbjct  588   VVQNGKIIETGTHSSLLDTSK-FYNNLCHMQNL  619



>ref|XP_003602445.1| ABC transporter ATP-binding protein/permease [Medicago truncatula]
Length=1342

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/544 (69%), Positives = 448/544 (82%), Gaps = 2/544 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +  DAKRKVG +S IF++IGLLS F++T QHY +GVVGEKAM N R +LYS  L NE+ W
Sbjct  799   FQDDAKRKVGLFSAIFSAIGLLSLFSHTFQHYFFGVVGEKAMANFRRALYSGVLCNEVGW  858

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F++PEN VGSLTSRI+++TS VKIII+DRMSVIVQC+SSI+IAT VSM V+WRM LVAWA
Sbjct  859   FDKPENTVGSLTSRIISDTSMVKIIIADRMSVIVQCVSSILIATGVSMYVNWRMALVAWA  918

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD +A HS++V+LASES  NI+T+ SFCHEE V+ KA+  
Sbjct  919   VMPCHFIGGLIQAKSAKGFSGDYSATHSDLVALASESTTNIRTIASFCHEEQVLEKAKTY  978

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L     + RKESIK+GIIQG SLCLWNIAHAVALWYTT+LV R Q+SF N IR+YQIFSL
Sbjct  979   LDIPKKKYRKESIKYGIIQGFSLCLWNIAHAVALWYTTILVDRRQASFENGIRAYQIFSL  1038

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITEL+TLIPTV++AI +L P F+TLDR T IEPD P++S  + I+G VEF+ + F 
Sbjct  1039  TVPSITELYTLIPTVITAINMLTPAFKTLDRKTEIEPDIPDDSQPDRIQGNVEFENVNFK  1098

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP RP V VL+ F+L+IEAG KVA VGPSGAGKSSV+ALLLRFYD   GKVLIDGKD+R+
Sbjct  1099  YPLRPTVTVLDNFSLQIEAGSKVAFVGPSGAGKSSVLALLLRFYDPVVGKVLIDGKDLRE  1158

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF CSIRENICYG+  A E+EI+EV++ ANIH F+SNLP GY
Sbjct  1159  YNLRWLRTQIGLVQQEPLLFNCSIRENICYGNNGAFESEIVEVAREANIHEFVSNLPNGY  1218

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +TVVGEKG QLSGGQKQRIAIAR LLK+PAI+LLDEATSALD+ SER +V+A++++    
Sbjct  1219  NTVVGEKGCQLSGGQKQRIAIARTLLKKPAILLLDEATSALDAESERTIVNAIKAMNLKE  1278

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             + G    S++TQITVAHRLSTV NSD I+VM+KG +VE GSHSTL     G+YSRL  LQ
Sbjct  1279  ETGLR--SRITQITVAHRLSTVRNSDTIIVMEKGKIVETGSHSTLIEVDAGLYSRLFRLQ  1336

Query  1622  SMKD  1633
             S  +
Sbjct  1337  SFDE  1340


 Score =   209 bits (532),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 176/590 (30%), Positives = 268/590 (45%), Gaps = 102/590 (17%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ ++ LR +   A L  E+  F+  E   G + + I    S ++  I +++       +
Sbjct  125   ERQLSRLRLAYLKAVLSQEIGAFDT-ELTSGKVITGISKHMSVIQDAIGEKLGHFTSSCA  183

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+   V+P   + G    K     S      HSE  S+  ++ 
Sbjct  184   TFFAGMVIATIACWEVALLCLVVVPLILLIGATYTKKMNRISTTKLFYHSEATSMIEQTI  243

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E   V      +  Q   S+ E+    +  G+ Q  S C W++     +
Sbjct  244   SQIKTVYAFVGEGLAVKSFTENMDKQYVVSKGEALVKGVGTGMFQTVSFCSWSLI----I  299

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V+  ++   + I +         SIT     +     A      VFQ + R   
Sbjct  300   WVGAVVVRAGRAQGGDIITAVMSILFGAISITYAAPDMQIFNQAKAAGYEVFQVIQRKPL  359

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  ++ +  +   I+G +E + + F YPSR E  +L G +L I AG  VALVG SG GKS
Sbjct  360   IH-NESKGKMPNKIDGSIELRNVYFSYPSRSEKPILQGLSLSIPAGKTVALVGSSGCGKS  418

Query  1004  SVIALLLRFYD----VDE------------------GKVLIDGKDVRDYNLRKLRAQIGL  1117
             + I+L+ RFYD    +D                   G++ ID  +++D +L+ LR+ IG 
Sbjct  419   TAISLITRFYDPTRGIDSVILNAINDAKPDIVQYIPGEIFIDSHNIKDLDLKFLRSNIGA  478

Query  1118  VQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGE---KGS  1288
             V QEP LF  +I++N+  G   AS+ EI + +  +N H+FIS LP  Y T       KG 
Sbjct  479   VYQEPSLFTGTIKDNLKLGKMDASDEEIQKAAVMSNAHSFISQLPNQYLTESSNSIVKGK  538

Query  1289  QLSG-----------------------------------------------GQK------  1309
              L G                                               GQ+      
Sbjct  539   TLGGEISLLFLNKSVLSLESDSWVPNIASMIWIIIPFMRLIVPYVCLTCQVGQRGVQVSG  598

Query  1310  ---QRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQI  1480
                QRIAIARA+LK P I+LLDEATSALDS SE+ V  AL++  Q    GR      T I
Sbjct  599   GQKQRIAIARAILKNPPILLLDEATSALDSESEKLVQEALDTAMQ----GR------TVI  648

Query  1481  TVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              +AHRLSTVVN+D+I V++ G +VE G+H +L       YS L S+Q+++
Sbjct  649   LIAHRLSTVVNADMIAVVENGQIVETGTHQSLLDTSK-FYSTLFSMQNLE  697



>emb|CDP04961.1| unnamed protein product [Coffea canephora]
Length=1278

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/543 (70%), Positives = 442/543 (81%), Gaps = 36/543 (7%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y ++AKR VGWYS+ F+SIG+LS F +T+QHYL+GVVGEKAMTNLR +L++ATL+NELAW
Sbjct  772   YQTNAKRTVGWYSIFFSSIGILSLFAHTVQHYLFGVVGEKAMTNLRQALFTATLRNELAW  831

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             +E+PEN+VGSLTSRI+NETSTVK II+DRMSVIVQCISSI+IAT VSM V+WRMGLVAWA
Sbjct  832   YEKPENSVGSLTSRIINETSTVKSIIADRMSVIVQCISSILIATIVSMKVNWRMGLVAWA  891

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGL+QAKSA+GFS DT AAHSE+V+LASESA NIKTV SFCHE+ ++ KA+++
Sbjct  892   VMPCHFIGGLVQAKSARGFSSDTNAAHSELVALASESATNIKTVASFCHEDQILKKAKLS  951

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L +SR+ES K+GIIQG S+CLWNIAHAVALWYTT LV+R Q+SF N IRSYQIFSL
Sbjct  952   LKTPLRKSRRESAKYGIIQGVSICLWNIAHAVALWYTTYLVERGQASFENGIRSYQIFSL  1011

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTL+PTV SAI IL PVF+T DR T IEPDKP E+  E I+G++EFK I F 
Sbjct  1012  TVPSITELWTLVPTVFSAISILTPVFETFDRHTEIEPDKPAETQFERIKGDIEFKNISFK  1071

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSR E+ VL+ F+L+IEAG KVALVGPSGAGKSSV+ALLLRFYD  EG VL+DGK ++ 
Sbjct  1072  YPSRQEMTVLDNFSLKIEAGTKVALVGPSGAGKSSVLALLLRFYDAKEGSVLVDGKSIKH  1131

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SIR+NICYG++ ASEAEIIEVS+ ANIH FIS LP+GY
Sbjct  1132  YNLRLLRLQIGLVQQEPLLFSFSIRDNICYGNQEASEAEIIEVSRQANIHEFISTLPDGY  1191

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              TVVGEKG  LSGGQKQRIAIARALLKRPA+MLLDEA                       
Sbjct  1192  HTVVGEKGCLLSGGQKQRIAIARALLKRPAVMLLDEA-----------------------  1228

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                          T+AHRLSTV+ SDIIVVMD+G VVE+G HS+L + P+GVYS+L  LQ
Sbjct  1229  -------------TIAHRLSTVMRSDIIVVMDRGQVVEIGPHSSLITAPEGVYSKLYRLQ  1275

Query  1622  SMK  1630
              MK
Sbjct  1276  GMK  1278


 Score =   254 bits (650),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 179/508 (35%), Positives = 275/508 (54%), Gaps = 21/508 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ ++ LR +   A L+ E+  F+   ++   +T  I +    ++  I +++   + C++
Sbjct  185   QRQVSRLRLAFLRAVLRQEMGAFDTDLSSAKVITG-ITDHMCIIQDAIGEKLGHFLSCLA  243

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + V    V+ I  W + L+   V+P     G    K     S       SE  SL  ++ 
Sbjct  244   TFVSGVLVAFISCWEVSLLTLFVVPLILFIGANYTKKMNSISATKLTYLSEATSLVEQTI  303

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESI----KFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E          L+ QL  S++E++      G+ Q  +   W    A+ +
Sbjct  304   SQIKTVYAFVGENRATKLLSKCLEKQLILSKQEALIKGAGTGMFQTVTFTSW----ALIV  359

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   +S+  + I +         S+T     +     A    K VFQ + R + 
Sbjct  360   WVGAVVVVNKRSTGGDVIAAVMSILFGAISLTYAAPDMQIFNQAKAAGKEVFQVIQRKSA  419

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  D   + L E+I+G ++ + I F YPSR E ++L GF+  I AG  VALVG SG GKS
Sbjct  420   INSDSKGKIL-EAIDGNIDLRNIYFAYPSRQEKVILQGFSFSIPAGKVVALVGSSGCGKS  478

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             ++I+LL RFYD ++G + ID  ++++ +L+ LR  IGLV QEP LF  +I++NI  G   
Sbjct  479   TIISLLARFYDPEKGDIFIDNHNIKELDLKFLRRNIGLVSQEPSLFAGTIKDNIKIGKMD  538

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + EI   +  AN  +FI  LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  539   ADDEEIQHAALLANADSFICQLPDKYLTEVGQRGLQLSGGQKQRIAIARAILKNPPILLL  598

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  AL++  +    GR      T I +AHRLST++N+D+IVV++ G
Sbjct  599   DEATSALDSESEKLVQEALDTAMK----GR------TVILIAHRLSTIINADMIVVVENG  648

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V E G+H  L       Y+ L  +Q++
Sbjct  649   KVSESGTHDYLLDTSKS-YNNLFRMQNI  675



>ref|XP_008813553.1| PREDICTED: ABC transporter B family member 19-like [Phoenix dactylifera]
Length=1259

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/542 (70%), Positives = 445/542 (82%), Gaps = 9/542 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DA+RKVGWYSVIF  +GLL+  T+TLQH+LYGVVGE AM NLR +L+SA L+NE+AW
Sbjct  722   YKPDARRKVGWYSVIFCLVGLLTLITHTLQHFLYGVVGETAMRNLRETLFSAVLRNEIAW  781

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+VG LTS +V +TS +K IISDRMSVIVQCISSI+IAT VSMIVDWRMGLVAWA
Sbjct  782   FEKPENSVGFLTSHVVGDTSMIKTIISDRMSVIVQCISSILIATIVSMIVDWRMGLVAWA  841

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD   +H E+V+L SESA+NI+TV SF HEE ++ KA+++
Sbjct  842   VMPCHFIGGLIQAKSAKGFSGDFAVSHRELVALTSESASNIRTVASFVHEEQILKKAKLS  901

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  +  SR ESIK+G+IQG SLCLWNIAHAVALWYTT+LV + Q++F+N IRSYQIFSL
Sbjct  902   LREPMRISRIESIKYGLIQGVSLCLWNIAHAVALWYTTVLVDKRQATFVNGIRSYQIFSL  961

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI IL P FQ LDR T I PD PE    E I G +EF+ I F 
Sbjct  962   TVPSITELWTLIPTVISAISILTPAFQILDRETEIVPDSPEIKSPERILGRIEFEEISFK  1021

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV++L+ F+L IE+G KVALVGPSGAGKSSV+ALLLRFYD  +G++LID K++R+
Sbjct  1022  YPSRPEVVILDNFSLIIESGQKVALVGPSGAGKSSVLALLLRFYDPHKGRILIDRKEIRE  1081

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SIR+NICYG+E ASE EIIE +  ANIH FIS+LP+GY
Sbjct  1082  YNLRWLRKQIGLVQQEPLLFSSSIRDNICYGNEGASETEIIEAAIEANIHEFISSLPDGY  1141

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKG QLSGGQKQRIAIAR LLKRPA++LLDEATSALD  SER V+SAL S     
Sbjct  1142  DTVVGEKGCQLSGGQKQRIAIARTLLKRPAVLLLDEATSALDGQSERKVISALGS-----  1196

Query  1442  KFGRSSP-SKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSL  1618
                +S P  + TQITVAHRLSTV+ SD+IVVMDKG VVEMG H+TL +   G Y ++  L
Sbjct  1197  ---KSGPLFRTTQITVAHRLSTVITSDVIVVMDKGKVVEMGKHATLIAATHGFYLKMFQL  1253

Query  1619  QS  1624
             Q+
Sbjct  1254  QN  1255


 Score =   251 bits (641),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 177/512 (35%), Positives = 273/512 (53%), Gaps = 15/512 (3%)
 Frame = +2

Query  95    YLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMs  274
             ++Y    E+ M   R     A L  ++  F+  +     + + + N  S ++  I +++ 
Sbjct  122   FMYA--SERQMARFRLEFLKAVLNQDIGAFDT-DLTTAKIITGMTNHMSIIQDAIGEKLG  178

Query  275   vivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevv  454
               V   S+  +   ++    W++ L+   V+P   I G          S       SE  
Sbjct  179   HFVSSFSTFFVGVIIAFACCWQVALLTLLVLPLILIIGATYTNKMNTISALRMTYLSEAT  238

Query  455   slasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHA  634
             S+  ++ ++IKTV SF  E   +      ++ Q   S+KE++  G+  G+   +   + A
Sbjct  239   SVVEQTVSHIKTVFSFVGEMEAIKSFTQCMEKQHILSKKEALIKGLGLGSFQAVTFGSWA  298

Query  635   VALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDR  814
             + +W   + V   +++    + +         SIT     +     A      VF+ ++R
Sbjct  299   LVVWVGAVAVTAKKANGGETLAAVMSILFGAISITYAAPDLEIFNRAKAAGHEVFKVIER  358

Query  815   CTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
                I  +   ++L E I GE++ + + F YPSR + ++L GF+L I AG  VALVG SG 
Sbjct  359   KPGISYENKGKTL-EKIVGEIDIQGVHFSYPSREDKLILQGFSLSIPAGRVVALVGTSGC  417

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS+VI+L+ RFYD  +G++LIDG +++D +L+ LR  I  V QEP LF  +I +N+  G
Sbjct  418   GKSTVISLIQRFYDPIKGEILIDGHNIKDLDLKFLRRNIAAVPQEPSLFSGTIEDNLRIG  477

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
             +  A++ +I   +  AN H+FIS LP+ Y T VGE+G QLSGGQKQRIAIARA+LK P I
Sbjct  478   NLDATDEQIERAASTANAHSFISQLPDKYSTEVGERGVQLSGGQKQRIAIARAILKDPPI  537

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDEATSALDS SE+ V  ALE   Q    GR      T I +AHR+STV+NSDIIVV+
Sbjct  538   LLLDEATSALDSESEKLVQDALERAMQ----GR------TVILIAHRMSTVINSDIIVVV  587

Query  1535  DKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             + G     G+H  L  +    Y  L  +Q++K
Sbjct  588   ENGKATHTGTHQELL-EGSKFYCNLFGMQNLK  618



>ref|XP_009788672.1| PREDICTED: ABC transporter B family member 14-like [Nicotiana 
sylvestris]
Length=620

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/497 (74%), Positives = 424/497 (85%), Gaps = 28/497 (6%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  D+K KV  YS IFASIG+LS F NTLQHYL+G+VGEKAMTNLR +LY+ATL+NELAW
Sbjct  135   YHPDSKEKVALYSAIFASIGVLSLFANTLQHYLFGIVGEKAMTNLRRALYTATLRNELAW  194

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN++GS+TSRIV++TSTVKIIISDRMSVIVQCISSIVIATTVSMIV+WRM LVAWA
Sbjct  195   FEKPENSIGSVTSRIVSDTSTVKIIISDRMSVIVQCISSIVIATTVSMIVNWRMSLVAWA  254

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD T AHSE+V+LASESA NIKTV SFCHEE ++ KA+++
Sbjct  255   VMPCHFIGGLIQAKSAKGFSGDGTLAHSELVALASESATNIKTVASFCHEEQILEKAKLS  314

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L + + ESIKFGIIQGTSLCLWNIAHAVALWYTT+LV R+Q+SF N IR+YQIFSL
Sbjct  315   LKRPLRKGKTESIKFGIIQGTSLCLWNIAHAVALWYTTILVDRNQASFENGIRAYQIFSL  374

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTVLSAI +LKPVFQ LDRCT I PD P+ S  E+I+GE+EF  +++H
Sbjct  375   TVPSITELWTLIPTVLSAIDVLKPVFQNLDRCTEIIPDTPDTSEHETIKGEIEFINVQWH  434

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
                                     L+G  GAGKSS++ALLLRFYD++EGKVLIDGKD+R 
Sbjct  435   ------------------------LLGKGGAGKSSIVALLLRFYDINEGKVLIDGKDIRY  470

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLRKLRAQIGLVQQEPLLF CSIRENICYGSERASEAEI+EVS++A+IH FISNLP+GY
Sbjct  471   YNLRKLRAQIGLVQQEPLLFSCSIRENICYGSERASEAEIVEVSRSAHIHEFISNLPDGY  530

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKGSQLSGGQKQRI IARALLK+P IMLLDEATSALD+ SERAVVSALES++  +
Sbjct  531   DTLVGEKGSQLSGGQKQRIVIARALLKKPRIMLLDEATSALDTESERAVVSALESMKL-N  589

Query  1442  KFGRSSPSKMTQITVAH  1492
              FG    +K+TQ+TVAH
Sbjct  590   SFG---GTKVTQVTVAH  603



>emb|CBI23123.3| unnamed protein product [Vitis vinifera]
Length=1157

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/542 (68%), Positives = 441/542 (81%), Gaps = 34/542 (6%)
 Frame = +2

Query  11    DAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER  190
             DAK++VG YS++F+ IGLLS FT+TLQHY +GV+GEKAMTNLR +LYS  L NELAWFE+
Sbjct  650   DAKQRVGLYSILFSLIGLLSLFTHTLQHYFFGVIGEKAMTNLRQALYSGILNNELAWFEK  709

Query  191   PENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP  370
             PENNVGSLTSRI+N+TSTVK IISDRMSVIVQCISSI+IAT V+M ++WRMGLVAWAVMP
Sbjct  710   PENNVGSLTSRIINDTSTVKTIISDRMSVIVQCISSILIATIVTMKLNWRMGLVAWAVMP  769

Query  371   CHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQP  550
             CHFIGGLIQAK AKGFS  + AAH E+V+LASESA N+KT+ SFCHE+ +++KA++AL+P
Sbjct  770   CHFIGGLIQAKFAKGFSSGSAAAHCELVALASESATNMKTIASFCHEDFILDKAKIALEP  829

Query  551   QLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP  730
              + +SR+ SIK+GIIQG SLCLWNIAHAVALWYT +LV+R Q++F N IRSYQIFSLTVP
Sbjct  830   PMRKSRRASIKYGIIQGFSLCLWNIAHAVALWYTAVLVERDQATFENGIRSYQIFSLTVP  889

Query  731   SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             SITELWTLIPTV+SAI IL P F+TLDR T IEPD PE S +E I+G +EF+ + F+YP 
Sbjct  890   SITELWTLIPTVISAISILTPTFKTLDRKTEIEPDTPENSHAEKIKGRIEFQNVSFNYPL  949

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RPEV VLN F L+IEAG KVALVGPSGAGKSSV+AL+LRFYD   G++LID KD+R+YNL
Sbjct  950   RPEVTVLNNFCLQIEAGSKVALVGPSGAGKSSVLALILRFYDPRAGRILIDRKDIRNYNL  1009

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R+LR++IGLVQQEPLLF  SIR+NICYG++ ASE EIIEV++ A IH FISNL  GYDTV
Sbjct  1010  RRLRSRIGLVQQEPLLFSSSIRDNICYGNDGASETEIIEVAREARIHEFISNLSHGYDTV  1069

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VG+KG QLSGGQKQRIAIAR LLKRPAI+LLDEATSALD+                    
Sbjct  1070  VGQKGCQLSGGQKQRIAIARTLLKRPAILLLDEATSALDT--------------------  1109

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
                           +LSTV+NSD I+VMDKG +VEMG HSTL +  DG+YS+LV LQS+ 
Sbjct  1110  --------------QLSTVINSDTIIVMDKGEIVEMGPHSTLIAVSDGLYSKLVQLQSLG  1155

Query  1631  DH  1636
             ++
Sbjct  1156  EN  1157


 Score =   273 bits (699),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 184/508 (36%), Positives = 279/508 (55%), Gaps = 21/508 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ ++ LR +   A L  E+  F+  +   G + S I +  S ++  I +++   +  I+
Sbjct  111   ERQVSRLRLAFLRAALNQEIGAFD-TDLTSGKIISGISSHMSIIQDAIGEKLGHFLSNIA  169

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + L+   V+P   + G   +K     S       SE  S+  ++ 
Sbjct  170   TCFSGILIAAICCWEVSLLTLLVVPLVLVTGATYSKKMNAISAAKMHFLSEATSMIEQTL  229

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESI----KFGIIQGTSLCLWNIAHAVAL  643
             + IKTV +F  E          +  Q   S++E+I      G+ Q  + C W    A+ +
Sbjct  230   SQIKTVFAFVGESTAAKSFSECMDKQFRISKREAIIKGVGTGLFQTVTTCCW----ALII  285

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   +SS  + I +         S+T     I    SA      VFQ + R   
Sbjct  286   WVGAIVVTAKRSSGGDIIAAVMSILFGAISLTYAAPDIQIFNSAKAAGNEVFQVIKRKPA  345

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  D   ++L E I G ++ + + F YPSR E ++L+GF+  I AG  VALVG SG GKS
Sbjct  346   ISYDSEGKTL-EKINGNIDMQDVYFTYPSRKERLILDGFSFSIPAGKVVALVGSSGCGKS  404

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+L+ RFYD  +G++LID  +++D +L+ LR  IG V QEP LF  +I++NI  GS  
Sbjct  405   TVISLVARFYDPSQGEILIDNYNIKDLDLKFLRKNIGAVFQEPSLFSGTIKDNIKVGSME  464

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A + E+  V+  AN H+FI+ LP+ Y T VGE+G QLSGGQKQRIAIARA++K P I+LL
Sbjct  465   ADDQEVQNVALMANAHSFITQLPDQYSTEVGERGVQLSGGQKQRIAIARAIIKNPPILLL  524

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V +A+E   Q    GR      T I +AHR+STV+N+D+I V++ G
Sbjct  525   DEATSALDSESEKLVQAAIEKAMQ----GR------TVILIAHRMSTVINADMIAVIENG  574

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V E G+HS L    +  Y+ L ++Q++
Sbjct  575   QVKETGTHSDLLDTSN-FYNNLFNMQNL  601



>ref|XP_004169290.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Cucumis sativus]
Length=1229

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/544 (66%), Positives = 449/544 (83%), Gaps = 6/544 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y ++AK +VG YS+IF+ +GLLS+F +T+QHY +G+VGEK+M NLR +LYSA L+NE+AW
Sbjct  691   YHTNAKHRVGLYSLIFSMVGLLSFFMHTIQHYFFGIVGEKSMKNLREALYSAVLRNEVAW  750

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+R ENNVGSLTS+I+N TS +K II+DRMSVIVQCISSI+IATTVS+IV+WRM LVAWA
Sbjct  751   FDRSENNVGSLTSQIMNTTSMIKTIIADRMSVIVQCISSILIATTVSLIVNWRMALVAWA  810

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMP HFIGGLIQAKSAKGFS D+  AH E+VSL S+SA NI+T+ SFC EE ++ +AR++
Sbjct  811   VMPFHFIGGLIQAKSAKGFSRDSAVAHHELVSLVSDSATNIRTIASFCQEEEIMKRARMS  870

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    +S++ESIK+GII G +LCLWNIAHA+ALWYTT+LV + Q+SF + IRSYQIFSL
Sbjct  871   LEEPKRKSKRESIKYGIINGIALCLWNIAHAIALWYTTILVHKRQASFEDGIRSYQIFSL  930

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAIG+L P F TLDR T IE + P     E  EG +EF+ +KF+
Sbjct  931   TVPSITELWTLIPTVISAIGVLTPAFHTLDRKTLIESEIPRGQKIEKFEGRIEFQRVKFN  990

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP+RPEV+VL  F+L I+AG +VAL+GPSGAGKSSV+ALLLRFYD +EG +LIDGKD+++
Sbjct  991   YPTRPEVIVLTNFSLEIKAGSRVALIGPSGAGKSSVLALLLRFYDPEEGNILIDGKDIKE  1050

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR  IG V+QEP+LF  SIR NICYG E  SE E+++VS+ A +H F+SNLP+GY
Sbjct  1051  YNLRILRTHIGFVRQEPVLFSSSIRYNICYGIEHVSETELLKVSRDAKVHEFVSNLPDGY  1110

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGE+G QLSGGQKQRIAIAR LLK+P I+LLDE TSALD  SER +VSALES+  ++
Sbjct  1111  DTLVGERGCQLSGGQKQRIAIARTLLKKPTILLLDEPTSALDVESERTLVSALESINGNN  1170

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              F      + TQITVAHRLSTV NSD+IVVMD+G +VE+GSHSTL + PDGVYS+L  +Q
Sbjct  1171  GF------RTTQITVAHRLSTVTNSDVIVVMDRGEIVEIGSHSTLLTAPDGVYSKLFRIQ  1224

Query  1622  SMKD  1633
             S+ D
Sbjct  1225  SLAD  1228


 Score =   252 bits (644),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 170/512 (33%), Positives = 267/512 (52%), Gaps = 27/512 (5%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+    LR +   + L  E+  F+  +     + + I    + ++  I +++   +  ++
Sbjct  112   ERQAARLRLAFLQSVLSQEIGAFD-TDLTTAKIITGISAHMTIIQDAIGEKLGHFLASVA  170

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + +    +++I  W + L+   V P     G    K     S       SE  SL  +S 
Sbjct  171   TFISGVVIAIISCWEVSLLTLLVAPLVMAIGAAYTKRMTLISSIKIGYQSEATSLIQQSI  230

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + I+ V +F  E   +       +  +  S++E+    +  G+ Q  + C W++     +
Sbjct  231   SQIRAVYAFVGERSSIKAFAEQCEKMIVMSKQEALVKGVGIGMFQTVTFCCWSLI----V  286

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   +++  + I +         S+T     +     A    K VFQ + R   
Sbjct  287   WIGAVVVTAGRANGGDIIAAVMSILFGAISLTYAAPDMQIFNQAKAAGKEVFQVIQR---  343

Query  824   IEP---DKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
              +P   D  +E   E IEG +  + + F YPSRP  ++L  F L I AG   ALVG SG 
Sbjct  344   -KPSSIDGSKEKTLEDIEGHINIQKVHFAYPSRPHKLILQDFTLSIPAGQSNALVGSSGC  402

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS+VI+L+ RFYD  +G + ID ++++D NL+ +R  IG+V QEP LF  +I++NI  G
Sbjct  403   GKSTVISLITRFYDPLQGDIFIDHQNIKDLNLKFVRENIGIVSQEPALFAGTIKDNIKMG  462

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
                A++ +I   +  AN H+FISNLP  Y T VGE G+QLSGGQKQRIAIARA+LK P I
Sbjct  463   KRDANDQQIENAAVMANAHSFISNLPNQYLTEVGEGGTQLSGGQKQRIAIARAILKNPRI  522

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDEATSALDS SER V  ALE        GR      T I +AHR+ST++ +D+I ++
Sbjct  523   LLLDEATSALDSESERLVQDALEK----AIVGR------TVILIAHRMSTIIGADVIAII  572

Query  1535  DKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             + G V+E G+H +L  +    Y  L S+ +++
Sbjct  573   ENGRVLETGTHQSLLEKSI-FYGNLFSMHNIR  603



>ref|XP_004151913.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1229

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/544 (66%), Positives = 449/544 (83%), Gaps = 6/544 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y ++AK +VG YS+IF+ +GLLS+F +T+QHY +G+VGEK+M NLR +LYSA L+NE+AW
Sbjct  691   YHTNAKHRVGLYSLIFSMVGLLSFFMHTIQHYFFGIVGEKSMKNLREALYSAVLRNEVAW  750

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+R ENNVGSLTS+I+N TS +K II+DRMSVIVQCISSI+IATTVS+IV+WRM LVAWA
Sbjct  751   FDRSENNVGSLTSQIMNTTSMIKTIIADRMSVIVQCISSILIATTVSLIVNWRMALVAWA  810

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMP HFIGGLIQAKSAKGFS D+  AH E+VSL S+SA NI+T+ SFC EE ++ +AR++
Sbjct  811   VMPFHFIGGLIQAKSAKGFSRDSAVAHHELVSLVSDSATNIRTIASFCQEEEIMKRARMS  870

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+    +S++ESIK+GII G +LCLWNIAHA+ALWYTT+LV + Q+SF + IRSYQIFSL
Sbjct  871   LEEPKRKSKRESIKYGIINGIALCLWNIAHAIALWYTTILVHKRQASFEDGIRSYQIFSL  930

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAIG+L P F TLDR T IE + P     E  EG +EF+ +KF+
Sbjct  931   TVPSITELWTLIPTVISAIGVLTPAFHTLDRKTLIESEIPRGQKIEKFEGRIEFQRVKFN  990

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP+RPEV+VL  F+L I+AG +VAL+GPSGAGKSSV+ALLLRFYD +EG +LIDGKD+++
Sbjct  991   YPTRPEVIVLTNFSLEIKAGSRVALIGPSGAGKSSVLALLLRFYDPEEGNILIDGKDIKE  1050

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR  IG V+QEP+LF  SIR NICYG E  SE E+++VS+ A +H F+SNLP+GY
Sbjct  1051  YNLRILRTHIGFVRQEPVLFSSSIRYNICYGIEHVSETELLKVSRDAKVHEFVSNLPDGY  1110

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGE+G QLSGGQKQRIAIAR LLK+P I+LLDE TSALD  SER +VSALES+  ++
Sbjct  1111  DTLVGERGCQLSGGQKQRIAIARTLLKKPTILLLDEPTSALDVESERTLVSALESINGNN  1170

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              F      + TQITVAHRLSTV NSD+IVVMD+G +VE+GSHSTL + PDGVYS+L  +Q
Sbjct  1171  GF------RTTQITVAHRLSTVTNSDVIVVMDRGEIVEIGSHSTLLTAPDGVYSKLFRIQ  1224

Query  1622  SMKD  1633
             S+ D
Sbjct  1225  SLAD  1228


 Score =   252 bits (643),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 170/512 (33%), Positives = 267/512 (52%), Gaps = 27/512 (5%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+    LR +   + L  E+  F+  +     + + I    + ++  I +++   +  ++
Sbjct  112   ERQAARLRLAFLQSVLSQEIGAFD-TDLTTAKIITGISAHMTIIQDAIGEKLGHFLASVA  170

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + +    +++I  W + L+   V P     G    K     S       SE  SL  +S 
Sbjct  171   TFISGVVIAIISCWEVSLLTLLVAPLVMAIGAAYTKRMTLISSIKIGYQSEATSLIQQSI  230

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + I+ V +F  E   +       +  +  S++E+    +  G+ Q  + C W++     +
Sbjct  231   SQIRAVYAFVGERSSIKAFAEQCEKMIVMSKQEALVKGVGIGMFQTATFCCWSLI----V  286

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   ++V   +++  + I +         S+T     +     A    K VFQ + R   
Sbjct  287   WIGAVVVTAGRANGGDIIAAVMSILFGAISLTYAAPDMQIFNQAKAAGKEVFQVIQR---  343

Query  824   IEP---DKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
              +P   D  +E   E IEG +  + + F YPSRP  ++L  F L I AG   ALVG SG 
Sbjct  344   -KPSSIDGSKEKTLEDIEGHINIQKVHFAYPSRPHKLILQDFTLSIPAGQSNALVGSSGC  402

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS+VI+L+ RFYD  +G + ID ++++D NL+ +R  IG+V QEP LF  +I++NI  G
Sbjct  403   GKSTVISLITRFYDPLQGDIFIDHQNIKDLNLKFVRENIGIVSQEPALFAGTIKDNIKMG  462

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
                A++ +I   +  AN H+FISNLP  Y T VGE G+QLSGGQKQRIAIARA+LK P I
Sbjct  463   KRDANDQQIENAAVMANAHSFISNLPNQYLTEVGEGGTQLSGGQKQRIAIARAILKNPRI  522

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDEATSALDS SER V  ALE        GR      T I +AHR+ST++ +D+I ++
Sbjct  523   LLLDEATSALDSESERLVQDALEK----AIVGR------TVILIAHRMSTIIGADVIAII  572

Query  1535  DKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             + G V+E G+H +L  +    Y  L S+ +++
Sbjct  573   ENGRVLETGTHQSLLEKSI-FYGNLFSMHNIR  603



>ref|XP_006659119.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1261

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/545 (68%), Positives = 450/545 (83%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD DAKRKV  YS IF + G+++  +N  QHY+YGVVGEKAM NLR +++S+ L+NEL W
Sbjct  719   YDPDAKRKVSKYSFIFFTAGVITLASNIFQHYIYGVVGEKAMKNLREAIFSSVLRNELGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N VG LTSRIV++TST+KIIISDRM+VIVQCISSI+IAT VSM V+WRMGLV+WA
Sbjct  779   FEKPKNGVGFLTSRIVSDTSTIKIIISDRMAVIVQCISSILIATVVSMYVNWRMGLVSWA  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAK+AKGF GD+  AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  839   VMPCHFIGGLIQAKAAKGFYGDSAIAHQELVSLASEAASNIRTVASFVYEDEIIKKAELS  898

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  ++ ES+K+G+IQG SLCLWNIAHAVALWYTT+LVQR Q+SF N+IRSYQIFSL
Sbjct  899   LQEPMRVTKIESMKYGVIQGISLCLWNIAHAVALWYTTVLVQRKQASFENSIRSYQIFSL  958

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI IL P F+ LDR T+I PDKPE   +  + G  EF+ + F+
Sbjct  959   TVPSITELWTLIPMVMSAIAILNPAFEMLDRDTQIVPDKPESPSNGWLMGRTEFQDVNFN  1018

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GFNL IE G +VALVGPSGAGKSSV+ALLLRFYD   G+VLID K+++D
Sbjct  1019  YPSRPEVTILDGFNLVIEPGQRVALVGPSGAGKSSVLALLLRFYDPQRGRVLIDDKNIKD  1078

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE  SE EII+ +  ANIH FIS+LP+GY
Sbjct  1079  YNLRWLRKQIGLVQQEPILFNSSIRDNISYGSEETSETEIIQAAMEANIHEFISSLPKGY  1138

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKGSQLSGGQKQRIAIAR LLKRPAI+LLDEATSALD  SER V+S+L + + + 
Sbjct  1139  DTVVGEKGSQLSGGQKQRIAIARTLLKRPAILLLDEATSALDGESERVVMSSLGAKEWNK  1198

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             +    + SK+T ITVAHRLSTV+N D+IVVM+KG VVE+G+H TL S  DGVYSRL  LQ
Sbjct  1199  R--NEASSKITSITVAHRLSTVINVDMIVVMEKGEVVELGNHQTLISADDGVYSRLFHLQ  1256

Query  1622  S-MKD  1633
             S M+D
Sbjct  1257  SNMRD  1261


 Score =   271 bits (694),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 179/509 (35%), Positives = 273/509 (54%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R +   + L  E+  F+  +     + + + +  S ++  I +++   V   S
Sbjct  128   ERQLARMRLAFLRSVLNQEVGAFD-TDLTTAKIITGVTSHMSVIQDAIGEKLGHFVTSFS  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++    W + L+++ V+P   + G    K   G S       SE  S+  ++ 
Sbjct  187   TFFAGIIIAFASCWEVALLSFLVIPLILVIGASYTKHMNGISLSRNVIISEATSIVEQTL  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E+  +      +  Q   S+KE+    I  G+ Q  + C W    A+ +
Sbjct  247   SHIKTVFSFVGEKWAMKSFVQCMDNQYKLSKKEAVIKGIGLGLFQAVTFCSW----ALMV  302

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V R +++    I +         SIT     + T   A    K VF+ ++R   
Sbjct  303   WIGAVAVTRRKATGGGTIAAIMSILFGAISITYAAPDLQTFNQAKAAGKEVFKVIERKPS  362

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  +K    L + + GE++ + + F YPSR +  +L GF+L I AG  VALVG SG GKS
Sbjct  363   ISYEKHGSVLGK-VRGEIKLRRVHFAYPSRQDKPILQGFSLCIPAGKVVALVGSSGCGKS  421

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G + IDG  ++  +L  LR  I  V QEP LF  +I++N+  G   
Sbjct  422   TVISLLQRFYDPASGDIFIDGHSIKKLDLESLRRNIASVSQEPSLFSGTIKDNLRIGKMD  481

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             AS+ EI + ++ AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  482   ASDDEISKAARTANVHSFISKLPNEYLTEVGERGVQLSGGQKQRIAIARAMLKDPPILLL  541

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  AL+           + S  T I +AHR+STVVN+D IVV++ G
Sbjct  542   DEATSALDSESEKLVQDALD----------KAMSGRTVILIAHRMSTVVNADTIVVVENG  591

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V + G+H  L  +    YS + S+Q+++
Sbjct  592   KVAQTGTHQELLGKST-FYSNVCSMQNIE  619



>ref|XP_010934699.1| PREDICTED: ABC transporter B family member 10-like [Elaeis guineensis]
Length=1261

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/541 (70%), Positives = 446/541 (82%), Gaps = 8/541 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DA+R+VGWYS IF  +GLL+  T+TLQH+ YGVVGE AM NLR +L+SA L+NE+AW
Sbjct  725   YKHDARRRVGWYSGIFCLVGLLTLITHTLQHFFYGVVGETAMRNLRETLFSAVLRNEIAW  784

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+ EN+VG L+S IV +TS +K IISDRMSVIVQCISSI+IAT VSMIV+WRMGLVAWA
Sbjct  785   FEKSENSVGFLSSHIVGDTSMIKTIISDRMSVIVQCISSILIATIVSMIVNWRMGLVAWA  844

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD   AH E+V+LASESA+NI+TV SF HEE ++ KA+++
Sbjct  845   VMPCHFIGGLIQAKSAKGFSGDFAVAHRELVALASESASNIRTVASFVHEEQILKKAKLS  904

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  +  SR ESIK+G IQG SLCLWNIAHAVALWYTT+LV + Q++F N IRSYQIFSL
Sbjct  905   LREPMRISRIESIKYGTIQGASLCLWNIAHAVALWYTTVLVDKRQATFENGIRSYQIFSL  964

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI IL P FQ LDR T I PD PE    E I G +EF+ + F+
Sbjct  965   TVPSITELWTLIPTVISAINILTPAFQILDRKTEIVPDAPENMSLERIVGRIEFEEVSFN  1024

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV++L+ F+L IE+G KVALVGPSGAGKSSV+ALLLRFYD D+G++L+D K++R+
Sbjct  1025  YPSRPEVVILDNFSLIIESGQKVALVGPSGAGKSSVLALLLRFYDPDKGRILVDKKEIRN  1084

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SIR+NICYG E ASE EI+E +  ANIH F+S+LP GY
Sbjct  1085  YNLRWLRKQIGLVQQEPLLFSSSIRDNICYGHEDASETEILEAAIEANIHEFVSSLPNGY  1144

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG QLSGGQKQRIAIAR LLKRPAI+LLDE TSALD  SER V+S+L S    +
Sbjct  1145  DTIVGEKGCQLSGGQKQRIAIARTLLKRPAILLLDEPTSALDGESERKVMSSLGS----N  1200

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K+GR    ++TQITVAHRLSTVV+SD+IVVMDKG VVEMG H+TL +  +G+Y RL  LQ
Sbjct  1201  KWGR---QRITQITVAHRLSTVVSSDVIVVMDKGKVVEMGKHATLVA-ANGIYLRLFQLQ  1256

Query  1622  S  1624
             S
Sbjct  1257  S  1257


 Score =   267 bits (683),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 183/516 (35%), Positives = 274/516 (53%), Gaps = 23/516 (4%)
 Frame = +2

Query  95    YLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMs  274
             ++Y    E+ M   R     A L  ++  F+  +     + + I N  ST++  I +++ 
Sbjct  124   FMYA--SERQMARFRLEFLKAVLSQDIGAFD-TDLTTAKIITGITNHMSTIQDAIGEKLG  180

Query  275   vivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevv  454
               +   S+  +   ++ +  W++GL+   V+P   I G          S       SE  
Sbjct  181   HFISSFSTFFVGVIIAFVCCWQVGLLTLLVLPLILIIGATYTSRMNIISALRVQYLSEAT  240

Query  455   slasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESI----KFGIIQGTSLCLWN  622
             S+  ++ ++IKTV SF  E   +      ++ Q   S+KE++      G  Q  + C W 
Sbjct  241   SVVEQTLSHIKTVFSFVGEMSAIKSFTQCMEKQYILSKKEALIKGLGLGSFQAATFCSW-  299

Query  623   IAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQ  802
                A+ +W     V   ++S    + +         SIT     +     A      VF+
Sbjct  300   ---ALIVWVGAAAVTAKKASGGETLAAVMSILFGAISITYAAPDLEIFNRAKAAGHEVFK  356

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              ++R   I  +   ++L E+I GE++ K + F YPSR + ++L GF+L I AG  VALVG
Sbjct  357   VIERKPGISYENKGKTL-ENIVGEIDIKGVHFSYPSREDNLILQGFSLSIPAGRVVALVG  415

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD   G++ IDG +++D +L+ LR  I  V QEP LF  +I++N
Sbjct  416   NSGCGKSTVISLIQRFYDPTTGEIFIDGHNIKDLDLKFLRRNIAAVPQEPSLFSGTIKDN  475

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             +  G+  AS+ +I   +  AN H FIS LP+ Y T  GE+G QLSGGQKQRIAIARA+LK
Sbjct  476   LKIGNMDASDEQIERATSTANAHLFISQLPDKYSTEAGERGVQLSGGQKQRIAIARAILK  535

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALDSGSE+ V  ALE   Q    GR      T I +AHR+STV+NSDI
Sbjct  536   DPPILLLDEATSALDSGSEKLVQDALERAMQ----GR------TVILIAHRMSTVINSDI  585

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             I V++ G V + G+H  L  +    Y  L  +Q++K
Sbjct  586   IAVVENGTVAQTGTHQELL-ESSKFYCNLFGMQNLK  620



>gb|ACF22786.1| MDR-like ABC transporter [Brachypodium distachyon]
Length=1269

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/541 (68%), Positives = 446/541 (82%), Gaps = 2/541 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD DAKRKV  YS+IF   G+++  ++ LQHY+YGV+GEKAM NLR +L+S+ L+NELAW
Sbjct  727   YDPDAKRKVSKYSLIFFGAGMVTLASSILQHYIYGVIGEKAMKNLREALFSSVLRNELAW  786

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N VGSLTSRIV++TSTVK IISDRM+VIVQCISSI+IATTVSM V+WRMGLV+WA
Sbjct  787   FEKPKNGVGSLTSRIVSDTSTVKTIISDRMAVIVQCISSILIATTVSMYVNWRMGLVSWA  846

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQA+SAKGF GD   AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  847   VMPCHFIGGLIQARSAKGFYGDAAIAHQELVSLASEAASNIRTVASFVYEDEIIKKAELS  906

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  +R ES+K+G+IQG SLCLWNIAHAVALWYTT+LVQR Q++F N+IRSYQIFSL
Sbjct  907   LQEPMRITRIESMKYGVIQGISLCLWNIAHAVALWYTTVLVQRKQATFENSIRSYQIFSL  966

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI IL P F  LDR T I PD+P++   + + G  EF+ + F+
Sbjct  967   TVPSITELWTLIPMVMSAIAILNPAFDMLDRETEIVPDEPKKPSEQWLVGRTEFQDVSFN  1026

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GFNL IE G +VALVGPSGAGKSSV+ALLLRFYD   G VL+D  ++RD
Sbjct  1027  YPSRPEVTILDGFNLVIEPGQRVALVGPSGAGKSSVLALLLRFYDPHGGTVLVDNTNIRD  1086

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIRENI YGSE +SE EII+ +  ANIH FIS LP+GY
Sbjct  1087  YNLRWLRKQIGLVQQEPILFNSSIRENISYGSEESSETEIIQAAMDANIHEFISGLPKGY  1146

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVG+KG QLSGGQKQRIAIAR LLKRP+I+LLDEATSALDS SER V+S+L + +  +
Sbjct  1147  DTVVGDKGGQLSGGQKQRIAIARTLLKRPSILLLDEATSALDSESERVVMSSLGAKEWKN  1206

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                RS  SK+T ITVAHRLSTV+N+D+IVVM+KG V+E+G H TL S  DGVYSRL  LQ
Sbjct  1207  IDERS--SKITSITVAHRLSTVINADMIVVMEKGKVIELGDHQTLVSADDGVYSRLFHLQ  1264

Query  1622  S  1624
             S
Sbjct  1265  S  1265


 Score =   273 bits (698),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 182/509 (36%), Positives = 271/509 (53%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R     + L  E+  F+  +    ++ + + N  + ++  I +++   V   S
Sbjct  138   ERQLARMRLEFLKSVLNQEVGAFD-TDLTTANIITGVTNHMNIIQDAIGEKLGHFVASFS  196

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++    W + ++++ V+P     G    K     S    A  SEV S+  ++ 
Sbjct  197   TFFAGIIIAFASCWEVAMLSFLVIPLILAIGATYTKKMNVISLSRNAIVSEVTSVVEQTL  256

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +         Q   S+KE+    I  G+ Q  + C W    A+ +
Sbjct  257   SHIKTVFSFVGENWAIKSFVRCTDNQYKLSKKEAMIKGIGLGLFQAVTFCSW----ALMV  312

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V +  ++    I +         SIT     + T   A    K VF+ + R   
Sbjct  313   WIGAVAVSKRTATGGGTIAAIMSILFGAISITYAAPDLQTFNQARAAGKEVFKVIKRNPS  372

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I   K    L + + GE+E + ++F YPSR +  +L GF+L I AG  VAL+G SG GKS
Sbjct  373   ISYGKGGTVL-DKVYGEIELRGVRFAYPSRQDKPILQGFSLSIPAGKVVALIGSSGCGKS  431

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G +LIDG  +R  +L+ LR  I  V QEP LF  +I++N+  G   
Sbjct  432   TVISLLQRFYDPTSGDILIDGHSIRKIDLKSLRRNIASVSQEPSLFSGTIKDNLRIGKMD  491

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A++ EI E +  AN+HTFIS LP GY T VGE+G QLSGGQKQR+AIARA+LK P I+LL
Sbjct  492   ATDDEITEAATTANVHTFISKLPNGYLTEVGERGVQLSGGQKQRVAIARAMLKDPPILLL  551

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE        GR      T I +AHR+ST+VN+D IVV++ G
Sbjct  552   DEATSALDSESEKLVQDALERAMH----GR------TVILIAHRMSTIVNADTIVVVENG  601

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V + G+H  L  +    YS + S+Q+++
Sbjct  602   RVAQNGTHQELLEKST-FYSNVCSMQNIE  629



>gb|KGN63320.1| hypothetical protein Csa_2G428920 [Cucumis sativus]
Length=919

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/542 (67%), Positives = 451/542 (83%), Gaps = 6/542 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  +AK+KVG YS+IF+ +GLLS FT+TLQHY +GVVGEKAM NLR +LYS  L+NE+AW
Sbjct  381   YKKNAKQKVGLYSLIFSLLGLLSLFTHTLQHYFFGVVGEKAMRNLREALYSVVLRNEVAW  440

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F++PENNVG LTS+I+N TS +K +I+DRMSVIVQCISSI+IAT VS I++WRM LVAWA
Sbjct  441   FDKPENNVGLLTSKIMNTTSVIKTVIADRMSVIVQCISSILIATIVSFIINWRMALVAWA  500

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMP HFIGGLIQAK AKGFS D+   H E+VSLASESA NI+T+ SFCHEE ++ +AR++
Sbjct  501   VMPFHFIGGLIQAKYAKGFSRDSADVHHELVSLASESATNIRTIASFCHEEQIMKRARIS  560

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  + + ++ESIK+GII G SLCLWNI++A+ALWYTT+LV + Q+SF + IRSYQIFSL
Sbjct  561   LEEPMRKGKRESIKYGIIYGVSLCLWNISNAIALWYTTILVSKRQASFEDGIRSYQIFSL  620

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+ AI IL P F TLDR T IEP+ P+   ++ IEG ++F+T+ F 
Sbjct  621   TVPSITELWTLIPAVIKAIDILTPAFHTLDRRTLIEPEIPKGETTDKIEGRIDFQTVNFK  680

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV+VL  F+L+I+AG  VAL+GPSGAGKSSV+ALLLRFYD ++G +LIDGKD+++
Sbjct  681   YPSRPEVIVLKNFSLQIKAGSDVALIGPSGAGKSSVLALLLRFYDPEKGNILIDGKDIKE  740

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR NICYGS++ SEAE+++VSK ANIH F+S+LP+GY
Sbjct  741   YNLRTLRRQIGLVQQEPVLFSSSIRYNICYGSDQVSEAEVLKVSKEANIHQFVSSLPDGY  800

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG QLSGGQKQRIAIAR LLK+PAI+LLDE TSALD  SER +V ALES+  ++
Sbjct  801   DTIVGEKGCQLSGGQKQRIAIARTLLKKPAILLLDEPTSALDIESERILVRALESINGNN  860

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                    S+ TQITVAHRLSTV NSD+IVVMD+G VVE+GSH+TL + PDGVYS+L  +Q
Sbjct  861   G------SRTTQITVAHRLSTVSNSDVIVVMDRGEVVEIGSHATLLTTPDGVYSKLFRIQ  914

Query  1622  SM  1627
             S+
Sbjct  915   SL  916


 Score =   242 bits (618),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 180/283 (64%), Gaps = 14/283 (5%)
 Frame = +2

Query  788   KPVFQTLDRCTRIEPDKPEESLS--ESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAG  961
             K VFQ + R      D  EE  S  + IEG ++ + + F YPSRP+ +V   F+L I AG
Sbjct  12    KEVFQVIQRIPATN-DSLEEKKSTLKHIEGHIDIREVHFAYPSRPQKLVFQDFSLSIPAG  70

Query  962   MKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLF  1141
               VALVG SG GKS+VI+L+ RFYD  +G + ID ++ +D NL+ LR  IG+V QEP LF
Sbjct  71    QTVALVGSSGCGKSTVISLITRFYDPLQGDIFIDHQNTKDLNLKFLRTNIGIVSQEPALF  130

Query  1142  CCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIA  1321
               +I++NI  G+  A + +I   +  AN H+FIS LP  Y T VG+ G+QLSGGQKQR+A
Sbjct  131   AGTIKDNIKMGNIDADDKQIENAAFMANAHSFISELPNQYSTEVGQGGTQLSGGQKQRVA  190

Query  1322  IARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLS  1501
             IARA+LK P I+LLDEATSALDS +ER V  ALE        GR      T I +AHR+S
Sbjct  191   IARAILKNPKILLLDEATSALDSEAERLVQDALEKA----IIGR------TTILIAHRIS  240

Query  1502  TVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             T+V +D+I +++ G V E G+H +L  +    Y  L +L S+K
Sbjct  241   TIVGADMIAIIEDGRVSETGTHQSLL-ETSTFYRNLFNLHSIK  282



>ref|XP_009420921.1| PREDICTED: ABC transporter B family member 10-like [Musa acuminata 
subsp. malaccensis]
Length=1148

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/541 (67%), Positives = 446/541 (82%), Gaps = 2/541 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  +A+  VG YS+IF  +G+L+   +TLQHY YGVVGEKAM NLR +L+SA L+NE+AW
Sbjct  609   YKQNARETVGKYSIIFCVVGVLALVAHTLQHYHYGVVGEKAMGNLREALFSAVLRNEVAW  668

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN VG L +RIV++T  +K IISDRMSVIVQCISSI+IATTVSMIV+WRMGLVAWA
Sbjct  669   FEKPENGVGLLATRIVSDTCVIKTIISDRMSVIVQCISSILIATTVSMIVNWRMGLVAWA  728

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             +MPCHFIGGLIQ+KSAKGFSGD+  AH ++  LASESA+NI+TV +F HEE ++ KA+++
Sbjct  729   LMPCHFIGGLIQSKSAKGFSGDSALAHQQLAVLASESASNIRTVAAFVHEEQMITKAKLS  788

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  +   R +SIK+G+IQGTSL LWN+AHAVALWYTT+LV ++QSSF + IRSYQIFSL
Sbjct  789   LEEPMRIGRLQSIKYGMIQGTSLFLWNVAHAVALWYTTILVDKNQSSFEDGIRSYQIFSL  848

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAIGILKP F  LDR TRI PD P+E  SE I G +EF+ I+F 
Sbjct  849   TVPSITELWTLIPTVVSAIGILKPAFDILDRETRILPDVPDEVNSERILGGIEFECIRFS  908

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V+VL+ F L +EAG  VALVGPSGAGKSSV+ALL+RFYD  +G++LID KD+R+
Sbjct  909   YPSRPQVVVLDSFVLTVEAGSSVALVGPSGAGKSSVLALLMRFYDPAQGRILIDRKDIRE  968

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIG VQQEPLLF  +IRENICYG+E ASEAE +E +  ANIH FIS+LP+GY
Sbjct  969   YNLRWLRQQIGFVQQEPLLFSSTIRENICYGNEGASEAETVEAATEANIHEFISSLPDGY  1028

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG Q+SGGQKQRIAIAR LLKRP I+LLDEATSALD+ +ER ++ AL S +   
Sbjct  1029  DTMVGEKGCQVSGGQKQRIAIARTLLKRPVILLLDEATSALDAETERTIMRALGSSKWWR  1088

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             +    +   +T++TVAHRLSTV++SDIIVVM+KG VVEMGSHSTL  + DGVYS+L  LQ
Sbjct  1089  R--EDTSCGITRVTVAHRLSTVISSDIIVVMEKGKVVEMGSHSTLIGEADGVYSKLFHLQ  1146

Query  1622  S  1624
             +
Sbjct  1147  N  1147


 Score =   244 bits (624),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 174/494 (35%), Positives = 264/494 (53%), Gaps = 23/494 (5%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  LR +   A L  ++  F+  E     + +   +  ST++  I +++   + C +
Sbjct  21    ERQVARLRLAFLRAVLHQDIEAFD-TELTTAKVMAGATHHMSTIQDAIGEKLGHFISCFA  79

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSG---DTTaahsevvslas  466
             +      ++++  W + L++  V+P     G    +  +G S       +  + VV    
Sbjct  80    TYFAGVVIAIVSCWEVALLSLMVLPMILAIGATYTRKMEGLSALRMSYLSEATSVVEQHL  139

Query  467   esaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHA  634
             ++ ++IKTV SF  E   +      ++ Q   S+KE+    +  G+ Q  + C W +   
Sbjct  140   QTLSHIKTVFSFVGESSSLKSFTRNVKQQYAMSKKEAAIKGLGLGLFQTVTFCSWALVVW  199

Query  635   VALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDR  814
             V     T   + +    L AI S    ++   SIT     +     A      VF+ ++R
Sbjct  200   VGAVVVTA-GRANGGETLAAIMSILFGAI---SITYAAPDLQIFNQAKAAGSEVFKVIER  255

Query  815   CTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
               RI  +   E L E I G +E   + F YPSR + +VL GF+L I AG   ALVG SG 
Sbjct  256   KPRISYETKGEKL-EKIVGGIEINGVSFAYPSRQDKLVLQGFSLSIPAGKVFALVGSSGC  314

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS++++L+ RFYD   G++ IDG +++D +L  LR  +  V QEP LF  +I++N+  G
Sbjct  315   GKSTLLSLVQRFYDPISGEISIDGHNIKDLDLEFLRRNVAAVPQEPSLFSGTIKDNLKVG  374

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
             +  A++ EI++ + AAN  +FIS LP+ Y T VGE+  QLSGGQKQRIAIARA+LK   I
Sbjct  375   NSEATDEEILKAASAANADSFISLLPDKYSTWVGERQVQLSGGQKQRIAIARAILKDSPI  434

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDE TSALDS SE+ V  ALE + Q    GR      T I VAHR STV N+D IVV+
Sbjct  435   LLLDEPTSALDSESEKLVQEALEKVMQ----GR------TVIIVAHRASTVSNADTIVVV  484

Query  1535  DKGCVVEMGSHSTL  1576
             ++G V + GSHS L
Sbjct  485   EEGRVAQSGSHSDL  498



>ref|XP_004972835.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1261

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/545 (70%), Positives = 452/545 (83%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD DAKRKV  YS+IF + G+++  +N LQHY+YGVVGEKAM NLR +L+SA L+NE+ W
Sbjct  719   YDPDAKRKVSKYSLIFFTAGMVTLVSNILQHYIYGVVGEKAMKNLREALFSAVLRNEIGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N VGSLTSRIVN+TSTVK IISDRM+VIVQCISSI+IAT VSM V+WRMGLV+WA
Sbjct  779   FEKPKNGVGSLTSRIVNDTSTVKTIISDRMAVIVQCISSILIATIVSMYVNWRMGLVSWA  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF GD+  AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  839   VMPCHFIGGLIQAKSAKGFYGDSAIAHRELVSLASEAASNIRTVASFVYEDEIIKKAELS  898

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  L +++ ES+K+G+IQG SLCLWNIAHAVALWYTT+LVQR Q+SF N+IRSYQIFSL
Sbjct  899   LREPLKKTKIESMKYGVIQGISLCLWNIAHAVALWYTTVLVQRKQASFENSIRSYQIFSL  958

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI IL P F TLDR T+I PDKPE      + G  EF+ + F+
Sbjct  959   TVPSITELWTLIPMVMSAIAILNPTFDTLDRETQIVPDKPENPSKGWLVGRTEFQDVHFN  1018

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GFNL IE G KVALVGPSGAGKSSV+AL+LRFYD   G+VLID K++RD
Sbjct  1019  YPSRPEVTILDGFNLIIEPGQKVALVGPSGAGKSSVLALILRFYDPYRGRVLIDNKNIRD  1078

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE  SE EII+ +  ANIH FIS LPEGY
Sbjct  1079  YNLRWLRKQIGLVQQEPILFNISIRDNISYGSEGTSETEIIQAAMEANIHEFISGLPEGY  1138

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKGSQLSGGQKQRIAIAR LLKRPA++LLDEATSALD  SER V+SAL + +  +
Sbjct  1139  DTVVGEKGSQLSGGQKQRIAIARTLLKRPALLLLDEATSALDGESERVVISALGAKEWTN  1198

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K  +S  SK+T ITVAHRLSTV+N+D IVVM+KG VVE+G+H TL S  DGVYSRL  LQ
Sbjct  1199  KDDQS--SKITSITVAHRLSTVINADTIVVMEKGKVVELGNHQTLISADDGVYSRLFHLQ  1256

Query  1622  S-MKD  1633
             S MKD
Sbjct  1257  SNMKD  1261


 Score =   285 bits (729),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 184/509 (36%), Positives = 281/509 (55%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R +   + L  E+  F+  +    ++ + + N  S ++  I +++   V   S
Sbjct  128   ERQLARMRLAFLRSVLNQEVGAFD-TDLTTATIITGVTNHMSVIQDAIGEKLGHFVASFS  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W++ ++++ V+P   + G    K   G S    A  SE +S+  ++ 
Sbjct  187   TFFAGIIIAFISCWQVAMLSFLVIPLILVIGATYTKKMIGISLSRNAIISEAISVVEQTL  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKT+ SF  E   +      ++ Q + S+KE+    I  G+ Q  + C W    A+ +
Sbjct  247   SHIKTIFSFVGESWAMKSFVRCMENQFNLSKKEAMIKGIGLGLFQAVTFCSW----ALMV  302

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V +++++    I +         SIT     + T   A    K VF+ + R   
Sbjct  303   WIGAVAVSKNKATGGGTIAAIMSILFGAISITYAAPDLQTFNQAKAAGKEVFKVIKRKPS  362

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  DK    L E I GE++F+ + F YPSR +  +L GF+L I AG  +ALVG SG GKS
Sbjct  363   ISYDKGGAVL-EKIHGEIKFRRVHFAYPSRQDNPILQGFSLTIPAGKVIALVGSSGCGKS  421

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G + IDG  ++  +L+ LR  I  V QEP LF  +I++N+  G   
Sbjct  422   TVISLLQRFYDPTSGDIFIDGHSIKKLDLKSLRRNIASVSQEPSLFSGNIKDNLRIGKMD  481

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             AS+ EIIE +  AN+H+FIS  P  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  482   ASDEEIIEAATTANVHSFISKQPNEYLTEVGERGVQLSGGQKQRIAIARAMLKDPPILLL  541

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE   +    GR      T I +AHR+ST+VN+D IVV++ G
Sbjct  542   DEATSALDSESEKLVQDALERAMR----GR------TVILIAHRMSTIVNADTIVVVENG  591

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V + G+H  L  +    YS + S+Q+++
Sbjct  592   RVAQTGTHHELLEKST-FYSNVCSMQNIE  619



>gb|EMT33289.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1258

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/545 (68%), Positives = 445/545 (82%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD DAKRKV  YS+IF   G+++  ++ LQHY+YGV+GE AM NLR +L+S+ LQNEL W
Sbjct  716   YDQDAKRKVSKYSLIFFGAGMVTLASSILQHYIYGVIGETAMKNLREALFSSVLQNELGW  775

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N VGSLTSRIV++TSTVK IISDRM+VIVQCISSI+IATTVSM V+WRMGLV+WA
Sbjct  776   FEKPKNGVGSLTSRIVSDTSTVKSIISDRMAVIVQCISSILIATTVSMFVNWRMGLVSWA  835

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF GD   AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  836   VMPCHFIGGLIQAKSAKGFYGDAAIAHQELVSLASEAASNIRTVASFVYEDEIMKKAELS  895

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  ++ ES+K+GIIQG SLCLWNIAHAVALWYTT+LVQR Q+SF N+IRSYQIFSL
Sbjct  896   LQEPMRITKIESMKYGIIQGISLCLWNIAHAVALWYTTVLVQRKQASFENSIRSYQIFSL  955

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI IL P F  LDR T+I PD+P+ +    + G +EF+ + F+
Sbjct  956   TVPSITELWTLIPMVMSAITILNPAFDILDRETQIVPDEPKATSDCWLVGRIEFQGVNFN  1015

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPE+ +L+GFNL IE G +VALVGPSGAGKSSV+AL+LRFYD   G VL+D KD+RD
Sbjct  1016  YPSRPEITILDGFNLVIEPGQRVALVGPSGAGKSSVLALILRFYDPHRGTVLVDNKDIRD  1075

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE +SE EII+ +  ANIH FIS LPEGY
Sbjct  1076  YNLRWLRRQIGLVQQEPILFNTSIRDNISYGSEESSETEIIQAAMDANIHEFISGLPEGY  1135

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              TVVG+KG QLSGGQKQRIAIAR LLKRP I+LLDEATSALD  SER V+++L + + ++
Sbjct  1136  GTVVGDKGGQLSGGQKQRIAIARTLLKRPDILLLDEATSALDGESERVVMTSLGAKEWNN  1195

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             +  RS  S +T ITVAHRLSTV+N+D+IVVM+KG V E G H TL S  DGVYSRL  LQ
Sbjct  1196  RGERS--SNITSITVAHRLSTVINADMIVVMEKGKVAETGDHQTLISADDGVYSRLFHLQ  1253

Query  1622  S-MKD  1633
             S MKD
Sbjct  1254  SNMKD  1258


 Score =   265 bits (677),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 178/509 (35%), Positives = 267/509 (52%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R     + L  E+  F+  + +  ++ + + N  + ++  I +++   V   S
Sbjct  125   ERQLARMRLEYLRSVLNQEVGAFD-TDLSTANIITGVTNHMNVIQDAIGEKLGHFVASFS  183

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++    W + ++++ V+P     G    K     S    A  S+  S+  ++ 
Sbjct  184   TFFAGIIIAFASCWEVAMLSFLVIPLILAIGATYTKKMNVISLSRNAIVSQATSVVEQTL  243

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +         Q   S+KE+    I  G+ Q  + C W    A+ +
Sbjct  244   SHIKTVFSFAGENWAMKSFVQCTDNQYKLSKKEAMIKGIGLGLFQTVTFCSW----ALMV  299

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V    ++    I +         SIT     + T   A    K VF+ + R   
Sbjct  300   WIGAVAVSNRTATGGGTIAAIMSILFGAISITYAAPDLQTFNQAKAAGKEVFKVIRRNPS  359

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I   K    L E + GE++   + F YPSR +  +L GF+L I AG  VALVG SG+GKS
Sbjct  360   ISYTKGGAIL-EKVYGEIKLHGVHFAYPSRQDKPILQGFSLSIPAGKVVALVGSSGSGKS  418

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G + IDG  ++  +L+ LR  I  V QEP LF  +I++N+  G   
Sbjct  419   TVISLLQRFYDPTSGDIFIDGHSIKKLDLKSLRRNIASVSQEPSLFSGTIKDNLRIGKMD  478

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A++ EIIE +  AN+H+FIS LP  Y T VGE+G QLSGGQKQR+AIARA+LK P I+LL
Sbjct  479   ATDEEIIEAATTANVHSFISKLPNEYLTEVGERGVQLSGGQKQRVAIARAMLKDPPILLL  538

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE        GR      T I +AHR+ST+VN+D IVV++ G
Sbjct  539   DEATSALDSESEKLVQDALERAMH----GR------TVILIAHRMSTIVNADTIVVVENG  588

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V + G+H  L  Q    YS +  +Q+++
Sbjct  589   SVAQTGTHQELL-QKSTFYSNVCRMQNIE  616



>ref|XP_010934697.1| PREDICTED: ABC transporter B family member 19-like [Elaeis guineensis]
Length=1264

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/543 (69%), Positives = 444/543 (82%), Gaps = 7/543 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  DA+  V WYSVIF  +GLL+  T+TLQH+ YGVVGE AM NLR +L+SA L+NE+AW
Sbjct  723   YKHDARTIVAWYSVIFCLVGLLTLITHTLQHFFYGVVGETAMRNLRETLFSAVLRNEVAW  782

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+PEN+VG L+S IV +TS +K IISDRMSVIVQCISSI+IAT VSM+V+WRMGLVAWA
Sbjct  783   FEKPENSVGFLSSHIVGDTSMIKTIISDRMSVIVQCISSILIATIVSMVVNWRMGLVAWA  842

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGFSGD   AH E+V+LASESA+NI+TV SF HEE ++ KA+ +
Sbjct  843   VMPCHFIGGLIQAKSAKGFSGDFAVAHRELVALASESASNIRTVASFVHEEQILKKAKHS  902

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  +  SR ESIK+G++QG SLCLWNIAHAVALWYTT+LV + Q++F N IRSYQIFSL
Sbjct  903   LREPMRISRIESIKYGMVQGVSLCLWNIAHAVALWYTTVLVDKRQATFENGIRSYQIFSL  962

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+SAI IL P F+ LDR T I PD PE+   E I G +EF+ + F+
Sbjct  963   TVPSITELWTLIPTVISAINILTPAFRILDRKTEIVPDAPEKISLERILGRIEFEEVSFN  1022

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV++L+ F+L IE+G KVALVGPSGAGKSSV+ALLLRFYD +EG++LID K++R 
Sbjct  1023  YPSRPEVVILDNFSLIIESGQKVALVGPSGAGKSSVLALLLRFYDPNEGRILIDRKEIRK  1082

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEPLLF  SIR+NICYG+E ASE +IIE +  ANIH FIS LP GY
Sbjct  1083  YNLRWLRKQIGLVQQEPLLFSSSIRDNICYGNEGASETQIIEAASEANIHEFISGLPNGY  1142

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG QLSGGQKQRIAIAR LLKRPA++LLDE TSALD  SER V+S L S    +
Sbjct  1143  DTIVGEKGCQLSGGQKQRIAIARTLLKRPAVLLLDEPTSALDGESERKVMSNLGS----N  1198

Query  1442  KFG--RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
             K+G  R    + TQITVAHRLSTVV++D+IVVMDKG VVEMG+H+TL +   GVYS+L  
Sbjct  1199  KWGKQRGPLFRSTQITVAHRLSTVVSADVIVVMDKGKVVEMGNHATLIA-ATGVYSKLFQ  1257

Query  1616  LQS  1624
             LQS
Sbjct  1258  LQS  1260


 Score =   268 bits (685),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 182/509 (36%), Positives = 273/509 (54%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ M   R     A L  ++  F+  +     + +RI N  S ++  I +++   +   S
Sbjct  128   ERQMARFRLEFLKAVLSQDIGAFD-TDLTTAKIITRITNHMSIIQDAIGEKLGHFISSFS  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +  +   ++ +  W++GL+   V+P   I G          S       SE  S+  ++ 
Sbjct  187   TFFVGVIIAFVCCWQVGLLTLLVLPLILIIGATYTSKMNIISAVRMQYLSEATSVVEQTL  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESI----KFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   VN     ++ Q   S+KE++      G  Q  + C W    A+ +
Sbjct  247   SHIKTVFSFVGEMSAVNSFTRCMEKQYILSKKEAVIKGLGLGSFQAATFCSW----ALIV  302

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V   ++S    + +         SIT     +     A      VF+ ++R   
Sbjct  303   WVGAVAVTARKASGGETLAAVMSILFGAISITYAAPDLEIFNRAKAAGHEVFKVIERKPG  362

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  +   ++L E+I GE++ + + F YPSR + ++L  F+L I AG  VALVG SG GKS
Sbjct  363   ISYENKGKTL-ENIVGEIDIQGVHFSYPSREDKLILQDFSLSIPAGRVVALVGNSGCGKS  421

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+L+ RFYD   G++ IDG +++D +L+ LR  I  V QEP LF  +I++N+  G+  
Sbjct  422   TVISLIQRFYDPTRGEIFIDGHNIKDLDLKFLRRNIAAVPQEPSLFSGNIKDNLKIGNMD  481

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             AS+ +I   +  AN H+FIS LP+ Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  482   ASDEQIERAASTANAHSFISQLPDKYSTEVGERGVQLSGGQKQRIAIARAILKDPPILLL  541

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE   Q    GR      T I +AHR+STV+NSDII V++ G
Sbjct  542   DEATSALDSESEKLVQDALERAMQ----GR------TVILIAHRMSTVINSDIIAVVENG  591

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V + G+H  L  +    Y  L  +Q++K
Sbjct  592   TVAQTGTHQELL-ESSKFYRNLFGMQNLK  619



>ref|XP_002443864.1| hypothetical protein SORBIDRAFT_07g003510 [Sorghum bicolor]
 gb|EES13359.1| hypothetical protein SORBIDRAFT_07g003510 [Sorghum bicolor]
Length=1237

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/545 (68%), Positives = 443/545 (81%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD DAK+KV  YS+IF + G+++  +N LQHY+YG++GE+AM NLR +L+SA LQNEL W
Sbjct  695   YDPDAKKKVTKYSLIFFTAGMVTMVSNILQHYIYGIIGERAMKNLREALFSAVLQNELGW  754

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P N +G LTSRIV++TSTVK IISDRM+VIVQCISSI+IAT VSM V+WRM LV+WA
Sbjct  755   FEKPNNGIGFLTSRIVSDTSTVKTIISDRMAVIVQCISSILIATIVSMKVNWRMALVSWA  814

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF GD+  AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  815   VMPCHFIGGLIQAKSAKGFYGDSAIAHRELVSLASEAASNIRTVASFVYEDEIIKKAELS  874

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  L  ++ ES+K+G+IQG SLCLWNIAHAVALWYTT+LVQR Q+SF ++IRSYQIFSL
Sbjct  875   LQEPLKITKIESMKYGVIQGISLCLWNIAHAVALWYTTVLVQRKQASFEDSIRSYQIFSL  934

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI IL PVF TLDR T+I PDKPE      + G  EF+ + F+
Sbjct  935   TVPSITELWTLIPMVMSAISILNPVFDTLDRETQIVPDKPENPGKGWLIGRTEFQDVSFN  994

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GFNL IE G +VALVGPSGAGKSSV+AL+LRFYD   G+VLID K+++D
Sbjct  995   YPSRPEVTILDGFNLVIEPGQRVALVGPSGAGKSSVLALILRFYDPSRGRVLIDNKNIKD  1054

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE  SE EII+ +  ANIH FIS LPEGY
Sbjct  1055  YNLRWLRKQIGLVQQEPILFNTSIRDNISYGSESPSETEIIQAAMEANIHEFISGLPEGY  1114

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              TVVG+KGSQLSGGQKQRIAIAR +LKRPAI+LLDEATSALD  SER V+S+L +  +  
Sbjct  1115  GTVVGDKGSQLSGGQKQRIAIARTILKRPAILLLDEATSALDGESERVVMSSLGA--KVW  1172

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K      S +T ITVAHRLSTV+N+D IVVM+KG VVE+G+H  L S  DGVYSRL  LQ
Sbjct  1173  KDENEQASMITSITVAHRLSTVINADTIVVMEKGKVVELGNHQALISAEDGVYSRLFHLQ  1232

Query  1622  S-MKD  1633
             S MKD
Sbjct  1233  SNMKD  1237


 Score =   274 bits (700),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 177/491 (36%), Positives = 268/491 (55%), Gaps = 20/491 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R +   + L  E+  F+  +    ++ + + N  S ++  I +++   +   S
Sbjct  128   ERQLARMRLAFLRSVLNQEVGAFDT-DLTTATIITGVTNYMSVIQDAIGEKLGHFIASFS  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W++ ++++ V+P   I G    K     S    A  SE +S+  ++ 
Sbjct  187   TFFAGIIIAFISCWQVAMLSFLVIPLILIIGAAYTKKLNVLSLSRNAIVSEAISVVEQTL  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +      ++ Q + S+KE+    I  G+ Q  + C W    A+ +
Sbjct  247   SHIKTVFSFVGESWAMKSFVQCMENQFNLSKKEALIKGIGLGMFQAVTFCSW----ALMV  302

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + + +++++    I +         SIT     + T   A    K VF+ + R   
Sbjct  303   WIGAVAITKNKATGGGTIAAIMSILFGAISITYAAPDLQTFNQAKAAGKEVFKVIKRKPS  362

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I   K    L + I GE++F+ + F YPSR +  +L GF+L I AG  +ALVG SG GKS
Sbjct  363   ISYGKSGLVL-DKIHGEIKFRRVHFAYPSRHDKPILQGFSLSIPAGKVIALVGSSGCGKS  421

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G + IDG  ++  +L+ LR  I  V QEP LF  +I++N+  G   
Sbjct  422   TVISLLQRFYDPTSGDIFIDGHSIKKLDLKSLRRNIASVSQEPSLFSGNIKDNLKIGKMD  481

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             AS+ EI E +  AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  482   ASDEEITEAATTANVHSFISKLPNEYLTEVGERGVQLSGGQKQRIAIARAMLKDPPILLL  541

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE        GR      T I +AHR+ST+VN+D IVV++ G
Sbjct  542   DEATSALDSESEKLVQDALERAMH----GR------TVILIAHRMSTIVNADTIVVVENG  591

Query  1544  CVVEMGSHSTL  1576
              V + G+H  L
Sbjct  592   RVAQTGTHHEL  602



>dbj|BAC99416.1| putative MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAC99764.1| putative MDR-like ABC transporter [Oryza sativa Japonica Group]
 gb|EEE68059.1| hypothetical protein OsJ_26065 [Oryza sativa Japonica Group]
Length=1261

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/545 (67%), Positives = 445/545 (82%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD DAKRKV  YS+IF + G+++  +N  QHY+YGVVGEKAM  LR +++S+ L+NEL W
Sbjct  719   YDLDAKRKVSKYSLIFFTAGVITLASNIFQHYIYGVVGEKAMKILREAIFSSVLRNELGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N VG LTSRIV++TSTVK IISDRM+VIVQCISSI+IAT VSM V+WRMGLV+WA
Sbjct  779   FEKPKNGVGFLTSRIVSDTSTVKTIISDRMAVIVQCISSILIATVVSMYVNWRMGLVSWA  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAK+AKGF GD+  AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  839   VMPCHFIGGLIQAKAAKGFYGDSAIAHQELVSLASEAASNIRTVASFVYEDEIIKKAELS  898

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  ++ ES+K+G++QG SLCLWNIAHAVALWYTT+LVQR Q+SF N+IRSYQIFSL
Sbjct  899   LQEPMRVTKIESMKYGVVQGISLCLWNIAHAVALWYTTVLVQRKQASFENSIRSYQIFSL  958

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI +L P F+ LDR T+I PD+PE      + G  EF+ + F+
Sbjct  959   TVPSITELWTLIPMVMSAIAVLNPAFEMLDRDTQIVPDRPENPSDGWLMGRTEFQDVSFN  1018

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GF+L IE G +VALVGPSGAGKSSV+ALLLRFYD   G+VLID K+++D
Sbjct  1019  YPSRPEVTILDGFSLVIEPGQRVALVGPSGAGKSSVLALLLRFYDPQRGRVLIDNKNIKD  1078

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE  SE EII+ +  ANIH FIS+LP+GY
Sbjct  1079  YNLRWLRKQIGLVQQEPILFNSSIRDNISYGSEETSETEIIQAAMEANIHEFISSLPKGY  1138

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVGEKGSQLSGGQKQRIAIAR LLKRP I+LLDEATSALD  SER V+S+L +  +  
Sbjct  1139  DTVVGEKGSQLSGGQKQRIAIARTLLKRPVILLLDEATSALDGESERVVMSSLGA--KDW  1196

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K      SK+T ITVAHRLSTV+NSD IVVM++G VVE+G+H TL +  DGVYSRL  LQ
Sbjct  1197  KDRNEGSSKITSITVAHRLSTVINSDTIVVMERGKVVELGNHHTLITADDGVYSRLFHLQ  1256

Query  1622  S-MKD  1633
             S MKD
Sbjct  1257  SNMKD  1261


 Score =   278 bits (710),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 181/509 (36%), Positives = 274/509 (54%), Gaps = 21/509 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R +   + L  E+  F+  +     + + + N  S ++  I +++   V   S
Sbjct  128   ERQLARMRLAFLRSVLNQEVGAFD-TDLTTAKIITGVTNHMSVIQDAIGEKLGHFVASFS  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++    W + L+++ V+P   + G    K   G S    A  SE  S+  ++ 
Sbjct  187   TFFAGIIIAFASCWEVALLSFLVIPLILVIGATYTKQMNGISLSRNAIVSEATSIVEQTL  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E+  +      +  Q   S+KE+    I  G+ Q  + C W    A+ +
Sbjct  247   SHIKTVFSFVGEKRAMRSFVRCMDNQYKLSKKEAVIKGIGLGLFQAVTFCSW----ALMV  302

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V   +++    I +         SIT     + T   A    K VF+ + R   
Sbjct  303   WIGAVAVTSRKATGGGTIAAIMSILFGAISITYAAPDLQTFNQAKAAGKEVFKVIKRKPS  362

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  +K    L + + GE++F+ + F YPSR +  +L GF+L I AG  VALVG SG GKS
Sbjct  363   ISYEKHGSVLGK-VHGEIKFRRVHFAYPSRQDKPILQGFSLSIPAGKVVALVGSSGCGKS  421

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G +LIDG  ++  +L  LR  I  V QEP LF  +I++N+  G   
Sbjct  422   TVISLLQRFYDPTSGSILIDGHSIKKLDLESLRRNIASVSQEPSLFSGTIKDNLRIGKMD  481

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A++ EI + ++ AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  482   ANDDEITKAARTANVHSFISKLPNEYLTEVGERGVQLSGGQKQRIAIARAMLKDPPILLL  541

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE           + S  T I +AHR+ST+VN+D IVV++ G
Sbjct  542   DEATSALDSESEKLVQDALE----------KAMSGRTVILIAHRMSTIVNADTIVVVENG  591

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V + G+H  L  +    YS + S+Q+++
Sbjct  592   KVAQTGTHQELI-EKSTFYSNVCSMQNIE  619



>ref|XP_008462855.1| PREDICTED: ABC transporter B family member 19-like [Cucumis melo]
Length=1251

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/542 (67%), Positives = 452/542 (83%), Gaps = 6/542 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  +AK+KVG YS+IF+ +GLLS FT+TLQHY +GVVGEKAM NLR +LYS  L+NE+AW
Sbjct  713   YQKNAKQKVGLYSLIFSLLGLLSLFTHTLQHYFFGVVGEKAMRNLREALYSVVLRNEVAW  772

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F++PENNVG LTS+I+N TS +K +I+DRMSVIVQCISSI+IATTVS I++WRM LVAWA
Sbjct  773   FDKPENNVGLLTSKIMNTTSVIKTVIADRMSVIVQCISSILIATTVSFIINWRMALVAWA  832

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMP HFIGGLIQAK AKGFS D+   H E++SLASESA NI+T+ SFCHEE ++ +AR++
Sbjct  833   VMPFHFIGGLIQAKYAKGFSRDSADVHHELISLASESATNIRTIASFCHEEQIMKRARIS  892

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  + + ++ESIK+GII G SLCLWNI++A+ALWYTT+LV + Q+SF + IRSYQIFSL
Sbjct  893   LEEPMRKGKRESIKYGIIYGVSLCLWNISNAIALWYTTILVSKRQASFEDGIRSYQIFSL  952

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIPTV+ AI IL P F TLDR T IEP+ P+   ++ IEG ++F+T+ F 
Sbjct  953   TVPSITELWTLIPTVIKAIDILTPAFHTLDRRTLIEPEIPKGETTDKIEGRIDFQTVNFK  1012

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV+VL  F+L+I+AG  VAL GPSGAGKSSV+ALLLRFYD ++G +LIDGKD+++
Sbjct  1013  YPSRPEVVVLKNFSLQIKAGSDVALTGPSGAGKSSVLALLLRFYDPEKGNILIDGKDIKE  1072

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR NICYGS++ SEAE+++VSK ANIH F+S+LP+GY
Sbjct  1073  YNLRTLRRQIGLVQQEPVLFSSSIRYNICYGSDQVSEAEVLKVSKEANIHQFVSSLPDGY  1132

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG QLSGGQKQRIAIAR LLK+P I+LLDE TSALD  SER +VSALES+  ++
Sbjct  1133  DTIVGEKGCQLSGGQKQRIAIARTLLKKPTILLLDEPTSALDIESERILVSALESINGNN  1192

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              F      + TQITVAHRLSTV NSD+IVVMD+G VVE+GSH+TL + PDGVYS+L  +Q
Sbjct  1193  GF------RTTQITVAHRLSTVTNSDVIVVMDRGEVVEIGSHATLLTTPDGVYSKLFRMQ  1246

Query  1622  SM  1627
             S+
Sbjct  1247  SL  1248


 Score =   248 bits (634),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 170/512 (33%), Positives = 273/512 (53%), Gaps = 25/512 (5%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+    LR +   + L  E+  F+  +     +   I    S ++  I +++   + C++
Sbjct  121   ERQTARLRFAFLQSVLCQEIGAFD-TDLTTAKIIIGISGHMSIIRDAIGEKLGHFISCVT  179

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + +    +++I  W + L+   V P     G    K     S       S+  SL  +S 
Sbjct  180   TFICGVVIAIISCWEVSLLTLLVAPLILTIGATYNKRMTAISSLKMDCQSQATSLVEQSI  239

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + I+TV +F  E   +       + Q    ++E+    +  G+ Q  + C W++     +
Sbjct  240   SQIRTVYAFVGERGSIKAFEEQCEKQAVMCKQEALVKGVGIGMFQTATFCCWSLI----V  295

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL--IPTVLSAIGILKPVFQTLDRC  817
             W   ++V   ++S  + I +  + S+   +IT  +    +     A    K VFQ + R 
Sbjct  296   WIGAVVVTAGRASGGDVIAA--VVSVLFGTITLTYAAPDMQAFNQAKVAGKEVFQVIQRI  353

Query  818   -TRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
              T I+  + ++S    IEG ++ + + F YPSRP+ +V  G +L I AG  VALVG SG 
Sbjct  354   PTTIDSLEEKKSTLNHIEGHIDIREVHFAYPSRPQKLVFQGISLSIPAGQTVALVGNSGC  413

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS+VI+L+ RFYD  +G + +D ++++D NL+ LR  IG+V QEP LF  +I++NI  G
Sbjct  414   GKSTVISLITRFYDPLQGDIFVDHQNIKDLNLKFLRNNIGIVSQEPALFAGTIKDNIKMG  473

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
             +  A + ++   +  AN H+FIS+LP  Y T VG+ G+QLSGGQKQRIAIARA+LK P I
Sbjct  474   NIDADDKQMENAAVMANAHSFISDLPNQYSTEVGQGGTQLSGGQKQRIAIARAILKNPRI  533

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDEATSALDS +ER V  ALE        GR      T I + HR+ST+V +D+I ++
Sbjct  534   LLLDEATSALDSEAERLVQDALEK----AIIGR------TTILIVHRISTIVGADMIAII  583

Query  1535  DKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             + G V + G+H +L  +    Y  L +L ++K
Sbjct  584   EDGRVSKTGTHQSLL-ETSTFYRNLFNLHNIK  614



>emb|CAD59579.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1242

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/545 (67%), Positives = 444/545 (81%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD DAKRKV  YS+IF + G+++  +N  QHY+YGVVGEKAM  LR +++S+ L+NEL W
Sbjct  700   YDLDAKRKVSKYSLIFFTAGVITLASNIFQHYIYGVVGEKAMKILREAIFSSVLRNELGW  759

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N VG LTSRIV++TSTVK IISDRM+VIVQCISSI+IAT VSM V+WRMGLV+WA
Sbjct  760   FEKPKNGVGFLTSRIVSDTSTVKTIISDRMAVIVQCISSILIATVVSMYVNWRMGLVSWA  819

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAK+AKGF GD+  AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  820   VMPCHFIGGLIQAKAAKGFYGDSAIAHQELVSLASEAASNIRTVASFVYEDEIIKKAELS  879

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  ++ ES+K+G++QG SLCLWNIAHAVALWYTT+LVQR Q+SF N+IRSYQIFSL
Sbjct  880   LQEPMRVTKIESMKYGVVQGISLCLWNIAHAVALWYTTVLVQRKQASFENSIRSYQIFSL  939

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI +L P F+ LDR T+I PD+PE      + G  EF+ + F+
Sbjct  940   TVPSITELWTLIPMVMSAIAVLNPAFEMLDRDTQIVPDRPENPSDGWLMGRTEFQDVSFN  999

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GF+L IE G +VALVGPSGAGKSSV+ALLLRFYD   G+VLID K+++D
Sbjct  1000  YPSRPEVTILDGFSLVIEPGQRVALVGPSGAGKSSVLALLLRFYDPQRGRVLIDNKNIKD  1059

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE  SE EII+ +  ANIH FIS+LP+GY
Sbjct  1060  YNLRWLRKQIGLVQQEPILFNSSIRDNISYGSEETSETEIIQAAMEANIHEFISSLPKGY  1119

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVG KGSQLSGGQKQRIAIAR LLKRP I+LLDEATSALD  SER V+S+L +  +  
Sbjct  1120  DTVVGRKGSQLSGGQKQRIAIARTLLKRPVILLLDEATSALDGESERVVMSSLGA--KDW  1177

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K      SK+T ITVAHRLSTV+NSD IVVM++G VVE+G+H TL +  DGVYSRL  LQ
Sbjct  1178  KDRNEGSSKITSITVAHRLSTVINSDTIVVMERGKVVELGNHHTLITADDGVYSRLFHLQ  1237

Query  1622  S-MKD  1633
             S MKD
Sbjct  1238  SNMKD  1242


 Score =   272 bits (696),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 179/509 (35%), Positives = 273/509 (54%), Gaps = 40/509 (8%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R +   + L  E+  F+  +     + + + N  S ++  I +++   V   S
Sbjct  128   ERQLARMRLAFLRSVLNQEVGAFD-TDLTTAKIITGVTNHMSVIQDAIGEKLGHFVASFS  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++    W + L+++ V+P   + G    K   G S    A  SE  S+  ++ 
Sbjct  187   TFFAGIIIAFASCWEVALLSFLVIPLILVIGATYTKQMNGISLSRNAIVSEATSIVEQTL  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E+  +      +  Q   S+KE+    I  G+ Q  + C W    A+ +
Sbjct  247   SHIKTVFSFVGEKRAMRSFVRCMDNQYKLSKKEAVIKGIGLGLFQAVTFCSW----ALMV  302

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V   +++    I +                 I ++L   G  K VF+ + R   
Sbjct  303   WIGAVAVTSRKATGGGTIAA-----------------IMSIL--FGAXKXVFKVIKRKPS  343

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I  +K    L + + GE++F+ + F YPSR +  +L GF+L I AG  VALVG SG GKS
Sbjct  344   ISYEKHGSVLGK-VHGEIKFRRVHFAYPSRQDKPILQGFSLSIPAGKVVALVGSSGCGKS  402

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G +LIDG  ++  +L  LR  I  V QEP LF  +I++N+  G   
Sbjct  403   TVISLLQRFYDPTSGSILIDGHSIKKLDLESLRRNIASVSQEPSLFSGTIKDNLRIGKMD  462

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             A++ EI + ++ AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  463   ANDDEITKAARTANVHSFISKLPNEYLTEVGERGVQLSGGQKQRIAIARAMLKDPPILLL  522

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE           + S  T I +AHR+ST+VN+D IVV++ G
Sbjct  523   DEATSALDSESEKLVQDALE----------KAMSGRTVILIAHRMSTIVNADTIVVVENG  572

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              V + G+H  L  +    YS + S+Q+++
Sbjct  573   KVAQTGTHQELIEKST-FYSNVCSMQNIE  600



>ref|XP_006581696.1| PREDICTED: ABC transporter B family member 14-like [Glycine max]
Length=507

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/497 (70%), Positives = 416/497 (84%), Gaps = 2/497 (0%)
 Frame = +2

Query  143   SLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVS  322
             S ++  L+NE+ WF++ EN VGSLTSRI ++T+ VK+II+DRMSVI+QC+SSI+IAT VS
Sbjct  11    STFTGVLRNEVGWFDKSENTVGSLTSRITSDTAMVKVIIADRMSVILQCVSSILIATVVS  70

Query  323   MIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF  502
             M V+WRM LVAWAVMPCHFIGGLIQAKSAKGFSGD +AAHSE+V+LASES  NI+TV SF
Sbjct  71    MAVNWRMSLVAWAVMPCHFIGGLIQAKSAKGFSGDYSAAHSELVALASESTTNIRTVASF  130

Query  503   CHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSS  682
             CHEE V+ KA+ +L+      RKESIK+GIIQG SLCLWNIAHAVALWYTT+L+ R Q++
Sbjct  131   CHEEQVLGKAKTSLEIPKKNYRKESIKYGIIQGFSLCLWNIAHAVALWYTTILIDRGQAT  190

Query  683   FLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSES  862
             F N IRSYQIFSLTVPSITEL+TLIPTV+SAI IL P F+TLDR T IEPD P++S  E 
Sbjct  191   FKNGIRSYQIFSLTVPSITELYTLIPTVISAISILTPAFKTLDRKTEIEPDTPDDSQPER  250

Query  863   IEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVD  1042
             I G VEF+ +KF+YPSRP V VL+ F+LRIEAG+KVA VGPSGAGKSSV+ALLLRFYD  
Sbjct  251   IHGNVEFENVKFNYPSRPTVTVLDNFSLRIEAGLKVAFVGPSGAGKSSVLALLLRFYDPQ  310

Query  1043  EGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAA  1222
              GKVLIDGK+++ YN+R LR QIGLVQQEPLLF CS+R+NICYG+  ASE+EI+EV+K A
Sbjct  311   AGKVLIDGKNIQKYNIRWLRTQIGLVQQEPLLFNCSVRDNICYGNSGASESEIVEVAKEA  370

Query  1223  NIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSER  1402
             NIH F+SNLP GY+TVVGEKG Q SGGQKQRIAIAR LLK+PAI+LLDEATSALD+ SER
Sbjct  371   NIHEFVSNLPNGYNTVVGEKGCQFSGGQKQRIAIARTLLKKPAILLLDEATSALDAESER  430

Query  1403  AVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTS  1582
              +V+AL+++  H K      S+ TQITVAHRLSTV+NSD IVVMDKG VVEMGSHSTL +
Sbjct  431   IIVNALKAI--HLKEDSGLCSRTTQITVAHRLSTVINSDTIVVMDKGKVVEMGSHSTLIA  488

Query  1583  QPDGVYSRLVSLQSMKD  1633
                G+YSR+  LQS ++
Sbjct  489   AEAGLYSRIFRLQSFEE  505



>ref|XP_004151914.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1244

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/542 (67%), Positives = 452/542 (83%), Gaps = 6/542 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             Y  +AK+KVG YS+IF+ +GLLS FT+TLQHY +GVVGEKAM NLR +LYS  L+NE+AW
Sbjct  706   YKKNAKQKVGLYSLIFSLLGLLSLFTHTLQHYFFGVVGEKAMRNLREALYSVVLRNEVAW  765

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F++PENNVG LTS+I+N TS +K +I+DRMSVIVQCISSI+IAT VS I++WRM LVAWA
Sbjct  766   FDKPENNVGLLTSKIMNTTSVIKTVIADRMSVIVQCISSILIATIVSFIINWRMALVAWA  825

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMP HFIGGLIQAKSAKGFS D+   H E+VSLASESA NI+T+ SFCHEE ++ +AR++
Sbjct  826   VMPFHFIGGLIQAKSAKGFSRDSADVHHELVSLASESATNIRTIASFCHEEQIMKRARIS  885

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+  + + ++ESIK+GII G SLCLWNI++A+ALWYTT+LV + Q+SF + IRSYQIFSL
Sbjct  886   LEEPMRKGKRESIKYGIIYGVSLCLWNISNAIALWYTTILVSKRQASFEDGIRSYQIFSL  945

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+ AI IL P F TLDR T IEP+ P+   ++ IEG ++F+T+ F 
Sbjct  946   TVPSITELWTLIPAVIKAIDILTPAFHTLDRRTLIEPEIPKGETTDKIEGRIDFQTVNFK  1005

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV+VL  F+L+I+AG  VAL+GPSGAGKSSV+ALLLRFYD ++G +LIDGKD+++
Sbjct  1006  YPSRPEVIVLKNFSLQIKAGSDVALIGPSGAGKSSVLALLLRFYDPEKGNILIDGKDIKE  1065

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR NICYGS++ SEAE+++VSK ANIH F+S+LP+GY
Sbjct  1066  YNLRTLRRQIGLVQQEPVLFSSSIRYNICYGSDQVSEAEVLKVSKEANIHQFVSSLPDGY  1125

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT+VGEKG QLSGGQKQRIAIAR LLK+PAI+LLDE TSALD  SER +V ALES+  ++
Sbjct  1126  DTIVGEKGCQLSGGQKQRIAIARTLLKKPAILLLDEPTSALDIESERILVRALESINGNN  1185

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                    S+ TQITVAHRLSTV NSD+IVVMD+G VVE+GSH+TL + PDGVYS+L  +Q
Sbjct  1186  G------SRTTQITVAHRLSTVSNSDVIVVMDRGEVVEIGSHATLLTTPDGVYSKLFRIQ  1239

Query  1622  SM  1627
             S+
Sbjct  1240  SL  1241


 Score =   249 bits (636),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 174/513 (34%), Positives = 271/513 (53%), Gaps = 27/513 (5%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+    LR +   + L  E+  F+  +     + + I    S ++  I +++   +  ++
Sbjct  106   ERQTARLRLAFLQSVLCQEIGAFD-TDLTTPKIITGISGHLSIIQDAIGEKLGHFISSVT  164

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + +    +++I  W + L+   V P     G    K     S       S+  SL  +S 
Sbjct  165   TFICGVVIAIISCWEVSLLTLLVAPLVLAIGASYNKRMTVISSLKMDCQSQATSLVEQSI  224

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             + I+TV +F  E   +       + Q    ++E+    +  G+ Q  + C W++     +
Sbjct  225   SQIRTVYAFVGERGSMKAFEEQCEKQAVMCKQEALVKGVGIGMFQTATFCCWSLI----V  280

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL--IPTVLSAIGILKPVFQTLDRC  817
             W   ++V   ++S  + I +  + S+   +IT  +    +     A  + K VFQ + R 
Sbjct  281   WIGAVVVTAGKASGGDVIAA--VVSVLFGTITLTYAAPDMQVFNQAKVVGKEVFQVIQRI  338

Query  818   TRIEPDKPEESLS--ESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSG  991
                  D  EE  S  + IEG ++ + + F YPSRP+ +V   F+L I AG  VALVG SG
Sbjct  339   PATN-DSLEEKKSTLKHIEGHIDIREVHFAYPSRPQKLVFQDFSLSIPAGQTVALVGSSG  397

Query  992   AGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICY  1171
              GKS+VI+L+ RFYD  +G + ID ++ +D NL+ LR  IG+V QEP LF  +I++NI  
Sbjct  398   CGKSTVISLITRFYDPLQGDIFIDHQNTKDLNLKFLRTNIGIVSQEPALFAGTIKDNIKM  457

Query  1172  GSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPA  1351
             G+  A + +I   +  AN H+FIS LP  Y T VG+ G+QLSGGQKQR+AIARA+LK P 
Sbjct  458   GNIDADDKQIENAAFMANAHSFISELPNQYSTEVGQGGTQLSGGQKQRVAIARAILKNPK  517

Query  1352  IMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVV  1531
             I+LLDEATSALDS +ER V  ALE        GR      T I +AHR+ST+V +D+I +
Sbjct  518   ILLLDEATSALDSEAERLVQDALEK----AIIGR------TTILIAHRISTIVGADMIAI  567

Query  1532  MDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             ++ G V E G+H +L  +    Y  L +L S+K
Sbjct  568   IEDGRVSETGTHQSLL-ETSTFYRNLFNLHSIK  599



>gb|AFW57329.1| hypothetical protein ZEAMMB73_128411 [Zea mays]
Length=1240

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/545 (67%), Positives = 441/545 (81%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD +AK++V  YS+IF + G+++  +N LQHY+YG++GE+AM N+R +L+SA L+NEL W
Sbjct  698   YDPNAKKEVTKYSLIFFTAGMVTMVSNILQHYIYGIIGERAMKNIREALFSAVLRNELGW  757

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P N VG LTSRIV++TSTVK IISDRM+VIVQCI+SI+IAT VSM V+WRM LV+WA
Sbjct  758   FEKPNNGVGFLTSRIVSDTSTVKTIISDRMAVIVQCIASILIATIVSMKVNWRMALVSWA  817

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF GD+  AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  818   VMPCHFIGGLIQAKSAKGFYGDSAIAHRELVSLASEAASNIRTVASFVYEDEIIKKAELS  877

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  L  ++ ES+K+G+IQG SLCLWNIAHAVALWYTT+LVQR Q+ F N+IRSYQIFSL
Sbjct  878   LQEPLRITKIESMKYGVIQGISLCLWNIAHAVALWYTTVLVQRKQAKFENSIRSYQIFSL  937

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI IL PVF TLDR T+I PDKPE      + G  EF+ + F+
Sbjct  938   TVPSITELWTLIPMVMSAISILNPVFDTLDRETQIVPDKPENPGKGWLVGRTEFQDVSFN  997

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GFNL IE G +VALVGPSGAGKSSV+AL+LRFYD   G++LID K+++D
Sbjct  998   YPSRPEVTILDGFNLIIEPGQRVALVGPSGAGKSSVLALILRFYDPARGRLLIDNKNIKD  1057

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE  SE EII+ +  ANIH FIS LPEGY
Sbjct  1058  YNLRWLRKQIGLVQQEPILFNTSIRDNISYGSESPSETEIIQAAMEANIHEFISGLPEGY  1117

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              TVVG+KGSQLSGGQKQRIAIAR +LKRPAI+LLDEATSALD  SER V+S+L +     
Sbjct  1118  GTVVGDKGSQLSGGQKQRIAIARTILKRPAILLLDEATSALDGESERVVMSSLGTKVWKD  1177

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K      S +T ITVAHRLSTV+N+D IVVM+KG VVE+G+H  L S  DGVYSRL  LQ
Sbjct  1178  K--DEQASTITSITVAHRLSTVINADTIVVMEKGKVVELGNHQELISAEDGVYSRLFHLQ  1235

Query  1622  S-MKD  1633
             S MK+
Sbjct  1236  SNMKE  1240


 Score =   276 bits (706),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 181/491 (37%), Positives = 270/491 (55%), Gaps = 20/491 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R +   + L  E+  F+  +    ++ + + N  S ++  I +++   V   S
Sbjct  131   ERQLARMRLAFLRSILNQEVGAFDT-DLTTATIITGVTNYMSVIQDAIGEKLGHFVASFS  189

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W++ ++++ V+P   I G    K     S    A  SE VS+  ++ 
Sbjct  190   TFFAGVIIAFISCWQVAMLSFLVIPLILIIGAAYTKKLNVLSLSRNAIVSEAVSVVEQTL  249

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +      ++ Q + S+KE+    I  G+ Q  + C W    A+ +
Sbjct  250   SHIKTVFSFVGESWAMKSFVQCMESQFNLSKKEALIKGIGLGMFQAVTFCSW----ALMV  305

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V +++++    I +         SIT     + T   A    K VF+ + R   
Sbjct  306   WIGAVAVTKNKATGGGTIAAIMSILFGAISITYAAPDLQTFNQAKTAGKEVFKVIKRKPS  365

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I   K    L + I GE++F+ + F YPSR +  +L GF+L I AG  +ALVG SG GKS
Sbjct  366   ISYAKSGLVL-DKIHGEIKFRRVHFAYPSRQDKPILQGFSLSIPAGKVIALVGSSGCGKS  424

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G +LIDG  ++  +L+ LR  I  V QEP LF  +I++N+  G   
Sbjct  425   TVISLLQRFYDPTSGDILIDGHSIKKIDLKSLRRNIASVSQEPSLFSGNIKDNLKIGKMD  484

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             AS+ EI E ++ AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  485   ASDKEITEAARTANVHSFISKLPNEYLTEVGERGVQLSGGQKQRIAIARAMLKDPPILLL  544

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE   +    GR      T I +AHR+ST+VN+D IVV++ G
Sbjct  545   DEATSALDSESEKLVQDALERAMR----GR------TVILIAHRMSTIVNADTIVVVENG  594

Query  1544  CVVEMGSHSTL  1576
              V   G+H  L
Sbjct  595   RVAHTGTHHEL  605



>ref|XP_008662870.1| PREDICTED: ABC transporter B family member 14-like [Zea mays]
Length=1263

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/545 (67%), Positives = 441/545 (81%), Gaps = 3/545 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YD +AK++V  YS+IF + G+++  +N LQHY+YG++GE+AM N+R +L+SA L+NEL W
Sbjct  721   YDPNAKKEVTKYSLIFFTAGMVTMVSNILQHYIYGIIGERAMKNIREALFSAVLRNELGW  780

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P N VG LTSRIV++TSTVK IISDRM+VIVQCI+SI+IAT VSM V+WRM LV+WA
Sbjct  781   FEKPNNGVGFLTSRIVSDTSTVKTIISDRMAVIVQCIASILIATIVSMKVNWRMALVSWA  840

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             VMPCHFIGGLIQAKSAKGF GD+  AH E+VSLASE+A+NI+TV SF +E+ ++ KA ++
Sbjct  841   VMPCHFIGGLIQAKSAKGFYGDSAIAHRELVSLASEAASNIRTVASFVYEDEIIKKAELS  900

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  L  ++ ES+K+G+IQG SLCLWNIAHAVALWYTT+LVQR Q+ F N+IRSYQIFSL
Sbjct  901   LQEPLRITKIESMKYGVIQGISLCLWNIAHAVALWYTTVLVQRKQAKFENSIRSYQIFSL  960

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             TVPSITELWTLIP V+SAI IL PVF TLDR T+I PDKPE      + G  EF+ + F+
Sbjct  961   TVPSITELWTLIPMVMSAISILNPVFDTLDRETQIVPDKPENPGKGWLVGRTEFQDVSFN  1020

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV +L+GFNL IE G +VALVGPSGAGKSSV+AL+LRFYD   G++LID K+++D
Sbjct  1021  YPSRPEVTILDGFNLIIEPGQRVALVGPSGAGKSSVLALILRFYDPARGRLLIDNKNIKD  1080

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIR+NI YGSE  SE EII+ +  ANIH FIS LPEGY
Sbjct  1081  YNLRWLRKQIGLVQQEPILFNTSIRDNISYGSESPSETEIIQAAMEANIHEFISGLPEGY  1140

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              TVVG+KGSQLSGGQKQRIAIAR +LKRPAI+LLDEATSALD  SER V+S+L +     
Sbjct  1141  GTVVGDKGSQLSGGQKQRIAIARTILKRPAILLLDEATSALDGESERVVMSSLGTKVWKD  1200

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K      S +T ITVAHRLSTV+N+D IVVM+KG VVE+G+H  L S  DGVYSRL  LQ
Sbjct  1201  K--DEQASTITSITVAHRLSTVINADTIVVMEKGKVVELGNHQELISAEDGVYSRLFHLQ  1258

Query  1622  S-MKD  1633
             S MK+
Sbjct  1259  SNMKE  1263


 Score =   279 bits (714),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 185/508 (36%), Positives = 279/508 (55%), Gaps = 21/508 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+ +  +R +   + L  E+  F+  +    ++ + + N  S ++  I +++   V   S
Sbjct  131   ERQLARMRLAFLRSILNQEVGAFDT-DLTTATIITGVTNYMSVIQDAIGEKLGHFVASFS  189

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W++ ++++ V+P   I G    K     S    A  SE VS+  ++ 
Sbjct  190   TFFAGVIIAFISCWQVAMLSFLVIPLILIIGAAYTKKLNVLSLSRNAIVSEAVSVVEQTL  249

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +      ++ Q + S+KE+    I  G+ Q  + C W    A+ +
Sbjct  250   SHIKTVFSFVGESWAMKSFVQCMESQFNLSKKEALIKGIGLGMFQAVTFCSW----ALMV  305

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
             W   + V +++++    I +         SIT     + T   A    K VF+ + R   
Sbjct  306   WIGAVAVTKNKATGGGTIAAIMSILFGAISITYAAPDLQTFNQAKTAGKEVFKVIKRKPS  365

Query  824   IEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKS  1003
             I   K    L + I GE++F+ + F YPSR +  +L GF+L I AG  +ALVG SG GKS
Sbjct  366   ISYAKSGLVL-DKIHGEIKFRRVHFAYPSRQDKPILQGFSLSIPAGKVIALVGSSGCGKS  424

Query  1004  SVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSER  1183
             +VI+LL RFYD   G +LIDG  ++  +L+ LR  I  V QEP LF  +I++N+  G   
Sbjct  425   TVISLLQRFYDPTSGDILIDGHSIKKIDLKSLRRNIASVSQEPSLFSGNIKDNLKIGKMD  484

Query  1184  ASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLL  1363
             AS+ EI E ++ AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LL
Sbjct  485   ASDKEITEAARTANVHSFISKLPNEYLTEVGERGVQLSGGQKQRIAIARAMLKDPPILLL  544

Query  1364  DEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKG  1543
             DEATSALDS SE+ V  ALE   +    GR      T I +AHR+ST+VN+D IVV++ G
Sbjct  545   DEATSALDSESEKLVQDALERAMR----GR------TVILIAHRMSTIVNADTIVVVENG  594

Query  1544  CVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
              V   G+H  L  +    YS + S+Q++
Sbjct  595   RVAHTGTHHELLDKST-FYSNVCSMQNI  621



>ref|XP_004173886.1| PREDICTED: ABC transporter B family member 10-like, partial [Cucumis 
sativus]
Length=487

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/489 (67%), Positives = 408/489 (83%), Gaps = 6/489 (1%)
 Frame = +2

Query  161   LQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWR  340
             L+NE+AWF++PENNVG LTS+I+N TS +K +I+DRMSVIVQCISSI+IAT VS I++WR
Sbjct  2     LRNEVAWFDKPENNVGLLTSKIMNTTSVIKTVIADRMSVIVQCISSILIATIVSFIINWR  61

Query  341   MGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHV  520
             M LVAWAVMP HFIGGLIQAK AKGFS D+   H E+VSLASESA NI+T+ SFCHEE +
Sbjct  62    MALVAWAVMPFHFIGGLIQAKYAKGFSRDSADVHHELVSLASESATNIRTIASFCHEEQI  121

Query  521   VNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIR  700
             + +AR++L+  + + ++ESIK+GII G SLCLWNI++A+ALWYTT+LV + Q+SF + IR
Sbjct  122   MKRARISLEEPMRKGKRESIKYGIIYGVSLCLWNISNAIALWYTTILVSKRQASFEDGIR  181

Query  701   SYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVE  880
             SYQIFSLTVPSITELWTLIP V+ AI IL P F TLDR T IEP+ P+   ++ IEG ++
Sbjct  182   SYQIFSLTVPSITELWTLIPAVIKAIDILTPAFHTLDRRTLIEPEIPKGETTDKIEGRID  241

Query  881   FKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLI  1060
             F+T+ F YPSRPEV+VL  F+L+I+AG  VAL+GPSGAGKSSV+ALLLRFYD ++G +LI
Sbjct  242   FQTVNFKYPSRPEVIVLKNFSLQIKAGSDVALIGPSGAGKSSVLALLLRFYDPEKGNILI  301

Query  1061  DGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFI  1240
             DGKD+++YNLR LR QIGLVQQEP+LF  SIR NICYGS++ SEAE+++VSK ANIH F+
Sbjct  302   DGKDIKEYNLRTLRRQIGLVQQEPVLFSSSIRYNICYGSDQVSEAEVLKVSKEANIHQFV  361

Query  1241  SNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSAL  1420
             S+LP+GYDT+VGEKG QLSGGQKQRIAIAR LLK+PAI+LLDE TSALD  SER +V AL
Sbjct  362   SSLPDGYDTIVGEKGCQLSGGQKQRIAIARTLLKKPAILLLDEPTSALDIESERILVRAL  421

Query  1421  ESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVY  1600
             ES+  ++       S+ TQITVAHRLSTV NSD+IVVMD+G VVE+GSH+TL + PDGVY
Sbjct  422   ESINGNNG------SRTTQITVAHRLSTVSNSDVIVVMDRGEVVEIGSHATLLTTPDGVY  475

Query  1601  SRLVSLQSM  1627
             S+L  +QS+
Sbjct  476   SKLFRIQSL  484



>gb|EMT33290.1| ABC transporter B family member 2 [Aegilops tauschii]
Length=1264

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/540 (61%), Positives = 432/540 (80%), Gaps = 2/540 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +D+DA +KV  YS+I   IG+L++F+N  QHY+YG+VGE+AM NLR +L+S  L++E+ W
Sbjct  721   FDADANKKVSKYSIILFLIGMLTFFSNIFQHYIYGLVGERAMNNLREALFSVVLRSEIGW  780

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE P+N+VG LTSR+V++TS VK IISDRM+V+VQCISSI+IAT +S+ V+WRMGLVAWA
Sbjct  781   FEEPKNSVGFLTSRVVSDTSMVKTIISDRMAVMVQCISSIIIATALSIAVNWRMGLVAWA  840

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             +MPCHFI GL+Q +SAKGF+ D + +H +++SL SE+ +NI+TV SF  EE ++ KA +A
Sbjct  841   MMPCHFIAGLVQVRSAKGFATDNSKSHRKLISLTSEAVSNIRTVASFVQEEEILRKADLA  900

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  SR ESIK+G++QG SLCLW++ HA+AL YT +L+ R  ++F N +RSYQ F++
Sbjct  901   LQEPMRISRIESIKYGVVQGISLCLWHMTHAIALSYTIVLLDRKLATFENCVRSYQAFAM  960

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T+PSITELW+LIP V+SAI IL P    LDR T+I PD+P+ +  + I G VEF+ + F 
Sbjct  961   TIPSITELWSLIPMVMSAIAILDPALDILDRETQIVPDEPKLNCEDRIVGNVEFEDVSFS  1020

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRPEV++L+GF+L IE+G +VALVGPSG+GKS+V+ALLLRFY+   G+VLIDGKD+R 
Sbjct  1021  YPSRPEVIILDGFSLAIESGQRVALVGPSGSGKSTVLALLLRFYNPCSGRVLIDGKDIRG  1080

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNL+ LR QIGLVQQEP+LF  SIR+NI YG+E ASE EI+E +  ANIH FIS+L +GY
Sbjct  1081  YNLKSLRKQIGLVQQEPILFNLSIRQNISYGNEGASETEIVEAAMEANIHDFISSLSKGY  1140

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVG+KG QLSGGQKQRIA+AR +LK+P I+LLDEATSALD  SER V++ L +    +
Sbjct  1141  DTVVGDKGGQLSGGQKQRIAVARTILKKPVILLLDEATSALDGESERVVMNTLGAKGWKN  1200

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K G  S SK+T IT+AHRLSTV N+D+IVVMDKG VVE GSH+TL S  +GVYSRL ++Q
Sbjct  1201  K-GELS-SKITSITIAHRLSTVTNADVIVVMDKGEVVETGSHATLVSASNGVYSRLYNMQ  1258


 Score =   280 bits (716),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 182/516 (35%), Positives = 288/516 (56%), Gaps = 35/516 (7%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ MT ++ +  ++ L  ++  F+  +    ++ +   N  ST+K  I ++M   +   S
Sbjct  131   QRQMTRMQMAYLTSLLSQDIGAFDT-DLTTATIMAGATNHMSTIKEAIGEKMGHFMSNFS  189

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + ++A  ++ +  W +G++A+ V+P   + G   AK   G S    A  SEV S+  ++ 
Sbjct  190   TFLVAVIIAFVCCWEVGMMAFLVVPMLLVVGATYAKMMVGMSATRIALVSEVTSVVEQTI  249

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +      +  Q    +KE+I      G++Q  + C    ++++ +
Sbjct  250   SHIKTVFSFVGENSAMKSFIECMDKQYKLGKKEAITKGLGLGMLQIATFC----SYSLTI  305

Query  644   WYTTLLVQRHQS-------SFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQ  802
             +   L V R  +       + +N + +    S   P +        T   A    K VF+
Sbjct  306   YIGALAVTRRSAKGGETIAAVINILSAAIYLSNAAPDLQ-------TFSQAKAAGKEVFK  358

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              + R   I  +     L E + G +E + + F YPSR + ++L GF L I AG  VALVG
Sbjct  359   VIKRKPAINYESNGRIL-EKVTGHIEIREVDFTYPSRKDKLILQGFTLVIPAGKVVALVG  417

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD   G + +DG+++++ +L+ LR  IG V QEP LF  +I +N
Sbjct  418   SSGCGKSTVISLVQRFYDPISGGITVDGQNIKELDLKSLRRNIGSVSQEPALFSGTIMDN  477

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             +  G   A++ EIIE +K AN+H+FIS LP+ Y T VGE+G QLSGGQKQRIAIARA+LK
Sbjct  478   LRIGKLDATDEEIIEAAKTANVHSFISKLPDQYSTEVGERGVQLSGGQKQRIAIARAILK  537

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALDS SE+ V  AL+   +    GR      T I +AHR+ST++N+D 
Sbjct  538   DPPILLLDEATSALDSESEKLVQDALDRAMK----GR------TVILIAHRMSTIINADK  587

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             IV+++ G V + G+H  L  +    YS + S+QS++
Sbjct  588   IVIVENGRVAQHGTHEELLERST-FYSSVCSMQSLE  622



>gb|EEC82914.1| hypothetical protein OsI_27835 [Oryza sativa Indica Group]
Length=1233

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/546 (61%), Positives = 430/546 (79%), Gaps = 3/546 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +D DAKR V  YS+I   IGLL++F+N  QHY+YG+VGE+AM NLR +L+S  LQNE+ W
Sbjct  689   FDPDAKRIVAKYSIILFLIGLLTFFSNIFQHYIYGLVGERAMNNLREALFSVILQNEIGW  748

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N+VG LTSR+V +TS +K IISDRMSVIVQCISSI+IAT +S+ V+WRMGLVAWA
Sbjct  749   FEQPKNSVGFLTSRVVGDTSMIKTIISDRMSVIVQCISSILIATGLSIGVNWRMGLVAWA  808

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             +MPC FI GL+Q +SAKGF+ DT+ +H +++SL SE+ +NI+TV SF  EE ++ KA ++
Sbjct  809   LMPCQFIAGLVQVRSAKGFATDTSTSHRKLISLTSEAVSNIRTVASFGQEEEILKKADLS  868

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  SR ESIK+G++QG SLCLW++ HA+AL YT +L+ +  ++F N +R+YQ  +L
Sbjct  869   LQEPMQTSRIESIKYGVVQGVSLCLWHMTHAIALSYTIVLLDKSLATFENCVRAYQAIAL  928

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T+ SITELW+LIP V+SAI IL P    LDR T+I PD+P+    + I G +EF+ + F 
Sbjct  929   TITSITELWSLIPMVISAIAILDPALDILDRETQIVPDEPKVHCEDRITGNIEFQDVSFS  988

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSR +V++L+GF+L IE G +VALVGPSGAGKS++++LLLRFYD   G+VL+DGKDVR+
Sbjct  989   YPSRQDVIILDGFSLAIEPGQRVALVGPSGAGKSTIVSLLLRFYDPCRGQVLVDGKDVRE  1048

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIRENI YG+E ASE EI+E +  ANIH FIS L  GY
Sbjct  1049  YNLRFLRKQIGLVQQEPILFNLSIRENISYGNEGASETEIVEAAMEANIHEFISGLSNGY  1108

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVG+KGSQLSGGQKQRIAIAR +LKRP I+LLDEATSALD  +E+ V+S+L + +   
Sbjct  1109  DTVVGDKGSQLSGGQKQRIAIARTILKRPVILLLDEATSALDGETEKVVMSSLAAKEWKS  1168

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K G  S +K+T IT+AHRLSTV ++D+IVVMDKG VVEMGSH TL +  +GVYSRL  +Q
Sbjct  1169  KEGELS-NKITSITIAHRLSTVTSADVIVVMDKGEVVEMGSHETLVTTSNGVYSRLYCMQ  1227

Query  1622  S--MKD  1633
             S  MKD
Sbjct  1228  SKGMKD  1233


 Score =   241 bits (614),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 169/511 (33%), Positives = 271/511 (53%), Gaps = 58/511 (11%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ M+ +R +   + L  ++  F+  +    ++ +   N  S ++  I +++   +   S
Sbjct  130   QRQMSRMRMAYLRSVLSQDIGAFDT-DLTTANVMAGATNHMSAIQDAIGEKLGHFLSNFS  188

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + +++  V+ +  W +G+++  V+P   + G   AK     S    A  S   ++  ++ 
Sbjct  189   TFLVSIIVAFVCCWEVGMLSMLVVPMLLMVGATYAKMMIDASMKRIALVSAATTVVEQTL  248

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
             ++IK V SF  E   +      +  Q   S+ E++  G++       W  A AV      
Sbjct  249   SHIKIVFSFVGENSAIKSFTKCMDKQYKLSKIEAMTKGLV-------WVGAAAV------  295

Query  656   LLVQRHQ------SSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRC  817
               V R        ++ +N + +    S   P +        +   A G  K VF+ ++R 
Sbjct  296   --VDRSAKGGETIAAVINILSAAIYISNAAPDLQSF-----SQAKAAG--KEVFEVINRN  346

Query  818   TRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAG  997
               I  +    ++ E + G +E + + F YPSR +  +L  F+L I AG  VALVG SG G
Sbjct  347   PAISYES-NGTILEKVTGNIEIREVDFMYPSRVDKPILRSFSLSIPAGKVVALVGSSGCG  405

Query  998   KSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGS  1177
             KS+VI+L+ RFYD   G +LIDG+++++ +L+ LR  IG V QEP LF            
Sbjct  406   KSTVISLVQRFYDPISGNILIDGQNIKELDLKSLRRSIGSVSQEPSLF------------  453

Query  1178  ERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIM  1357
                  +EIIE++K+AN+H+F+S LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+
Sbjct  454   -----SEIIEIAKSANVHSFVSKLPNQYSTEVGERGVQLSGGQKQRIAIARAMLKDPPIL  508

Query  1358  LLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMD  1537
             LLDEATSALDS SE+ V  AL+   +    GR      T I +AHR+ST++NSD IVV++
Sbjct  509   LLDEATSALDSESEKLVQEALDGAMK----GR------TVILIAHRMSTIINSDKIVVVE  558

Query  1538  KGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              G V + G+H  L  +    YS + S+Q+++
Sbjct  559   NGKVAQSGTHEELLEKSP-FYSSVCSMQNLE  588



>gb|EEE68060.1| hypothetical protein OsJ_26066 [Oryza sativa Japonica Group]
Length=1250

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/546 (61%), Positives = 430/546 (79%), Gaps = 3/546 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +D DAKR V  YS+I   IGLL++F+N  QHY+YG+VGE+AM NLR +L+S  LQNE+ W
Sbjct  706   FDPDAKRIVAKYSIILFLIGLLTFFSNIFQHYIYGLVGERAMNNLREALFSVILQNEIGW  765

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N+VG LTSR+V +TS +K IISDRMSVIVQCISSI+IAT +S+ V+WRMGLVAWA
Sbjct  766   FEQPKNSVGFLTSRVVGDTSMIKTIISDRMSVIVQCISSILIATGLSIGVNWRMGLVAWA  825

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             +MPC FI GL+Q +SAKGF+ DT+ +H +++SL SE+ +NI+TV SF  EE ++ KA ++
Sbjct  826   LMPCQFIAGLVQVRSAKGFATDTSTSHRKLISLTSEAVSNIRTVASFGQEEEILKKADLS  885

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  SR ESIK+G++QG SLCLW++ HA+AL YT +L+ +  ++F N +R+YQ  +L
Sbjct  886   LQEPMQTSRIESIKYGVVQGVSLCLWHMTHAIALSYTIVLLDKSLATFENCVRAYQAIAL  945

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T+ SITELW+LIP V+SAI IL P    LDR T+I PD+P+    + I G +EF+ + F 
Sbjct  946   TITSITELWSLIPMVISAIAILDPALDILDRETQIVPDEPKVHCEDRITGNIEFQDVSFS  1005

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSR +V++L+GF+L IE G +VALVGPSGAGKS++++LLLRFYD   G+VL+DGKDVR+
Sbjct  1006  YPSRQDVIILDGFSLAIEPGQRVALVGPSGAGKSTIVSLLLRFYDPCRGQVLVDGKDVRE  1065

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIRENI YG+E ASE EI+E +  ANIH FIS L  GY
Sbjct  1066  YNLRFLRKQIGLVQQEPILFNLSIRENISYGNEGASETEIVEAAMEANIHEFISGLSNGY  1125

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVG+KGSQLSGGQKQRIAIAR +LKRP I+LLDEATSALD  +E+ V+S+L + +   
Sbjct  1126  DTVVGDKGSQLSGGQKQRIAIARTILKRPVILLLDEATSALDGETEKVVMSSLAAKEWKS  1185

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K G  S +K+T IT+AHRLSTV ++D+IVVMDKG VVEMGSH TL +  +GVYSRL  +Q
Sbjct  1186  KEGELS-NKITSITIAHRLSTVTSADVIVVMDKGEVVEMGSHETLVTTSNGVYSRLYCMQ  1244

Query  1622  S--MKD  1633
             S  MKD
Sbjct  1245  SKGMKD  1250


 Score =   258 bits (658),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 173/511 (34%), Positives = 279/511 (55%), Gaps = 41/511 (8%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ M+ +R +   + L  ++  F+  +    ++ +   N  S ++  I +++   +   S
Sbjct  130   QRQMSRMRMAYLRSVLSQDIGAFDT-DLTTANVMAGATNHMSAIQDAIGEKLGHFLSNFS  188

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + +++  V+ +  W +G+++  V+P   + G   AK     S    A  S   ++  ++ 
Sbjct  189   TFLVSIIVAFVCCWEVGMLSMLVVPMLLMVGATYAKMMIDASMKRIALVSAATTVVEQTL  248

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
             ++IKTV SF  E   +      +  Q   S+ E++  G++       W  A AV      
Sbjct  249   SHIKTVFSFVGENSAIKSFTKCMDKQYKLSKIEAMTKGLV-------WVGAAAV------  295

Query  656   LLVQRHQ------SSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRC  817
               V R        ++ +N + +    S   P +        +   A G  K VF+ ++R 
Sbjct  296   --VDRSAKGGETIAAVINILSAAIYISNAAPDLQSF-----SQAKAAG--KEVFEVINRN  346

Query  818   TRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAG  997
               I  +    ++ E + G +E + + F YPSR +  +L  F+L I AG  VALVG SG G
Sbjct  347   PAISYES-NGTILEKVTGNIEIREVDFMYPSRVDKPILRSFSLSIPAGKVVALVGSSGCG  405

Query  998   KSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGS  1177
             KS+VI+L+ RFYD   G +LIDG+++++ +L+ LR  IG V QEP LF  +I +N+  G 
Sbjct  406   KSTVISLVQRFYDPISGNILIDGQNIKELDLKSLRRSIGSVSQEPSLFSGTIMDNLRIGK  465

Query  1178  ERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIM  1357
                ++ EIIE++K+AN+H+F+S LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+
Sbjct  466   MDGTDEEIIEIAKSANVHSFVSKLPNQYSTEVGERGVQLSGGQKQRIAIARAMLKDPPIL  525

Query  1358  LLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMD  1537
             LLDEATSALDS SE+ V  AL+   +    GR      T I +AHR+ST++NSD IVV++
Sbjct  526   LLDEATSALDSESEKLVQEALDGAMK----GR------TVILIAHRMSTIINSDKIVVVE  575

Query  1538  KGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
              G V + G+H  L  +    YS + S+Q+++
Sbjct  576   NGKVAQSGTHEELLEKSP-FYSSVCSMQNLE  605



>emb|CAD59578.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAC99418.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAC99766.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1266

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/546 (61%), Positives = 430/546 (79%), Gaps = 3/546 (1%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +D DAKR V  YS+I   IGLL++F+N  QHY+YG+VGE+AM NLR +L+S  LQNE+ W
Sbjct  722   FDPDAKRIVAKYSIILFLIGLLTFFSNIFQHYIYGLVGERAMNNLREALFSVILQNEIGW  781

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N+VG LTSR+V +TS +K IISDRMSVIVQCISSI+IAT +S+ V+WRMGLVAWA
Sbjct  782   FEQPKNSVGFLTSRVVGDTSMIKTIISDRMSVIVQCISSILIATGLSIGVNWRMGLVAWA  841

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             +MPC FI GL+Q +SAKGF+ DT+ +H +++SL SE+ +NI+TV SF  EE ++ KA ++
Sbjct  842   LMPCQFIAGLVQVRSAKGFATDTSTSHRKLISLTSEAVSNIRTVASFGQEEEILKKADLS  901

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  SR ESIK+G++QG SLCLW++ HA+AL YT +L+ +  ++F N +R+YQ  +L
Sbjct  902   LQEPMQTSRIESIKYGVVQGVSLCLWHMTHAIALSYTIVLLDKSLATFENCVRAYQAIAL  961

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T+ SITELW+LIP V+SAI IL P    LDR T+I PD+P+    + I G +EF+ + F 
Sbjct  962   TITSITELWSLIPMVISAIAILDPALDILDRETQIVPDEPKVHCEDRITGNIEFQDVSFS  1021

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSR +V++L+GF+L IE G +VALVGPSGAGKS++++LLLRFYD   G+VL+DGKDVR+
Sbjct  1022  YPSRQDVIILDGFSLAIEPGQRVALVGPSGAGKSTIVSLLLRFYDPCRGQVLVDGKDVRE  1081

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIRENI YG+E ASE EI+E +  ANIH FIS L  GY
Sbjct  1082  YNLRFLRKQIGLVQQEPILFNLSIRENISYGNEGASETEIVEAAMEANIHEFISGLSNGY  1141

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVG+KGSQLSGGQKQRIAIAR +LKRP I+LLDEATSALD  +E+ V+S+L + +   
Sbjct  1142  DTVVGDKGSQLSGGQKQRIAIARTILKRPVILLLDEATSALDGETEKVVMSSLAAKEWKS  1201

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K G  S +K+T IT+AHRLSTV ++D+IVVMDKG VVEMGSH TL +  +GVYSRL  +Q
Sbjct  1202  KEGELS-NKITSITIAHRLSTVTSADVIVVMDKGEVVEMGSHETLVTTSNGVYSRLYCMQ  1260

Query  1622  S--MKD  1633
             S  MKD
Sbjct  1261  SKGMKD  1266


 Score =   261 bits (668),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 172/516 (33%), Positives = 285/516 (55%), Gaps = 35/516 (7%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ M+ +R +   + L  ++  F+  +    ++ +   N  S ++  I +++   +   S
Sbjct  130   QRQMSRMRMAYLRSVLSQDIGAFDT-DLTTANVMAGATNHMSAIQDAIGEKLGHFLSNFS  188

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + +++  V+ +  W +G+++  V+P   + G   AK     S    A  S   ++  ++ 
Sbjct  189   TFLVSIIVAFVCCWEVGMLSMLVVPMLLMVGATYAKMMIDASMKRIALVSAATTVVEQTL  248

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +      +  Q   S+ E++      G++Q  + C    ++++ +
Sbjct  249   SHIKTVFSFVGENSAIKSFTKCMDKQYKLSKIEAMTKGLGLGMLQIATFC----SYSLTV  304

Query  644   WY-TTLLVQRHQ------SSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQ  802
             W     +V R        ++ +N + +    S   P +        +   A G  K VF+
Sbjct  305   WVGAAAVVDRSAKGGETIAAVINILSAAIYISNAAPDLQSF-----SQAKAAG--KEVFE  357

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              ++R   I  +    ++ E + G +E + + F YPSR +  +L  F+L I AG  VALVG
Sbjct  358   VINRNPAISYES-NGTILEKVTGNIEIREVDFMYPSRVDKPILRSFSLSIPAGKVVALVG  416

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD   G +LIDG+++++ +L+ LR  IG V QEP LF  +I +N
Sbjct  417   SSGCGKSTVISLVQRFYDPISGNILIDGQNIKELDLKSLRRSIGSVSQEPSLFSGTIMDN  476

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             +  G    ++ EIIE++K+AN+H+F+S LP  Y T VGE+G QLSGGQKQRIAIARA+LK
Sbjct  477   LRIGKMDGTDEEIIEIAKSANVHSFVSKLPNQYSTEVGERGVQLSGGQKQRIAIARAMLK  536

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALDS SE+ V  AL+   +    GR      T I +AHR+ST++NSD 
Sbjct  537   DPPILLLDEATSALDSESEKLVQEALDGAMK----GR------TVILIAHRMSTIINSDK  586

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             IVV++ G V + G+H  L  +    YS + S+Q+++
Sbjct  587   IVVVENGKVAQSGTHEELLEKSP-FYSSVCSMQNLE  621



>ref|XP_006659120.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1264

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/541 (61%), Positives = 424/541 (78%), Gaps = 1/541 (0%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +D DAKR VG YS+I   IGLL++F+N  QHY+YG++GE+AM NLR +L+S  LQNE+ W
Sbjct  720   FDPDAKRIVGKYSIILFLIGLLTFFSNIFQHYIYGLIGERAMNNLREALFSVILQNEIGW  779

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             FE+P+N+VG LTSR+V +TS +K IISDR+SVIVQC+SSI+IAT +SM V+WRMGLVAWA
Sbjct  780   FEQPKNSVGFLTSRVVGDTSMIKTIISDRISVIVQCVSSILIATGLSMAVNWRMGLVAWA  839

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             +MP  FI GL+Q +SAKGF+ D++ +H +++ L SE+ +NI+TV SF  EE ++ KA  +
Sbjct  840   LMPFQFITGLVQVRSAKGFATDSSTSHRKLILLTSEAVSNIRTVASFVQEEEILKKADSS  899

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             LQ  +  S+ ESIK+G++QG SLCLW++ HA+AL YT + + +  ++F N +RSYQ  +L
Sbjct  900   LQEPMQTSKIESIKYGVVQGVSLCLWHMTHAIALSYTIVQLDKSLATFENCVRSYQAIAL  959

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T+ S+TELW+LIP VLSAI IL PV   LDR T+I PD+P+    + I G +EF+ + F 
Sbjct  960   TITSVTELWSLIPMVLSAITILDPVLDILDRETQIVPDEPKVHCEDRITGNIEFQYVSFR  1019

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSR EV++L+GF+L IE G +VALVGPSGAGKS+V++LLLRFYD   G+VL+DGKD+RD
Sbjct  1020  YPSRQEVIILDGFSLAIEPGQRVALVGPSGAGKSTVVSLLLRFYDPCRGQVLVDGKDIRD  1079

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNLR LR QIGLVQQEP+LF  SIRENI YG+E ASE EI+E +  ANIH FIS L  GY
Sbjct  1080  YNLRFLRKQIGLVQQEPILFNFSIRENISYGNEGASETEIVEAAMEANIHEFISGLSSGY  1139

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DTVVG+KGSQLSGGQKQRIAIAR +LKRP I+LLDEATSALD  SER V+S+L + +   
Sbjct  1140  DTVVGDKGSQLSGGQKQRIAIARTILKRPVILLLDEATSALDGESERLVMSSLAAKEWKS  1199

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             K G  S +K+T IT+AHRLSTV ++D+IVVMDKG VVEM +H TL +  +GVYSRL  +Q
Sbjct  1200  KEGEPS-NKITSITIAHRLSTVTSADVIVVMDKGQVVEMSNHETLVAASNGVYSRLYRMQ  1258

Query  1622  S  1624
             S
Sbjct  1259  S  1259


 Score =   266 bits (681),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 175/512 (34%), Positives = 280/512 (55%), Gaps = 23/512 (4%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ M+ +R +   + L  ++  F+  +     + +  +N  S ++  I +++   +   S
Sbjct  128   QRQMSRMRMAYLRSVLSQDIGAFD-TDLTTAKIMAGAINHMSAIQDAIGEKLGHFLSNFS  186

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +  ++  V+ +  W +G+++  V+P   + G   AK     S    A  SE  ++  ++ 
Sbjct  187   TFFVSIIVAFVCCWEVGMLSMLVVPMLLMVGATYAKMMIDMSMKRMALISEATTVVEQAF  246

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +      +  Q   S+KE++      G++Q  + C    ++++ +
Sbjct  247   SHIKTVFSFAGENSAIKSFIKCMDKQYELSKKEAMTKGLGLGMLQIATFC----SYSLTV  302

Query  644   WY-TTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCT  820
             W     ++ R             I S  +  I+     + +   A    K VF+ ++R  
Sbjct  303   WVGAAAVIDRSAKGGQTVAAVINILSAAI-YISNAAPDLQSFSQAKAAGKEVFEIINRNP  361

Query  821   RIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGK  1000
              I  +    ++ E + G +E + + F YPSR +  +L GF+L I AG  +ALVG SG GK
Sbjct  362   AINYES-NGTILEKVIGNIEIREVYFMYPSRVDKPILRGFSLTIPAGKVIALVGSSGCGK  420

Query  1001  SSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSE  1180
             S+VI+L+ RFYD   G +LIDG++V+D +L+ LR  IG V QEP LF  +I +N+  G  
Sbjct  421   STVISLVQRFYDPISGDILIDGQNVKDLDLKSLRRSIGSVSQEPSLFSGTIMDNLRIGKM  480

Query  1181  RASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIML  1360
               ++ EIIE +KAAN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+L+ P I+L
Sbjct  481   DGTDEEIIETAKAANVHSFISKLPNQYLTEVGERGVQLSGGQKQRIAIARAMLRDPPILL  540

Query  1361  LDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDK  1540
             LDEATSALDS SE+ V  AL+   Q    GR      T I +AHR+ST+ N+D+IVVM+ 
Sbjct  541   LDEATSALDSESEKLVQEALDRAMQ----GR------TVILIAHRMSTIKNADMIVVMEN  590

Query  1541  GCVVEMGSHSTLTSQPDGVYSRLVSLQSMKDH  1636
             G V + G+H  L  +    YS +  +Q ++  
Sbjct  591   GKVAQSGTHEELLEKSP-FYSSVCGMQYLEQE  621



>ref|XP_003571483.1| PREDICTED: ABC transporter B family member 14-like [Brachypodium 
distachyon]
Length=1266

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/539 (60%), Positives = 432/539 (80%), Gaps = 2/539 (0%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             D DAKRKV  YS+    +G+ ++F+N  QHY+YG+VGE+AM NLR +L++A L+NE+ WF
Sbjct  724   DPDAKRKVTKYSITLFLVGISTFFSNIFQHYIYGLVGERAMNNLREALFTAVLRNEMGWF  783

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             E+P+N+VG LTSR+V++TS +K IIS+RM++IVQCISSI+IAT +S  V+WRMGLV+WA+
Sbjct  784   EKPKNSVGFLTSRVVSDTSMIKTIISERMAIIVQCISSILIATGLSTGVNWRMGLVSWAM  843

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL  544
             MPCHFI GL+Q +SAKGF+ DT+ +H +++SL SE+ +NI+TV SF  EE ++ KA +AL
Sbjct  844   MPCHFIAGLVQVRSAKGFATDTSKSHRKLISLTSEAVSNIRTVASFVQEEEILRKADLAL  903

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             Q  +  SR ES+K+G++QG SLCLW++ HA+AL +T +L+ +  +SF +++RSYQ F++T
Sbjct  904   QEPMRISRIESVKYGVVQGISLCLWHMTHAIALSFTIVLLDKRLASFEDSVRSYQAFAMT  963

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
             + SITELW+LIP V+SAI IL P    LDR T+I PD+P+ +  + I G VEFK + F Y
Sbjct  964   ISSITELWSLIPMVMSAITILDPALDILDRETQIVPDEPKVTCEDRIVGNVEFKDVIFSY  1023

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRPEV++L+GF+L IE+G +VALVGPSG+GKS+V+ALLLRFYD   G+VL+DGKD+R Y
Sbjct  1024  PSRPEVIILDGFSLAIESGQRVALVGPSGSGKSTVLALLLRFYDPCNGQVLVDGKDIRTY  1083

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR QIGLVQQEP+LF  SIRENI YG+E ASE EI+E +  ANIH FIS+L +GYD
Sbjct  1084  NLKCLRKQIGLVQQEPILFNMSIRENISYGNEGASETEIVEAAMEANIHEFISSLSKGYD  1143

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T+VG+KGSQLSGGQKQRIA+AR +LK+P I+LLDEATSALD  SER V++ L +    +K
Sbjct  1144  TIVGDKGSQLSGGQKQRIAVARTILKKPVILLLDEATSALDGESERVVMNTLGAKGWKNK  1203

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              G  S SK+T IT+AHRLSTV N+D+IVVMDKG VVE GSH+TL S+ +G+YSR+  +Q
Sbjct  1204  -GELS-SKITSITIAHRLSTVTNTDVIVVMDKGEVVETGSHATLVSESNGIYSRMYHMQ  1260


 Score =   275 bits (702),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 182/512 (36%), Positives = 286/512 (56%), Gaps = 26/512 (5%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ MT ++ +   + L   +  F+  +    ++ +   N  S +K  I ++M   +   S
Sbjct  132   QRQMTRMQMAYLRSVLSQNVGAFDT-DLTTANIMAGATNHMSVIKDAIGEKMGHFISNFS  190

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + ++A  V+ +  W +G++++ V+P   + G   AK   G S    A  SE  S+  ++ 
Sbjct  191   TFLVAIIVAFVCSWEVGMMSFLVVPMLLVIGATYAKMMNGMSMRRIALVSEATSVVEQNL  250

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVAL  643
             ++IKTV SF  E   +      +  Q   S+KE+I      G++Q  + C +++   +  
Sbjct  251   SHIKTVFSFVGENSAMRSFTKCMDKQYKLSKKEAITKGLGLGMLQIATFCSYSLTIYIGA  310

Query  644   WYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTR  823
                T    +     + A+    I S  +  I+     +     A    K VF+ + R   
Sbjct  311   VAVTGRRPKKAGETIAAV--INILSAAI-YISNAAPDLQAFSQAKAAGKEVFKVIKR---  364

Query  824   IEPDKPEES---LSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
              +P    ES   +SE + GE+E + + F YPSR +  +L GF+L I+AG  VALVG SG 
Sbjct  365   -KPVISYESGGIISEQVIGEIEIREVDFTYPSREDKPILQGFSLAIQAGEIVALVGSSGC  423

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS+VI+L+ RFYD   G ++IDG+++++ +L+ LR  IG V QEP LF  +I +N+  G
Sbjct  424   GKSTVISLVQRFYDPTSGDIIIDGQNIKELDLKFLRRNIGSVSQEPALFSGTIMDNLRIG  483

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
                A++ EIIE +K AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I
Sbjct  484   KMDATDEEIIEAAKTANVHSFISKLPNQYSTEVGERGLQLSGGQKQRIAIARAILKDPPI  543

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDEATSALDS SE+ V  AL+   +    GR      T I +AHR+ST++N+D IVV+
Sbjct  544   LLLDEATSALDSESEKLVQDALDRAMR----GR------TVILIAHRMSTIINADKIVVV  593

Query  1535  DKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             + G V + G+H  L  +    YS + ++Q+++
Sbjct  594   ENGGVAQSGTHEELLKKST-FYSSVCNMQNLE  624



>ref|XP_008680218.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
14-like [Zea mays]
Length=1264

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/538 (61%), Positives = 423/538 (79%), Gaps = 2/538 (0%)
 Frame = +2

Query  11    DAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER  190
             DAK  V  YSVI   IGLL++F+N  QHY+YG+VGE+A  NLR +L+S  L+NE+ WFE+
Sbjct  724   DAKSIVSTYSVILFLIGLLTFFSNMFQHYIYGLVGERATNNLREALFSVILRNEIGWFEQ  783

Query  191   PENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP  370
             P+N+VG LTSRIV +TS +K IISDRMS+IVQCISSI+IAT +S +V+WRMGLVAW +MP
Sbjct  784   PKNSVGFLTSRIVGDTSMIKTIISDRMSLIVQCISSILIATVLSTVVNWRMGLVAWTLMP  843

Query  371   CHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQP  550
              HF  GL+Q +SAKGF+ D +A+H E++SL SE+ +NI+TV SF  E+ ++ KA ++LQ 
Sbjct  844   FHFFAGLVQVRSAKGFATDFSASHRELISLTSEAVSNIRTVASFVQEDEILKKADLSLQE  903

Query  551   QLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP  730
              +  S+ ESIK+G++QGTSLCLW++ HA+AL +T +L+ ++ SSF + +RSYQ F++T+ 
Sbjct  904   PMRTSKVESIKYGLVQGTSLCLWHMTHAIALSFTIMLLDKNLSSFKDCVRSYQAFAMTIS  963

Query  731   SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             SITELW+LIP VLSAI +L P    LDR T+I PD PE    E + G++ F+ + F YPS
Sbjct  964   SITELWSLIPLVLSAITVLDPALDILDRETQIVPDVPEVHSEERLAGDIVFQDVSFSYPS  1023

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RPEV++L+GFNL IE G +VALVGPSG+GK++V+ALLLRFYD  EG+VL++ KD+RDYNL
Sbjct  1024  RPEVIILDGFNLDIEPGQQVALVGPSGSGKTTVLALLLRFYDPCEGRVLVNDKDIRDYNL  1083

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR  IGLVQQEP+LF  SIRENI YG+E ASE+EI+  +  ANIH FIS L  GYDTV
Sbjct  1084  RYLRKHIGLVQQEPMLFNLSIRENISYGNEGASESEIVAAAMEANIHEFISGLSNGYDTV  1143

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VG+KGSQLSGGQKQRIAIARA+LKRP IMLLDEATSALD  SE  V+S+L + +  +  G
Sbjct  1144  VGDKGSQLSGGQKQRIAIARAILKRPTIMLLDEATSALDGQSEMVVMSSLVAKEWRNN-G  1202

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
               S SK+T IT+AHRLST+ ++++IVVMDKG VVE+GSH  L S  DGVYSRL S+QS
Sbjct  1203  ELS-SKITSITIAHRLSTITSAEVIVVMDKGQVVELGSHEALISAKDGVYSRLYSMQS  1259


 Score =   275 bits (703),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 183/516 (35%), Positives = 287/516 (56%), Gaps = 35/516 (7%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ MT +R +   + L  ++  F+  +    S+ +   N  S ++  I ++M   +   S
Sbjct  127   QRQMTRMRIAYLRSVLSQDIGAFD-TDLTTASIMAGATNHMSVIQDAIGEKMGHFMSNFS  185

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + ++A  V+    W +GL++  V+P   + G   +K+    S   T+  SE  ++  ++ 
Sbjct  186   TFLVAIIVAFACCWEVGLLSLLVVPMLLMVGASYSKAMISMSLARTSFVSEATAIVEQNL  245

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             A+IKTV SF  E+  +      +  Q   S+KES    +  G++Q  + C    ++++ +
Sbjct  246   AHIKTVFSFVGEKSAIKSFSNCMDSQYALSKKESMVKGLGLGMLQIATFC----SYSLVI  301

Query  644   WYTTLLVQRHQS-------SFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQ  802
             W   + V   ++       + +N +      S   P +        +     G  K VF+
Sbjct  302   WVGAVAVTEGKAKPGETIAAVINVLSGAIYISNAAPDLQAF-----SQAKVAG--KEVFK  354

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              + R   I  +   + L E + G++E + + F YPSR +  VL GF+L I+AG  +ALVG
Sbjct  355   VIKRTPAISYESKGKFL-EKVTGDIEIREVHFTYPSREDKPVLQGFSLAIQAGNILALVG  413

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD   G VLIDG+D++  +L+ LR  IG V QEP LF  +I +N
Sbjct  414   SSGCGKSTVISLVQRFYDPMSGVVLIDGQDIKTLDLKFLRTNIGSVSQEPSLFSGTIMDN  473

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             +  G   A++ EIIE +K AN+H+FISNLP  Y T VGE+G QLSGGQKQRIAIARA+LK
Sbjct  474   LRIGKIDATDEEIIEAAKTANVHSFISNLPNQYATEVGERGLQLSGGQKQRIAIARAILK  533

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALDS SE+ V  AL+   Q    GR      T I +AHR+ST++ +D 
Sbjct  534   DPPILLLDEATSALDSESEKXVQEALDIAMQ----GR------TVILIAHRMSTIIGADK  583

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             IV+++ G V + G+H  L  +    YS + S+Q+++
Sbjct  584   IVLVENGTVAQSGTHEELL-EKSAFYSSVCSMQNLE  618



>ref|XP_002443865.1| hypothetical protein SORBIDRAFT_07g003520 [Sorghum bicolor]
 gb|EES13360.1| hypothetical protein SORBIDRAFT_07g003520 [Sorghum bicolor]
Length=1260

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/538 (61%), Positives = 416/538 (77%), Gaps = 9/538 (2%)
 Frame = +2

Query  11    DAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER  190
             DAK  V  YSVI   IGLL++F+N  QHY+YG+VGE+AM NLR +L+S        WFE+
Sbjct  727   DAKSTVSKYSVILFLIGLLTFFSNIFQHYIYGLVGERAMNNLREALFSG-------WFEQ  779

Query  191   PENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP  370
             P+N+VG LTSRI+ +TS +K IISDRMS+IVQCISSIVIAT +S +V+WRMGLVAW +MP
Sbjct  780   PKNSVGFLTSRIIGDTSMIKTIISDRMSLIVQCISSIVIATVLSTVVNWRMGLVAWTLMP  839

Query  371   CHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQP  550
              HF  GL+Q +SAKGF+ D + +H +++SL SE+ +NI+TV SF  E+ ++ KA ++LQ 
Sbjct  840   FHFFAGLVQVRSAKGFATDFSTSHRKLISLTSEAVSNIRTVASFVQEDEILKKADLSLQE  899

Query  551   QLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP  730
              +  SR ESIK+G +QGTSLCLW+  HA+AL +T +L+ ++ SSF + +RSYQ F++T+ 
Sbjct  900   PMRTSRVESIKYGAVQGTSLCLWHTTHAIALSFTIMLLDKNLSSFKDCVRSYQAFAMTIS  959

Query  731   SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             SITELW+LIP VLSAI +L P    LDR TRI PD PE    E + G V F+ + F YPS
Sbjct  960   SITELWSLIPLVLSAITVLDPALDILDRETRIVPDVPEVHSEERLAGNVVFQDVSFSYPS  1019

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RPEV++L+GFNL IE G +VALVGPSG+GKS+V+ALLLRFYD   G+VL+DGKD+RDYNL
Sbjct  1020  RPEVIILDGFNLDIEPGQQVALVGPSGSGKSTVLALLLRFYDPRSGQVLVDGKDIRDYNL  1079

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R +R  IGLVQQEP+LF  SIRENI YG+E ASE+EI+E +  ANIH FIS L  GYDTV
Sbjct  1080  RYMRKHIGLVQQEPILFNLSIRENISYGNEGASESEIVEAAMEANIHEFISGLSNGYDTV  1139

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VG+KGSQLSGGQKQRIAIARA+LKRP IMLLDEATSALD  SE  V+S+L + +   K G
Sbjct  1140  VGDKGSQLSGGQKQRIAIARAILKRPTIMLLDEATSALDGQSEMVVMSSLLAKEWKSK-G  1198

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
             R S SK+T IT+AHR+STV ++D+IVVMD+G V+E+G+H  L S  +GVYSRL  +QS
Sbjct  1199  RLS-SKITSITIAHRMSTVTSADVIVVMDRGQVIELGNHEALISANNGVYSRLYHMQS  1255


 Score =   271 bits (693),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 183/516 (35%), Positives = 286/516 (55%), Gaps = 35/516 (7%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ M  +R +   + L  ++  F+  +    ++ +   N  + ++  I ++M   +   S
Sbjct  130   QRQMARMRIAYLRSVLSQDIGAFDT-DLTTANIIAGATNHMNVIQDAIGEKMGHFMSNFS  188

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + ++A  V+    W +GL++  V+P   + G   AK     S   T+  SE  ++  ++ 
Sbjct  189   TFLVAIIVAFACCWEVGLLSLLVVPMLLMVGAYYAKMMIHMSVTRTSFVSEATTIVEQNL  248

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVAL  643
             A+IKTV SF  E+  +      +  Q   S+KESI      G++Q  + C    ++++ +
Sbjct  249   AHIKTVFSFVGEKSAIKSFNNCMDNQYVLSKKESIAKGLGLGMLQIATFC----SYSLVI  304

Query  644   WYTTLLVQRHQS-------SFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQ  802
             W     V   Q+       + +N +      S   P +        +   A G  + VF+
Sbjct  305   WVGAAAVIDRQAKPGETIAAVINVLSGAIYLSNAAPDLQAF-----SQAKAAG--QEVFK  357

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              + R   I  +   + L E + G++E + + F YPSR +  VL GF+L I+AG  +ALVG
Sbjct  358   IIKRNPAISYESKGKIL-EKVIGDIEIREVHFTYPSREDKPVLQGFSLAIQAGNILALVG  416

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD   G +LIDG+D++  +L+ LR  IG V QEP LF  +I +N
Sbjct  417   SSGCGKSTVISLVQRFYDPISGAILIDGQDIKTLDLKFLRTNIGSVSQEPSLFSGTIMDN  476

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             +  G   A++ EIIE +K AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK
Sbjct  477   LRIGKIDATDEEIIEAAKTANVHSFISKLPNQYATEVGERGVQLSGGQKQRIAIARAILK  536

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALDS SE+ V  ALE   Q    GR      T I +AHR+ST++N+D 
Sbjct  537   DPPILLLDEATSALDSESEKIVQEALEIAMQ----GR------TVILIAHRMSTIINADK  586

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             IV+++ G V + G+H  L  + +  YS + S+Q+++
Sbjct  587   IVLVENGRVAQSGTHEELLEKSE-FYSSICSMQNLE  621



>ref|XP_004972834.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1265

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/540 (60%), Positives = 420/540 (78%), Gaps = 2/540 (0%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             + DAK  V  YS+I   IGLL++F+N  QHY+YG+ GE+A  NLR +L+S  L+NE+ WF
Sbjct  723   EPDAKSIVSKYSIILFLIGLLTFFSNIFQHYIYGLAGERATNNLREALFSVILRNEIGWF  782

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             E+P+N+VG L SRIV +TS +K IISDRMS+IVQCISSI+IAT +S +V+WRMGLVAW +
Sbjct  783   EQPKNSVGFLNSRIVGDTSMIKTIISDRMSLIVQCISSILIATGLSTVVNWRMGLVAWTL  842

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL  544
             MP HFI GL+Q +SAKGF+ D + +H +++SL SE+ +NI+TV SF  E+ ++ KA ++L
Sbjct  843   MPFHFIAGLVQVRSAKGFATDFSTSHRKLISLTSEAVSNIRTVASFVQEDEILRKADLSL  902

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             Q  + +SR ESIK+G +QGT+L LW+  HA+A+ +T +L+ +  ++F N +RSYQ F++T
Sbjct  903   QEPMRKSRVESIKYGAVQGTALFLWHTTHAIAMSFTIMLLDKDLATFKNCVRSYQAFAMT  962

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
             + SITELW+LIP VLSAI IL P    LDR T+I PD P+    E + G+VEF+ + F Y
Sbjct  963   ISSITELWSLIPMVLSAIAILDPALDILDRETQIVPDVPKLHSEERLAGDVEFQDVSFSY  1022

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRPEV++L+GFNL IE G +VALVG SG+GKS+V+ALLLRFYD  EG+VL+DGKD+RDY
Sbjct  1023  PSRPEVIILDGFNLAIEPGQRVALVGSSGSGKSTVLALLLRFYDPCEGQVLVDGKDIRDY  1082

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR  IGLVQQEP+LF  SIRENI YG+E  SE+EIIE +  ANIH FIS L  GYD
Sbjct  1083  NLRYLRKHIGLVQQEPILFNMSIRENISYGNEGVSESEIIEAAMEANIHEFISGLSNGYD  1142

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T+VG+KGSQLSGGQKQRIAIAR +LKRP I+LLDEATSALDS SER V+S+L + +  +K
Sbjct  1143  TMVGDKGSQLSGGQKQRIAIARTILKRPTILLLDEATSALDSESERVVMSSLGTKEWKNK  1202

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              G  S  K+T IT+AHR+STV ++D+IVVMDKG VVEMGSH +L S  +GVYS+L  + S
Sbjct  1203  -GELS-RKITSITIAHRISTVTSADVIVVMDKGQVVEMGSHESLVSASNGVYSKLYRMHS  1260


 Score =   261 bits (668),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 178/516 (34%), Positives = 282/516 (55%), Gaps = 35/516 (7%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ M  +R +   + L  ++  F+  + +  ++ +   N  S ++  I ++M   +   S
Sbjct  130   QRQMARMRMAYLRSVLSQDIGAFD-TDLSTANIIAGATNHMSVIQDAIGEKMGHFMSNFS  188

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + V+A  V+    W +G+++  V+P   + G   AK     S    +  SE  ++  ++ 
Sbjct  189   TFVVAIIVAFACCWEVGMLSLLVVPMLLMVGATYAKMMIDMSLARISYISEATTVVEQTL  248

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVAL  643
             ANIKTV SF  E   +      +  Q   S+KE++      G++Q  + C    ++++ +
Sbjct  249   ANIKTVFSFVGENSAIKSFNKCMYNQYMLSKKEAMAKGLGLGMLQIATFC----SYSLVI  304

Query  644   WYTTLLVQRHQS-------SFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQ  802
             W     V   ++       + +N +      S   P +        +   A G  K +F+
Sbjct  305   WVGAAAVTGGKAKAGETIAAVINVLSGAIYISNAAPDLQAF-----SQAKAAG--KEIFK  357

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              + R   I  +   + L + I G++E + + F YPSR +  VL GF+L I+AG  VALVG
Sbjct  358   VIKRNPAISYESNGKILKK-ITGDIEMREVHFMYPSREDNPVLQGFSLAIQAGNIVALVG  416

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD   G VLID +++++ +L+ LR  IG V QEP LF  +I +N
Sbjct  417   SSGCGKSTVISLVQRFYDPTSGVVLIDNQNIKELDLKCLRRNIGSVSQEPALFSGTIMDN  476

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLK  1342
             +  G   A++ EI E ++ AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK
Sbjct  477   LRIGKMDATDEEITEAARTANVHSFISKLPNQYSTEVGERGVQLSGGQKQRIAIARAILK  536

Query  1343  RPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDI  1522
              P I+LLDEATSALDS SE+ V  AL+   Q    GR      T I +AHR+ST++N+D 
Sbjct  537   DPPILLLDEATSALDSESEKIVQEALDRAMQ----GR------TVILIAHRISTIINADR  586

Query  1523  IVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             IV ++ G V + G+H  L  +    YS + S+Q+++
Sbjct  587   IVHVENGRVAQSGTHEELLEKSK-FYSSVCSMQNLE  621



>gb|AFW61227.1| hypothetical protein ZEAMMB73_394985 [Zea mays]
Length=1197

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/538 (60%), Positives = 418/538 (78%), Gaps = 9/538 (2%)
 Frame = +2

Query  11    DAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER  190
             DAK  V  YSVI   IGLL++F+N  QHY+YG+VGE+A  NLR +L+S        WFE+
Sbjct  664   DAKSIVSTYSVILFLIGLLTFFSNMFQHYIYGLVGERATNNLREALFSG-------WFEQ  716

Query  191   PENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP  370
             P+N+VG LTSRIV +TS +K IISDRMS+IVQCISSI+IAT +S +V+WRMGLVAW +MP
Sbjct  717   PKNSVGFLTSRIVGDTSMIKTIISDRMSLIVQCISSILIATVLSTVVNWRMGLVAWTLMP  776

Query  371   CHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQP  550
              HF  GL+Q +SAKGF+ D +A+H E++SL SE+ +NI+TV SF  E+ ++ KA ++LQ 
Sbjct  777   FHFFAGLVQVRSAKGFATDFSASHRELISLTSEAVSNIRTVASFVQEDEILKKADLSLQE  836

Query  551   QLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP  730
              +  S+ ESIK+G++QGTSLCLW++ HA+AL +T +L+ ++ SSF + +RSYQ F++T+ 
Sbjct  837   PMRTSKVESIKYGLVQGTSLCLWHMTHAIALSFTIMLLDKNLSSFKDCVRSYQAFAMTIS  896

Query  731   SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             SITELW+LIP VLSAI +L P    LDR T+I PD PE    E + G++ F+ + F YPS
Sbjct  897   SITELWSLIPLVLSAITVLDPALDILDRETQIVPDVPEVHSEERLAGDIVFQDVSFSYPS  956

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RPEV++L+GFNL IE G +VALVGPSG+GK++V+ALLLRFYD  EG+VL++ KD+RDYNL
Sbjct  957   RPEVIILDGFNLDIEPGQQVALVGPSGSGKTTVLALLLRFYDPCEGRVLVNDKDIRDYNL  1016

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR  IGLVQQEP+LF  SIRENI YG+E ASE+EI+  +  ANIH FIS L  GYDTV
Sbjct  1017  RYLRKHIGLVQQEPMLFNLSIRENISYGNEGASESEIVAAAMEANIHEFISGLSNGYDTV  1076

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VG+KGSQLSGGQKQRIAIARA+LKRP IMLLDEATSALD  SE  V+S+L + +  +  G
Sbjct  1077  VGDKGSQLSGGQKQRIAIARAILKRPTIMLLDEATSALDGQSEMVVMSSLVAKEWRNN-G  1135

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
               S SK+T IT+AHRLST+ ++++IVVMDKG VVE+GSH  L S  DGVYSRL S+QS
Sbjct  1136  ELS-SKITSITIAHRLSTITSAEVIVVMDKGQVVELGSHEALISAKDGVYSRLYSMQS  1192


 Score =   190 bits (483),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 131/414 (32%), Positives = 218/414 (53%), Gaps = 24/414 (6%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ MT +R +   + L  ++  F+  +    S+ +   N  S ++  I ++M   +   S
Sbjct  127   QRQMTRMRIAYLRSVLSQDIGAFDT-DLTTASIMAGATNHMSVIQDAIGEKMGHFMSNFS  185

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + ++A  V+    W +GL++  V+P   + G   +K+    S   T+  SE  ++  ++ 
Sbjct  186   TFLVAIIVAFACCWEVGLLSLLVVPMLLMVGASYSKAMISMSLARTSFVSEATAIVEQNL  245

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIAHAVAL  643
             A+IKTV SF  E+  +      +  Q   S+KES    +  G++Q  + C    ++++ +
Sbjct  246   AHIKTVFSFVGEKSAIKSFSNCMDSQYALSKKESMVKGLGLGMLQIATFC----SYSLVI  301

Query  644   WYTTLLVQRHQS-------SFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQ  802
             W   + V   ++       + +N +      S   P +        +     G  K VF+
Sbjct  302   WVGAVAVTEGKAKPGETIAAVINVLSGAIYISNAAPDLQAF-----SQAKVAG--KEVFK  354

Query  803   TLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVG  982
              + R   I  +   + L E + G++E + + F YPSR +  VL GF+L I+AG  +ALVG
Sbjct  355   VIKRTPAISYESKGKFL-EKVTGDIEIREVHFTYPSREDKPVLQGFSLAIQAGNILALVG  413

Query  983   PSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIREN  1162
              SG GKS+VI+L+ RFYD   G VLIDG+D++  +L+ LR  IG V QEP LF  +I +N
Sbjct  414   SSGCGKSTVISLVQRFYDPMSGVVLIDGQDIKTLDLKFLRTNIGSVSQEPSLFSGTIMDN  473

Query  1163  ICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAI  1324
             +  G   A++ EIIE +K AN+H+FISNLP  Y T VGE+G QLSGG  + + +
Sbjct  474   LRIGKIDATDEEIIEAAKTANVHSFISNLPNQYATEVGERGLQLSGGADKIVLV  527



>ref|XP_010234412.1| PREDICTED: ABC transporter B family member 14-like [Brachypodium 
distachyon]
Length=454

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/439 (68%), Positives = 358/439 (82%), Gaps = 2/439 (0%)
 Frame = +2

Query  308   ATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIK  487
             ATTVSM V+WRMGLV+WAVMPCHFIGGLIQA+SAKGF GD   AH E+VSLASE+A+NI+
Sbjct  14    ATTVSMYVNWRMGLVSWAVMPCHFIGGLIQARSAKGFYGDAAIAHQELVSLASEAASNIR  73

Query  488   TVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQ  667
             TV SF +E+ ++ KA ++LQ  +  +R ES+K+G+IQG SLCLWNIAHAVALWYTT+LVQ
Sbjct  74    TVASFVYEDEIIKKAELSLQEPMRITRIESMKYGVIQGISLCLWNIAHAVALWYTTVLVQ  133

Query  668   RHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEE  847
             R Q++F N+IRSYQIFSLTVPSITELWTLIP V+SAI IL P F  LDR T I PD+P++
Sbjct  134   RKQATFENSIRSYQIFSLTVPSITELWTLIPMVMSAIAILNPAFDMLDRETEIVPDEPKK  193

Query  848   SLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLR  1027
                + + G  EF+ + F+YPSRPEV +L+GFNL IE G +VALVGPSGAGKSSV+ALLLR
Sbjct  194   PSEQWLVGRTEFQDVSFNYPSRPEVTILDGFNLVIEPGQRVALVGPSGAGKSSVLALLLR  253

Query  1028  FYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIE  1207
             FYD   G VL+D  ++RDYNLR LR QIGLVQQEP+LF  SIRENI YGSE +SE EII+
Sbjct  254   FYDPHGGTVLVDNTNIRDYNLRWLRKQIGLVQQEPILFNSSIRENISYGSEESSETEIIQ  313

Query  1208  VSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALD  1387
              +  ANIH FIS LP+GYDTVVG+KG QLSGGQKQRIAIAR LLKRP+I+LLDEATSALD
Sbjct  314   AAMDANIHEFISGLPKGYDTVVGDKGGQLSGGQKQRIAIARTLLKRPSILLLDEATSALD  373

Query  1388  SGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSH  1567
             S SER V+S+L + +  +   RS  SK+T ITVAHRLSTV+N+D+IVVM+KG V+E+G H
Sbjct  374   SESERVVMSSLGAKEWKNIDERS--SKITSITVAHRLSTVINADMIVVMEKGKVIELGDH  431

Query  1568  STLTSQPDGVYSRLVSLQS  1624
              TL S  DGVYSRL  LQS
Sbjct  432   QTLVSADDGVYSRLFHLQS  450



>gb|ACF22787.1| MDR-like ABC transporter [Brachypodium distachyon]
Length=1261

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/539 (58%), Positives = 411/539 (76%), Gaps = 28/539 (5%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             D DAKRKV  YS+    +G+ ++F+N  QHY+YG+VGE+AM NLR +L++A L+NE+ WF
Sbjct  745   DPDAKRKVTKYSITLFLVGISTFFSNIFQHYIYGLVGERAMNNLREALFTAVLRNEMGWF  804

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             E+P+N+VG LTSR+V++TS +K IIS+RM++IVQCISSI+IAT +S  V+WRMGLV+WA+
Sbjct  805   EKPKNSVGFLTSRVVSDTSMIKTIISERMAIIVQCISSILIATGLSTGVNWRMGLVSWAM  864

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL  544
             MPCHFI GL+Q +SAKGF+ DT+ +H +++SL SE+ +NI+TV SF  EE ++ KA +AL
Sbjct  865   MPCHFIAGLVQVRSAKGFATDTSKSHRKLISLTSEAVSNIRTVASFVQEEEILRKADLAL  924

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             Q  +  SR ES+K+G+                            +SF +++RSYQ F++T
Sbjct  925   QEPMRISRIESVKYGV--------------------------RLASFEDSVRSYQAFAMT  958

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
             + SITELW+LIP V+SAI IL P    LDR T+I PD+P+ +  + I G VEFK + F Y
Sbjct  959   ISSITELWSLIPMVMSAITILDPALDILDRETQIVPDEPKVTCEDRIVGNVEFKDVIFSY  1018

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRPEV++L+GF+L IE+G +VALVGPSG+GKS+V+ALLLRFYD   G+VL+DGKD+R Y
Sbjct  1019  PSRPEVIILDGFSLAIESGQRVALVGPSGSGKSTVLALLLRFYDPCNGQVLVDGKDIRTY  1078

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR QIGLVQQEP+LF  SIRENI YG+E ASE EI+E +  ANIH FIS+L +GYD
Sbjct  1079  NLKCLRKQIGLVQQEPILFNMSIRENISYGNEGASETEIVEAAMEANIHEFISSLSKGYD  1138

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T+VG+KGSQLSGGQKQRIA+AR +LK+P I+LLDEATSALD  SER V++ L +    +K
Sbjct  1139  TIVGDKGSQLSGGQKQRIAVARTILKKPVILLLDEATSALDGESERVVMNTLGAKGWKNK  1198

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              G  S SK+T IT+AHRLSTV N+D+IVVMDKG VVE GSH+TL S+ +G+YSR+  +Q
Sbjct  1199  -GELS-SKITSITIAHRLSTVTNTDVIVVMDKGEVVETGSHATLVSESNGIYSRMYHMQ  1255


 Score =   268 bits (684),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 172/448 (38%), Positives = 257/448 (57%), Gaps = 25/448 (6%)
 Frame = +2

Query  308   ATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIK  487
             A  V+ +  W +G++++ V+P   + G   AK   G S    A  SE  S+  ++ ++IK
Sbjct  216   AIIVAFVCSWEVGMMSFLVVPMLLVIGATYAKMMNGMSMRRIALVSEATSVVEQNLSHIK  275

Query  488   TVVSFCHEEHVVNKARVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVALWYTT  655
             TV SF  E   +      +  Q   S+KE+I      G++Q  + C +++   +     T
Sbjct  276   TVFSFVGENSAMRSFTKCMDKQYKLSKKEAITKGLGLGMLQIATFCSYSLTIYIGAVAVT  335

Query  656   LLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPD  835
                 +     + A+    I S  +  I+     +     A    K VF+ + R    +P 
Sbjct  336   GRRPKKAGETIAAV--INILSAAI-YISNAAPDLQAFSQAKAAGKEVFKVIKR----KPV  388

Query  836   KPEES---LSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSS  1006
                ES   +SE + GE+E + + F YPSR +  +L GF+L I+AG  VALVG SG GKS+
Sbjct  389   ISYESGGIISEQVIGEIEIREVDFTYPSREDKPILQGFSLAIQAGEIVALVGSSGCGKST  448

Query  1007  VIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERA  1186
             VI+L+ RFYD   G ++IDG+++++ +L+ LR  IG V QEP LF  +I +N+  G   A
Sbjct  449   VISLVQRFYDPTSGDIIIDGQNIKELDLKFLRRNIGSVSQEPALFSGTIMDNLRIGKMDA  508

Query  1187  SEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLD  1366
             ++ EIIE +K AN+H+FIS LP  Y T VGE+G QLSGGQKQRIAIARA+LK P I+LLD
Sbjct  509   TDEEIIEAAKTANVHSFISKLPNQYSTEVGERGLQLSGGQKQRIAIARAILKDPPILLLD  568

Query  1367  EATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGC  1546
             EATSALDS SE+ V  AL+   +    GR      T I +AHR+ST++N+D IVV++ G 
Sbjct  569   EATSALDSESEKLVQDALDRAMR----GR------TVILIAHRMSTIINADKIVVVENGG  618

Query  1547  VVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             V + G+H  L  +    YS + ++Q+++
Sbjct  619   VAQSGTHEELLKKST-FYSSVCNMQNLE  645



>ref|XP_006846530.1| hypothetical protein AMTR_s00018p00193700 [Amborella trichopoda]
 gb|ERN08205.1| hypothetical protein AMTR_s00018p00193700 [Amborella trichopoda]
Length=436

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/443 (61%), Positives = 340/443 (77%), Gaps = 8/443 (2%)
 Frame = +2

Query  323   MIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF  502
             M+V+WRMGLVAWAVMPCHFIGGL+QA+SA+GF+ D++ +HS++  + +ESA+NI+TV SF
Sbjct  1     MVVNWRMGLVAWAVMPCHFIGGLVQARSAQGFALDSSLSHSKLSKIMAESASNIRTVASF  60

Query  503   CHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSS  682
               E+ ++ +A  +L   L RSR ES+K+G IQG SLCLWNIAHAVALWYTT+LV+R Q+S
Sbjct  61    VCEDRLIAQANSSLMDPLMRSRIESLKYGFIQGFSLCLWNIAHAVALWYTTVLVERKQAS  120

Query  683   FLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSES  862
             F N IRSYQIFSLTVPSITELWTL+PTV +++ IL+P  + LDR + I+P +      + 
Sbjct  121   FENGIRSYQIFSLTVPSITELWTLLPTVFASLRILRPALRVLDRQSHIDPQRNGGLRRDR  180

Query  863   IEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVD  1042
             I G V F+ ++F YP RP+ ++L G +  I  GM++ALVGPSG+GKSSV+ L+LRFYD  
Sbjct  181   ICGAVCFQDVQFSYPLRPDSLILQGLSFSIGEGMQMALVGPSGSGKSSVLGLVLRFYDPQ  240

Query  1043  EGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAA  1222
             +G++LIDG+D+RDY LR LR  IGLVQQEPLLF  SI +NI YG+E ASE+EI+E SK A
Sbjct  241   KGRILIDGRDIRDYELRWLRTHIGLVQQEPLLFSTSIVDNIRYGNENASESEILEASKQA  300

Query  1223  NIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSER  1402
             N H F+S+LP+GYDT+VGEKG QLSGGQKQRIAIARALLKRP+IM+LDEATSALD+ SE 
Sbjct  301   NAHGFVSSLPDGYDTMVGEKGCQLSGGQKQRIAIARALLKRPSIMMLDEATSALDAESEA  360

Query  1403  AVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTS  1582
              V+ A+   Q     G       TQI VAHRLSTV++SD IVVMDKG VVEMG HS L +
Sbjct  361   MVMRAIA--QSGEGCG------CTQIRVAHRLSTVMDSDTIVVMDKGKVVEMGHHSELVT  412

Query  1583  QPDGVYSRLVSLQSMKDH*HTQL  1651
                GVYSR   LQ++    +T L
Sbjct  413   SEGGVYSRFFKLQNLSGKSNTTL  435



>gb|EMT14005.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1400

 Score =   514 bits (1325),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 291/546 (53%), Positives = 378/546 (69%), Gaps = 45/546 (8%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             +DA+R VG YS                 HY+YG+VGE+AM NLR +L+S  L++E+ WFE
Sbjct  720   TDAQRIVGKYS-----------------HYIYGLVGERAMNNLREALFSVVLRSEVGWFE  762

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
              P N+VG LT+R+V++TS +K +ISDRMSVIVQCISSI+IAT +S  V+WRM L  +A+M
Sbjct  763   EPRNSVGFLTARVVSDTSMIKTVISDRMSVIVQCISSILIATVLSTAVNWRMALAVYAMM  822

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ  547
             PCH I GL+Q +SAKGF+ D + +H +++SL SE+ +NI+TV SF  EE ++ KA +ALQ
Sbjct  823   PCHLIAGLVQVRSAKGFATDVSTSHQKLISLTSEAVSNIRTVASFVQEEEILRKADLALQ  882

Query  548   PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
               +   R ESIK+G +QG +LCLW++ HAV L  T  L+ +  ++F N +RSYQ F+LTV
Sbjct  883   EPMRTIRMESIKYGALQGVALCLWHMTHAVQLSCTIALIGKGLATFENCVRSYQTFALTV  942

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTR-IEPDKPEESLSES--IEGEVEFKTIKF  898
             PSITELWTLIP V+SA+ +L P    LDR T+ I  D P+ S  E   I G V F+ + F
Sbjct  943   PSITELWTLIPMVMSALAVLDPALDILDRETQIIVLDVPKASHDEEDRIVGGVAFEGVSF  1002

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YPSR +V +L+GF+L IE G +VALVGPSGAGKS+V ALLLRFY+  +G+VL+D KD+R
Sbjct  1003  SYPSRAKVTILDGFSLAIEPGQRVALVGPSGAGKSTVFALLLRFYEPSQGRVLVDSKDIR  1062

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
             DYNL+ LR QIGLVQQEP+LF  SIRENI YG+E ASEAEI+E +  ANIH FIS L  G
Sbjct  1063  DYNLKWLRRQIGLVQQEPILFNLSIRENIGYGNEGASEAEIVEAATEANIHEFISGLSAG  1122

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ-Q  1435
                                      +LK+PAI+LLDEATSALD  SER V+S+L +    
Sbjct  1123  ------------------------TILKKPAILLLDEATSALDGESERVVMSSLAAKGWG  1158

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 G +S S  T IT+AHRLSTV N+D+IVVM+KG VVE+GSH TL S  +GVYSR+  
Sbjct  1159  KSGIGEASSSTTTSITIAHRLSTVANADVIVVMEKGAVVELGSHETLVSASNGVYSRMYR  1218

Query  1616  LQSMKD  1633
             +Q  K+
Sbjct  1219  VQGPKN  1224


 Score =   261 bits (668),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 181/524 (35%), Positives = 287/524 (55%), Gaps = 39/524 (7%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             ++ MT ++ +   + L  ++  F+  +    ++ +   N  S +K  I ++M   +   S
Sbjct  120   QRQMTRMQRAYLGSVLSQDVGAFD-TDLTTANIMAGTTNHMSVIKDAIGEKMGHFISNFS  178

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             + ++A  V+ +  W +G+++  V+P   + G   AK+  G S   TA  SE  ++  ++ 
Sbjct  179   TFLVAVIVAFVCCWEVGMLSLLVVPMLLVVGATYAKTMIGMSMTRTAFVSETTTVVEQTL  238

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES----IKFGIIQGTSLCLWNIA---HA  634
             ++IKTV SF  E   +      +  Q   S+KE+    +  G++Q  + C +++     A
Sbjct  239   SHIKTVFSFVGENSAMKSFVKCMDKQYKLSKKEAFIKGLGLGMLQIVTFCSYSLTIYVGA  298

Query  635   VALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDR  814
             VA+   +       ++ +N +      S   P +      I +   A G  K VF+ + R
Sbjct  299   VAVTRRSAKAGETIAAVINILSGAIYLSNAAPDLQ-----IFSQAKAAG--KEVFKVIKR  351

Query  815   CTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
                I  +     L E + G++E + + F YPSR +  +L GF+L + AG  VALVG SG 
Sbjct  352   NPVISSESNGRIL-EKVIGDIEIREVHFTYPSREDNPILQGFSLAVPAGKIVALVGSSGC  410

Query  995   GKSSVIALLLRFYDV------------DEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLL  1138
             GKS+VI+L+ RFYD             + G +LIDG+++++ +L+ LR  IG V QEP L
Sbjct  411   GKSTVISLVQRFYDTMSGFTCVCNTVWNAGDILIDGQNIKELDLKSLRRNIGSVSQEPSL  470

Query  1139  FCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRI  1318
             F  +I +N+  G   A++ E+IE +K AN+HTFI  LP  Y T VGE+G QLSGGQKQRI
Sbjct  471   FSGTISDNLRIGKMSATDEEVIEAAKTANVHTFICKLPNQYSTEVGERGVQLSGGQKQRI  530

Query  1319  AIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRL  1498
             AIARA+LK P I+LLDEATSALDS SE+ V  AL+   Q    GR      T I +AHR+
Sbjct  531   AIARAILKNPPILLLDEATSALDSESEKLVQDALDRAMQ----GR------TVILIAHRI  580

Query  1499  STVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMK  1630
             ST++N+D IVV++ G V   G+H  L  +    YS + ++Q+++
Sbjct  581   STIINADKIVVVENGRVAHSGTHKELL-EKSAFYSSVCNMQNLE  623



>ref|XP_006338462.1| PREDICTED: ABC transporter B family member 19-like [Solanum tuberosum]
Length=1249

 Score =   452 bits (1162),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 253/539 (47%), Positives = 343/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++    + RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FGI Q   L L+  + A+ LWY   LV    S+F   I+ + +  +T
Sbjct  901   MQSLRRSQMSGLLFGISQ---LALYG-SEALILWYGAHLVNNGVSTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TR++PD PE    ESI G++E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRVDPDDPEADPVESIRGDIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+HTF+S LPEGY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ N D I V+  G +VE GSHS L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRNVDTIGVVQDGRIVEQGSHSELISRPEGAYSRLLQLQ  1245


 Score =   307 bits (787),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 193/539 (36%), Positives = 301/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMSL  315

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    R +P   +++L       + G +EFK + F YPS
Sbjct  316   GQSF--SNLGAFSKGKAAGYKLMEIIRQKPTIVQDTLDGKCLSEVSGNIEFKNVTFSYPS  373

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   FN+   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L
Sbjct  374   RPDVIIFRDFNIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQL  433

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FI+ LP GY+T 
Sbjct  434   RWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATCASNAHSFITLLPNGYNTQ  493

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  494   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  549

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L S+  G Y+ L+  Q M
Sbjct  550   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELISKA-GAYASLIRFQEM  601



>gb|ABX82929.1| LO4 [Solanum pennellii]
Length=1249

 Score =   450 bits (1157),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 252/539 (47%), Positives = 343/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++    + RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FGI Q   L L+  + A+ LWY   LV    S+F   I+ + +  +T
Sbjct  901   MQSLRRSQMSGLLFGISQ---LALYG-SEALILWYGAHLVNNGVSTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TR++PD PE    ESI G++E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRVDPDDPEGDPVESIRGDIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+HTF+S LPEGY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ N D I V+  G +VE GSHS L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRNVDTIGVVQDGRIVEQGSHSELISRPEGAYSRLLQLQ  1245


 Score =   301 bits (772),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 191/539 (35%), Positives = 300/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMSL  315

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   +++L       + G +EFK + F YPS
Sbjct  316   GQSF--SNLGAFSKGKAAGYKLMEIIKQKPTIVQDTLDGKCLSEVSGNIEFKNVTFSYPS  373

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F +   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L
Sbjct  374   RPDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQL  433

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FI+ LP GY+T 
Sbjct  434   RWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATCASNAHSFITLLPNGYNTQ  493

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  494   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  549

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L S+  G Y+ L+  Q M
Sbjct  550   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELISKA-GAYASLIRFQEM  601



>ref|NP_001234209.1| L04 [Solanum lycopersicum]
 gb|ABX82928.1| L04 [Solanum lycopersicum]
Length=1249

 Score =   450 bits (1157),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 252/539 (47%), Positives = 343/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++    + RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FGI Q   L L+  + A+ LWY   LV    S+F   I+ + +  +T
Sbjct  901   MQSLRRSQMSGLLFGISQ---LALYG-SEALILWYGAHLVNNGVSTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TR++PD PE    ESI G++E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRVDPDDPEGDPVESIRGDIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVSVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+HTF+S LPEGY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHTFVSGLPEGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ N D I V+  G +VE GSHS L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRNVDTIGVVQDGRIVEQGSHSELISRPEGAYSRLLQLQ  1245


 Score =   301 bits (771),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 191/539 (35%), Positives = 299/539 (55%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMSL  315

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   +++L       + G +EFK + F YPS
Sbjct  316   GQSF--SNLGAFSKGKAAGYKLMEIIKQKPTIVQDTLDGKCLSEVSGNIEFKNVTFSYPS  373

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F +   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L
Sbjct  374   RPDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKTLQL  433

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H FI+ LP GY+T 
Sbjct  434   RWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATCASNAHNFITLLPNGYNTQ  493

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  494   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  549

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L S+  G Y+ L+  Q M
Sbjct  550   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELISKA-GAYASLIRFQEM  601



>gb|AFW59635.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=737

 Score =   431 bits (1108),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  206   NEMEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  265

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + + +  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ ++  A  
Sbjct  266   EEENNSSLVAAHLAVDAADVKSAIAERISVILQNMTSLMTSFVVGFIIEWRVAILILATF  325

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R
Sbjct  326   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQSKILSLFSHELR  385

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             V  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  386   VPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  441

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     +I G++E + + 
Sbjct  442   VVTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVD  501

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS++IAL+ RFYD   GKV IDGKD+
Sbjct  502   FSYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTIIALIERFYDPCGGKVAIDGKDI  561

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG E ASE E++E +K AN+H F+S LP+
Sbjct  562   RTLNLKSLRRKIGLVQQEPVLFASSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPD  621

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  622   GYRTAVGERGMQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  681

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G VVE GSHS L ++P+G YSRL+ 
Sbjct  682   ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRVVEHGSHSDLLARPEGAYSRLLQ  731

Query  1616  LQ  1621
             LQ
Sbjct  732   LQ  733


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 11/97 (11%)
 Frame = +2

Query  1334  LLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVN  1513
             +LK P I+LLDEATSALD+ SE  V  AL+ L      GR      T + VAHRLST+ N
Sbjct  1     MLKNPKILLLDEATSALDADSESIVQEALDRLM----VGR------TTVVVAHRLSTIRN  50

Query  1514  SDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              ++I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  51    VNMIAVIQQGQVVETGTHDELLAKGTSGAYASLIRFQ  87



>dbj|BAF01897.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=600

 Score =   425 bits (1093),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 244/547 (45%), Positives = 346/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  68    YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  126

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+   
Sbjct  127   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILG  186

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  187   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  246

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + 
Sbjct  247   LRVPQKRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSKVIKVFV  302

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  303   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  362

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  363   VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  422

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+I+ ++AAN H FIS L
Sbjct  423   DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGL  482

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  483   PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  542

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  543   MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  592

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  593   LQLQTHR  599



>ref|XP_006827168.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
 gb|ERM94405.1| hypothetical protein AMTR_s00010p00254310 [Amborella trichopoda]
Length=1252

 Score =   442 bits (1138),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 239/524 (46%), Positives = 331/524 (63%), Gaps = 10/524 (2%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             +  ++   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  ENN   +
Sbjct  728   FVFMYIGAGLYAVIAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEENNSSQV  787

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
              SR+  + +TVK  I++RMSVI+Q ++S++ +  V+ I++WR+ L+  A  P        
Sbjct  788   ASRLATDATTVKSAIAERMSVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLLVFANFA  847

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKE  574
             Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++   R  L+P  HR+ + 
Sbjct  848   QQLSLKGFAGDTAKAHAKASMVAGEGVSNIRTVAAFNAQSKLLALFRRELRPPAHRALRR  907

Query  575   SIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL  754
             S   G++ G S      + A+ LWY   LVQ   S+F   I+ + +  +T  S+ E  +L
Sbjct  908   SQIAGLLFGVSQLALYASEALILWYGARLVQHGTSTFSRVIKVFVVLVITANSVAETVSL  967

Query  755   IPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLN  934
              P ++     L  VF  LDR T I+PD  +    ESI GE+EF+ + F YPSRPEV VL 
Sbjct  968   TPEIIRGSEALSSVFSILDRPTAIDPDDKDADPIESIRGEIEFRHVDFSYPSRPEVQVLK  1027

Query  935   GFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIG  1114
               NLRI AG  +ALVG SG+GKSS++AL+ RFYD   G+V IDG+D+R  NLR LR +IG
Sbjct  1028  ALNLRIRAGQSLALVGASGSGKSSILALIERFYDPSAGRVTIDGRDIRRLNLRDLRKRIG  1087

Query  1115  LVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQL  1294
             LVQQEP+LF  +I +NI YG E A+EAE+IE +KAAN H FIS LP+GY T VGE+G QL
Sbjct  1088  LVQQEPILFAATIHDNISYGREGATEAEVIEAAKAANAHGFISALPDGYKTAVGERGVQL  1147

Query  1295  SGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMT  1474
             SGGQ+QRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE L +    GR      T
Sbjct  1148  SGGQRQRIAIARAVLKDPAVLLLDEATSALDAESEHVLQEALERLMK----GR------T  1197

Query  1475  QITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
              + VAHRLST+   D I V+  G VVE GSH  L S+P+G Y+R
Sbjct  1198  TVVVAHRLSTIRGVDSIGVVQDGRVVEQGSHGELASRPEGAYTR  1241


 Score =   304 bits (778),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 191/543 (35%), Positives = 301/543 (55%), Gaps = 26/543 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIACWMYTGERQVSALRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYMSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A E+ A I+TV S+  E   +     A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSQQSYASAGIIAEEAIAQIRTVYSYVGESKALGSYSEAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  314

Query  743   LWTLIPTVLSAIGILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G           + + + +   I  D+ E ++ E ++G +EFK + F 
Sbjct  315   ----LGQSFSNLGAFSKGKVAGYKLMEIIQQKPSIIQDQAEGNILEQVQGNIEFKDVTFS  370

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V++    ++   AG  VA+VG SG+GKS+V+AL+ RFYD ++G VL+D  D+R 
Sbjct  371   YPSRPDVVIFRSLSILFPAGKTVAVVGGSGSGKSTVVALIERFYDPNQGHVLLDNVDIRT  430

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +IRENI YG   A+  E+   + AAN H+FI+ LP GY
Sbjct  431   LQLRWLRDQIGLVNQEPALFATTIRENILYGKPDATNDEVEAAAAAANAHSFIALLPNGY  490

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT VGE+G QLSGGQKQR+AIARA+LK P I+LLDEATSALD+GSE  V  AL+ L    
Sbjct  491   DTQVGERGVQLSGGQKQRVAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM---  547

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N D I V+  G V E+G+H  L ++ P G Y+ L+  
Sbjct  548   -VGR------TTVVVAHRLSTIRNVDTIAVIQNGRVAELGNHDELLAKAPSGAYANLIRF  600

Query  1619  QSM  1627
             Q +
Sbjct  601   QEI  603



>ref|XP_010937072.1| PREDICTED: ABC transporter B family member 19 [Elaeis guineensis]
Length=1253

 Score =   441 bits (1134),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 342/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  725   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEDE  784

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V  IV+WR+ L+  A  P  
Sbjct  785   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVGFIVEWRVALLILATFPLL  844

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ RV  
Sbjct  845   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELRVPQ  904

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+   + FG+ Q   L L++ + A+ LWY   LV+   S+F   I+ + +  +T
Sbjct  905   RRSLRRSQTSGLLFGVSQ---LSLYS-SEALILWYGAHLVRTGASTFSKVIKVFVVLVIT  960

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ VF  L+R TRI+PD PE    ESI GE+E + + F Y
Sbjct  961   ANSVAETVSLAPEIIRGGESIRSVFSILNRATRIDPDDPEAEPVESIRGEIELRHVDFAY  1020

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V +   FNLRI AG   ALVG SG+GKS+VI L+ RFYD   GKV+IDGKD+R  
Sbjct  1021  PSRPDVPIFKDFNLRIRAGQSQALVGASGSGKSTVIGLIERFYDPTAGKVMIDGKDIRRL  1080

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG + A+E E+IE ++AAN+H F+S LPEGY 
Sbjct  1081  NLKSLRLKIGLVQQEPALFAASIFENIAYGKDGATEEEVIEAARAANVHGFVSALPEGYK  1140

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1141  TAVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERLMR---  1197

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T I VAHRLST+   D I V+  G +VE GSHS L ++ DG YSRL+ LQ
Sbjct  1198  -GR------TTILVAHRLSTIRGVDSIAVVQDGRIVEQGSHSELVARADGAYSRLLQLQ  1249


 Score =   291 bits (746),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 195/544 (36%), Positives = 299/544 (55%), Gaps = 28/544 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  81    EVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQVGTLRRRYLEAVLKQDVGFFD-TDAR  139

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  I  WR+ L++ AV+P    
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAF  199

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +     +++    +A ++ A ++TV SF  E   +     A+Q  L  
Sbjct  200   AGGLYAYTLTGLTSKGRESYANAGIIAEQAIAQVRTVYSFVGESKALTSYSEAIQNTLKL  259

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  260   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  316

Query  743   LWTLIPTVLSAIGIL---KPVFQTLDRCTRIEPDKPEES-----LSESIEGEVEFKTIKF  898
                 +    S +G     K     L    R +P   ++S     L+E + G +EFK + F
Sbjct  317   ----LGQAFSNLGAFSKGKIAGYKLMEIIRQKPSITQDSSDGKCLAE-VHGNIEFKDVTF  371

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YPSRP+V++   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++
Sbjct  372   SYPSRPDVIIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIK  431

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
                L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FIS LP G
Sbjct  432   TLQLKWLREQIGLVNQEPALFATTILENILYGKPDATIAEVEAAASAANAHSFISLLPNG  491

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQH  1438
             YDT  GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L   
Sbjct  492   YDTQAGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM--  549

Query  1439  HKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVS  1615
                GR      T + VAHRLST+ N D+I V+ +G VVE G+H  L ++   G Y+ L+ 
Sbjct  550   --VGR------TTVVVAHRLSTIKNVDMIAVIQQGQVVETGTHEELLAKGSSGAYASLIR  601

Query  1616  LQSM  1627
              Q M
Sbjct  602   FQEM  605



>dbj|BAG96130.1| unnamed protein product [Oryza sativa Japonica Group]
Length=989

 Score =   435 bits (1118),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 238/536 (44%), Positives = 344/536 (64%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+N++ WF++ E
Sbjct  461   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEE  520

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  521   NNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPLL  580

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ V++     L+ PQ
Sbjct  581   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVPQ  640

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             +H  R+  I   +   + L L+  + A+ LWY   LV+ H S+F   I+ + +  +T  +
Sbjct  641   MHSLRRSQISGALFGLSQLSLYA-SEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  699

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++ VF  L+  TRI+PD+PE    ES+ G+++F+ + F YPSR
Sbjct  700   VAETVSLAPEIVRGGESIRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSR  759

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  N+R
Sbjct  760   PDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVR  819

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE +K AN+H F+S LPEGY T V
Sbjct  820   SLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPV  879

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +    GR
Sbjct  880   GERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK----GR  935

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  936   ------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELVSRPDGAYSRLLQLQ  985


 Score =   260 bits (665),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 153/349 (44%), Positives = 209/349 (60%), Gaps = 26/349 (7%)
 Frame = +2

Query  611   CLWNIAH---AVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV------PSITELWTLIPT  763
             C + IA    A+  WY  + ++  Q+    A  +  IFS  V       S + L      
Sbjct  9     CTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGLSLGQSFSNLGAFSKG  66

Query  764   VLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFN  943
              ++   +L+ + Q   R T ++       L E + G +EFK + F YPSRP+VM+   F+
Sbjct  67    KIAGYKLLEVIRQ---RPTIVQDPADGRCLDE-VHGNIEFKEVAFSYPSRPDVMIFRDFS  122

Query  944   LRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQ  1123
             L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++   L+ LR QIGLV 
Sbjct  123   LFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVN  182

Query  1124  QEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGG  1303
             QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP GY+T VGE+G QLSGG
Sbjct  183   QEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGG  242

Query  1304  QKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQIT  1483
             QKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR      T + 
Sbjct  243   QKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLM----VGR------TTVV  292

Query  1484  VAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
             VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q M
Sbjct  293   VAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQEM  341



>ref|XP_009347047.1| PREDICTED: ABC transporter B family member 19 [Pyrus x bretschneideri]
Length=1250

 Score =   440 bits (1131),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 245/540 (45%), Positives = 343/540 (64%), Gaps = 18/540 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++  +GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFMYVGVGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   LT+++  + + VK  +S+R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   HNSNLLTAKLATDAADVKSAVSERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  V+    ++ R+ L
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKVLSLFCHELRLPL  901

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FGI Q       + + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  902   LGSLRRSQTAGVLFGISQ----FALHASEALILWYGAHLVSKGVSTFSKVIKVFIVLVVT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE  + ES+ GE+E + + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPEAEVVESVRGEIELRHVDFAY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP++MV   F+LRI  G   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1018  PSRPDIMVFKDFSLRIRTGHSQALVGASGSGKSSVIALIERFYDPLVGKVMIDGKDIRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++ AN+H F+S LP+GY 
Sbjct  1078  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1138  TPVGERGVQLSGGQKQRIAIARAVLKDPRILLLDEATSALDAESECVLQEALERLMR---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG YSRL+ LQ+
Sbjct  1195  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEHGSHSELVSRPDGAYSRLLQLQN  1247


 Score =   300 bits (767),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 190/539 (35%), Positives = 298/539 (55%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   T+  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVAKYALYFVYLGLIVCVTSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   I  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIVF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRQSYANAGIVADQAIAQVRTVYSYVGESKALNSYSDAIQNTLQL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  I+ 
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVYWYAGVFIRNGQTDGGKAFTA--IFSAIVGGISL  316

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P    D  E      + G +EFK + F YPS
Sbjct  317   GQSF--SNLGAFSKGKSAGYKLMEIIKQKPTIVQDPLEGKCLSDVSGNIEFKEVTFSYPS  374

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VLID  D++   L
Sbjct  375   RPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIKTLQL  434

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+  ++   + +AN H+FI+ LP+GY+T 
Sbjct  435   KWLRDQIGLVNQEPALFATTILENILYGKPDATMEDVEVAASSANAHSFITLLPKGYNTQ  494

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      G
Sbjct  495   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----VG  550

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  551   R------TTVIVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQEM  602



>gb|EYU34087.1| hypothetical protein MIMGU_mgv1a000781mg [Erythranthe guttata]
Length=988

 Score =   434 bits (1115),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 245/543 (45%), Positives = 345/543 (64%), Gaps = 19/543 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             +D +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + +A L+NE+ WF+
Sbjct  456   ADMERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFD  515

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  
Sbjct  516   EEENNSSLLANRLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATF  575

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E ++    N+ R
Sbjct  576   PLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFSAQEKILSLFSNELR  635

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  +  L RS+   + FG+ Q   L L+  + A+ LWY + LV +  S+F   I+ + + 
Sbjct  636   LPQKQSLRRSQCSGLLFGLSQ---LALYA-SEALILWYGSHLVSKGVSTFSKVIKVFVVL  691

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     +  VF  LDR TRI+PD  E    ESI GE+E + + 
Sbjct  692   VITANSVAETVSLAPEIIRGGEAVGSVFSILDRPTRIDPDDTEAETVESIRGEIELRHVD  751

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+VMV   F+LRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV++DGKD+
Sbjct  752   FAYPSRPDVMVFKDFSLRIRAGHSQALVGASGSGKSSVIALIERFYDPLSGKVMVDGKDI  811

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSE-RASEAEIIEVSKAANIHTFISNLP  1252
             R  NL+ LR +IGLVQQEP LF  SI ENI YG +  A+EAE+IE ++AAN+HTF+S LP
Sbjct  812   RRLNLKSLRRRIGLVQQEPALFAASIFENIAYGKDGAATEAEVIEAARAANVHTFVSGLP  871

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
             EGY T VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L 
Sbjct  872   EGYKTPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLM  931

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLV  1612
             +    GR      T + VAHRLST+     I V+  G +VE GSH+ L  +P+  YS+L+
Sbjct  932   R----GR------TTVLVAHRLSTIRGVHSIGVVQDGRIVEQGSHNELIGRPESAYSKLL  981

Query  1613  SLQ  1621
              LQ
Sbjct  982   QLQ  984


 Score =   248 bits (634),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 212/348 (61%), Gaps = 26/348 (7%)
 Frame = +2

Query  611   CLWNIAH---AVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV------PSITELWTLIPT  763
             C + IA    A+  WY  + ++  Q+    A  +  IFS  V       S + L      
Sbjct  9     CTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSLGQSFSNLGAFSKG  66

Query  764   VLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFN  943
               +   +++ + Q   + T ++ D   + L+E + G +EFK + F YPSRP+V++   F+
Sbjct  67    KAAGFKLMEIIKQ---KPTIVQDDLDSKCLTE-VNGNIEFKNVTFSYPSRPDVIIFRDFS  122

Query  944   LRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQ  1123
             +   AG  VA+VG SG+GKS+V++L+ RFYD ++G++L+D  D++   LR LR+Q+GLV 
Sbjct  123   IFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGEILLDNVDIKTLQLRWLRSQMGLVN  182

Query  1124  QEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGG  1303
             QEP LF  +I ENI YG   A+ +E+   S AAN H+FI+ LP GY+T VGE+G QLSGG
Sbjct  183   QEPALFATTILENILYGKPDATMSEVEAASSAANAHSFITLLPNGYNTQVGERGVQLSGG  242

Query  1304  QKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQIT  1483
             QKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR      T + 
Sbjct  243   QKQRIAIARAMLKDPKILLLDEATSALDAGSESIVQEALDRLM----IGR------TTVV  292

Query  1484  VAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             VAHRLST+ N D I V+ +G VVE G+H  L ++    Y+ L+  Q M
Sbjct  293   VAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-AAYANLIRFQEM  339



>ref|XP_011098607.1| PREDICTED: ABC transporter B family member 19 [Sesamum indicum]
Length=1250

 Score =   439 bits (1129),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 246/539 (46%), Positives = 343/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ RV  
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELRVPQ  901

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+     FG+ Q   L L+  + A  LWY   LV +  S+F   I+ + +  +T
Sbjct  902   RRSLCRSQCSGFLFGLSQ---LALYA-SEAFILWYGAHLVSKGASTFSKVIKVFVVLVIT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD+PE    ESI GE+E + + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSILDRPTRIDPDEPEAEPVESIRGEIELRHVDFAY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   F+LRI AG   ALVG SG+GKSSVI L+ RFYD   GKV+IDGKD+R  
Sbjct  1018  PSRPDVMVFKDFSLRIRAGQSQALVGASGSGKSSVIVLIERFYDPIAGKVMIDGKDIRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG + A+EAE+IE ++AAN+HTF+S LPEGY 
Sbjct  1078  NLKSLRLKIGLVQQEPALFAASIFDNIAYGKDGATEAEVIEAARAANVHTFVSGLPEGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1138  TTVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMR---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + +AHRLST+   + I V+  G +VE GSH  L S+P+G YSRL+ LQ
Sbjct  1195  -GR------TTVLIAHRLSTIRGVNSIGVVQDGRIVEQGSHGELISRPEGAYSRLLQLQ  1246


 Score =   286 bits (732),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 194/544 (36%), Positives = 304/544 (56%), Gaps = 29/544 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  79    EVAKYALYFVYLGLVVCFSSYAEIACWMYTGERQVGALRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A +S A ++TV S+  E    +KA  A    +  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQSIAQVRTVYSYVGE----SKALSAYSDLIQN  253

Query  563   SRKESIKFGIIQGTSL-CLWNIAH---AVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP  730
             + K   K G+ +G  L C + IA    A+  WY  + ++  Q+    A  +  IFS  V 
Sbjct  254   TLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVG  311

Query  731   SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSES-----IEGEVEFKTIK  895
              ++   +   + L A    K     L    + +P   +++ S++     + G +EFK + 
Sbjct  312   GMSLGQSF--SNLGAFSKGKAAGYKLMEIIKQKPTIVQDASSDAKCLADVHGNIEFKNVT  369

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G++L+D  D+
Sbjct  370   FSYPSRPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGEILLDNVDI  429

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP 
Sbjct  430   KTLQLRWLRNQIGLVNQEPALFATTILENILYGKPDATMAEVEAAASAANAHSFITLLPI  489

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L  
Sbjct  490   GYNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM-  548

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+ 
Sbjct  549   ---VGR------TTVVVAHRLSTIRNVDCIAVIQQGQVVETGTHEELIAKA-GAYASLIR  598

Query  1616  LQSM  1627
              Q M
Sbjct  599   FQEM  602



>ref|XP_010693227.1| PREDICTED: ABC transporter B family member 19 [Beta vulgaris 
subsp. vulgaris]
Length=1250

 Score =   438 bits (1126),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 341/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + +A ++NE+ WF+  E
Sbjct  722   EKKTKEYVFIYIGAGIYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAIMRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  782   HNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E ++    ++ RV  
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKILSLFCHELRVPQ  901

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +    RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  902   KRSFRRSQTSGSLFGLSQ---LALYG-SEALILWYGAHLVSKGLSTFSKVIKVFVVLVIT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDRCTRI+PD  E    ESI G++EF+ + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSILDRCTRIDPDDSEAEPVESIRGDIEFRHVDFSY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RP+V+V   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1018  PTRPDVLVFQDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPSAGKVMIDGKDIRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE+IE ++AAN+H F+S LPEGY 
Sbjct  1078  NLKSLRLKIGLVQQEPALFASSIFDNIVYGKEGATEAEVIEAARAANVHGFVSALPEGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1138  TTVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMR---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+     I V+  G +VE GSHS L S+P+G YSRL  LQ
Sbjct  1195  -GR------TTVLVAHRLSTIRGVSSIGVVQDGRIVEQGSHSELISRPEGAYSRLSQLQ  1246


 Score =   287 bits (734),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 189/537 (35%), Positives = 296/537 (55%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+    LR     A L+ ++ +F+  +  
Sbjct  80    EVSKYALYFVYLGLIVCVSSYAEIACWMYSGERQAGALREKYLEAVLRQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRQSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSDAIQNTLKL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V   S+
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMSL  316

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + + +   I  D  +    E I G +EFK + F YPSRP
Sbjct  317   GQSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDLCDGKCLEEISGNIEFKNVSFSYPSRP  376

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D+R   L  
Sbjct  377   DVMIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNNDIRTLQLTW  436

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP GY+T VG
Sbjct  437   LRGQIGLVNQEPALFATTILENILYGKSDATMAEVEAAASSANAHSFIALLPNGYNTHVG  496

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      GR 
Sbjct  497   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----VGR-  551

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  552   -----TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHEELITKA-GAYASLIRFQEM  602



>ref|XP_008784383.1| PREDICTED: ABC transporter B family member 19 [Phoenix dactylifera]
Length=1253

 Score =   438 bits (1126),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 240/539 (45%), Positives = 344/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  725   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEDE  784

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V  IV+WR+ L+  A  P  
Sbjct  785   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVGFIVEWRVALLILATFPLL  844

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ RV  
Sbjct  845   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELRVPQ  904

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+   + FG+ Q   L L++ + A+ LWY   LV+   S+F   I+ + +  +T
Sbjct  905   RRSLRRSQTSGLLFGLSQ---LSLYS-SEALVLWYGAHLVRSGASTFSKVIKVFVVLVIT  960

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ +F  L+R TRI+PD PE    +SI GE+E + + F Y
Sbjct  961   ANSVAETVSLAPEIIRGGESIRSIFSILNRGTRIDPDDPEAEPIDSIRGEIELRHVDFAY  1020

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V +   FNLRI +G   ALVG SG+GKS+VI L+ RFYD   GKV++DGKD+R  
Sbjct  1021  PSRPDVPIFKDFNLRIRSGQSQALVGASGSGKSTVIGLIERFYDPTAGKVMVDGKDIRRL  1080

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG +RA+E E+IE ++AAN+H F+S LPEGY 
Sbjct  1081  NLKSLRLKIGLVQQEPVLFAASIFENIAYGKDRATEEEVIEAARAANVHGFVSVLPEGYK  1140

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1141  TAVGERGVQLSGGQKQRIAIARAVLKNPAVLLLDEATSALDAESECVLQEALERLMR---  1197

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L ++ DG YSRL+ LQ
Sbjct  1198  -GR------TTVLVAHRLSTIRGVDSIAVVQDGRIVEQGSHTELVTRADGAYSRLLQLQ  1249


 Score =   288 bits (738),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 192/542 (35%), Positives = 298/542 (55%), Gaps = 24/542 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +   R     A L+ ++ +F+  +  
Sbjct  81    EVSKYALYFIYLGLVVCVSSYAEIACWMYTGERQVGTFRRRYLEAVLKQDVGFFD-TDAR  139

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  I  WR+ L++ AV+P    
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAF  199

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +     +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  200   AGGLYAYTLTGLTSKGRESYANAGIIAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  259

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  260   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  317

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               + + L       ++   +++ + Q   R + I+     + L E + G +EFK + F Y
Sbjct  318   GQAFSNLGAFSKGKIAGYKLMEIIRQ---RPSIIQDPSDGKCLPE-VHGNIEFKDVTFSY  373

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V++   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++  
Sbjct  374   PSRPDVIIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTL  433

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FIS LP GY+
Sbjct  434   QLKWLRDQIGLVNQEPALFATTILENILYGKPDATIAEVEAAASAANAHSFISLLPNGYN  493

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T  GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD GSE  V  AL+ L     
Sbjct  494   TQAGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDLGSESIVQEALDRLM----  549

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ N D+I VM +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  550   VGR------TTVVVAHRLSTIKNVDMIAVMQQGQVVETGTHEELLAKGSSGAYASLIRFQ  603

Query  1622  SM  1627
              M
Sbjct  604   EM  605



>gb|KFK44669.1| hypothetical protein AALP_AA1G288400 [Arabis alpina]
Length=1247

 Score =   437 bits (1124),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 237/543 (44%), Positives = 343/543 (63%), Gaps = 18/543 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             KR V   +++F   G+L+     LQHY Y ++GE+  + +R SL+SA L NE+ WF+  E
Sbjct  719   KRDVEKVAIVFVGAGILTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDE  778

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  ++DR+S IVQ +S  V A  ++    WR+  V  A  P  
Sbjct  779   NNTGSLTSILAADATLVRSALADRLSTIVQNLSLTVTALVLAFYYSWRVAAVVTACFPLL  838

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNK-ARVALQPQ  553
                 L +    KGF GD T A+S+  S+A E+  NI+TV +F  E+ ++ +  R   +P 
Sbjct  839   IAASLTEQLFLKGFGGDYTKAYSKATSVAREAIGNIRTVAAFGAEKQIMEQFTRELSKPT  898

Query  554   LH---RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              +   R       +G+ Q  + C    ++A+ LWY ++L+++ +++F ++I+S+ +  +T
Sbjct  899   KNAFLRGHISGFGYGLSQFLAFC----SYALGLWYVSVLIKQKETNFSDSIKSFMVLIVT  954

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S++E   L P ++     L+ VF+ L R T I PD+   SL   IEG++EF+ + F Y
Sbjct  955   AFSVSETLALTPDIVKGTQALQSVFRVLHRETEIPPDQANSSLVTQIEGDIEFRNVSFTY  1014

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RP++ +    NLR+ AG  +A+VGPSG+GKS+VI L++RFYD D GK+ IDG+D++  
Sbjct  1015  PARPDIAIFQNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPDSGKLCIDGQDIKTL  1074

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR ++ LVQQEP LF  +I ENI YG+E ASE EIIE +KAAN H FIS + +GY 
Sbjct  1075  NLRSLRKKLALVQQEPALFSTTIHENIKYGNENASETEIIEAAKAANAHEFISRMEDGYK  1134

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG+KG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ +E+ V  AL+ L     
Sbjct  1135  THVGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSAEKLVQEALDKLMN---  1191

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+  +D I V+ KG VVE GSH  L S PDG Y ++ SLQ 
Sbjct  1192  -GR------TTVLVAHRLSTIRKADTIAVLHKGRVVEKGSHRELVSIPDGFYKQMTSLQE  1244

Query  1625  MKD  1633
               D
Sbjct  1245  GVD  1247


 Score =   266 bits (681),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 183/540 (34%), Positives = 290/540 (54%), Gaps = 38/540 (7%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR +   + L  ++ +F+  E   
Sbjct  100   LGLANLVSAWIGVACWMQ----------TGERQTAQLRINYLKSILAKDITFFD-TEARD  148

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +L   I ++   V+  I D+   +++ +S  V    +  +  W++ L+  AV+P   I 
Sbjct  149   SNLIFHISSDAILVQDAIGDKTDHVLRYLSQFVAGFVIGFLSVWQLTLLTLAVVPLIAIA  208

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  + AA+++   +A E  + ++TV +F  EE  V     +L+  L   
Sbjct  209   GGGYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVESYSNSLKKALKLG  268

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFSLT  724
             ++  +  G+  G +  L   A ++ LWY +LLV+  ++       + LN I S       
Sbjct  269   KRSGLAKGLGVGLTYSLLFCAWSLLLWYASLLVRHGKTNGAKAFTTILNVIYSGFALGQA  328

Query  725   VPSITELWTLIPTVLSAIGILKPVFQT-LDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
              PS++    +    ++A  I++ +    L+   R++      +   ++ G +EF  + F 
Sbjct  329   APSLS---AITKGRVAAANIIRMIGNNNLESSERLD----NGTTLRNVAGRIEFHRVSFA  381

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP  MV    +  I +G   A VGPSG+GKS++I+++ RFY+ + G++ +DG D++ 
Sbjct  382   YPSRPN-MVFEDLSFTIRSGKTYAFVGPSGSGKSTIISMVQRFYEPNSGEIFLDGFDIKR  440

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR Q+GLV QEP LF  +I  NI  G   A   +IIE +K+AN  +FI +LP GY
Sbjct  441   LKLKWLREQMGLVSQEPALFATTIASNILLGKANADMDQIIEAAKSANADSFIKSLPNGY  500

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+++    
Sbjct  501   NTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDNI----  556

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                     K T I +AHRLST+ N   I+V+  G V+E GSHS L S+  G Y+ LV+ Q
Sbjct  557   ------IGKRTTIVIAHRLSTIRNVHKIIVLKNGQVIETGSHSELISR-GGDYANLVNCQ  609



>gb|AFW58472.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=822

 Score =   426 bits (1096),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 233/539 (43%), Positives = 341/539 (63%), Gaps = 12/539 (2%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S  + K   Y  I+   GL +     +QHY + ++GE   T +R  + +  L+N++ WF+
Sbjct  291   SKMESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFD  350

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
             + ENN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ L+     
Sbjct  351   QEENNSNLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILVTF  410

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ  547
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++     L+
Sbjct  411   PLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELR  470

Query  548   -PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              PQ+H  R+  I   +   + L L+  + A+ LW+   LV+ H S+F   I+ + +  +T
Sbjct  471   VPQMHSLRRSQISGALFGLSQLSLYA-SEALILWFGAHLVRTHVSTFSKVIKVFVVLVIT  529

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ VF  L+  TRI+PD P+    ES+ GE++F+ + F Y
Sbjct  530   ANSVAETVSLAPEIVRGGESIRSVFSVLNSRTRIDPDDPDAEQVESVRGEIDFRHVDFAY  589

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RP+VMV    +LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  
Sbjct  590   PTRPDVMVFKDLSLRIRAGQSQALVGASGSGKSTVIALVERFYDPLAGKVMIDGKDIRRL  649

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E++E +K AN+H F+S LP+GY 
Sbjct  650   NLKSLRLRIGLVQQEPVLFATSILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYR  709

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +   
Sbjct  710   TPVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK---  766

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  767   -GR------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQ  818


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 80/120 (67%), Gaps = 11/120 (9%)
 Frame = +2

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG++G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+GSE  V  AL+ L     
Sbjct  65    TQVGDRGLQLSGGQKQRIAIARAMLKNPKLLLLDEATSALDAGSESIVQEALDRLM----  120

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  121   VGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  174



>ref|XP_010256924.1| PREDICTED: ABC transporter B family member 19 [Nelumbo nucifera]
Length=1249

 Score =   436 bits (1122),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 242/539 (45%), Positives = 341/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   +  I+   GL +      QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEFVFIYIGAGLYAVVAYLTQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ I++WR+ L+  A  P  
Sbjct  781   NNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  901   RRSLRRSQSAGSMFGVSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR T+I+PD+P+    ES+ GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVSSVFSILDRTTKIDPDEPDAETVESVRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPEVMV    NLRI AG   ALVG SG+GKSSVI L+ RFYD   GKVLIDGKD+R  
Sbjct  1017  PTRPEVMVFKDLNLRIRAGQSQALVGASGSGKSSVIVLIERFYDPSAGKVLIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             N++ LR +IGLVQQEP LF  SI +NI YG + A+EAE+IE ++AAN+H F+S LP+GY 
Sbjct  1077  NMKSLRLKIGLVQQEPALFAASIFDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKNPAILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+ DG YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIQGVDNIAVVQDGRIVEQGSHSELVSRADGAYSRLLQLQ  1245


 Score =   290 bits (741),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 195/547 (36%), Positives = 303/547 (55%), Gaps = 23/547 (4%)
 Frame = +2

Query  8     SDAKR---KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELA  178
             SD K+   +V  Y++ F  +GL+   ++  +   +   GE+ + +LR     A L+ ++ 
Sbjct  71    SDLKKMTEEVAKYALYFVYLGLVVCLSSYAEIACWMYSGERQVISLRKKYLEAVLKQDVG  130

Query  179   WFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAW  358
             +F+  +   G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ 
Sbjct  131   FFD-TDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFLSAWRLALLSV  189

Query  359   AVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARV  538
             AV+P     G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    
Sbjct  190   AVIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSD  249

Query  539   ALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFS  718
             A+Q  L    K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS
Sbjct  250   AIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFS  307

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFK  886
               V  ++   +   + L A    K     L    R +P    D  +      + G +EFK
Sbjct  308   AIVGGMSLGQSF--SNLGAFSKGKTAGYKLMEIIRQKPSIIQDPSDGKCLTEVNGNIEFK  365

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D 
Sbjct  366   DVTFSYPSRPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDN  425

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
              D+R   L+ LR QIGLV QEP LF  +I ENI YG   AS AE+   + AAN H+FI+ 
Sbjct  426   VDIRTLQLKWLRDQIGLVNQEPALFATTILENILYGKPDASIAEVEAAAAAANAHSFITL  485

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LP GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ 
Sbjct  486   LPNGYNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDR  545

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L      GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ 
Sbjct  546   LM----VGR------TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHDELIAKA-GSYAS  594

Query  1607  LVSLQSM  1627
             L+  Q M
Sbjct  595   LIRFQEM  601



>emb|CDP02220.1| unnamed protein product [Coffea canephora]
Length=1250

 Score =   435 bits (1119),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 246/536 (46%), Positives = 340/536 (63%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   HNSNLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++     L+ PQ
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVPQ  901

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             L RS K S   G++ G S      + A+ LWY + LV +  S+F   I+ + +  +T  S
Sbjct  902   L-RSLKRSQISGLLFGLSQLALFASEALILWYGSHLVGKGVSTFSKVIKVFVVLVITANS  960

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     +  VF  LDR TRI+PD P+    ESI GE+E + + F YPSR
Sbjct  961   VAETVSLAPEIIRGGEAVGSVFMILDRSTRIDPDDPDAEPVESIRGEIELRHVDFAYPSR  1020

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+V V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD++  NL+
Sbjct  1021  PDVNVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTFGKVMIDGKDIKRLNLK  1080

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP LF  SI +NI YG + A+E+E+IE ++AAN+H F+S LPEGY T V
Sbjct  1081  SLRLKIGLVQQEPALFAASIFDNIAYGKDGATESEVIEAARAANMHAFVSGLPEGYKTPV  1140

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +    GR
Sbjct  1141  GERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR----GR  1196

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G +VE GSH  L S+PDG YSRL+ LQ
Sbjct  1197  ------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHGELISRPDGAYSRLLQLQ  1246


 Score =   291 bits (746),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 187/537 (35%), Positives = 298/537 (55%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+    LR     A L+ ++ +F+  +  
Sbjct  80    EVAKYALYFIYLGLIVCFSSYAEIACWMHSGERQAGALRRKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  316

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + + +   I  D  +      + G +EFK + F YPSRP
Sbjct  317   GQSFSNLGAFSKGKAAGYKLMEIMKQKPTILQDPSDGKCLAEVNGNIEFKNVTFSYPSRP  376

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G++L+D  D++   LR 
Sbjct  377   DVMIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQILLDNVDIKTLQLRW  436

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+F++ LP GY+T VG
Sbjct  437   LRDQIGLVNQEPALFATTILENILYGKPEATMAEVEAAATAANAHSFVTLLPNGYNTQVG  496

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  497   ERGIQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  551

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  552   -----TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELVAKA-GAYASLIRFQEM  602



>ref|XP_004489384.1| PREDICTED: ABC transporter B family member 19-like [Cicer arietinum]
Length=1250

 Score =   435 bits (1118),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 248/545 (46%), Positives = 339/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFIYIGAGIYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE     
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSIFCHE-----  896

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
               RV     L RS    + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ +
Sbjct  897   -LRVPQSLSLRRSLTSGLLFGLSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVF  951

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+    ES+ GE+E +
Sbjct  952   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDAEQVESVRGEIELR  1011

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+VMV   F+LRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDG
Sbjct  1012  HVDFAYPSRPDVMVFKDFSLRIRAGQSQALVGASGSGKSSVIALIERFYDPIVGKVMIDG  1071

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE +++AN+H F+S 
Sbjct  1072  KDIRKLNLKSLRLKIGLVQQEPALFAASILENIAYGKEGATEAEVIEAARSANVHAFVSG  1131

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LPEGY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE 
Sbjct  1132  LPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALER  1191

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSR
Sbjct  1192  LMR----GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELISRPEGAYSR  1241

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1242  LLQLQ  1246


 Score =   303 bits (776),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 191/539 (35%), Positives = 299/539 (55%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  316

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    R +P   E+ L       + G +EFK + F YPS
Sbjct  317   GQSF--SNLGAFSKGKAAGYKLMEIIRQKPTIVEDLLDGKTLAEVNGNIEFKDVTFSYPS  374

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD +EG+VL+D  D++   L
Sbjct  375   RPDVIIFRKFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQL  434

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+T 
Sbjct  435   KWLRDQIGLVNQEPALFATTILENILYGKPDATIDEVEAATSAANAHSFITLLPNGYNTQ  494

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  495   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----IG  550

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  551   R------TTVVVAHRLSTIRNVDTIAVIQQGLVVETGTHEELFAK-GGTYASLIRFQEM  602



>ref|XP_010439807.1| PREDICTED: ABC transporter B family member 14-like isoform X3 
[Camelina sativa]
Length=1157

 Score =   433 bits (1113),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 242/541 (45%), Positives = 340/541 (63%), Gaps = 18/541 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             KR+V    VIF   G+++     LQHY Y ++GE+  + +R SL+SA L NE+ WF+  E
Sbjct  630   KRQVEKVIVIFVGAGVITTPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLEE  689

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  I+DR+S IVQ IS  V +  ++    WR+  V  A  P  
Sbjct  690   NNTGSLTSILSADATLVRSAIADRLSTIVQNISLTVTSLGLAFFYCWRVAAVVTACFPLI  749

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
                 L +    KGF GD T A+S   SLA E+  NI+TV +F  E+ +  +       +L
Sbjct  750   ITASLTEQLFLKGFGGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQ----FTSEL  805

Query  557   HRSRKESIKFGIIQG----TSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              +  K ++  G I G     S CL   ++A+ LWY ++L+QR +++F ++I+S+ +  +T
Sbjct  806   TKPTKNALLKGHISGFGYGLSQCLAYCSYALGLWYISVLIQRKETNFEDSIKSFMVLLVT  865

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E   L P ++     L  VF+ L R + I PD+P   L   +EG++EF+ + F Y
Sbjct  866   AYSVGETLALTPDIVKGTQALGSVFRVLHRESEIPPDQPNSRLVTQVEGDIEFRAVSFAY  925

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPE+ +    NL I AG  +A+VG SG+GKS+VI L++RFYD   GK+ IDG+D++  
Sbjct  926   PTRPEITIFQNLNLWISAGKSLAVVGTSGSGKSTVIGLIMRFYDTTNGKLFIDGQDIKTI  985

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR ++ LVQQEP LF  +I ENI YG+E ASEAEI+E +KAAN H FI  + EGY 
Sbjct  986   NLRSLRNKLALVQQEPALFSTTIYENIKYGNENASEAEIMEAAKAANAHEFIIMMEEGYK  1045

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG++G QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +   
Sbjct  1046  THVGDRGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDRLMK---  1102

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+  +D+I V+ KG VVE GSH  L S+ DGVY +L SLQ 
Sbjct  1103  -GR------TTVLVAHRLSTIRKADMIAVLHKGGVVEKGSHRELVSKSDGVYKQLTSLQE  1155

Query  1625  M  1627
             M
Sbjct  1156  M  1156


 Score =   278 bits (711),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 191/542 (35%), Positives = 295/542 (54%), Gaps = 41/542 (8%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR S   + L  ++ +F+  E   
Sbjct  10    LGLVNLVSAWIGVACWMQT----------GERQTRRLRISYLKSILAKDITFFD-TETRD  58

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP--CHF  379
              +    I ++   V+  I D+   +++ +   +    +  +  W++ L+   V+P     
Sbjct  59    SNFIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVA  118

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
             +GG     S    S  + AA+++   +A E  + ++TV +F  EE  V     +L+    
Sbjct  119   VGGYAIVMST--ISEKSEAAYADAGKIAEEVMSQVRTVYAFVGEEKAVKSYSKSLKEAFK  176

Query  560   RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFS  718
              S++  I  G+  G +  L   A A+  WY ++LV+  ++       + LN I S     
Sbjct  177   ISKRSGIAKGLGIGLTFSLLFCAWALLFWYASILVRHGKTNGAKAFTTILNVIYSGFALG  236

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQT-LDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
               VPS++    ++   ++A  I K +    L+   R+  D    SL E++ G +EF  + 
Sbjct  237   QAVPSLS---AILKGRVAAANIFKMIGNNNLESSERL--DDNGTSL-ENVAGRIEFHQVS  290

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSR   MV    ++ I +G   A VGPSG+GKS++I+L+ RFY+ + G++L+DG D+
Sbjct  291   FAYPSRTS-MVFENLSVTIHSGKTFAFVGPSGSGKSTIISLMQRFYEPNSGEILLDGNDI  349

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   L+ LR Q+GLV QEP LF  +I  NI  G E AS  +IIE +KAAN  +FI +LP 
Sbjct  350   KSLKLKWLREQMGLVSQEPALFATTIASNILLGKENASMVQIIEAAKAANADSFIKSLPN  409

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+++ +
Sbjct  410   GYNTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDTVME  469

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                       K T I +AHRLST+ N D IVV+  G ++E GSHS L S+  G Y+ LV+
Sbjct  470   ----------KRTTIVIAHRLSTIRNVDKIVVLRNGQIMETGSHSELISR-GGDYATLVN  518

Query  1616  LQ  1621
              Q
Sbjct  519   CQ  520



>gb|EEC77398.1| hypothetical protein OsI_16157 [Oryza sativa Indica Group]
Length=1248

 Score =   434 bits (1117),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 238/536 (44%), Positives = 344/536 (64%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+N++ WF++ E
Sbjct  720   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEE  779

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  780   NNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPLL  839

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ V++     L+ PQ
Sbjct  840   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVPQ  899

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             +H  R+  I   +   + L L+  + A+ LWY   LV+ H S+F   I+ + +  +T  +
Sbjct  900   MHSLRRSQISGALFGLSQLSLYA-SEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  958

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++ VF  L+  TRI+PD+PE    ES+ G+++F+ + F YPSR
Sbjct  959   VAETVSLAPEIVRGGESIRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSR  1018

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  N+R
Sbjct  1019  PDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVR  1078

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE +K AN+H F+S LPEGY T V
Sbjct  1079  SLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPV  1138

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +    GR
Sbjct  1139  GERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK----GR  1194

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1195  ------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELVSRPDGAYSRLLQLQ  1244


 Score =   286 bits (731),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 184/518 (36%), Positives = 284/518 (55%), Gaps = 30/518 (6%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+ +  LR     A L+ ++ +F+  +   G +   +  +T  V+  I +++   +  +
Sbjct  100   GERQVGALRRRYLEAVLRQDVGFFD-TDARTGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  158

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             S+ +    V  +  WR+ L++ AV+P     G + A +  G +  +  +++    +A ++
Sbjct  159   STFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRDSYANAGIIAEQA  218

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              A ++TV S+  E   +N    A+Q  L    K  +  G+  G +  +  ++ A+  WY 
Sbjct  219   IAQVRTVYSYVGESKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWYA  278

Query  653   TLLVQRHQSSFLNAIRSYQIFSLTV------PSITELWTLIPTVLSAIGILKPVFQTLDR  814
              + ++  Q+    A  +  IFS  V       S + L       ++   +L+ + Q   R
Sbjct  279   GVFIRNGQTDGGKAFTA--IFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQ---R  333

Query  815   CTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
              T ++       L E + G +EFK + F YPSRP+VM+   F+L   AG   A+VG SG+
Sbjct  334   PTIVQDPADGRCLDE-VHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGS  392

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS+V+AL+ RFYD ++G+VL+D  D++   L+ LR QIGLV QEP LF  +I ENI YG
Sbjct  393   GKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYG  452

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGY------DTVVGEKGSQLSGGQKQRIAIARAL  1336
                A+ AE+   + +AN H+FI+ LP GY        +VGE+G QLSGGQKQRIAIARA+
Sbjct  453   KPDATMAEVEAAATSANAHSFIALLPNGYTLRWVLGLLVGERGLQLSGGQKQRIAIARAM  512

Query  1337  LKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNS  1516
             LK P I+LLDEATSALD+GSE  V  AL+ L      GR      T + VAHRLST+   
Sbjct  513   LKNPKILLLDEATSALDAGSENIVQEALDRLM----VGR------TTVVVAHRLSTIRCV  562

Query  1517  DIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
             D+I V+ +G VVE G+H  L ++   G Y+ L+  Q M
Sbjct  563   DMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQEM  600



>ref|XP_008804466.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Phoenix dactylifera]
Length=946

 Score =   427 bits (1099),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 237/539 (44%), Positives = 339/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++   GL +  +  +QHY + ++GE   T +R  + +A L+NEL WF+  E
Sbjct  418   ERKTRQYVFMYVGTGLYAVVSYLVQHYFFSIMGENLTTRVRRMMLAAILRNELGWFDEEE  477

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + + +  + + VK +I++R+SVI+Q ++S++ +  V  IV+WR+ L+  A  P  
Sbjct  478   NNSSLVAAHLATDAADVKSVIAERISVILQNMTSLLTSFIVGFIVEWRVALLIIATFPLL  537

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GD   AH+    +A E  +NI+TV +F  ++ ++    ++  V  
Sbjct  538   VLANFAQQLSLKGFAGDMAKAHARTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELEVPQ  597

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             Q  L RS+   + FG+ Q   L L++ + A+ LWY   LV    S+F   I+ + I  +T
Sbjct  598   QCSLRRSQTSGLLFGLSQ---LSLYS-SEALILWYGAHLVHSGASTFSKVIKVFVILVIT  653

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ VF  L+R TRI+PD PE     SI GE+E + + F Y
Sbjct  654   ANSVAETVSLAPEIIRGGESIRSVFSILNRLTRIDPDDPEAKPVGSIRGEIELRHVDFAY  713

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP++ V   FNLRI AG+  ALVG SG GKS+VIAL+ RFYD   GKV+IDG+D+R  
Sbjct  714   PSRPDIPVFEDFNLRIHAGLSQALVGASGCGKSTVIALIERFYDPTAGKVMIDGEDIRGL  773

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E++E ++AAN+H F+S LP+GY 
Sbjct  774   NLKSLRLKIGLVQQEPVLFAASIFENIAYGKDGATEDEVLEAARAANVHGFVSALPKGYK  833

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE L +   
Sbjct  834   TPVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALEQLMR---  890

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L ++ DG Y RL+ LQ
Sbjct  891   -GR------TTVLVAHRLSTIRGVDSIAVVQDGHIVEQGSHAELVARADGAYVRLLQLQ  942


 Score =   241 bits (616),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 172/256 (67%), Gaps = 11/256 (4%)
 Frame = +2

Query  863   IEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVD  1042
             + G +EFK + F YPSRP+V++   F+L   AG   A+VG SG+GKS+V+ L+ RFYD +
Sbjct  53    VHGNLEFKDVTFSYPSRPDVIIFRDFSLSFPAGKTTAVVGGSGSGKSTVVVLIERFYDPN  112

Query  1043  EGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAA  1222
             +G++L+D  D++   L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AA
Sbjct  113   QGQILLDNVDIKTLQLKWLREQIGLVSQEPALFATTILENILYGKPGATIAEVEAAASAA  172

Query  1223  NIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSER  1402
             N H FIS LP GY+T  GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE 
Sbjct  173   NAHNFISLLPNGYNTQAGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSES  232

Query  1403  AVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTS  1582
              V  AL+ L      GR      T + VAHRLST+ N D+I V+ +G +VE G+H  L +
Sbjct  233   IVQEALDRLM----VGR------TTVVVAHRLSTIRNVDMIAVIQQGQIVETGTHEELLA  282

Query  1583  Q-PDGVYSRLVSLQSM  1627
             +   G Y+ L+  Q M
Sbjct  283   KGTSGAYASLIRFQEM  298



>tpg|DAA35747.1| TPA: hypothetical protein ZEAMMB73_634725 [Zea mays]
Length=989

 Score =   429 bits (1102),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 239/542 (44%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  458   NEIEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  517

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ ++  A  
Sbjct  518   EEENNSSLVAARLGVDAADVKSAIAERISVILQNMTSLMTSFVVGFIIEWRVAILILATF  577

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH+    +A E+ +NI+TV +F  +  ++    ++ R
Sbjct  578   PLLVLANFAQQLSMKGFAGDTAKAHARSSMVAGEAVSNIRTVAAFNAQSKILSLFSHELR  637

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             V  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  638   VPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  693

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     +I G++E + + 
Sbjct  694   VVTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVD  753

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS+VIAL+ RFYD   GKV IDGKD+
Sbjct  754   FSYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTVIALIERFYDPCGGKVAIDGKDI  813

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG E ASE E++E +K AN+H F+S LP+
Sbjct  814   RTLNLKSLRLKIGLVQQEPVLFASSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPD  873

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  874   GYRTAVGEQGMQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  933

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G VVE GSHS L ++P+G Y RL+ 
Sbjct  934   ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRVVEHGSHSDLLARPEGAYLRLLQ  983

Query  1616  LQ  1621
             LQ
Sbjct  984   LQ  985


 Score =   258 bits (658),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 206/348 (59%), Gaps = 28/348 (8%)
 Frame = +2

Query  611   CLWNIAH---AVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIG  781
             C + IA    A+  WY  + ++  Q+    A  +  IFS  V  ++     +    S +G
Sbjct  9     CTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-----LGQAFSNLG  61

Query  782   ILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGF  940
                        + + + +   I  D  +      + G +EFK + F YPSRP+V++   F
Sbjct  62    AFSKGKIAGYKLLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVIIFRDF  121

Query  941   NLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLV  1120
             +L   AG  VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++   LR LR QIGLV
Sbjct  122   SLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLREQIGLV  181

Query  1121  QQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSG  1300
              QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY+T+ GE+G QLSG
Sbjct  182   NQEPALFATTILENILYGKPDATIAEVEAAATASNAHSFISLLPNGYNTMAGERGIQLSG  241

Query  1301  GQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQI  1480
             GQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      GR      T +
Sbjct  242   GQKQRIAIARAMLKNPKILLLDEATSALDADSESIVQEALDRLM----VGR------TTV  291

Query  1481  TVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ LV  Q
Sbjct  292   VVAHRLSTIRNVNMIAVIQQGQVVETGTHDELIAKGTSGAYASLVRFQ  339



>ref|NP_001052982.1| Os04g0459000 [Oryza sativa Japonica Group]
 dbj|BAF14896.1| Os04g0459000 [Oryza sativa Japonica Group]
 gb|EEE61119.1| hypothetical protein OsJ_15045 [Oryza sativa Japonica Group]
Length=1259

 Score =   434 bits (1117),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 238/536 (44%), Positives = 344/536 (64%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+N++ WF++ E
Sbjct  731   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEE  790

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  791   NNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPLL  850

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ V++     L+ PQ
Sbjct  851   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVPQ  910

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             +H  R+  I   +   + L L+  + A+ LWY   LV+ H S+F   I+ + +  +T  +
Sbjct  911   MHSLRRSQISGALFGLSQLSLYA-SEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  969

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++ VF  L+  TRI+PD+PE    ES+ G+++F+ + F YPSR
Sbjct  970   VAETVSLAPEIVRGGESIRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSR  1029

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  N+R
Sbjct  1030  PDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVR  1089

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE +K AN+H F+S LPEGY T V
Sbjct  1090  SLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPV  1149

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +    GR
Sbjct  1150  GERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK----GR  1205

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1206  ------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELVSRPDGAYSRLLQLQ  1255


 Score =   301 bits (772),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 192/542 (35%), Positives = 300/542 (55%), Gaps = 24/542 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  87    EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDAR  145

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  146   TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  205

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  206   AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTLKL  265

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  266   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGLSL  323

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F Y
Sbjct  324   GQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDPADGRCLDE-VHGNIEFKEVAFSY  379

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VM+   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++  
Sbjct  380   PSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTL  439

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP GY+
Sbjct  440   QLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYN  499

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L     
Sbjct  500   TQVGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLM----  555

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  556   VGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  609

Query  1622  SM  1627
              M
Sbjct  610   EM  611



>emb|CAD59581.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
Length=1256

 Score =   434 bits (1117),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 238/536 (44%), Positives = 344/536 (64%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+N++ WF++ E
Sbjct  728   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEE  787

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  788   NNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAVLILVTFPLL  847

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ V++     L+ PQ
Sbjct  848   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVPQ  907

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             +H  R+  I   +   + L L+  + A+ LWY   LV+ H S+F   I+ + +  +T  +
Sbjct  908   MHSLRRSQISGALFGLSQLSLYA-SEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  966

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++ VF  L+  TRI+PD+PE    ES+ G+++F+ + F YPSR
Sbjct  967   VAETVSLAPEIVRGGESIRSVFAILNYRTRIDPDEPETEPVESVRGDIDFRHVDFAYPSR  1026

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  N+R
Sbjct  1027  PDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVR  1086

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE +K AN+H F+S LPEGY T V
Sbjct  1087  SLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVSALPEGYKTPV  1146

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +    GR
Sbjct  1147  GERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK----GR  1202

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1203  ------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELVSRPDGAYSRLLQLQ  1252


 Score =   302 bits (774),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 192/544 (35%), Positives = 300/544 (55%), Gaps = 24/544 (4%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +R    YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +
Sbjct  82    RRMTDEYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TD  140

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
                G +   +  +T  V+  I +++   +  +S+ +    V  +  WR+ L++ AV+P  
Sbjct  141   ARTGDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGI  200

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
                G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L
Sbjct  201   AFAGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTL  260

Query  557   HRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV---  727
                 K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   
Sbjct  261   KLGYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGL  318

Query  728   ---PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKF  898
                 S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F
Sbjct  319   SLGQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDPADGRCLDE-VHGNIEFKEVAF  374

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YPSRP+VM+   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++
Sbjct  375   SYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIK  434

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
                L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP G
Sbjct  435   TLQLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNG  494

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQH  1438
             Y+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L   
Sbjct  495   YNTQVGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLM--  552

Query  1439  HKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVS  1615
                GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+ 
Sbjct  553   --VGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIR  604

Query  1616  LQSM  1627
              Q M
Sbjct  605   FQEM  608



>gb|KEH24996.1| ABC transporter B family protein [Medicago truncatula]
Length=1250

 Score =   434 bits (1117),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 246/545 (45%), Positives = 340/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   EKKTKEYVFIYIGAGIYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  782   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE     
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSIFCHE-----  896

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
               RV     L RS    + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ +
Sbjct  897   -LRVPQSQSLRRSLTSGLLFGLSQ---LALYA-SEALILWYGAHLVSKGLSTFSKVIKVF  951

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+  + ES+ GE+E +
Sbjct  952   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDAEMVESVRGEIELR  1011

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP++MV   F+LRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDG
Sbjct  1012  HVDFAYPSRPDMMVFKDFSLRIRAGQSQALVGASGSGKSSVIALIERFYDPLVGKVMIDG  1071

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE+IE ++AAN+H F+S 
Sbjct  1072  KDIRRLNLKSLRLKIGLVQQEPALFASSIFDNIAYGKEGATEAEVIEAARAANVHGFVSG  1131

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LPEGY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE 
Sbjct  1132  LPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALER  1191

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSR
Sbjct  1192  LMR----GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELISRPEGAYSR  1241

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1242  LLQLQ  1246


 Score =   299 bits (766),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 189/540 (35%), Positives = 297/540 (55%), Gaps = 26/540 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  315

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPE--ESLSES-----IEGEVEFKTIKFH  901
                 +    S +G          +   I   KP   E LS+      + G +EFK + F 
Sbjct  316   ----LGQSFSNLGAFSKGKAAGYKLMEIIKQKPTIVEDLSDGKCLAEVNGNIEFKDVSFS  371

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+VM+   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++ 
Sbjct  372   YPSRPDVMIFQNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQVLLDNVDIKT  431

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY
Sbjct  432   LQLKWLRDQIGLVNQEPALFATTILENILYGKPDATMDEVESATSAANAHSFITLLPNGY  491

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L    
Sbjct  492   NTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM---  548

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T + VAHRLST+ N D I V+ +  VVE G+H  L ++  G Y+ L+  Q
Sbjct  549   -VGR------TTVVVAHRLSTIRNVDSIAVIQQRVVVETGTHEELFAK-GGTYASLIRFQ  600



>ref|XP_002283051.2| PREDICTED: ABC transporter B family member 19 [Vitis vinifera]
Length=1250

 Score =   434 bits (1115),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 340/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFIYIGAGLYAVIAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++    + RV  
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKILSLFCYELRVPQ  901

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY + LV +  S+F   I+ + +  +T
Sbjct  902   MQSLRRSQTSGLLFGLSQ---LALYA-SEALILWYGSHLVSKGASTFSKVIKVFVVLVIT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR T+I+PD  +    ESI GE+E + + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTKIDPDDSDAEPVESIRGEIELRHVDFSY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSR ++ V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKDVR  
Sbjct  1018  PSRSDITVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDVRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG + A+EAE+IE ++AAN+H F+S LP+GY 
Sbjct  1078  NLKSLRLKIGLVQQEPALFAASILDNIAYGKDGATEAEVIEAARAANVHGFVSGLPDGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1138  TPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL+ LQ
Sbjct  1195  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHSELISRPEGAYSRLLQLQ  1246


 Score =   293 bits (750),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 191/544 (35%), Positives = 302/544 (56%), Gaps = 20/544 (4%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S    +V  Y++ F  +G++   ++  +   +   GE+ ++ LR     A L+ ++ +F+
Sbjct  75    SKMTEEVAKYALYFVYLGVVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD  134

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               +   G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+
Sbjct  135   -TDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVI  193

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ  547
             P     G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q
Sbjct  194   PGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQ  253

Query  548   PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
               L    K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V
Sbjct  254   NTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIV  311

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIK  895
               ++   +   + L A    K     L    R +P    D  +      + G +EFK + 
Sbjct  312   GGMSLGQSF--SNLGAFSKGKAAGYKLMEIIRQKPSIVQDPSDGKCLAEVNGNIEFKDVT  369

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D+
Sbjct  370   FSYPSRPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDI  429

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP 
Sbjct  430   KTLQLRWLRDQIGLVNQEPALFATTILENILYGKPDATAAEVEAAASAANAHSFITLLPN  489

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE+G+QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L  
Sbjct  490   GYNTQVGERGTQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM-  548

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+ N D I V+ +G VVE G+H  L+++  G Y+ L+ 
Sbjct  549   ---VGR------TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHEELSAKA-GAYASLIR  598

Query  1616  LQSM  1627
              Q M
Sbjct  599   FQEM  602



>ref|XP_006652374.1| PREDICTED: ABC transporter B family member 19-like [Oryza brachyantha]
Length=1255

 Score =   434 bits (1115),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 236/536 (44%), Positives = 345/536 (64%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+N++ WF++ E
Sbjct  727   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNDVGWFDQEE  786

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  787   NNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVAILILVTFPLL  846

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ V++     L+ PQ
Sbjct  847   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLSLFCTELRVPQ  906

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             +H  R+  I   +   + L L+  + A+ LWY   LV+ H S+F   I+ + +  +T  +
Sbjct  907   MHSLRRSQISGALFGLSQLSLYA-SEALILWYGAHLVRHHVSTFSKVIKVFVVLVITANT  965

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++ VF  L+  TRI+PD+P+    ES+ G+++F+ + F YPSR
Sbjct  966   VAETVSLAPEIVRGGESIRSVFAILNYRTRIDPDEPDTEPVESVRGDIDFRHVDFAYPSR  1025

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  N+R
Sbjct  1026  PDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGKDIRRLNVR  1085

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
             +LR +IGLVQQEP+LF  SI ENI YG + A+E E++E +K AN+H F+S LPEGY T V
Sbjct  1086  QLRLKIGLVQQEPVLFATSIMENIAYGKDGATEEEVVEAAKVANMHGFVSALPEGYKTPV  1145

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +    GR
Sbjct  1146  GERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK----GR  1201

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1202  ------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELVSRPDGAYSRLLQLQ  1251


 Score =   301 bits (771),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 192/542 (35%), Positives = 300/542 (55%), Gaps = 24/542 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  83    EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDAR  141

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  142   TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  201

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  202   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQNTLKL  261

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  262   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGLSL  319

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F Y
Sbjct  320   GQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDPADGRCLDE-VHGNIEFKEVAFSY  375

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VM+   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++  
Sbjct  376   PSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTL  435

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP GY+
Sbjct  436   QLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYN  495

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L     
Sbjct  496   TQVGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLM----  551

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  552   VGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  605

Query  1622  SM  1627
              M
Sbjct  606   EM  607



>ref|XP_008230752.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
 ref|XP_008230753.1| PREDICTED: ABC transporter B family member 19 [Prunus mume]
Length=1249

 Score =   433 bits (1114),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 247/539 (46%), Positives = 341/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVAAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +R+  + S VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   HNSSLLAARLATDASDVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R+  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRIPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  901   LGSLRRSQTAGLLFGLSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVFVVLVVT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE  + E+I GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPEAEIVETIRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP++MV   FNLRI  G   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDIMVFKDFNLRIRTGQSQALVGASGSGKSSVIALIERFYDPIVGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++ AN+H F+S LP+GY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEHGSHSELVSRPDGAYSRLLQLQ  1245


 Score =   297 bits (761),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 190/539 (35%), Positives = 300/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVAKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIMAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLQL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  315

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   ++ L       + G +EFK + F YPS
Sbjct  316   GQSF--SNLGAFSKGKSAGYKLMEIIKQKPTIIQDPLDGKCLSDVNGNIEFKEVTFSYPS  373

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VLID  D+R   L
Sbjct  374   RPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIRTLQL  433

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+ A++   + AAN H+FI+ LP GY+T 
Sbjct  434   KWLRDQIGLVNQEPALFATTILENILYGKPDATMADVEAAASAANAHSFITLLPNGYNTQ  493

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      G
Sbjct  494   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----VG  549

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  550   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQEM  601



>ref|XP_010108971.1| ABC transporter B family member 19 [Morus notabilis]
 gb|EXC20611.1| ABC transporter B family member 19 [Morus notabilis]
Length=1249

 Score =   433 bits (1114),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 248/548 (45%), Positives = 340/548 (62%), Gaps = 36/548 (7%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + S VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   HNSSLVAARLATDASDVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE  V  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRV--  898

Query  527   KARVALQPQLH---RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAI  697
                    PQLH   RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I
Sbjct  899   -------PQLHSLRRSQTSGLLFGLSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVI  947

Query  698   RSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEV  877
             + + +  +T  S+ E  +L P ++     +  VF  LDR T+I+PD P+    ESI GE+
Sbjct  948   KVFVVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRQTKIDPDDPDAEPVESIRGEI  1007

Query  878   EFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVL  1057
             E + + F YPSRP+VMV    +LRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+
Sbjct  1008  ELRHVDFAYPSRPDVMVFKDLSLRIRAGQSQALVGASGSGKSSVIALIERFYDPVVGKVM  1067

Query  1058  IDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTF  1237
             IDGKD+R  NL+ LR ++GLVQQEP LF  SI +NI YG E A+E E+IE ++AAN+H F
Sbjct  1068  IDGKDIRRLNLKSLRLKMGLVQQEPALFAASIFDNIAYGKEGATETEVIEAARAANVHGF  1127

Query  1238  ISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSA  1417
             +S LP+GY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  A
Sbjct  1128  VSGLPDGYKTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEA  1187

Query  1418  LESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGV  1597
             LE L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G 
Sbjct  1188  LERLMR----GR------TTVLVAHRLSTIRGVDTIGVVQDGRIVEQGSHSELVSRPEGA  1237

Query  1598  YSRLVSLQ  1621
             YSRL+ LQ
Sbjct  1238  YSRLLQLQ  1245


 Score =   310 bits (793),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 189/537 (35%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYSLYFVYLGLVVCVSSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRQSYANAGVIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V   S+
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMSL  315

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +      + G +EFK + F YPSRP
Sbjct  316   GQSFSNLGAFSKGKAAGDKLMEIINQKPSITQDASDAKCLAEVNGNIEFKDVTFSYPSRP  375

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V +   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L+ 
Sbjct  376   DVFIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKW  435

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GY+T VG
Sbjct  436   LRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVG  495

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  496   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  550

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++P G Y+ L+  Q M
Sbjct  551   -----TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKP-GAYASLIRFQEM  601



>ref|XP_009415585.1| PREDICTED: ABC transporter B family member 19 [Musa acuminata 
subsp. malaccensis]
Length=1255

 Score =   433 bits (1114),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 344/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++   GL +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  727   ERKTREYVFVYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEE  786

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+ N+ + VK  I++R+SVI+Q ++S++ +  V  IV+WR+ L+  A  P  
Sbjct  787   NNSSLVAARLANDAADVKSAIAERISVILQNMTSLLTSFIVGFIVEWRVALLILATFPLL  846

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++    + RV  
Sbjct  847   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCSELRVPQ  906

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+   I +GI Q   L L+  + A+ LWY   LV+   S+F   I+ + +  +T
Sbjct  907   RRSLRRSQTSGILYGISQ---LSLY-ASEALILWYGAHLVRTGASTFSKVIKVFVVLVVT  962

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ VF  L+R TRI+PD PE    +S+ GE+E + ++F Y
Sbjct  963   ANSVAETVSLAPEIVRGGESIRSVFAILNRGTRIDPDDPEAEPVDSVRGEIELRHVEFAY  1022

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V +   FNLRI AG   ALVG SG+GKS+VIAL+ RFYD   GKVLIDGKD++  
Sbjct  1023  PSRPDVTIFKDFNLRIRAGQSQALVGASGSGKSTVIALIERFYDPTAGKVLIDGKDIKRL  1082

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE ++AAN+H F+S LP+GY 
Sbjct  1083  NLKSLRLKIGLVQQEPVLFAASIMENIAYGKDGATEEEVIEAARAANVHGFVSALPDGYK  1142

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1143  TTVGERGVQLSGGQKQRIAIARAVLKDPALLLLDEATSALDAESECVLQEALERLMK---  1199

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G V E GSHS L ++PDG YSRL+ LQ
Sbjct  1200  -GR------TTVLVAHRLSTIRGVDCIGVVQDGRVAEQGSHSDLVARPDGAYSRLLQLQ  1251


 Score =   292 bits (747),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 192/540 (36%), Positives = 298/540 (55%), Gaps = 20/540 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+  + LR     A L+ ++ +F+  +  
Sbjct  83    EVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQASALRRKYLEAVLRQDVGFFD-TDAR  141

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  142   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  201

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  202   AGGLYAYTLTGLTSKSRESYANAGIVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  261

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  262   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  319

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    R +P    D+ +      + G +E K + F YPS
Sbjct  320   GQSF--SNLGAFSKGKAAGYKLLEIIRQKPSIVQDQSDGKCLAEVHGNIELKDVTFSYPS  377

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F+L I AG  VA+VG SG+GKS+V+AL+ RFYD ++G +L+D  D++   L
Sbjct  378   RPDVIIFRDFSLFIPAGKTVAVVGGSGSGKSTVVALIERFYDPNQGLILLDNVDIKTLQL  437

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FIS LP  Y+T 
Sbjct  438   KWLREQIGLVNQEPALFATTILENILYGKPDATIAEVEAAASAANAHSFISQLPNAYNTQ  497

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  498   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  553

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D+I V+ +G VVE G+H  L ++   G Y+ L+  Q M
Sbjct  554   R------TTVVVAHRLSTIRNVDMIAVIQQGQVVETGTHEELLAKGSSGAYASLIRFQEM  607



>gb|AFW59636.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=1146

 Score =   430 bits (1106),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  615   NEMEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  674

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + + +  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ ++  A  
Sbjct  675   EEENNSSLVAAHLAVDAADVKSAIAERISVILQNMTSLMTSFVVGFIIEWRVAILILATF  734

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R
Sbjct  735   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQSKILSLFSHELR  794

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             V  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  795   VPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  850

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     +I G++E + + 
Sbjct  851   VVTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVD  910

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS++IAL+ RFYD   GKV IDGKD+
Sbjct  911   FSYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTIIALIERFYDPCGGKVAIDGKDI  970

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG E ASE E++E +K AN+H F+S LP+
Sbjct  971   RTLNLKSLRRKIGLVQQEPVLFASSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPD  1030

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1031  GYRTAVGERGMQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1090

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G VVE GSHS L ++P+G YSRL+ 
Sbjct  1091  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRVVEHGSHSDLLARPEGAYSRLLQ  1140

Query  1616  LQ  1621
             LQ
Sbjct  1141  LQ  1142


 Score =   297 bits (761),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 184/511 (36%), Positives = 284/511 (56%), Gaps = 26/511 (5%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+ +  LR +   A L+ ++ +F+  +   G +   +  +T  V+  I +++   +  I
Sbjct  4     GERQVIALRKAYLDAVLRQDVGFFD-TDARTGDIVFGVSTDTLLVQDAIGEKVGNFMHYI  62

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             ++ +    V  +  WR+ L++ AV+P     G + A +  G +  +  +++    +A ++
Sbjct  63    ATFLAGLVVGFVSAWRLALLSVAVIPAIAFAGGLYAYTLTGLTSKSRESYTNAGVVAEQA  122

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              A ++TV SF  E   +N    A+Q  L    K  +  G+  G +  +  ++ A+  WY 
Sbjct  123   IAQVRTVYSFVGESKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWYA  182

Query  653   TLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKP-------VFQTLD  811
              + ++  QS    A  +  IFS  V  ++     +    S +G           + + + 
Sbjct  183   GVFIRNGQSDGGKAFTA--IFSAIVGGMS-----LGQAFSNLGAFSKGKIAGYKLLEVIR  235

Query  812   RCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSG  991
             +   I  D  +      + G +EFK + F YPSRP+V++   F+L   AG  VA+VG SG
Sbjct  236   QKPSIVNDHKDGKWLAEVHGNIEFKEVTFSYPSRPDVIIFRDFSLFFPAGKTVAVVGGSG  295

Query  992   AGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICY  1171
             +GKS+V+AL+ RFYD +EG+VL+D  D++   LR LR QIGLV QEP LF  +I ENI Y
Sbjct  296   SGKSTVVALIERFYDPNEGQVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTILENILY  355

Query  1172  GSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPA  1351
             G   A+ AE+   + A+N H+FIS LP GY+T+VGE+G QLSGGQKQRIAIARA+LK P 
Sbjct  356   GKPDATIAEVEAATTASNAHSFISLLPNGYNTMVGERGIQLSGGQKQRIAIARAMLKNPK  415

Query  1352  IMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVV  1531
             I+LLDEATSALD+ SE  V  AL+ L      GR      T + VAHRLST+ N ++I V
Sbjct  416   ILLLDEATSALDADSESIVQEALDRLM----VGR------TTVVVAHRLSTIRNVNMIAV  465

Query  1532  MDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
             + +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  466   IQQGQVVETGTHDELLAKGTSGAYASLIRFQ  496



>ref|XP_010439790.1| PREDICTED: ABC transporter B family member 14-like isoform X1 
[Camelina sativa]
Length=1250

 Score =   432 bits (1111),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 242/541 (45%), Positives = 340/541 (63%), Gaps = 18/541 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             KR+V    VIF   G+++     LQHY Y ++GE+  + +R SL+SA L NE+ WF+  E
Sbjct  723   KRQVEKVIVIFVGAGVITTPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLEE  782

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  I+DR+S IVQ IS  V +  ++    WR+  V  A  P  
Sbjct  783   NNTGSLTSILSADATLVRSAIADRLSTIVQNISLTVTSLGLAFFYCWRVAAVVTACFPLI  842

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
                 L +    KGF GD T A+S   SLA E+  NI+TV +F  E+ +  +       +L
Sbjct  843   ITASLTEQLFLKGFGGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQ----FTSEL  898

Query  557   HRSRKESIKFGIIQG----TSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              +  K ++  G I G     S CL   ++A+ LWY ++L+QR +++F ++I+S+ +  +T
Sbjct  899   TKPTKNALLKGHISGFGYGLSQCLAYCSYALGLWYISVLIQRKETNFEDSIKSFMVLLVT  958

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E   L P ++     L  VF+ L R + I PD+P   L   +EG++EF+ + F Y
Sbjct  959   AYSVGETLALTPDIVKGTQALGSVFRVLHRESEIPPDQPNSRLVTQVEGDIEFRAVSFAY  1018

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPE+ +    NL I AG  +A+VG SG+GKS+VI L++RFYD   GK+ IDG+D++  
Sbjct  1019  PTRPEITIFQNLNLWISAGKSLAVVGTSGSGKSTVIGLIMRFYDTTNGKLFIDGQDIKTI  1078

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR ++ LVQQEP LF  +I ENI YG+E ASEAEI+E +KAAN H FI  + EGY 
Sbjct  1079  NLRSLRNKLALVQQEPALFSTTIYENIKYGNENASEAEIMEAAKAANAHEFIIMMEEGYK  1138

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG++G QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +   
Sbjct  1139  THVGDRGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDRLMK---  1195

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+  +D+I V+ KG VVE GSH  L S+ DGVY +L SLQ 
Sbjct  1196  -GR------TTVLVAHRLSTIRKADMIAVLHKGGVVEKGSHRELVSKSDGVYKQLTSLQE  1248

Query  1625  M  1627
             M
Sbjct  1249  M  1249


 Score =   278 bits (710),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 191/542 (35%), Positives = 295/542 (54%), Gaps = 41/542 (8%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR S   + L  ++ +F+  E   
Sbjct  103   LGLVNLVSAWIGVACWMQT----------GERQTRRLRISYLKSILAKDITFFD-TETRD  151

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP--CHF  379
              +    I ++   V+  I D+   +++ +   +    +  +  W++ L+   V+P     
Sbjct  152   SNFIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVA  211

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
             +GG     S    S  + AA+++   +A E  + ++TV +F  EE  V     +L+    
Sbjct  212   VGGYAIVMST--ISEKSEAAYADAGKIAEEVMSQVRTVYAFVGEEKAVKSYSKSLKEAFK  269

Query  560   RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFS  718
              S++  I  G+  G +  L   A A+  WY ++LV+  ++       + LN I S     
Sbjct  270   ISKRSGIAKGLGIGLTFSLLFCAWALLFWYASILVRHGKTNGAKAFTTILNVIYSGFALG  329

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQT-LDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
               VPS++    ++   ++A  I K +    L+   R+  D    SL E++ G +EF  + 
Sbjct  330   QAVPSLS---AILKGRVAAANIFKMIGNNNLESSERL--DDNGTSL-ENVAGRIEFHQVS  383

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSR   MV    ++ I +G   A VGPSG+GKS++I+L+ RFY+ + G++L+DG D+
Sbjct  384   FAYPSRTS-MVFENLSVTIHSGKTFAFVGPSGSGKSTIISLMQRFYEPNSGEILLDGNDI  442

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   L+ LR Q+GLV QEP LF  +I  NI  G E AS  +IIE +KAAN  +FI +LP 
Sbjct  443   KSLKLKWLREQMGLVSQEPALFATTIASNILLGKENASMVQIIEAAKAANADSFIKSLPN  502

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+++ +
Sbjct  503   GYNTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDTVME  562

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                       K T I +AHRLST+ N D IVV+  G ++E GSHS L S+  G Y+ LV+
Sbjct  563   ----------KRTTIVIAHRLSTIRNVDKIVVLRNGQIMETGSHSELISR-GGDYATLVN  611

Query  1616  LQ  1621
              Q
Sbjct  612   CQ  613



>ref|XP_002517493.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF45035.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1259

 Score =   432 bits (1111),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 248/545 (46%), Positives = 336/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  731   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  790

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  791   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  850

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE  V  
Sbjct  851   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELSV--  908

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
                    PQL RS + S   G++ G S      + A+ LWY   LV +  S+F   I+ +
Sbjct  909   -------PQL-RSLRRSQTSGLLFGLSQLALYASEALILWYGAHLVSKGVSTFSKVIKVF  960

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD PE    ESI GE+E +
Sbjct  961   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPEAEPVESIRGEIELR  1020

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+V V    NLRI AG   ALVG SG GKSSVIAL+ RFYD   GKV+IDG
Sbjct  1021  HVDFSYPSRPDVPVFKDLNLRIRAGQSQALVGASGCGKSSVIALIERFYDPTAGKVMIDG  1080

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR ++GLVQQEP LF  SI +NI YG E A+EAE+IE ++AAN+H F+S 
Sbjct  1081  KDIRRLNLKSLRLKVGLVQQEPALFAASIFDNIVYGKEGATEAEVIEAARAANVHGFVSA  1140

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LP+GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE 
Sbjct  1141  LPDGYKTPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALER  1200

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSH+ L S+ DG YSR
Sbjct  1201  LMR----GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHAELVSRGDGAYSR  1250

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1251  LLQLQ  1255


 Score =   293 bits (751),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 190/539 (35%), Positives = 298/539 (55%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  89    EVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  147

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  148   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  207

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  ++++   +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  208   AGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  267

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  268   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  325

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P    D  +      I G +EFK + F YPS
Sbjct  326   GQSF--SNLGAFSKGKAAGYKLMEIIKQKPTIIQDPSDGKCLPEINGNIEFKDVTFSYPS  383

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L
Sbjct  384   RPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQL  443

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             R LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+T 
Sbjct  444   RWLRDQIGLVNQEPALFATTILENILYGKPDATMDEVEAAASAANAHSFITLLPNGYNTQ  503

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  504   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  559

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L S+    Y+ L+  Q M
Sbjct  560   R------TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHEELISK-GAAYASLIRFQEM  611



>gb|EAZ32166.1| hypothetical protein OsJ_16371 [Oryza sativa Japonica Group]
Length=1213

 Score =   431 bits (1108),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 345/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   GL +     +QHY + ++GE   T +R  + SA L NE+ WF+
Sbjct  683   NEMEKKTKLYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILTNEVGWFD  742

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ L+  A  
Sbjct  743   EEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLMTSFIVGFIIEWRVALLILATF  802

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++    + R
Sbjct  803   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQNKILSLFSYELR  862

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  863   IPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  918

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     ++ G++E + + 
Sbjct  919   VVTANSVAETVSLAPEIVRGGESIRSIFGILNRATRIEPDDPESERVTNVRGDIELRHVD  978

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS+VIAL+ RFYD   GKV IDGKD+
Sbjct  979   FAYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTVIALIERFYDPTGGKVTIDGKDI  1038

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E+I+ +K AN+H F+S LP 
Sbjct  1039  RRLNLKALRLKIGLVQQEPVLFAASILENIAYGKDGATEEEVIQAAKTANVHGFVSQLPN  1098

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1099  GYKTAVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1158

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL+ 
Sbjct  1159  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRIVEHGSHSDLVSRPEGAYSRLLQ  1208

Query  1616  LQ  1621
             LQ
Sbjct  1209  LQ  1210


 Score =   311 bits (798),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 194/546 (36%), Positives = 301/546 (55%), Gaps = 26/546 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  42    EVSKYALYFVYLGLVVCASSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  100

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  I++ +    V  +  WR+ L++ AV+P    
Sbjct  101   TGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAF  160

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  161   AGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFAGESKALNSYSEAIQNTLKL  220

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  221   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  277

Query  743   LWTLIPTVLSAIGIL---KPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G     K     L    R +P    D  +  L   + G +EFK + F 
Sbjct  278   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIVHDHKDGKLLAEVHGNIEFKDVTFS  333

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+VM+   F+L   A   VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  334   YPSRPDVMIFRDFSLFFPAAKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  393

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  394   LQLRWLRDQIGLVNQEPALFATTIHENILYGKPDATMAEVEAAATASNAHSFISTLPNGY  453

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L    
Sbjct  454   NTMVGERGIQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLMT--  511

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ L+  
Sbjct  512   --GR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELLAKGSSGAYASLIRF  563

Query  1619  QSMKDH  1636
             Q M  +
Sbjct  564   QEMAQN  569



>gb|KDP45498.1| hypothetical protein JCGZ_09747 [Jatropha curcas]
Length=1253

 Score =   432 bits (1110),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 341/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  725   ERKTKEYVFIYIGAGLYAVIAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  784

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  785   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  844

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ RV  
Sbjct  845   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELRV--  902

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              PQL RS ++S   G++ G S      + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  903   -PQL-RSLRKSQTSGLLFGLSQLALYASEALILWYGAHLVSKGASTFSKVIKVFVVLVIT  960

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE    ES+ GE+E + + F Y
Sbjct  961   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPEAEPVESVRGEIELRHVDFAY  1020

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V    NLRI AG   ALVG SG GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1021  PSRPDVPVFKDLNLRIRAGQSQALVGASGCGKSSVIALIERFYDPSAGKVMIDGKDIRRL  1080

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  +I +NI YG + A+EAE+IE ++AAN+H F+S LP+GY 
Sbjct  1081  NLKSLRLKIGLVQQEPALFAANILDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYK  1140

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1141  TPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMR---  1197

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L S+ DG YSRL+ LQ
Sbjct  1198  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHAELISRADGAYSRLLQLQ  1249


 Score =   299 bits (765),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 186/537 (35%), Positives = 297/537 (55%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  83    EVSKYALYFVYLGLVVCLSSYAEIGCWMYTGERQVGTLRKKYLEAVLKQDVGFFD-TDAR  141

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  142   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  201

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  ++++   +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  202   AGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  261

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V   S+
Sbjct  262   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGVTDGGKAFTA--IFSAIVGGMSL  319

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + + +   I  D  +      + G +EFK + F YPSRP
Sbjct  320   GQSFSNLGAFSKGKAAGYKLMEVIKQKPTIVQDPSDGKCLPEVNGNIEFKNVTFSYPSRP  379

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   LR 
Sbjct  380   DVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLRW  439

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+T VG
Sbjct  440   LRDQIGLVNQEPALFATTILENILYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVG  499

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  500   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  554

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G YS L+  Q M
Sbjct  555   -----TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHEELIAK-GGAYSSLIRFQEM  605



>ref|XP_010439800.1| PREDICTED: ABC transporter B family member 14-like isoform X2 
[Camelina sativa]
Length=1249

 Score =   432 bits (1110),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 242/541 (45%), Positives = 340/541 (63%), Gaps = 18/541 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             KR+V    VIF   G+++     LQHY Y ++GE+  + +R SL+SA L NE+ WF+  E
Sbjct  722   KRQVEKVIVIFVGAGVITTPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  I+DR+S IVQ IS  V +  ++    WR+  V  A  P  
Sbjct  782   NNTGSLTSILSADATLVRSAIADRLSTIVQNISLTVTSLGLAFFYCWRVAAVVTACFPLI  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
                 L +    KGF GD T A+S   SLA E+  NI+TV +F  E+ +  +       +L
Sbjct  842   ITASLTEQLFLKGFGGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQ----FTSEL  897

Query  557   HRSRKESIKFGIIQG----TSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              +  K ++  G I G     S CL   ++A+ LWY ++L+QR +++F ++I+S+ +  +T
Sbjct  898   TKPTKNALLKGHISGFGYGLSQCLAYCSYALGLWYISVLIQRKETNFEDSIKSFMVLLVT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E   L P ++     L  VF+ L R + I PD+P   L   +EG++EF+ + F Y
Sbjct  958   AYSVGETLALTPDIVKGTQALGSVFRVLHRESEIPPDQPNSRLVTQVEGDIEFRAVSFAY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPE+ +    NL I AG  +A+VG SG+GKS+VI L++RFYD   GK+ IDG+D++  
Sbjct  1018  PTRPEITIFQNLNLWISAGKSLAVVGTSGSGKSTVIGLIMRFYDTTNGKLFIDGQDIKTI  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR ++ LVQQEP LF  +I ENI YG+E ASEAEI+E +KAAN H FI  + EGY 
Sbjct  1078  NLRSLRNKLALVQQEPALFSTTIYENIKYGNENASEAEIMEAAKAANAHEFIIMMEEGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG++G QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +   
Sbjct  1138  THVGDRGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDRLMK---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+  +D+I V+ KG VVE GSH  L S+ DGVY +L SLQ 
Sbjct  1195  -GR------TTVLVAHRLSTIRKADMIAVLHKGGVVEKGSHRELVSKSDGVYKQLTSLQE  1247

Query  1625  M  1627
             M
Sbjct  1248  M  1248


 Score =   277 bits (709),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 191/542 (35%), Positives = 295/542 (54%), Gaps = 41/542 (8%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR S   + L  ++ +F+  E   
Sbjct  102   LGLVNLVSAWIGVACWMQT----------GERQTRRLRISYLKSILAKDITFFD-TETRD  150

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP--CHF  379
              +    I ++   V+  I D+   +++ +   +    +  +  W++ L+   V+P     
Sbjct  151   SNFIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVA  210

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
             +GG     S    S  + AA+++   +A E  + ++TV +F  EE  V     +L+    
Sbjct  211   VGGYAIVMST--ISEKSEAAYADAGKIAEEVMSQVRTVYAFVGEEKAVKSYSKSLKEAFK  268

Query  560   RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFS  718
              S++  I  G+  G +  L   A A+  WY ++LV+  ++       + LN I S     
Sbjct  269   ISKRSGIAKGLGIGLTFSLLFCAWALLFWYASILVRHGKTNGAKAFTTILNVIYSGFALG  328

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQT-LDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
               VPS++    ++   ++A  I K +    L+   R+  D    SL E++ G +EF  + 
Sbjct  329   QAVPSLS---AILKGRVAAANIFKMIGNNNLESSERL--DDNGTSL-ENVAGRIEFHQVS  382

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSR   MV    ++ I +G   A VGPSG+GKS++I+L+ RFY+ + G++L+DG D+
Sbjct  383   FAYPSRTS-MVFENLSVTIHSGKTFAFVGPSGSGKSTIISLMQRFYEPNSGEILLDGNDI  441

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   L+ LR Q+GLV QEP LF  +I  NI  G E AS  +IIE +KAAN  +FI +LP 
Sbjct  442   KSLKLKWLREQMGLVSQEPALFATTIASNILLGKENASMVQIIEAAKAANADSFIKSLPN  501

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+++ +
Sbjct  502   GYNTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDTVME  561

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                       K T I +AHRLST+ N D IVV+  G ++E GSHS L S+  G Y+ LV+
Sbjct  562   ----------KRTTIVIAHRLSTIRNVDKIVVLRNGQIMETGSHSELISR-GGDYATLVN  610

Query  1616  LQ  1621
              Q
Sbjct  611   CQ  612



>ref|XP_009395922.1| PREDICTED: ABC transporter B family member 19-like [Musa acuminata 
subsp. malaccensis]
Length=1256

 Score =   431 bits (1109),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 241/539 (45%), Positives = 343/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  728   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  787

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+ N+ + VK  I++R+SVI+Q ++S++ +  V  +V+WR+ L+  A  P  
Sbjct  788   NNSSLVAARLANDAADVKSAIAERISVILQNMTSLLTSFIVGFVVEWRVALLILATFPLL  847

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    N+ R+  
Sbjct  848   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQAKILSLFCNELRIPQ  907

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +    RS+   I +G+ Q   L L+  + A+ LWY   LV    S+F   I+ + +  +T
Sbjct  908   RRSFRRSQTSGILYGLSQ---LSLY-ASEALILWYGAHLVSSGASTFSKVIKVFVVLVVT  963

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ VF  L+R TR+EPD PE    +S+ GE+E + + F Y
Sbjct  964   ANSVAETVSLAPEIVRGGESIRSVFAILNRGTRVEPDDPEAEHVDSVRGEIELRHVDFAY  1023

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V +   FNLRI AG   ALVG SG+GKS+VIAL+ RFYD   GKVLIDGKD++  
Sbjct  1024  PSRPDVPIFKDFNLRIRAGQSHALVGASGSGKSTVIALIERFYDPTAGKVLIDGKDIKRL  1083

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE ++AAN+H F+S LP+GY 
Sbjct  1084  NLKSLRLKIGLVQQEPVLFAASIMENIAYGKDGATEEEVIEAARAANVHGFVSALPDGYK  1143

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1144  TAVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERLMK---  1200

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+ +G +VE GSHS L ++PDG YSRL+ LQ
Sbjct  1201  -GR------TTVLVAHRLSTIRGVDSIGVVQEGRIVEQGSHSELVARPDGAYSRLLQLQ  1252


 Score =   299 bits (766),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 194/540 (36%), Positives = 298/540 (55%), Gaps = 20/540 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+  + LR     A L+ ++ +F+  +  
Sbjct  84    EVSKYALYFVYLGLVVCLSSYAEIGCWMYTGERQASALRRRYLEAVLRQDVGFFD-TDAR  142

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  I  WR+ L++ AV+P    
Sbjct  143   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAF  202

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  203   AGGLYAYTLTGLTSKSRESYANAGIVAEQTIAQVRTVYSFVGENKALNSYSEAIQNTLKL  262

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  263   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  320

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    R +P    D+ +    E + G +EFK + F YPS
Sbjct  321   GQSF--SNLGAFSKGKAAGYKLLEIIRQKPSIIQDQSDGKCLEEVHGNIEFKDVTFSYPS  378

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F+L   AG  VA+VG SG+GKS+V+AL+ RFYD ++G VL+D  D++   L
Sbjct  379   RPDVIIFRDFSLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNQGLVLLDNVDIKTLQL  438

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FIS LP  Y+T 
Sbjct  439   KWLREQIGLVNQEPALFATTILENILYGKPDATIGEVEAAASAANAHSFISQLPSAYNTQ  498

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  499   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  554

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D+I V+ +G VVE G+H  L ++   G Y+ L+  Q M
Sbjct  555   R------TTVVVAHRLSTIRNVDMIAVIQQGQVVETGAHEDLLAKGSSGAYASLIRFQEM  608



>ref|XP_004304313.1| PREDICTED: ABC transporter B family member 19-like [Fragaria 
vesca subsp. vesca]
Length=1250

 Score =   431 bits (1108),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 242/542 (45%), Positives = 344/542 (63%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++   GL +     +QHY + ++GE   T +R  + +A L+NE+ W++  E
Sbjct  722   ERKTKEYVFVYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWYDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L S++  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   NNSSLLASKLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ R+  
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELRIPQ  901

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  902   LGSLRRSQTAGLLFGLSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVFVVLVVT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE  + E+I GE+E + + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPEAEVVETIRGEIELRHVDFAY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP++M+   FNLRI  G   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1018  PSRPDIMIFKDFNLRIRTGQSQALVGASGSGKSTVIALIERFYDPIVGKVMIDGKDIRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE+IE ++ AN+H F+S LP+GY 
Sbjct  1078  NLKSLRLKIGLVQQEPALFAASIFDNIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1138  TPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG YSRL+ LQ+
Sbjct  1195  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEHGSHSELVSRPDGAYSRLLQLQN  1247

Query  1625  MK  1630
              +
Sbjct  1248  HR  1249


 Score =   290 bits (743),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 189/541 (35%), Positives = 300/541 (55%), Gaps = 24/541 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVAKYALYFVYLGLIVCVSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRESYANAGIMAEQAIAQVRTVKSYVGESKALNSYSDAIQNTLQL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  316

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L        +   +++ + Q   + T I+     + LSE + G +E K + F Y
Sbjct  317   GQSFSNLGAFSKGKSAGYKLMEIIKQ---KPTIIQDQLDGKCLSE-VNGNIELKEVTFSY  372

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V++   F++   AG  +A+VG SG+GKS+V++L+ RFYD + G+VL+DG D+R  
Sbjct  373   PSRPDVIIFRNFSIFFPAGKTIAVVGGSGSGKSTVVSLIERFYDPNHGQVLLDGVDIRTL  432

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR Q+GLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+
Sbjct  433   QLKWLRDQMGLVNQEPALFATTILENILYGKADATMDEVEAAASAANAHSFITLLPNGYN  492

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L     
Sbjct  493   TQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRLM----  548

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G YS L+  Q 
Sbjct  549   VGR------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYSSLIRFQE  601

Query  1625  M  1627
             M
Sbjct  602   M  602



>ref|XP_010528330.1| PREDICTED: ABC transporter B family member 19 [Tarenaya hassleriana]
Length=1256

 Score =   431 bits (1108),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 252/553 (46%), Positives = 345/553 (62%), Gaps = 31/553 (6%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  724   YDS-MERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  782

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  +++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A
Sbjct  783   FDEEEHNSSLVAARLATDAADVKSAMAERISVILQNMTSLLTSFIVAFIVEWRVSLLILA  842

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHE  511
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE
Sbjct  843   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHE  902

Query  512   EHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLN  691
              HV  K        L RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F  
Sbjct  903   LHVPQK------RSLRRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVGKGASTFSK  952

Query  692   AIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEG  871
              I+ + +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+    E+I G
Sbjct  953   VIKVFVVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPDADPVETIRG  1012

Query  872   EVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGK  1051
             E+EF+ + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GK
Sbjct  1013  EIEFRHVDFAYPSRPDVMVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPLAGK  1072

Query  1052  VLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIH  1231
             V+IDGKD+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+EAE+IE ++AAN H
Sbjct  1073  VMIDGKDIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATEAEVIEAARAANAH  1132

Query  1232  TFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVV  1411
              FIS LP+GY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  + 
Sbjct  1133  GFISGLPDGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQ  1192

Query  1412  SALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPD  1591
              ALE L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+
Sbjct  1193  EALERLMR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPE  1242

Query  1592  GVYSRLVSLQSMK  1630
             G YSRL+ LQ+ +
Sbjct  1243  GAYSRLLQLQNHR  1255


 Score =   286 bits (731),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  86    EVSKYALYFVYLGLVVCFSSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVGFFD-TDAR  144

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  145   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  204

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  205   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSLYSDAIQYTLKL  264

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  265   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  322

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    + + G +EFK + F YPSRP
Sbjct  323   GQSFSNLGAFSKGKAAGYKLMEIINQRPSIIQDPLDGKCLDEVRGNIEFKDVTFSYPSRP  382

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD + G++L+D  D++   L+ 
Sbjct  383   DVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDSVDIKTLQLKF  442

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GY+T VG
Sbjct  443   LRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAAASAANAHSFITLLPNGYNTQVG  502

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  503   ERGIQLSGGQKQRIAIARAMLKDPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  557

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  558   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQEM  608



>emb|CAD40903.1| OSJNBa0036B21.21 [Oryza sativa Japonica Group]
 emb|CBW45777.1| ORW1943Ba0077G13.5 [Oryza rufipogon]
Length=1252

 Score =   431 bits (1107),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 240/546 (44%), Positives = 345/546 (63%), Gaps = 22/546 (4%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLR----------NSLYSATLQ  166
             +RK   Y  I+   GL +     +QHY + ++GE   T +R            L+SA L+
Sbjct  714   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVALFDQRLFSAILR  773

Query  167   NELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMG  346
             N++ WF++ ENN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ 
Sbjct  774   NDVGWFDQEENNSSLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVA  833

Query  347   LVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN  526
             ++     P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ V++
Sbjct  834   VLILVTFPLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKVLS  893

Query  527   KARVALQ-PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRS  703
                  L+ PQ+H  R+  I   +   + L L+  + A+ LWY   LV+ H S+F   I+ 
Sbjct  894   LFCTELRVPQMHSLRRSQISGALFGLSQLSLYA-SEALILWYGAHLVRHHVSTFSKVIKV  952

Query  704   YQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEF  883
             + +  +T  ++ E  +L P ++     ++ VF  L+  TRI+PD+PE    ES+ G+++F
Sbjct  953   FVVLVITANTVAETVSLAPEIVRGGESIRSVFAILNYRTRIDPDEPETEPVESVRGDIDF  1012

Query  884   KTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLID  1063
             + + F YPSRP+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+ID
Sbjct  1013  RHVDFAYPSRPDVMVFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMID  1072

Query  1064  GKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFIS  1243
             GKD+R  N+R LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE +K AN+H F+S
Sbjct  1073  GKDIRRLNVRSLRLKIGLVQQEPVLFATSIFENIAYGKDGATEEEVIEAAKVANMHGFVS  1132

Query  1244  NLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALE  1423
              LPEGY T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE
Sbjct  1133  ALPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALE  1192

Query  1424  SLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYS  1603
              + +    GR      T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YS
Sbjct  1193  RIMK----GR------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGELVSRPDGAYS  1242

Query  1604  RLVSLQ  1621
             RL+ LQ
Sbjct  1243  RLLQLQ  1248


 Score =   294 bits (753),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 185/512 (36%), Positives = 285/512 (56%), Gaps = 24/512 (5%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+ +  LR     A L+ ++ +F+  +   G +   +  +T  V+  I +++   +  +
Sbjct  100   GERQVGALRRRYLEAVLRQDVGFFD-TDARTGDVVFSVSTDTLLVQDAIGEKVGNFIHYL  158

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             S+ +    V  +  WR+ L++ AV+P     G + A +  G +  +  +++    +A ++
Sbjct  159   STFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGLYAYTLTGLTSKSRDSYANAGIIAEQA  218

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              A ++TV S+  E   +N    A+Q  L    K  +  G+  G +  +  ++ A+  WY 
Sbjct  219   IAQVRTVYSYVGESKALNSYSEAIQNTLKLGYKAGMAKGLGIGCTYGIACMSWALVFWYA  278

Query  653   TLLVQRHQSSFLNAIRSYQIFSLTV------PSITELWTLIPTVLSAIGILKPVFQTLDR  814
              + ++  Q+    A  +  IFS  V       S + L       ++   +L+ + Q   R
Sbjct  279   GVFIRNGQTDGGKAFTA--IFSAIVGGLSLGQSFSNLGAFSKGKIAGYKLLEVIRQ---R  333

Query  815   CTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
              T ++       L E + G +EFK + F YPSRP+VM+   F+L   AG   A+VG SG+
Sbjct  334   PTIVQDPADGRCLDE-VHGNIEFKEVAFSYPSRPDVMIFRDFSLFFPAGKTAAVVGGSGS  392

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS+V+AL+ RFYD ++G+VL+D  D++   L+ LR QIGLV QEP LF  +I ENI YG
Sbjct  393   GKSTVVALIERFYDPNQGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYG  452

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
                A+ AE+   + +AN H+FI+ LP GY+T VGE+G QLSGGQKQRIAIARA+LK P I
Sbjct  453   KPDATMAEVEAAATSANAHSFIALLPNGYNTQVGERGLQLSGGQKQRIAIARAMLKNPKI  512

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDEATSALD+GSE  V  AL+ L      GR      T + VAHRLST+   D+I V+
Sbjct  513   LLLDEATSALDAGSENIVQEALDRLM----VGR------TTVVVAHRLSTIRCVDMIAVI  562

Query  1535  DKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
              +G VVE G+H  L ++   G Y+ L+  Q M
Sbjct  563   QQGQVVETGTHDELLAKGSSGAYAALIRFQEM  594



>ref|XP_007217651.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
 gb|EMJ18850.1| hypothetical protein PRUPE_ppa000359mg [Prunus persica]
Length=1249

 Score =   431 bits (1107),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 246/539 (46%), Positives = 340/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVAAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +R+  + S VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   HNSSLLAARLATDASDVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R+  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRIPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  901   LGSLRRSQTAGLLFGLSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVFVVLVVT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LD  TRI+PD PE  + E+I GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDSQTRIDPDDPEAEIVETIRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP++MV   FNLRI  G   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDIMVFKDFNLRIRTGQSQALVGASGSGKSSVIALIERFYDPIVGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++ AN+H F+S LP+GY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEHGSHSELVSRPDGAYSRLLQLQ  1245


 Score =   297 bits (761),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 190/539 (35%), Positives = 300/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVAKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIMAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLQL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  315

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   ++ L       + G +EFK + F YPS
Sbjct  316   GQSF--SNLGAFSKGKSAGYKLMEIIKQKPTIIQDPLDGKCLSDVNGNIEFKEVTFSYPS  373

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VLID  D+R   L
Sbjct  374   RPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIRTLQL  433

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+ A++   + AAN H+FI+ LP GY+T 
Sbjct  434   KWLRDQIGLVNQEPALFATTILENILYGKPDATMADVEAAASAANAHSFITLLPNGYNTQ  493

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      G
Sbjct  494   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----VG  549

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  550   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQEM  601



>emb|CAD59582.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 emb|CAD41854.2| OSJNBb0079B02.13 [Oryza sativa Japonica Group]
 emb|CAE05967.2| OSJNBa0063C18.8 [Oryza sativa Japonica Group]
Length=1268

 Score =   431 bits (1107),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 345/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   GL +     +QHY + ++GE   T +R  + SA L NE+ WF+
Sbjct  738   NEMEKKTKLYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILTNEVGWFD  797

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ L+  A  
Sbjct  798   EEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLMTSFIVGFIIEWRVALLILATF  857

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++    + R
Sbjct  858   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQNKILSLFSYELR  917

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  918   IPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  973

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     ++ G++E + + 
Sbjct  974   VVTANSVAETVSLAPEIVRGGESIRSIFGILNRATRIEPDDPESERVTNVRGDIELRHVD  1033

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS+VIAL+ RFYD   GKV IDGKD+
Sbjct  1034  FAYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTVIALIERFYDPTGGKVTIDGKDI  1093

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E+I+ +K AN+H F+S LP 
Sbjct  1094  RRLNLKALRLKIGLVQQEPVLFAASILENIAYGKDGATEEEVIQAAKTANVHGFVSQLPN  1153

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1154  GYKTAVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1213

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL+ 
Sbjct  1214  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRIVEHGSHSDLVSRPEGAYSRLLQ  1263

Query  1616  LQ  1621
             LQ
Sbjct  1264  LQ  1265


 Score =   311 bits (798),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 194/546 (36%), Positives = 301/546 (55%), Gaps = 26/546 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  97    EVSKYALYFVYLGLVVCASSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  155

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  I++ +    V  +  WR+ L++ AV+P    
Sbjct  156   TGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAF  215

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  216   AGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFAGESKALNSYSEAIQNTLKL  275

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  276   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  332

Query  743   LWTLIPTVLSAIGIL---KPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G     K     L    R +P    D  +  L   + G +EFK + F 
Sbjct  333   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIVHDHKDGKLLAEVHGNIEFKDVTFS  388

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+VM+   F+L   A   VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  389   YPSRPDVMIFRDFSLFFPAAKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  448

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  449   LQLRWLRDQIGLVNQEPALFATTIHENILYGKPDATMAEVEAAATASNAHSFISTLPNGY  508

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L    
Sbjct  509   NTMVGERGIQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLMT--  566

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ L+  
Sbjct  567   --GR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELLAKGSSGAYASLIRF  618

Query  1619  QSMKDH  1636
             Q M  +
Sbjct  619   QEMAQN  624



>emb|CAC09461.2| H0423H10.7 [Oryza sativa Indica Group]
 gb|EAY95758.1| hypothetical protein OsI_17633 [Oryza sativa Indica Group]
Length=1269

 Score =   431 bits (1107),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 345/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   GL +     +QHY + ++GE   T +R  + SA L NE+ WF+
Sbjct  739   NEMEKKTKLYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILTNEVGWFD  798

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ L+  A  
Sbjct  799   EEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLMTSFIVGFIIEWRVALLILATF  858

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++    + R
Sbjct  859   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQNKILSLFSYELR  918

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  919   IPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  974

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     ++ G++E + + 
Sbjct  975   VVTANSVAETVSLAPEIVRGGESIRSIFGILNRATRIEPDDPESERVTNVRGDIELRHVD  1034

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS+VIAL+ RFYD   GKV IDGKD+
Sbjct  1035  FAYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTVIALIERFYDPTGGKVTIDGKDI  1094

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E+I+ +K AN+H F+S LP 
Sbjct  1095  RRLNLKALRLKIGLVQQEPVLFAASILENIAYGKDGATEEEVIQAAKTANVHGFVSQLPN  1154

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1155  GYKTAVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1214

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL+ 
Sbjct  1215  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRIVEHGSHSDLVSRPEGAYSRLLQ  1264

Query  1616  LQ  1621
             LQ
Sbjct  1265  LQ  1266


 Score =   311 bits (797),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 194/546 (36%), Positives = 301/546 (55%), Gaps = 26/546 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  98    EVSKYALYFVYLGLVVCASSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  156

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  I++ +    V  +  WR+ L++ AV+P    
Sbjct  157   TGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAGLVVGFVAAWRLALLSVAVIPAIAF  216

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  217   AGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  276

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  277   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  333

Query  743   LWTLIPTVLSAIGIL---KPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G     K     L    R +P    D  +  L   + G +EFK + F 
Sbjct  334   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIIHDHKDGKLLAEVHGNIEFKDVTFS  389

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+VM+   F+L   A   VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  390   YPSRPDVMIFRDFSLFFPAAKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  449

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  450   LQLRWLRDQIGLVNQEPALFATTIHENILYGKPDATMAEVEAAATASNAHSFISTLPNGY  509

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L    
Sbjct  510   NTMVGERGIQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLMT--  567

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ L+  
Sbjct  568   --GR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELLAKGSSGAYASLIRF  619

Query  1619  QSMKDH  1636
             Q M  +
Sbjct  620   QEMAQN  625



>ref|XP_002448624.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
 gb|EES12952.1| hypothetical protein SORBIDRAFT_06g030350 [Sorghum bicolor]
Length=1266

 Score =   431 bits (1107),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  735   NEMEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  794

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ ++  A  
Sbjct  795   EEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLMTSFVVGFIIEWRVAILILATF  854

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R
Sbjct  855   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQSKILSLFSHELR  914

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             V  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  915   VPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  970

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     +I G++E + + 
Sbjct  971   VVTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVD  1030

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I AG   ALVG SG+GKS+VIAL+ RFYD   GKV IDGKD+
Sbjct  1031  FSYPARPDIQIFKDFNLKIHAGRSQALVGASGSGKSTVIALIERFYDPCGGKVAIDGKDI  1090

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG E A+E E+IE +K AN+H F+S LP+
Sbjct  1091  RTLNLKSLRLKIGLVQQEPVLFASSILENIAYGKEGATEEEVIEAAKTANVHGFVSQLPD  1150

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1151  GYKTAVGERGMQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1210

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G +VE GSH+ L ++P+G YSRL+ 
Sbjct  1211  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRIVEHGSHNDLLARPEGAYSRLLQ  1260

Query  1616  LQ  1621
             LQ
Sbjct  1261  LQ  1262


 Score =   301 bits (770),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 189/541 (35%), Positives = 297/541 (55%), Gaps = 26/541 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  94    EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  152

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  I++ +    V  +  WR+ L++ AV+P    
Sbjct  153   TGDIVFGVSTDTLLVQDAIGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAF  212

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  213   AGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  272

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  273   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  329

Query  743   LWTLIPTVLSAIGILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G           + + + +   I  D  +      + G +EFK + F 
Sbjct  330   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFS  385

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V++   F+L   AG  VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  386   YPSRPDVIIFRDFSLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  445

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H FIS LP GY
Sbjct  446   LQLRWLRDQIGLVNQEPALFATTILENILYGKPDATIAEVEAAATASNAHGFISLLPNGY  505

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L    
Sbjct  506   NTMVGERGIQLSGGQKQRIAIARAMLKNPKILLLDEATSALDADSESIVQEALDRLM---  562

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ LV  
Sbjct  563   -VGR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELLAKGTSGAYASLVRF  615

Query  1619  Q  1621
             Q
Sbjct  616   Q  616



>ref|XP_010514603.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1254

 Score =   430 bits (1105),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 245/547 (45%), Positives = 349/547 (64%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  722   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  780

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+W++ L+   
Sbjct  781   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWKVSLLILG  840

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  841   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  900

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+   I FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + 
Sbjct  901   LRVPQKRSLYRSQTSGILFGLSQ---LALYG-SEALILWYGAHLVSKGESTFSKVIKVFV  956

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  957   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  1016

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP++MV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1017  VDFAYPSRPDIMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1076

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+EIIE ++AAN H FIS L
Sbjct  1077  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEIIEAARAANAHGFISGL  1136

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1137  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1196

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+ +G +VE GSHS L S+P+G YSRL
Sbjct  1197  MR----GR------TTVVVAHRLSTIRGVDCIGVIQEGRIVEQGSHSELVSRPEGAYSRL  1246

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1247  LQLQTHR  1253


 Score =   288 bits (736),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  84    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  142

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  143   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  202

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  203   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  262

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  263   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  320

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    E + G +EFK + F YPSRP
Sbjct  321   GQSFSNLGAFSKGKAAGYKLLEIINQRPTIIQDPLDGKCLEQVHGNIEFKDVTFSYPSRP  380

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  381   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKF  440

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  441   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANSHSFITLLPKGYDTQVG  500

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  501   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  555

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  556   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  606



>ref|XP_002447959.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
 gb|EES12287.1| hypothetical protein SORBIDRAFT_06g018860 [Sorghum bicolor]
Length=1262

 Score =   429 bits (1104),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 232/530 (44%), Positives = 340/530 (64%), Gaps = 12/530 (2%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y  I+   GL +     +QHY + ++GE   T +R  + +  L+N++ WF++ ENN   +
Sbjct  740   YVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQEENNSNLV  799

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
             T+R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ L+     P   +    
Sbjct  800   TARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILVTFPLLVLANFA  859

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQLHRSRK  571
             Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++     L+ PQ+H  R+
Sbjct  860   QQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVPQMHSLRR  919

Query  572   ESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWT  751
               I   +   + L L+  + A+ LW+   LV+ H S+F   I+ + +  +T  S+ E  +
Sbjct  920   SQISGALFGASQLSLY-ASEALILWFGAHLVRTHVSTFSKVIKVFVVLVITANSVAETVS  978

Query  752   LIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVL  931
             L P ++     ++ VF  L+  TRI+PD P+    ES+ GE++F+ + F YP+RP+VMV 
Sbjct  979   LAPEIVRGGESIRSVFAILNSRTRIDPDDPDAEQVESVRGEIDFRHVDFAYPTRPDVMVF  1038

Query  932   NGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQI  1111
               F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV++DGKD+R  NL+ LR +I
Sbjct  1039  KDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMVDGKDIRRLNLKSLRLRI  1098

Query  1112  GLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQ  1291
             GLVQQEP+LF  SI ENI YG + A+E E++E +K AN+H F+S LP+GY T VGE+G Q
Sbjct  1099  GLVQQEPVLFAASILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYRTPVGERGVQ  1158

Query  1292  LSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKM  1471
             LSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +    GR      
Sbjct  1159  LSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK----GR------  1208

Query  1472  TQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1209  TAVLVAHRLSTIRGVDNIAVVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQ  1258


 Score =   298 bits (763),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 189/540 (35%), Positives = 299/540 (55%), Gaps = 24/540 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  92    EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDAR  150

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +++ +    V  +  WR+ L++ AV+P    
Sbjct  151   TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  210

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  211   AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQNTLKL  270

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  271   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGLSL  328

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F Y
Sbjct  329   GQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDTADGRCLDE-VHGNIEFKEVAFSY  384

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VM+   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++  
Sbjct  385   PSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTL  444

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP GY+
Sbjct  445   QLKWLREQIGLVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYN  504

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+GSE  V  AL+ L     
Sbjct  505   THVGERGLQLSGGQKQRIAIARAMLKNPKLLLLDEATSALDAGSENIVQEALDRLM----  560

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  561   VGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  614



>ref|XP_002983053.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
 gb|EFJ15862.1| hypothetical protein SELMODRAFT_117529 [Selaginella moellendorffii]
Length=1232

 Score =   429 bits (1103),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 229/552 (41%), Positives = 343/552 (62%), Gaps = 23/552 (4%)
 Frame = +2

Query  2     YDSD---AKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNE  172
             Y+ D    K++V  Y   F  + +L+   NTL+HY +G +GE     +RN ++SA L+NE
Sbjct  694   YNPDKHYVKKEVEKYVFFFTGLTILAVLANTLEHYFFGYMGECLTMRVRNMMFSAILKNE  753

Query  173   LAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLV  352
             L WFE+ +N    ++S++ ++ + V+  + DR+S+++Q  + I+    ++ ++ W++ L+
Sbjct  754   LGWFEKADNYSSLVSSQLASDATLVRAAVGDRLSILLQNSALILGGFIIAFVLQWKLTLI  813

Query  353   AWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKA  532
               A+ P      + +    KGF  + +  ++    +A E+ +NI+TV +FC E  V+   
Sbjct  814   VLALFPLLISAHVGEHLFMKGFGVNLSKVYARASVVAGEAVSNIRTVAAFCGESKVLE--  871

Query  533   RVALQPQLHRSRKESIKFGIIQG-----TSLCLWNIAHAVALWYTTLLVQRHQSSFLNAI  697
                   QL   +K S   G + G        CL++ ++ +ALWY   L++   SSF   I
Sbjct  872   --LFNRQLEGIKKNSFARGQVAGLGYGLAQCCLYS-SYGLALWYAAKLIKDGDSSFGPVI  928

Query  698   RSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEV  877
             + + +   T   + E   L P ++ +   +  VF  LDR T I+PD+P+  +   I G++
Sbjct  929   KCFILLIFTAFGVAETLALAPDLMRSSRAVGSVFAILDRKTEIDPDEPDSEIITHIRGDI  988

Query  878   EFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVL  1057
             EFK + F YPSRP+V +    NL++ AG  +ALVG SG+GKSSV+AL+ RFYD   GKVL
Sbjct  989   EFKRVNFSYPSRPDVTIFYDLNLKVRAGSSLALVGASGSGKSSVVALIQRFYDPSAGKVL  1048

Query  1058  IDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTF  1237
             IDG D+R  NL+ LR  IGLVQQEP LF  SI EN+ YG + A+E+E++E +KA N H+F
Sbjct  1049  IDGMDIRRINLKSLRLHIGLVQQEPALFATSIYENVAYGRDGATESEVVEAAKAGNAHSF  1108

Query  1238  ISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSA  1417
             IS+LP+GY T VGE+G+QLSGGQKQR+AIARA+LK PAI+LLDEATSALD+ SE+ V  A
Sbjct  1109  ISSLPDGYQTQVGERGTQLSGGQKQRVAIARAVLKNPAILLLDEATSALDAQSEKVVQEA  1168

Query  1418  LESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGV  1597
             L+ L +    GR      T + VAHRLST+ N+ +I V++ G +VE GSH  L ++ DG 
Sbjct  1169  LDRLMR----GR------TTVLVAHRLSTIQNAGVIAVVEGGRIVEQGSHRELMAKGDGA  1218

Query  1598  YSRLVSLQSMKD  1633
             Y+RLV LQ MK+
Sbjct  1219  YARLVRLQQMKE  1230


 Score =   292 bits (748),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 196/538 (36%), Positives = 289/538 (54%), Gaps = 20/538 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+      L+   +   GE+  + +R     A L  ++ +F+  +  
Sbjct  82    EVSKYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAMLSQDVGFFD-TDAT  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   I ++T+ V+  I  +    V  ++       V     W++ L+  AV+P   +
Sbjct  141   TGEIVIGISSDTALVQEAIGPKAGNYVHYMARFFAGFAVGFTSVWQLTLLTLAVVPAIAV  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G   A +  G +     A++    +A E+ + ++TV SF  EE        AL+  L  
Sbjct  201   AGGAYAYTMVGLTTKNQKAYARAGEIAEETISQVRTVYSFVGEEKAQESYSRALETTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
              +   +  G+  G +  L   + A+ LWY  +LV RH ++  N   ++      V S   
Sbjct  261   GKSGGLAKGLGLGATYGLTFGSWALLLWYAGVLV-RHGTT--NGGEAFTTILNVVISSLS  317

Query  743   LWTLIPTVLSAIGILKP----VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             L    P  L A    K     + + + R   I P+  +     +++G +EF  I F YPS
Sbjct  318   LGNAAPN-LGAFAKGKAAGYNILEMIKRKPAINPNTSDGKTISNVQGNIEFVDIHFSYPS  376

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V +     L+I  G  VA+VG SG+GKS+VIAL+ RFYD   G +L+D  D++   L
Sbjct  377   RPDVTIFQKLCLKIPQGKTVAIVGGSGSGKSTVIALIERFYDPMSGIILLDSHDIKTLQL  436

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR+QIGLV QEP LF  +IRENI  G   AS+ EI E +  A  H FI  LP+GY+T 
Sbjct  437   KWLRSQIGLVNQEPALFATTIRENILLGKPDASDDEIFEAATVAGAHAFIQQLPDGYETQ  496

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGEKG QLSGGQKQR+AI RA++K P+I+LLDEATSALD+ SE++V  AL++L      G
Sbjct  497   VGEKGVQLSGGQKQRVAITRAMVKNPSILLLDEATSALDAASEQSVQEALDTLM----VG  552

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPD-GVYSRLVSLQ  1621
             R      T + VAHRLSTV N+DII V+  G +VE G+HS L ++ + G Y  LV LQ
Sbjct  553   R------TTVVVAHRLSTVQNADIIAVVQGGKIVETGTHSALMAKGESGAYCELVRLQ  604



>ref|XP_008663648.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 gb|AFW59637.1| hypothetical protein ZEAMMB73_350646 [Zea mays]
Length=1266

 Score =   429 bits (1104),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  735   NEMEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  794

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + + +  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ ++  A  
Sbjct  795   EEENNSSLVAAHLAVDAADVKSAIAERISVILQNMTSLMTSFVVGFIIEWRVAILILATF  854

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R
Sbjct  855   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQSKILSLFSHELR  914

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             V  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  915   VPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  970

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     +I G++E + + 
Sbjct  971   VVTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVD  1030

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS++IAL+ RFYD   GKV IDGKD+
Sbjct  1031  FSYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTIIALIERFYDPCGGKVAIDGKDI  1090

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG E ASE E++E +K AN+H F+S LP+
Sbjct  1091  RTLNLKSLRRKIGLVQQEPVLFASSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPD  1150

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1151  GYRTAVGERGMQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1210

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G VVE GSHS L ++P+G YSRL+ 
Sbjct  1211  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRVVEHGSHSDLLARPEGAYSRLLQ  1260

Query  1616  LQ  1621
             LQ
Sbjct  1261  LQ  1262


 Score =   301 bits (772),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 189/541 (35%), Positives = 298/541 (55%), Gaps = 26/541 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  94    EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  152

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  I++ +    V  +  WR+ L++ AV+P    
Sbjct  153   TGDIVFGVSTDTLLVQDAIGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAF  212

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  213   AGGLYAYTLTGLTSKSRESYTNAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  272

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  273   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMS-  329

Query  743   LWTLIPTVLSAIGILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G           + + + +   I  D  +      + G +EFK + F 
Sbjct  330   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFS  385

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V++   F+L   AG  VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  386   YPSRPDVIIFRDFSLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  445

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  446   LQLRWLRDQIGLVNQEPALFATTILENILYGKPDATIAEVEAATTASNAHSFISLLPNGY  505

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L    
Sbjct  506   NTMVGERGIQLSGGQKQRIAIARAMLKNPKILLLDEATSALDADSESIVQEALDRLM---  562

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ L+  
Sbjct  563   -VGR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELLAKGTSGAYASLIRF  615

Query  1619  Q  1621
             Q
Sbjct  616   Q  616



>gb|KHG20565.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   429 bits (1103),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 246/539 (46%), Positives = 339/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  +  A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +++  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  781   HNSSLLAAKLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++    + RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCYELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY   LV    S+F   I+ + +  +T
Sbjct  901   MRSLRRSQTSGLLFGLSQ---LALY-ASEALILWYGAHLVSEGVSTFSKVIKVFVVLVVT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE    E+I GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIVRGGEAVGSVFSILDRSTRIDPDDPEAEPVETIRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVSVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE+IE ++AAN+H F+S LP+GY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFDNITYGKEGATEAEVIEAARAANVHGFVSALPDGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ N D I V+  G +VE GSHS L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRNVDSIGVVQDGRIVEQGSHSELISRPEGAYSRLLQLQ  1245


 Score =   296 bits (758),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 186/537 (35%), Positives = 301/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRTKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V   S+
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMSL  315

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +  + E + G +EFK + F YPSRP
Sbjct  316   GQSFSNLGAFSKGKAAGYKLMEIINQKPSIIQDHLDGKVLEEVNGNIEFKEVTFSYPSRP  375

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++ + F++   AG  +A+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L+ 
Sbjct  376   DVIIFSNFSIFFPAGKTLAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLKW  435

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H FI+ LP GY+T VG
Sbjct  436   LRDQIGLVNQEPALFATTILENILYGKPEATMDEVEAAACAANAHCFITLLPNGYNTQVG  495

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  496   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  550

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  551   -----TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQEM  601



>ref|XP_010425667.1| PREDICTED: ABC transporter B family member 19 [Camelina sativa]
Length=1254

 Score =   429 bits (1104),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 245/547 (45%), Positives = 348/547 (64%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  722   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  780

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+W++ L+   
Sbjct  781   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWKVSLLILG  840

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  841   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  900

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+   I FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + 
Sbjct  901   LRVPQKRSLYRSQTSGILFGLSQ---LALYG-SEALILWYGAHLVSKGESTFSKVIKVFV  956

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  957   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  1016

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP++MV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1017  VDFAYPSRPDIMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1076

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+EIIE ++AAN H FIS L
Sbjct  1077  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEIIEAARAANAHGFISGL  1136

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1137  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1196

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1197  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1246

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1247  LQLQTHR  1253


 Score =   292 bits (747),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  84    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  142

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  143   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  202

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  203   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  262

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  263   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  320

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    E + G +EFK + F YPSRP
Sbjct  321   GQSFSNLGAFSKGKAAGYKLLEIINQRPTIIQDPLDGKCLEQVHGNIEFKDVTFSYPSRP  380

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  381   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKF  440

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  441   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVG  500

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  501   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  555

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  556   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  606



>ref|XP_010502886.1| PREDICTED: ABC transporter B family member 19-like [Camelina 
sativa]
Length=1255

 Score =   429 bits (1103),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 245/547 (45%), Positives = 348/547 (64%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  723   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  781

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+W++ L+   
Sbjct  782   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWKVSLLILG  841

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  842   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  901

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+   I FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + 
Sbjct  902   LRVPQKRSLYRSQTSGILFGLSQ---LALYG-SEALILWYGAHLVSKGESTFSKVIKVFV  957

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  958   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  1017

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP++MV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1018  VDFAYPSRPDIMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1077

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+EIIE ++AAN H FIS L
Sbjct  1078  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEIIEAARAANAHGFISGL  1137

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1138  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1197

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1198  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1247

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1248  LQLQTHR  1254


 Score =   288 bits (736),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  85    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  143

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  144   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  203

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  204   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  263

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  264   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  321

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    E + G +EFK + F YPSRP
Sbjct  322   GQSFSNLGAFSKGKAAGYKLLEIINQRPTIIQDPLDGKCLEQVHGNIEFKDVTFSYPSRP  381

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  382   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTLQLKF  441

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  442   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANSHSFITLLPKGYDTQVG  501

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  502   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  556

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  557   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  607



>ref|XP_004977001.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1264

 Score =   429 bits (1104),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 237/542 (44%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  733   NEMEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  792

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ L+  A  
Sbjct  793   EEENNSSLVAARLAVDAADVKSAIAERISVILQNMTSLMTSFVVGFIIEWRVALLILATF  852

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R
Sbjct  853   PLLVLANFAQQISMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQSKILSLFSHELR  912

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  913   IPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  968

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     +I G++E + + 
Sbjct  969   VVTANSVAETVSLAPEIVRGGESIRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVD  1028

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I AG   ALVG SG+GKS+VIAL+ RFYD   GKV IDGKD+
Sbjct  1029  FAYPARPDIQIFKDFNLKIHAGRSQALVGASGSGKSTVIALIERFYDPTGGKVSIDGKDI  1088

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE +K AN+H F+S LP+
Sbjct  1089  RRLNLKSLRLKIGLVQQEPVLFAASILENIAYGKDGATEEEVIEAAKTANVHGFVSQLPD  1148

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1149  GYKTAVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1208

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G +VE GSH+ L ++P+G YSRL+ 
Sbjct  1209  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRIVEHGSHNELLTRPEGAYSRLLQ  1258

Query  1616  LQ  1621
             LQ
Sbjct  1259  LQ  1260


 Score =   296 bits (759),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 191/541 (35%), Positives = 299/541 (55%), Gaps = 26/541 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  92    EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  150

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  I++ +    V  +  WR+ L++ AV+P    
Sbjct  151   TGDIVFGVSTDTLLVQDAIGEKVGNFIHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAF  210

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  211   AGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  270

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  271   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMS-  327

Query  743   LWTLIPTVLSAIGILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G           + + + +   I  D  +      + G +EFK + F 
Sbjct  328   ----LGQAFSNLGAFSKGKIAGYKLLEIIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFS  383

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+VM+   F+L   AG  VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  384   YPSRPDVMIFRDFSLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  443

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  444   LQLRWLRDQIGLVNQEPALFATTILENILYGKPDATVAEVEAAATASNAHSFISLLPNGY  503

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G+QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L    
Sbjct  504   NTMVGERGTQLSGGQKQRIAIARAMLKNPKILLLDEATSALDADSESIVQEALDRLM---  560

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPD-GVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ LV  
Sbjct  561   -VGR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELLAKGSTGAYASLVRF  613

Query  1619  Q  1621
             Q
Sbjct  614   Q  614



>ref|XP_006593671.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Glycine max]
Length=1091

 Score =   426 bits (1094),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 249/545 (46%), Positives = 338/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  563   ERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  622

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  623   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  682

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE     
Sbjct  683   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSVFCHE-----  737

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
               RV     L RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ +
Sbjct  738   -LRVPQSQSLRRSQTSGFLFGLSQ---LALY-ASEALILWYGAHLVSKGVSTFSKVIKVF  792

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+    ES+ GE+E +
Sbjct  793   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELR  852

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+VMV    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV++DG
Sbjct  853   HVDFAYPSRPDVMVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDG  912

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+H F+S 
Sbjct  913   KDIRKLNLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHGFVSG  972

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LPEGY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE 
Sbjct  973   LPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALER  1032

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSR
Sbjct  1033  LMR----GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRPEGAYSR  1082

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1083  LLQLQ  1087


 Score =   287 bits (734),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 252/439 (57%), Gaps = 15/439 (3%)
 Frame = +2

Query  317   VSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVV  496
             V  +  WR+ L++ AV+P     G + A +  G +  +  +++    +A ++ A ++TV 
Sbjct  18    VGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVY  77

Query  497   SFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQ  676
             S+  E   +N    A+Q  L    K  +  G+  G +  +  ++ A+  WY  + ++  Q
Sbjct  78    SYVGESKALNSYSDAIQNTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQ  137

Query  677   SSFLNAIRSYQIFSLTVP--SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEES  850
             +    A  +  IFS  V   S+ + ++ +            + + +++   I  D  E  
Sbjct  138   TDGGKAFTA--IFSAIVGGMSLGQSFSNLGAFSKGKAAGYKLMEIINQKPTIVEDPSEGK  195

Query  851   LSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRF  1030
                 + G +EFK + F YPSRP++ +   F++   AG  VA+VG SG+GKS+V++L+ RF
Sbjct  196   CLAEVNGNIEFKDVTFSYPSRPDMFIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERF  255

Query  1031  YDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEV  1210
             YD +EG+VL+D  D++   L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   
Sbjct  256   YDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAA  315

Query  1211  SKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDS  1390
             + AAN H+FI+ LP GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+
Sbjct  316   TSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDA  375

Query  1391  GSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHS  1570
             GSE  V  AL+ L      GR      T + VAHRLST+ N D I V+ +G VVE G+H 
Sbjct  376   GSESIVQEALDRLM----VGR------TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHE  425

Query  1571  TLTSQPDGVYSRLVSLQSM  1627
              L ++  G Y+ L+  Q M
Sbjct  426   ELIAKA-GTYASLIRFQEM  443



>ref|XP_006290510.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
 gb|EOA23408.1| hypothetical protein CARUB_v10016588mg [Capsella rubella]
Length=1252

 Score =   429 bits (1103),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 245/547 (45%), Positives = 347/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  720   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+   
Sbjct  779   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILG  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  839   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHE  898

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+     FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + 
Sbjct  899   LRVPQKRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGESTFSKVIKVFV  954

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  955   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  1014

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1015  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1074

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE ++AAN H FIS L
Sbjct  1075  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGL  1134

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1135  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1194

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1195  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1244

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1245  LQLQTHR  1251


 Score =   291 bits (744),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 183/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSRYSLYFIYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLRQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSIAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IF+  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFAAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    E + G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPLDGQCLEQVHGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  379   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKKLQLKF  438

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  439   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVG  498

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  499   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  553

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  554   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  604



>ref|XP_002279471.2| PREDICTED: ABC transporter B family member 13-like [Vitis vinifera]
Length=1254

 Score =   429 bits (1103),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 234/546 (43%), Positives = 344/546 (63%), Gaps = 18/546 (3%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             D   KR+V   S+IF    +L+ F   LQHY Y ++GE+  T +R  ++SA L NE+ WF
Sbjct  718   DFQIKREVDHISLIFVGAAILTIFIYLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWF  777

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             +  EN+ GSLTS++  + + V+  ++DR+S IVQ ++  V A  ++  + WR+  V  A 
Sbjct  778   DLDENSTGSLTSKLAADATLVRSALADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIAS  837

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHV-VNKARVA  541
              P      + +    KGF GD T A+++  ++A E+ ANI+TV +F  E+ + +  A   
Sbjct  838   FPLLIGASITEQLFLKGFGGDYTRAYAQATAVAREAIANIRTVAAFGAEDRISLQFASEL  897

Query  542   LQPQ---LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQI  712
              QP    L R       +G+ Q  + C    ++A+ LWY ++L++ + S+F + I+S+ +
Sbjct  898   NQPNKQALLRGHISGFGYGVSQLFAFC----SYALGLWYASVLIKHNDSNFGDIIKSFMV  953

Query  713   FSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTI  892
               +T  S+ E   L P ++     L  VF  L R T I  D P  S+   I+G++EF+ +
Sbjct  954   LIITAFSVAETLALTPDIVKGSQALGSVFSILQRKTAINRDNPTSSVVTDIQGDIEFRNV  1013

Query  893   KFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKD  1072
              F YP+RP++++    NL+I AG  +A+VG SG+GKS+VI+L++RFYD   G V+IDG D
Sbjct  1014  SFRYPARPDLIIFKDLNLKISAGKSLAIVGQSGSGKSTVISLVMRFYDPTSGAVMIDGFD  1073

Query  1073  VRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLP  1252
             ++  NLR LR +IGLVQQEP LF  +I ENI YG+E ASE EI++ ++AAN H+FIS +P
Sbjct  1074  IKGLNLRSLRMKIGLVQQEPALFSTTIYENIRYGNEEASEIEIMKAARAANAHSFISRMP  1133

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
             EGY T VG++G QLSGGQKQR+AIARA+LK P+I+LLDEATSALD+ SE+ V  AL++L 
Sbjct  1134  EGYQTQVGDRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTASEKLVQEALDTLM  1193

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLV  1612
             +    GR      T I +AHRLST+ N+D I V+  G VVE G H  L ++P  +Y +LV
Sbjct  1194  E----GR------TTILIAHRLSTIHNADSIAVLQHGKVVETGDHRQLITRPGSIYKQLV  1243

Query  1613  SLQSMK  1630
             SLQ  K
Sbjct  1244  SLQQEK  1249


 Score =   272 bits (696),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 186/511 (36%), Positives = 275/511 (54%), Gaps = 29/511 (6%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+    LR     + L+ ++ +F+  E    ++T  I N+   ++  I D++   ++ +
Sbjct  120   GERQTARLRLKYLQSVLRQDINFFD-TEARDKNITFHISNDAILLQDAIGDKIGHGLRYL  178

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             S   +   +     W++ L+  AV+P   I G          S    AA++E   +A E+
Sbjct  179   SQFFVGFAIGFTSVWQLTLLTVAVVPLMAIAGGAYTVIMTTLSEKGEAAYAEAGKVAEEA  238

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              + ++TV SF  E+  V     +LQ  L   +K     GI  G +  L   A A+ LWY 
Sbjct  239   ISQVRTVYSFVGEDRAVETYSRSLQKALKLGKKSGFAKGIGIGFTYGLLFCAWALLLWYA  298

Query  653   TLLVQRHQ--------SSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTL  808
             + LV RH         ++ LN I S        P++  +        + + +++      
Sbjct  299   SKLV-RHGDTNGGKAFTTILNVIFSGFALGQAAPNLAAIAKGRAAAANIVNMIET-----  352

Query  809   DRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPS  988
             D       D     +   + G++EF  + F YPSRP  MV    +  I AG   A+VGPS
Sbjct  353   DSTASKRLDNG--IMLPKVAGQLEFCEVCFAYPSRPS-MVFENLSFSIYAGKTFAVVGPS  409

Query  989   GAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENIC  1168
             G+GKS++I+++ RFY+   GK+L+DG D+++  L+ LRAQ+GLV QEP LF  +I  NI 
Sbjct  410   GSGKSTIISMVQRFYEPTSGKILLDGHDIKNLRLKWLRAQMGLVSQEPALFATTIAGNIL  469

Query  1169  YGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRP  1348
             YG E A   ++IE +KAAN H+F+  LP+GY T VGE G+QLSGGQKQRIAIARA+L+ P
Sbjct  470   YGKEDADMDQVIEAAKAANAHSFVQGLPDGYQTQVGEGGTQLSGGQKQRIAIARAVLRNP  529

Query  1349  AIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIV  1528
              I+LLDEATSALD+ SE  V  AL+ +  +           T I VAHRLST+ + + I+
Sbjct  530   KILLLDEATSALDAESELIVQKALDKIMLNR----------TTIVVAHRLSTIRDVNKII  579

Query  1529  VMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             V+  G VVE G+H  L SQ  G Y+ LVSLQ
Sbjct  580   VLKNGQVVESGTHLELISQ-GGEYATLVSLQ  609



>gb|KCW46711.1| hypothetical protein EUGRSUZ_K00531 [Eucalyptus grandis]
Length=966

 Score =   422 bits (1085),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 260/314 (83%), Gaps = 0/314 (0%)
 Frame = +2

Query  2    YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
            Y   AKR+VGWYS+ F+ IGLLS  ++ LQHY +GVVGEKAMTNLR +L+S  L NE AW
Sbjct  651  YHKHAKREVGWYSIPFSLIGLLSLVSHILQHYYFGVVGEKAMTNLRKALFSGVLHNEFAW  710

Query  182  FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
            FE+PEN++G +TSRI+N+TS VK+IISDRMSVIVQCI+SI+IAT VSMIV+WRMGLVAWA
Sbjct  711  FEKPENSIGMVTSRIINDTSMVKVIISDRMSVIVQCITSILIATVVSMIVNWRMGLVAWA  770

Query  362  VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
            VMPCHFIGGLIQAKSAKGF+GD++AAH +VVSL SESA NI+TV SFC+EE ++ KA++ 
Sbjct  771  VMPCHFIGGLIQAKSAKGFAGDSSAAHGKVVSLTSESATNIRTVASFCYEEQILRKAKLT  830

Query  542  LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
            L+  +  SR+ SIK+GIIQG SLCLWNIAHA+ALWYT +L+ R Q++F N IRSYQIFSL
Sbjct  831  LEVPMKESRRTSIKYGIIQGFSLCLWNIAHAIALWYTAVLIDRGQATFENGIRSYQIFSL  890

Query  722  TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
            TVPSITELWTLIPTVLSA+ IL P FQTLDR T IEPD  E +    IEG  EF+ +KF 
Sbjct  891  TVPSITELWTLIPTVLSAMSILTPAFQTLDRKTEIEPDVLENTHQGRIEGTAEFQNVKFK  950

Query  902  YPSRPEVMVLNGFN  943
            YPSRPEV VL  F+
Sbjct  951  YPSRPEVTVLKNFS  964


 Score =   271 bits (693),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 182/504 (36%), Positives = 269/504 (53%), Gaps = 13/504 (3%)
 Frame = +2

Query  116   EKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcis  295
             E+    +R     + L+ E+  F+  E + G + + I    S ++  I +++   + C +
Sbjct  112   ERQTARIRLEFLRSVLRQEIGAFD-TELSSGKIIAGISTHMSVIQDAIGEKLGHFLSCFA  170

Query  296   siviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesa  475
             +      ++ I  W + LV   V+P   + G    K     S       SE  ++  ++ 
Sbjct  171   TFFSGVLIAFICSWEVSLVTLFVVPFILLIGATYTKKMNAISAAKMIYLSEATTVVEQTI  230

Query  476   aNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTT  655
             ++IKTV +F  E+  +      +  Q   SR E++  G+  G    + N + A+ +W   
Sbjct  231   SHIKTVFAFVGEDRAIKSFSDCMDKQSVISRGEALIKGVGTGMFQAVTNSSWALIIWIGA  290

Query  656   LLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPD  835
             ++V   +SS  N I +         SIT     +     A      VF+ + R   I   
Sbjct  291   IVVTAGRSSGGNVIAAVMSILFGAISITYAAPDMQVFNQAKAAGNEVFKVIRRQPTISNA  350

Query  836   KPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIA  1015
                  L E IEG ++ + I F YPSR + ++L GF L I AG  VALVG SG GKS+VI+
Sbjct  351   SGGIVLKE-IEGNIDIRNIHFAYPSREDKVILQGFTLSIPAGKTVALVGSSGCGKSTVIS  409

Query  1016  LLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEA  1195
             L+ RFYD  +G +LID  +++D +L+ LR  IG V QEP LF  +I++N+  G+  A + 
Sbjct  410   LVARFYDPSKGVILIDNHNIKDLDLKCLRQNIGAVSQEPSLFAGTIKDNLKVGNLDADDQ  469

Query  1196  EIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEAT  1375
             +I   +  AN H FIS LP+ Y T VG++G QLSGGQKQRIAIARA+LK P I+LLDEAT
Sbjct  470   QIENAAMMANAHYFISQLPDKYSTEVGQRGFQLSGGQKQRIAIARAVLKNPPILLLDEAT  529

Query  1376  SALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVE  1555
             SALDS SE+ V  ALE   Q    GR      T I +AHRLST+VN+D I V++ G V E
Sbjct  530   SALDSQSEKLVQKALEKAMQ----GR------TVILIAHRLSTIVNADEIAVVENGHVKE  579

Query  1556  MGSHSTLTSQPDGVYSRLVSLQSM  1627
              G+HSTL       Y+ L ++Q++
Sbjct  580   TGTHSTLLDTSK-FYNSLFNMQNI  602



>ref|XP_011008935.1| PREDICTED: ABC transporter B family member 19 [Populus euphratica]
Length=1251

 Score =   429 bits (1102),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 246/548 (45%), Positives = 339/548 (62%), Gaps = 36/548 (7%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  723   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILKNEVGWFDEEE  782

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  783   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  842

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE  V  
Sbjct  843   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQGKVLSLFCHELRV--  900

Query  527   KARVALQPQLH---RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAI  697
                    PQLH   RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I
Sbjct  901   -------PQLHSLRRSQTSGLLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSKVI  949

Query  698   RSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEV  877
             + + +  +T  S+ E  +L P ++     +  VF  L+R T+I+PD  E    ES+ GE+
Sbjct  950   KVFVVLVITANSVAETVSLAPEIIRGGEAVGSVFSILERSTKIDPDDSEAEPVESLRGEI  1009

Query  878   EFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVL  1057
             E + + F YPSRP+V V    NLRI AG   ALVG SG GKSSVI+L+ RFYD   GKV+
Sbjct  1010  ELRHVDFAYPSRPDVPVFKDLNLRIRAGQSQALVGASGCGKSSVISLIERFYDPMAGKVM  1069

Query  1058  IDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTF  1237
             IDGKD+R  NL+ LR +IGLVQQEP LF  SI +NI YG + A+EAE+IE ++AAN+H F
Sbjct  1070  IDGKDIRRLNLKSLRLKIGLVQQEPALFAASIFDNIAYGKDGATEAEVIEAARAANVHGF  1129

Query  1238  ISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSA  1417
             +S LP+GY+T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  A
Sbjct  1130  VSALPDGYETPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEA  1189

Query  1418  LESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGV  1597
             LE L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG 
Sbjct  1190  LERLMR----GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHSELVSRPDGA  1239

Query  1598  YSRLVSLQ  1621
             Y RL+ LQ
Sbjct  1240  YFRLLQLQ  1247


 Score =   300 bits (767),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +G++   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  81    EVSKYALYFVYLGIVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  139

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  199

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  ++++   +A ++ A ++TV SF  E   ++    A+Q  L  
Sbjct  200   AGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVYSFVGESKALSSYTDAIQNTLKL  259

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  260   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  317

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + + +   I  D  +      + G +EFK++ F YPSRP
Sbjct  318   GQSFSNLGAFSKGKAAGYKLMEIIKQRPSITQDAADGKCMPEVNGNIEFKSVTFSYPSRP  377

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   LR 
Sbjct  378   DVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDSVDIKTLQLRW  437

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+T VG
Sbjct  438   LRDQIGLVNQEPALFATTILENIRYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVG  497

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      GR 
Sbjct  498   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----IGR-  552

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  553   -----TTVVVAHRLSTIRNVDTIAVIQQGLVVETGTHEELIAKA-GAYASLIRFQEM  603



>ref|XP_002965566.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ32986.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1243

 Score =   428 bits (1101),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 229/552 (41%), Positives = 343/552 (62%), Gaps = 23/552 (4%)
 Frame = +2

Query  2     YDSD---AKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNE  172
             Y+ D    K++V  Y   F  + +L+   NTL+HY +G +GE     +RN ++SA L+NE
Sbjct  705   YNPDKHYVKKEVEKYVFFFTGLTILAVLANTLEHYFFGYMGECLTMRVRNMMFSAILKNE  764

Query  173   LAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLV  352
             L WFE+ +N    ++S++ ++ + V+  + DR+S+++Q  + I+    ++ ++ W++ L+
Sbjct  765   LGWFEKADNYSSLVSSQLASDATLVRAAVGDRLSILLQNSALILGGFIIAFVLQWKLTLI  824

Query  353   AWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKA  532
               A+ P      + +    KGF  + +  ++    +A E+ +NI+TV +FC E  V+   
Sbjct  825   VLALFPLLISAHVGEHLFMKGFGVNLSKVYARASVVAGEAVSNIRTVAAFCGESKVLE--  882

Query  533   RVALQPQLHRSRKESIKFGIIQG-----TSLCLWNIAHAVALWYTTLLVQRHQSSFLNAI  697
                   QL   +K S   G + G        CL++ ++ +ALWY   L++   SSF   I
Sbjct  883   --LFNRQLEGIKKNSFARGQVAGLGYGLAQCCLYS-SYGLALWYAAKLIKDGDSSFGPVI  939

Query  698   RSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEV  877
             + + +   T   + E   L P ++ +   +  VF  LDR T I+PD+P+  +   I G++
Sbjct  940   KCFILLIFTAFGVAETLALAPDLMRSSRAVGSVFAILDRKTEIDPDEPDSEVITHIRGDI  999

Query  878   EFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVL  1057
             EFK + F YPSRP+V +    NL++ AG  +ALVG SG+GKSSV+AL+ RFYD   GKVL
Sbjct  1000  EFKRVNFSYPSRPDVAIFYDLNLKVRAGSSLALVGASGSGKSSVVALIQRFYDPSAGKVL  1059

Query  1058  IDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTF  1237
             IDG D+R  NL+ LR  IGLVQQEP LF  SI EN+ YG + A+E+E++E +KA N H+F
Sbjct  1060  IDGMDIRRINLKSLRLHIGLVQQEPALFATSIYENVAYGRDGATESEVVEAAKAGNAHSF  1119

Query  1238  ISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSA  1417
             IS+LP+GY T VGE+G+QLSGGQKQR+AIARA+LK PAI+LLDEATSALD+ SE+ V  A
Sbjct  1120  ISSLPDGYQTQVGERGTQLSGGQKQRVAIARAVLKNPAILLLDEATSALDAQSEKVVQEA  1179

Query  1418  LESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGV  1597
             L+ L +    GR      T + VAHRLST+ N+ +I V++ G +VE GSH  L ++ DG 
Sbjct  1180  LDRLMR----GR------TTVLVAHRLSTIQNAGVIAVVEGGRIVEQGSHRELMAKGDGA  1229

Query  1598  YSRLVSLQSMKD  1633
             Y+RLV LQ MK+
Sbjct  1230  YARLVRLQQMKE  1241


 Score =   248 bits (633),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 184/543 (34%), Positives = 276/543 (51%), Gaps = 32/543 (6%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+      L+   +   GE+  + +R     A L  ++ +F+  +  
Sbjct  82    EVSKYSLYFVYLGLVILVAAWLEVSCWTYTGERQSSRMRTHYLKAMLSQDVGFFD-TDAT  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   I ++T+ V+  I  +    V  ++       V     W++ L+  AV+P   +
Sbjct  141   TGEIVIGISSDTALVQEAIGPKAGNYVHYMARFFAGFAVGFTSVWQLTLLTLAVVPAIAV  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G   A +  G +     A++    +A E+ + ++TV SF  EE        AL+  L  
Sbjct  201   AGGAYAYTMVGLTTKNQKAYARAGEIAEETISQVRTVYSFVGEEKAQELYSRALETTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
              +   +  G+  G +  L   + A+ LWY  +LV RH ++  N   ++      V S   
Sbjct  261   GKSGGLAKGLGLGATYGLTFGSWALLLWYAGVLV-RHGTT--NGGEAFTTILNVVISSLS  317

Query  743   LWTLIPTVLSAIGILKP----VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPS  910
             L    P  L A    K     + + + R   I P+  +     +++G +EF  I F YPS
Sbjct  318   LGNAAPN-LGAFAKGKAAGYNILEMIKRKPAINPNTSDGKTISNVQGNIEFVDIHFSYPS  376

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V +     L+I  G  VA+VG SG+GKS+VIAL+ RFYD     V       R    
Sbjct  377   RPDVTIFQKLCLKIPQGKTVAIVGGSGSGKSTVIALIERFYDPMHNLV-------RFSRH  429

Query  1091  RKLRAQIGL-----VQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             + + AQ+        +    + C +IRENI  G   AS+ EI E +  A  H FI  LP+
Sbjct  430   QDVAAQMATESNWSCESRAGIICTTIRENILLGKPDASDDEIFEAATVAGAHAFIQQLPD  489

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGEKG QLSGGQKQR+AI RA++K P+I+LLDEATSALD+ SE++V  AL++L  
Sbjct  490   GYETQVGEKGVQLSGGQKQRVAITRAMVKNPSILLLDEATSALDAASEQSVQEALDTLM-  548

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPD-GVYSRLV  1612
                 GR      T + VAHRLSTV N+DII V+  G +VE G+HS L ++ + G Y  LV
Sbjct  549   ---IGR------TTVVVAHRLSTVQNADIIAVVQGGKIVETGTHSALMAKGESGAYCELV  599

Query  1613  SLQ  1621
              LQ
Sbjct  600   RLQ  602



>ref|XP_008668793.1| PREDICTED: ABC transporter B family member 19-like [Zea mays]
 tpg|DAA35746.1| TPA: hypothetical protein ZEAMMB73_634725 [Zea mays]
Length=1266

 Score =   429 bits (1102),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 239/542 (44%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  735   NEIEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  794

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  I++WR+ ++  A  
Sbjct  795   EEENNSSLVAARLGVDAADVKSAIAERISVILQNMTSLMTSFVVGFIIEWRVAILILATF  854

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH+    +A E+ +NI+TV +F  +  ++    ++ R
Sbjct  855   PLLVLANFAQQLSMKGFAGDTAKAHARSSMVAGEAVSNIRTVAAFNAQSKILSLFSHELR  914

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             V  Q  L RS+   + FG+ Q   LCL++ + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  915   VPEQQILRRSQTSGLLFGLSQ---LCLYS-SEALILWYGSHLVRSHGSTFSKVIKVFVVL  970

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     +I G++E + + 
Sbjct  971   VVTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPESERVTTIRGDIELRHVD  1030

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YP+RP++ +   FNL+I+AG   ALVG SG+GKS+VIAL+ RFYD   GKV IDGKD+
Sbjct  1031  FSYPARPDIQIFKDFNLKIQAGRSQALVGASGSGKSTVIALIERFYDPCGGKVAIDGKDI  1090

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG E ASE E++E +K AN+H F+S LP+
Sbjct  1091  RTLNLKSLRLKIGLVQQEPVLFASSILENIAYGKEGASEEEVVEAAKTANVHGFVSQLPD  1150

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1151  GYRTAVGEQGMQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1210

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G VVE GSHS L ++P+G Y RL+ 
Sbjct  1211  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRVVEHGSHSDLLARPEGAYLRLLQ  1260

Query  1616  LQ  1621
             LQ
Sbjct  1261  LQ  1262


 Score =   299 bits (765),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 187/541 (35%), Positives = 296/541 (55%), Gaps = 26/541 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  94    EVAKYALYFVYLGLVVCVSSYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  152

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  I++ +    V  +  WR+ L++ AV+P    
Sbjct  153   TGDIVFGVSTDTLLVQDGIGEKVGNFMHYIATFLAGLVVGFVSAWRLALLSVAVIPAIAF  212

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++   ++TV SF  E   +N    A+Q  L  
Sbjct  213   AGGLYAYTLTGLTSKSRESYANAGVVAEQAIGQVRTVYSFVGESKALNSYSEAIQNTLKL  272

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  273   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  329

Query  743   LWTLIPTVLSAIGILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G           + + + +   I  D  +      + G +EFK + F 
Sbjct  330   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIVNDHKDGKWLAEVHGNIEFKEVTFS  385

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V++   F+L   AG  VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  386   YPSRPDVIIFRDFSLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  445

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  446   LQLRWLREQIGLVNQEPALFATTILENILYGKPDATIAEVEAAATASNAHSFISLLPNGY  505

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+ GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L    
Sbjct  506   NTMAGERGIQLSGGQKQRIAIARAMLKNPKILLLDEATSALDADSESIVQEALDRLM---  562

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L ++   G Y+ LV  
Sbjct  563   -VGR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELIAKGTSGAYASLVRF  615

Query  1619  Q  1621
             Q
Sbjct  616   Q  616



>ref|XP_008379345.1| PREDICTED: ABC transporter B family member 19 [Malus domestica]
Length=1250

 Score =   428 bits (1101),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 243/537 (45%), Positives = 342/537 (64%), Gaps = 12/537 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++  +GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFMYIGVGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   LT+++  + + VK  IS+R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   HNSNLLTTKLATDAADVKSAISERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++     L+ PQ
Sbjct  842   VLSNYAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRLPQ  901

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             L   R+     G++ G S    + + A+ LWY   LV +  S+F   I+ + +  +T  S
Sbjct  902   LGSLRRSQTA-GVLFGLSQFALHASEALILWYGAHLVSKGVSTFSKVIKVFVVLVVTANS  960

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     +  VF  LDR T+I+PD PE  + ES+ GE+E + + F YPSR
Sbjct  961   VAETVSLAPEIIRGGEAVGSVFSILDRQTKIDPDDPEAEVVESVRGEIELRHVDFAYPSR  1020

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI  G   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  NL+
Sbjct  1021  PDVMVFKDFSLRIRTGQSQALVGASGSGKSSVIALIERFYDPXVGKVMIDGKDIRRLNLK  1080

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++ AN+H F+S LP+GY T V
Sbjct  1081  SLRLKIGLVQQEPALFASSIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYKTPV  1140

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +    GR
Sbjct  1141  GERGVQLSGGQKQRIAIARAVLKDPRILLLDEATSALDAESECVLQEALERLMR----GR  1196

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
                   T + VAHRLST+   D I V+  G +VE GSHS L S+PDG Y+RL+ LQ+
Sbjct  1197  ------TTVLVAHRLSTIRGVDSIGVVQDGRIVEHGSHSELASRPDGAYTRLLQLQN  1247


 Score =   297 bits (761),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 188/539 (35%), Positives = 298/539 (55%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   T+  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVAKYALYFVYLGLIVCVTSYAEIACWMYTGERQVSRLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   I  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRQSYANAGIMADQAIAQVRTVYSYVGESKALNSYSDAIQNTLQL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  316

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   ++ L       + G +EFK + F YPS
Sbjct  317   GQSF--SNLGAFSKGKSAGYKLMEIIKQKPTIVQDPLDGKCLSDVSGNIEFKEVTFSYPS  374

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VLID  D++   L
Sbjct  375   RPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIKTLQL  434

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+  ++   + +AN H+FI+ LP GY+T 
Sbjct  435   KWLRDQIGLVNQEPALFATTILENILYGKPDATMEDVEVAASSANAHSFITLLPXGYNTQ  494

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      G
Sbjct  495   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----VG  550

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  551   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQEM  602



>gb|KCW51753.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1250

 Score =   428 bits (1101),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 241/539 (45%), Positives = 339/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ I++WR+ L+  A  P  
Sbjct  782   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R+  
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNRILSLFCHELRLPQ  901

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY   LV R  S+F   I+ + +  +T
Sbjct  902   MRSLGRSQTAGLLFGVSQ---LALYA-SEALILWYGAHLVSRGMSTFSKVIKVFVVLVIT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE     S+ GE+E + + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPEAEQVGSLRGEIELRHVDFAY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V+V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1018  PSRPDVVVFKDLNLRIRAGHSQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  +I +NI YG E A+EAE+IE ++ AN+H F+S LP+GY 
Sbjct  1078  NLKSLRLKIGLVQQEPALFAANILDNIAYGKEGATEAEVIEAARTANVHGFVSALPDGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD  SE  +  ALE L +   
Sbjct  1138  TPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDPESECVLQEALERLMR---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L S+P+G YSRL+ LQ
Sbjct  1195  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHAELVSRPEGAYSRLLQLQ  1246


 Score =   285 bits (729),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 193/548 (35%), Positives = 301/548 (55%), Gaps = 24/548 (4%)
 Frame = +2

Query  8     SDAKR---KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELA  178
             SD K+   +V  Y++ F  +GL+   ++  +   +   GE+  + LR     A L+ ++ 
Sbjct  71    SDLKKMTQEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQASTLRKKYLEAVLRQDVG  130

Query  179   WFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAW  358
             +F+  +   G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ 
Sbjct  131   FFD-TDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVAAWRLALLSV  189

Query  359   AVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARV  538
             AV+P     G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    
Sbjct  190   AVIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGECKALNSYSD  249

Query  539   ALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFS  718
             A+Q  L    K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS
Sbjct  250   AIQNTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFS  307

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFK  886
               V  ++   +   + L A    K     L    R +P    D         I G +EFK
Sbjct  308   AIVGGMSLGQSF--SNLGAFSKGKAAGYKLMEVIRQKPSIGHDPSNGKTLPEINGNIEFK  365

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D 
Sbjct  366   DVTFSYPSRPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDN  425

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
              D++   L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ 
Sbjct  426   VDLKALQLKWLRDQIGLVNQEPALFATTILENIIYGKPDATMAEVEAAATAANAHSFITL  485

Query  1247  LPEGYDT-VVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALE  1423
             LP+GY T  VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+GSE  V  AL+
Sbjct  486   LPKGYSTQQVGERGVQLSGGQKQRIAIARAMLKNPKVLLLDEATSALDAGSESIVQEALD  545

Query  1424  SLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYS  1603
              L      GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+
Sbjct  546   RLM----VGR------TTVVVAHRLSTIRNVDSIAVIQQGLVVETGTHEELIAKA-GAYA  594

Query  1604  RLVSLQSM  1627
              L+  Q M
Sbjct  595   SLIRFQEM  602



>ref|XP_010032346.1| PREDICTED: ABC transporter B family member 19 [Eucalyptus grandis]
 gb|KCW51754.1| hypothetical protein EUGRSUZ_J01214 [Eucalyptus grandis]
Length=1249

 Score =   428 bits (1101),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 241/539 (45%), Positives = 339/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ I++WR+ L+  A  P  
Sbjct  781   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R+  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNRILSLFCHELRLPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY   LV R  S+F   I+ + +  +T
Sbjct  901   MRSLGRSQTAGLLFGVSQ---LALYA-SEALILWYGAHLVSRGMSTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE     S+ GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPEAEQVGSLRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V+V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVVVFKDLNLRIRAGHSQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  +I +NI YG E A+EAE+IE ++ AN+H F+S LP+GY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAANILDNIAYGKEGATEAEVIEAARTANVHGFVSALPDGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD  SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDPESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHAELVSRPEGAYSRLLQLQ  1245


 Score =   290 bits (741),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 193/547 (35%), Positives = 301/547 (55%), Gaps = 23/547 (4%)
 Frame = +2

Query  8     SDAKR---KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELA  178
             SD K+   +V  Y++ F  +GL+   ++  +   +   GE+  + LR     A L+ ++ 
Sbjct  71    SDLKKMTQEVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQASTLRKKYLEAVLRQDVG  130

Query  179   WFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAW  358
             +F+  +   G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ 
Sbjct  131   FFD-TDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVAAWRLALLSV  189

Query  359   AVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARV  538
             AV+P     G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    
Sbjct  190   AVIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGECKALNSYSD  249

Query  539   ALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFS  718
             A+Q  L    K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS
Sbjct  250   AIQNTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFS  307

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFK  886
               V  ++   +   + L A    K     L    R +P    D         I G +EFK
Sbjct  308   AIVGGMSLGQSF--SNLGAFSKGKAAGYKLMEVIRQKPSIGHDPSNGKTLPEINGNIEFK  365

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D 
Sbjct  366   DVTFSYPSRPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDN  425

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
              D++   L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ 
Sbjct  426   VDLKALQLKWLRDQIGLVNQEPALFATTILENIIYGKPDATMAEVEAAATAANAHSFITL  485

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LP+GY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+GSE  V  AL+ 
Sbjct  486   LPKGYSTQVGERGVQLSGGQKQRIAIARAMLKNPKVLLLDEATSALDAGSESIVQEALDR  545

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L      GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ 
Sbjct  546   LM----VGR------TTVVVAHRLSTIRNVDSIAVIQQGLVVETGTHEELIAKA-GAYAS  594

Query  1607  LVSLQSM  1627
             L+  Q M
Sbjct  595   LIRFQEM  601



>ref|XP_010460562.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Camelina sativa]
Length=1240

 Score =   427 bits (1099),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 339/541 (63%), Gaps = 18/541 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             KR +   ++IF   G+++     LQHY Y ++GE+    +R SL+SA L NE+ WF+  E
Sbjct  713   KRDIEKVAIIFVVAGIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDE  772

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  ++DR+S IVQ +S  V A  ++    WR+  V  A  P  
Sbjct  773   NNTGSLTSILAADATLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLL  832

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL----  544
                 L +    KGF GD T A+S+  S+A E+ ANI+TV +F  E+ +  +    L    
Sbjct  833   IAASLTEQLFLKGFGGDYTRAYSKATSVAREAIANIRTVAAFGVEKQISEQFTSELSKPT  892

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +    R       +G+ Q  + C    ++A+ LWY ++L++  +++F ++I+S+ +  +T
Sbjct  893   KNAFVRGHISGFGYGLSQFLAFC----SYALGLWYVSVLIKHKETNFGDSIKSFMVLIVT  948

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S++E   L P ++     L  VF+ L R T+I P+K    L   I G++EF+++ F Y
Sbjct  949   AFSVSETLALTPDIVKGTQALGSVFRVLHRETKITPNKLNSQLITQINGDIEFRSVSFAY  1008

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPE+ +    NLR+ AG  +A+VGPSG+GKS+VI L++RFYD + G + IDG+D++  
Sbjct  1009  PTRPEITIFQNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPNNGNLCIDGQDIKTL  1068

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR +I LVQQEP LF  +I ENI YG E ASEAEII  +KAAN H FI+ + EGY 
Sbjct  1069  NLRSLRKKIALVQQEPALFSTTIYENIKYGKENASEAEIIGAAKAANAHEFITRMEEGYK  1128

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG+KG+QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +   
Sbjct  1129  THVGDKGAQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDELMK---  1185

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+  +D I V+ +G VVE GSHS L S P+G Y +L SLQ 
Sbjct  1186  -GR------TTVLVAHRLSTIRKADTIAVLHRGRVVEKGSHSELVSIPNGFYKQLTSLQE  1238

Query  1625  M  1627
             +
Sbjct  1239  V  1239


 Score =   277 bits (709),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 188/512 (37%), Positives = 285/512 (56%), Gaps = 28/512 (5%)
 Frame = +2

Query  110   VGEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqc  289
             +GE+    LR +   + L  ++ +F+  E    +L   I ++   V+  I D+   +++ 
Sbjct  112   IGERQTARLRINYLKSILAKDITFFD-TEARDSNLIYHISSDAILVQDAIGDKTDHVLRY  170

Query  290   issiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslase  469
             +S  +    +  +  W++ L+  AV+P   I G   A      S  + AA+++   +A E
Sbjct  171   LSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIAGGGYAIIMSTISEKSEAAYADAGKVAEE  230

Query  470   saaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWY  649
               + ++TV +F  EE  V     +L+  L   +K  +  G+  G +  L   A A+ LWY
Sbjct  231   VMSQVRTVYAFVGEEKAVKSYSTSLKKALKLGKKSGLAKGLGVGLTYSLLFCAWALLLWY  290

Query  650   TTLLVQRHQS-------SFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQT-  805
              ++LV+  ++       + LN I S        PS++    +    ++A  I K +    
Sbjct  291   ASILVRHGKTNGAKAFTTILNVIFSGFALGQAAPSLS---VIAKGRVAAANIFKMIGNNN  347

Query  806   LDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGP  985
             L+   R++      +  E++ G +EF  + F YPSRP  MV    +  I +G   A VGP
Sbjct  348   LESSDRLD----NGATLENVAGRIEFHQVSFAYPSRPN-MVFENLSFTIRSGKTFAFVGP  402

Query  986   SGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENI  1165
             SG+GKS++I+++ RFY+ + G++L+DG D++   L+ LR Q+GLV QEP LF  +I  NI
Sbjct  403   SGSGKSTIISMVQRFYEPNSGEILLDGNDIKSLKLKWLREQMGLVSQEPALFATTIASNI  462

Query  1166  CYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKR  1345
               G E AS  +IIE +KAAN  +FI +LP GY T VGE G+QLSGGQKQRIAIARA+L+ 
Sbjct  463   LLGKESASMVQIIEAAKAANADSFIKSLPNGYSTQVGEGGTQLSGGQKQRIAIARAVLRN  522

Query  1346  PAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDII  1525
             P I+LLDEATSALD+ SE+ V  AL+S+ +          K T I VAHRLST+ N D I
Sbjct  523   PKILLLDEATSALDAESEKIVQQALDSVME----------KRTTIVVAHRLSTIRNVDKI  572

Query  1526  VVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             VV+  G V+E GSHS L S+  G Y+ LV+ Q
Sbjct  573   VVLKNGQVMETGSHSELISR-GGDYAALVNCQ  603



>ref|XP_002323847.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
 gb|EEF03980.1| multidrug resistance P-glycoprotein [Populus trichocarpa]
Length=1251

 Score =   427 bits (1099),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 246/548 (45%), Positives = 338/548 (62%), Gaps = 36/548 (7%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  723   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  782

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  783   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  842

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE  V  
Sbjct  843   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQGKVLSLFCHELRV--  900

Query  527   KARVALQPQLH---RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAI  697
                    PQLH   RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I
Sbjct  901   -------PQLHSLRRSQTSGLLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSKVI  949

Query  698   RSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEV  877
             + + +  +T  S+ E  +L P ++     +  VF  L+R T+I+PD  E    ES+ GE+
Sbjct  950   KVFVVLVITANSVAETVSLAPEIIRGGEAVGSVFSILERSTKIDPDDSEAEPVESLRGEI  1009

Query  878   EFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVL  1057
             E + + F YPSRP+V V    NLRI AG   ALVG SG GKSSVI+L+ RFYD   GKV+
Sbjct  1010  ELRHVDFAYPSRPDVPVFKDLNLRIRAGQSQALVGASGCGKSSVISLIERFYDPMAGKVM  1069

Query  1058  IDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTF  1237
             IDGKD+R  NL+ LR +IGLVQQEP LF  SI +NI YG + A+EAE+IE ++AAN+H F
Sbjct  1070  IDGKDIRRLNLKSLRLKIGLVQQEPALFAASIFDNIAYGKDGATEAEVIEAARAANVHGF  1129

Query  1238  ISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSA  1417
             +S LP+GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  A
Sbjct  1130  VSALPDGYKTPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEA  1189

Query  1418  LESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGV  1597
             LE L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG 
Sbjct  1190  LERLMR----GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHSELVSRPDGA  1239

Query  1598  YSRLVSLQ  1621
             Y RL+ LQ
Sbjct  1240  YFRLLQLQ  1247


 Score =   299 bits (765),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +G++   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  81    EVSKYALYFVYLGIVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  139

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  199

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  ++++   +A ++ A ++TV SF  E   ++    A+Q  L  
Sbjct  200   AGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRTVYSFVGESKALSSYTDAIQNTLKL  259

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  260   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  317

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + + +   I  D  +      + G +EFK++ F YPSRP
Sbjct  318   GQSFSNLGAFSKGKAAGYKLMEIIKQRPSITQDAVDGKCLAEVNGNIEFKSVTFSYPSRP  377

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   LR 
Sbjct  378   DVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQLRW  437

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+T VG
Sbjct  438   LRDQIGLVNQEPALFATTILENIRYGKPDATMDEVEAATSAANAHSFITLLPNGYNTQVG  497

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      GR 
Sbjct  498   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----IGR-  552

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  553   -----TTVVVAHRLSTIRNVDTIAVIQQGLVVETGTHEELIAKA-GAYASLIRFQEM  603



>ref|XP_002893495.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69754.1| P-glycoprotein 13 [Arabidopsis lyrata subsp. lyrata]
Length=1246

 Score =   427 bits (1098),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 232/540 (43%), Positives = 339/540 (63%), Gaps = 18/540 (3%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             R V   ++IF  +G+++     LQHY Y ++GE+  + +R SL+SA L NE+ WF+  EN
Sbjct  720   RDVEKVAIIFVGVGIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDEN  779

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
             N GSLTS +  + + V+  ++DR+S IVQ +S  V A  ++    WR+  V  A  P   
Sbjct  780   NTGSLTSILAADATLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLLI  839

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL-QPQL  556
                L +    KGF GD T A+S   S+A E+ ANI+TV +F  E+ +  +    L +P  
Sbjct  840   AASLTEQLFLKGFGGDYTRAYSRATSVAREAIANIRTVAAFGAEKQIAEQFTCELSKPTK  899

Query  557   H---RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
             +   R       +G+ Q  + C    ++A+ LWY ++ ++  +++F ++I+S+ +  +T 
Sbjct  900   NAFVRGHISGFGYGLSQFLAFC----SYALGLWYVSVSIKNKETNFGDSIKSFMVLIVTA  955

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYP  907
              S++E   L P ++     L  VF+ L R T I PD+P   +   I+G++EF+ + F YP
Sbjct  956   FSVSETLALTPDIVKGTQALGSVFRVLHRETEIPPDQPNSRMVSQIKGDIEFRNVSFVYP  1015

Query  908   SRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYN  1087
             +RP++ +    NLR+ AG  +A+VGPSG+GKS+VI L++RFYD   G + IDG+D++  N
Sbjct  1016  TRPDINIFQNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPSHGNLCIDGQDIKTLN  1075

Query  1088  LRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDT  1267
             LR LR ++ LVQQEP LF  +I ENI YG+E ASE+EIIE +KAAN H FIS + EGY T
Sbjct  1076  LRSLRKKLALVQQEPALFSTTIHENIKYGNENASESEIIEAAKAANAHEFISRMEEGYKT  1135

Query  1268  VVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKF  1447
              VG+KG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +    
Sbjct  1136  YVGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDKLMK----  1191

Query  1448  GRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             GR      T + VAHRLST+  +D I V+ KG VVE GSH  L S P+G Y +L +LQ +
Sbjct  1192  GR------TTVLVAHRLSTIRKADTIAVLHKGRVVEKGSHRELVSIPNGFYKQLTNLQEV  1245


 Score =   279 bits (714),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 186/540 (34%), Positives = 293/540 (54%), Gaps = 38/540 (7%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR +   + L  ++ +F+  E   
Sbjct  100   LGLVNLVSAWIGVSCWMQ----------TGERQTARLRINYLKSILAKDITFFD-TEARD  148

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +L   I ++   V+  I D+   +++ +S  +    +  +  W++ L+  AV+P   + 
Sbjct  149   SNLIFHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAVA  208

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  +  A+++   +A E  + ++TV +F  EE  V     +L+  L   
Sbjct  209   GGGYAIIMSTISEKSETAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALKLG  268

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFSLT  724
             ++  +  G+  G +  L   + A+ LWY +LLV+  ++       + LN I S       
Sbjct  269   KRSGLAKGLGVGLTYSLLFCSWALLLWYASLLVRHGKTNGAKAFTTILNVIFSGFALGQA  328

Query  725   VPSITELWTLIPTVLSAIGILKPV-FQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
              PS++    +    ++A  I + +    L+   R+E      +  +++ G +EF  + F 
Sbjct  329   APSLS---AIAKGRVAAANIFRMIGNNNLESSERLE----NGTTLQNVAGRIEFHQVSFA  381

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP  MV    +  I +G   A VGPSG+GKS++I+++ RFY+ + GK+L+DG D++ 
Sbjct  382   YPSRPN-MVFENLSFTIRSGKTFAFVGPSGSGKSTIISMVQRFYEPNSGKILLDGNDIKS  440

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR  +GLV QEP LF  +I  NI +G E A+  +IIE +KAAN  +FI +LP GY
Sbjct  441   LKLKWLREHLGLVSQEPALFATTIASNIIFGKENANMDQIIEAAKAANADSFIKSLPNGY  500

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+++ ++ 
Sbjct  501   NTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDNITENR  560

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                       T I VAHRLST+ N D IVV+  G V E GSHS L S+  G Y+ LV+ Q
Sbjct  561   ----------TTIVVAHRLSTIRNVDKIVVLRNGQVTETGSHSELMSR-GGDYATLVNCQ  609



>gb|EPS61919.1| hypothetical protein M569_12874 [Genlisea aurea]
Length=1149

 Score =   425 bits (1093),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 235/533 (44%), Positives = 336/533 (63%), Gaps = 18/533 (3%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             RK   Y  ++  IGL +     +QHY + ++GE   T +R+ +  A L+NE+ WF+  EN
Sbjct  617   RKTKEYVFVYIGIGLYAVVAYLIQHYFFSIMGENLTTRVRSMMLEAVLRNEMGWFDEEEN  676

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
             N   +++R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+ +   P   
Sbjct  677   NSSLVSARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLIFGTFPLLV  736

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVALQ  547
             +    Q  + KGF+GDT  AH++   +A E  +NI+TV +F  ++ V++    + RV  +
Sbjct  737   LANFAQQLALKGFAGDTARAHAKTSMIAGEGVSNIRTVAAFNAQKKVLSLFGRELRVPQK  796

Query  548   PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
               L RS      FG+ Q   L L++ + A+ LWY   LV R  S+F   I+ + +  +T 
Sbjct  797   RSLRRSNASGFLFGLSQ---LALYS-SEALILWYGCRLVARGLSTFSRVIKVFIVLVITA  852

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYP  907
              S+ E  +L P ++     +  VF  LDR T I+PD PE    ES+ GE+E + + F YP
Sbjct  853   NSVAETVSLAPEIVRGGESIASVFTILDRGTEIDPDDPEAEAVESVRGEIELRHVDFAYP  912

Query  908   SRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYN  1087
             SRP+V+V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  N
Sbjct  913   SRPDVLVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRKLN  972

Query  1088  LRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDT  1267
             L+ LR +IG VQQEP LF  +I +NI YG++ A+E+E+IE +++AN+H F+S+LPEGY T
Sbjct  973   LKSLRRKIGFVQQEPALFAATIFDNIAYGNDGATESEVIEAARSANVHAFVSSLPEGYKT  1032

Query  1268  VVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKF  1447
              VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +    
Sbjct  1033  PVGERGIQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMR----  1088

Query  1448  GRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             GR      T + VAHRLST+   D I V+  G + E GSH  L  + DG YSR
Sbjct  1089  GR------TTVLVAHRLSTIRGVDSIGVVQDGRIAEQGSHGELVGKADGAYSR  1135


 Score =   284 bits (726),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 181/513 (35%), Positives = 285/513 (56%), Gaps = 21/513 (4%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+    LR     A L+ ++ +++  +   G +   +  +T  V+  IS+++   +   
Sbjct  4     GERQAGTLRKKYLEAVLKQDVGFYD-TDARTGDVVFGVSTDTLLVQDAISEKVGNFIHYQ  62

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             S+ +    V  +  WR+ L++ AV+P     G +   +  G +  +  +++    +A +S
Sbjct  63    STFLAGLVVGFVSAWRLALLSVAVIPGIAFAGGLYGYTVSGLASKSRDSYANASIVAEQS  122

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              A ++TV S+  E   +      +Q  L    K  +  G+  G +  +  ++ A+  WY 
Sbjct  123   IAQVRTVYSYVGESRALRSYSDLIQDTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYA  182

Query  653   TLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP  832
              + ++  ++    A  +  IFS  V  ++   +   + L A G  K     L      +P
Sbjct  183   GVFIRNGETDGGKAFTA--IFSAIVGGMSLGQSF--SNLGAFGKGKAAGYKLMEIINQKP  238

Query  833   ---DKPEES--LSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAG  997
                D P  +  LSE ++G +EF+ + F YPSRP+V+V   F++   AG  VA+VG SG+G
Sbjct  239   TIVDDPSGAKVLSE-VKGNIEFRNVTFGYPSRPDVLVFRDFSITFPAGRTVAVVGGSGSG  297

Query  998   KSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGS  1177
             KS+V++L+ RFYD ++G++L+D  +++   LR LR QIGLV QEP LF  +I ENI YG 
Sbjct  298   KSTVVSLIERFYDPNQGEILLDDVNIKTLQLRWLRNQIGLVNQEPALFATTILENILYGK  357

Query  1178  ERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIM  1357
               A+  E+   + AAN  +FI  LP G+DT VGE+G QLSGGQKQRIAIARA+LK P ++
Sbjct  358   PDATMEEVEAAATAANALSFIGVLPHGFDTQVGERGVQLSGGQKQRIAIARAVLKNPRVL  417

Query  1358  LLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMD  1537
             LLDEATSALD+GSE+ V  AL+SL      GR      T + VAHRLST+ + D + V+ 
Sbjct  418   LLDEATSALDAGSEKLVQEALDSLM----IGR------TTVVVAHRLSTITSVDSVAVIQ  467

Query  1538  KGCVVEMGSHSTLTSQPDGVYSRLVSLQSMKDH  1636
             +G VVE G+H  L ++P G Y+ L+  Q M  +
Sbjct  468   QGQVVETGTHEELLAKPAGAYASLIRFQEMAGN  500



>ref|XP_010460561.1| PREDICTED: ABC transporter B family member 13-like isoform X1 
[Camelina sativa]
Length=1248

 Score =   427 bits (1098),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 339/541 (63%), Gaps = 18/541 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             KR +   ++IF   G+++     LQHY Y ++GE+    +R SL+SA L NE+ WF+  E
Sbjct  721   KRDIEKVAIIFVVAGIVTAPIYLLQHYFYTLMGERLTARVRLSLFSAILSNEIGWFDLDE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  ++DR+S IVQ +S  V A  ++    WR+  V  A  P  
Sbjct  781   NNTGSLTSILAADATLVRSALADRLSTIVQNLSLTVTALALAFYYSWRVAAVVTACFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL----  544
                 L +    KGF GD T A+S+  S+A E+ ANI+TV +F  E+ +  +    L    
Sbjct  841   IAASLTEQLFLKGFGGDYTRAYSKATSVAREAIANIRTVAAFGVEKQISEQFTSELSKPT  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +    R       +G+ Q  + C    ++A+ LWY ++L++  +++F ++I+S+ +  +T
Sbjct  901   KNAFVRGHISGFGYGLSQFLAFC----SYALGLWYVSVLIKHKETNFGDSIKSFMVLIVT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S++E   L P ++     L  VF+ L R T+I P+K    L   I G++EF+++ F Y
Sbjct  957   AFSVSETLALTPDIVKGTQALGSVFRVLHRETKITPNKLNSQLITQINGDIEFRSVSFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPE+ +    NLR+ AG  +A+VGPSG+GKS+VI L++RFYD + G + IDG+D++  
Sbjct  1017  PTRPEITIFQNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPNNGNLCIDGQDIKTL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR +I LVQQEP LF  +I ENI YG E ASEAEII  +KAAN H FI+ + EGY 
Sbjct  1077  NLRSLRKKIALVQQEPALFSTTIYENIKYGKENASEAEIIGAAKAANAHEFITRMEEGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG+KG+QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +   
Sbjct  1137  THVGDKGAQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDELMK---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+  +D I V+ +G VVE GSHS L S P+G Y +L SLQ 
Sbjct  1194  -GR------TTVLVAHRLSTIRKADTIAVLHRGRVVEKGSHSELVSIPNGFYKQLTSLQE  1246

Query  1625  M  1627
             +
Sbjct  1247  V  1247


 Score =   277 bits (708),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 193/540 (36%), Positives = 294/540 (54%), Gaps = 38/540 (7%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR +   + L  ++ +F+  E   
Sbjct  102   LGLVNLVSAWIGVACWMQT----------GERQTARLRINYLKSILAKDITFFD-TEARD  150

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +L   I ++   V+  I D+   +++ +S  +    +  +  W++ L+  AV+P   I 
Sbjct  151   SNLIYHISSDAILVQDAIGDKTDHVLRYLSQFIAGFVIGFLSVWQLTLLTLAVVPLIAIA  210

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  + AA+++   +A E  + ++TV +F  EE  V     +L+  L   
Sbjct  211   GGGYAIIMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSTSLKKALKLG  270

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFSLT  724
             +K  +  G+  G +  L   A A+ LWY ++LV+  ++       + LN I S       
Sbjct  271   KKSGLAKGLGVGLTYSLLFCAWALLLWYASILVRHGKTNGAKAFTTILNVIFSGFALGQA  330

Query  725   VPSITELWTLIPTVLSAIGILKPV-FQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
              PS++    +    ++A  I K +    L+   R++      +  E++ G +EF  + F 
Sbjct  331   APSLS---VIAKGRVAAANIFKMIGNNNLESSDRLD----NGATLENVAGRIEFHQVSFA  383

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP  MV    +  I +G   A VGPSG+GKS++I+++ RFY+ + G++L+DG D++ 
Sbjct  384   YPSRPN-MVFENLSFTIRSGKTFAFVGPSGSGKSTIISMVQRFYEPNSGEILLDGNDIKS  442

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR Q+GLV QEP LF  +I  NI  G E AS  +IIE +KAAN  +FI +LP GY
Sbjct  443   LKLKWLREQMGLVSQEPALFATTIASNILLGKESASMVQIIEAAKAANADSFIKSLPNGY  502

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+S+ +  
Sbjct  503   STQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDSVME--  560

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                     K T I VAHRLST+ N D IVV+  G V+E GSHS L S+  G Y+ LV+ Q
Sbjct  561   --------KRTTIVVAHRLSTIRNVDKIVVLKNGQVMETGSHSELISR-GGDYAALVNCQ  611



>ref|XP_009758464.1| PREDICTED: ABC transporter B family member 19 [Nicotiana sylvestris]
Length=1249

 Score =   427 bits (1098),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 250/539 (46%), Positives = 344/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++    + RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FGI Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  901   MQSLRRSQMSGLLFGISQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TR++PD  E    ESI G++E + + F Y
Sbjct  957   ANSVAETVSLAPEIVRGGEAVGSVFSILDRSTRVDPDDTEADPVESIRGDIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVSVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE++E ++AAN+HTF+S LPEGY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVVEAARAANVHTFVSGLPEGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ + D I V+  G +VE GSHS L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRHVDSIGVVQDGRIVEQGSHSELISRPEGAYSRLLQLQ  1245


 Score =   304 bits (779),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 195/543 (36%), Positives = 299/543 (55%), Gaps = 28/543 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMS-  314

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPE--------ESLSESIEGEVEFKTIKF  898
                 +    S +G          +   I   KP         + LSE + G +EFK + F
Sbjct  315   ----LGQSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDLADGKCLSE-VNGNIEFKNVTF  369

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YPSRP+V++   F +   AG  VA+VG SG+GKS+V++L+ RFYD +EG+VL+D  D++
Sbjct  370   SYPSRPDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIK  429

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
                LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP G
Sbjct  430   TLQLRWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNG  489

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQH  1438
             Y+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L   
Sbjct  490   YNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM--  547

Query  1439  HKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSL  1618
                GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G YS L+  
Sbjct  548   --VGR------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAK-GGAYSSLIRF  598

Query  1619  QSM  1627
             Q M
Sbjct  599   QEM  601



>ref|XP_009591470.1| PREDICTED: ABC transporter B family member 19 [Nicotiana tomentosiformis]
Length=1249

 Score =   427 bits (1098),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 250/539 (46%), Positives = 344/539 (64%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++    + RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKIISLFSQELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FGI Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  901   MQSLRRSQMSGLLFGISQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TR++PD  E    ESI G++E + + F Y
Sbjct  957   ANSVAETVSLAPEIVRGGEAVGSVFSILDRSTRVDPDDTEADPVESIRGDIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVSVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTGGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE++E ++AAN+HTF+S LPEGY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVVEAARAANVHTFVSGLPEGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPSILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ + D I V+  G +VE GSHS L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRHVDSIGVVQDGRIVEQGSHSELISRPEGAYSRLLQLQ  1245


 Score =   304 bits (779),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 195/543 (36%), Positives = 299/543 (55%), Gaps = 28/543 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLIVCASSYAEIGCWMYTGERQVSALRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMS-  314

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPE--------ESLSESIEGEVEFKTIKF  898
                 +    S +G          +   I   KP         + LSE + G +EFK + F
Sbjct  315   ----LGQSFSNLGAFSKGKAAGYKLMEIIKQKPTIVQDLADGKCLSE-VNGNIEFKNVTF  369

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YPSRP+V++   F +   AG  VA+VG SG+GKS+V++L+ RFYD +EG+VL+D  D++
Sbjct  370   SYPSRPDVIIFRDFCIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIK  429

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
                LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP G
Sbjct  430   TLQLRWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNG  489

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQH  1438
             Y+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L   
Sbjct  490   YNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM--  547

Query  1439  HKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSL  1618
                GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G YS L+  
Sbjct  548   --VGR------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYSSLIRF  598

Query  1619  QSM  1627
             Q M
Sbjct  599   QEM  601



>ref|NP_174115.1| ABC transporter B family member 13 [Arabidopsis thaliana]
 sp|Q9C7F8.1|AB13B_ARATH RecName: Full=ABC transporter B family member 13; Short=ABC transporter 
ABCB.13; Short=AtABCB13; AltName: Full=P-glycoprotein 
13; AltName: Full=Putative multidrug resistance protein 
15 [Arabidopsis thaliana]
 gb|AAG51482.1|AC069471_13 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30893.1| ABC transporter B family member 13 [Arabidopsis thaliana]
Length=1245

 Score =   427 bits (1097),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 232/541 (43%), Positives = 339/541 (63%), Gaps = 18/541 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             KR V   ++IFA  G+++     LQHY Y ++GE+  + +R SL+SA L NE+ WF+  E
Sbjct  718   KRDVEKVAIIFAGAGIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGWFDLDE  777

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  ++DR+S IVQ +S  V A  ++    WR+  V  A  P  
Sbjct  778   NNTGSLTSILAADATLVRSALADRLSTIVQNLSLTVTALALAFFYSWRVAAVVTACFPLL  837

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL-QPQ  553
                 L +    KGF GD T A+S   S+A E+ ANI+TV ++  E+ +  +    L +P 
Sbjct  838   IAASLTEQLFLKGFGGDYTRAYSRATSVAREAIANIRTVAAYGAEKQISEQFTCELSKPT  897

Query  554   LH---RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              +   R       +G+ Q  + C    ++A+ LWY ++L+   +++F ++I+S+ +  +T
Sbjct  898   KNAFVRGHISGFGYGLSQFLAFC----SYALGLWYVSVLINHKETNFGDSIKSFMVLIVT  953

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S++E   L P ++     L  VF+ L R T+I PD+P   +   ++G++EF+ + F Y
Sbjct  954   AFSVSETLALTPDIVKGTQALGSVFRVLHRETKISPDQPNSRMVSQVKGDIEFRNVSFVY  1013

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPE+ +    NLR+ AG  +A+VGPSG+GKS+VI L++RFYD   G + IDG+D++  
Sbjct  1014  PTRPEIDIFKNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPSNGNLCIDGQDIKTL  1073

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR ++ LVQQEP LF  +I ENI YG+E ASEAEI+E +KAAN H FI  + EGY 
Sbjct  1074  NLRSLRKKLALVQQEPALFSTTIYENIKYGNENASEAEIMEAAKAANAHEFIIKMEEGYK  1133

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T  G+KG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +   
Sbjct  1134  THAGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDKLMK---  1190

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+  +D + V+ KG VVE GSH  L S P+G Y +L SLQ 
Sbjct  1191  -GR------TTVLVAHRLSTIRKADTVAVLHKGRVVEKGSHRELVSIPNGFYKQLTSLQE  1243

Query  1625  M  1627
             +
Sbjct  1244  V  1244


 Score =   274 bits (701),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 183/508 (36%), Positives = 278/508 (55%), Gaps = 22/508 (4%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+    LR +   + L  ++ +F+  E    +L   I ++   V+  I D+   +++ +
Sbjct  118   GERQTARLRINYLKSILAKDITFFD-TEARDSNLIFHISSDAILVQDAIGDKTDHVLRYL  176

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             S  +    +  +  W++ L+   V+P   I G   A      S  +  A+++   +A E 
Sbjct  177   SQFIAGFVIGFLSVWQLTLLTLGVVPLIAIAGGGYAIVMSTISEKSETAYADAGKVAEEV  236

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              + ++TV +F  EE  V     +L+  L   ++  +  G+  G +  L   A A+ LWY 
Sbjct  237   MSQVRTVYAFVGEEKAVKSYSNSLKKALKLGKRSGLAKGLGVGLTYSLLFCAWALLLWYA  296

Query  653   TLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP  832
             +LLV RH  +  N  +++      + S   L    P+ LSAI   +     + R      
Sbjct  297   SLLV-RHGKT--NGAKAFTTILNVIFSGFALGQAAPS-LSAIAKGRVAAANIFRMIGNNN  352

Query  833   DKPEESLSE-----SIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAG  997
              +  + L E     ++ G +EF+ + F YPSRP  MV    +  I +G   A VGPSG+G
Sbjct  353   SESSQRLDEGTTLQNVAGRIEFQKVSFAYPSRPN-MVFENLSFTIRSGKTFAFVGPSGSG  411

Query  998   KSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGS  1177
             KS++I+++ RFY+ + G++L+DG D++   L+  R Q+GLV QEP LF  +I  NI  G 
Sbjct  412   KSTIISMVQRFYEPNSGEILLDGNDIKSLKLKWFREQLGLVSQEPALFATTIASNILLGK  471

Query  1178  ERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIM  1357
             E A+  +IIE +KAAN  +FI +LP GY+T VGE G+QLSGGQKQRIAIARA+L+ P I+
Sbjct  472   ENANMDQIIEAAKAANADSFIKSLPNGYNTQVGEGGTQLSGGQKQRIAIARAVLRNPKIL  531

Query  1358  LLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMD  1537
             LLDEATSALD+ SE+ V  AL+++ +          K T I VAHRLST+ N D IVV+ 
Sbjct  532   LLDEATSALDAESEKIVQQALDNVME----------KRTTIVVAHRLSTIRNVDKIVVLR  581

Query  1538  KGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              G V E GSHS L  +  G Y+ LV+ Q
Sbjct  582   DGQVRETGSHSELMLR-GGDYATLVNCQ  608



>gb|AAN28720.2| MDR-like p-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   427 bits (1097),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 244/547 (45%), Positives = 347/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  720   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+   
Sbjct  779   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILG  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  839   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  898

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + 
Sbjct  899   LRVPQKRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSKVIKVFV  954

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  955   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  1014

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD+  GKV+IDGK
Sbjct  1015  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDLLAGKVMIDGK  1074

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+I+ ++AAN H FIS L
Sbjct  1075  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGL  1134

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1135  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1194

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1195  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1244

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1245  LQLQTHR  1251


 Score =   293 bits (749),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    + + G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  379   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKF  438

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  439   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVG  498

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  499   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  553

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  554   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  604



>ref|XP_002877137.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53396.1| P-glycoprotein 19 [Arabidopsis lyrata subsp. lyrata]
Length=1252

 Score =   427 bits (1097),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 243/542 (45%), Positives = 343/542 (63%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  724   ERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDE  783

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  784   HNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLL  843

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ RV  
Sbjct  844   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHELRVPQ  903

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L+RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  904   KRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSKVIKVFVVLVIT  959

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ + F Y
Sbjct  960   ANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAY  1019

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGKD+R  
Sbjct  1020  PSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRL  1079

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE ++AAN H FIS LPEGY 
Sbjct  1080  NLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYK  1139

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1140  TPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERLMR---  1196

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG YSRL+ LQ+
Sbjct  1197  -GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPDGAYSRLLQLQT  1249

Query  1625  MK  1630
              +
Sbjct  1250  HR  1251


 Score =   291 bits (744),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 183/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    + + G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKAAGYKLMEIINQKPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  379   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKF  438

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  439   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVG  498

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  499   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  553

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  554   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  604



>ref|XP_008459308.1| PREDICTED: ABC transporter B family member 19 [Cucumis melo]
Length=1250

 Score =   426 bits (1096),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 243/542 (45%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S  +RK+  +  I+  IG+ +     +QHY + ++GE   T +R  + +A L+NE+ WF+
Sbjct  719   SAMERKIKEFVFIYIGIGVYAVVAYLIQHYFFTIMGENLTTRVRRMMLAAILRNEVGWFD  778

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               E+N   + +R+  + + VK  I++R+SVI+Q ++S+  +  V+ IV+WR+ L+  A  
Sbjct  779   EEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLFTSFIVAFIVEWRVSLLILAAF  838

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +  + Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ R
Sbjct  839   PLLVLANMAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFRHELR  898

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             V  +  L RS+   I FGI Q   L L+  + A+ LWY   LV    S+F   I+ + + 
Sbjct  899   VPQRQSLRRSQTAGILFGISQ---LALY-ASEALVLWYGVHLVSNGGSTFSKVIKVFVVL  954

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     +  VF  LDR TRI+PD PE    E++ GE+E + + 
Sbjct  955   VVTANSVAETVSLAPEIVRGGESIGSVFSILDRPTRIDPDDPEAETVETLRGEIELRHVD  1014

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+VMV    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+
Sbjct  1015  FAYPSRPDVMVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPLTGKVMIDGKDI  1074

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP LF  SI +NI YG + A+E+E+IE ++AAN+H F+S LP+
Sbjct  1075  RRLNLQSLRLKIGLVQQEPALFAASIFDNIAYGKDGATESEVIEAARAANVHGFVSGLPD  1134

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +
Sbjct  1135  GYNTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR  1194

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+ + D I V+  G +VE GSH+ L S+ +G YSRL+ 
Sbjct  1195  ----GR------TTVVVAHRLSTIRSVDSIGVVQDGRIVEQGSHNELLSRAEGAYSRLLQ  1244

Query  1616  LQ  1621
             LQ
Sbjct  1245  LQ  1246


 Score =   294 bits (752),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 192/539 (36%), Positives = 301/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVSKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDVVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    ++Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDSIQNTLKI  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  316

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSES----IEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   ++ L       + G +EFK + F YPS
Sbjct  317   GQSF--SNLGAFSKGKAAGYKLMEIIKQKPTIIQDPLDGKCLGEVNGNIEFKDVSFSYPS  374

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+VM+   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L
Sbjct  375   RPDVMIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQL  434

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GYDT 
Sbjct  435   KWLRDQIGLVNQEPALFATTIYENILYGKPDATTAEVEAAAAAANAHSFITLLPNGYDTQ  494

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  495   VGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  550

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G YS L+  Q M
Sbjct  551   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHDELITK-SGAYSSLIRFQEM  602



>ref|XP_010554005.1| PREDICTED: ABC transporter B family member 19-like [Tarenaya 
hassleriana]
Length=1250

 Score =   426 bits (1096),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 247/542 (46%), Positives = 345/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   +  IF   GL +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  722   ERKTKEFVFIFIGTGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNK-ARVALQPQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++  +   L PQ
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFSHELLVPQ  901

Query  554   ---LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+     FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + +  +T
Sbjct  902   KRSLRRSQTSGFLFGLSQ---LALYG-SEALILWYGARLVGKGESTFSKVIKVFVVLVIT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD P+    E++ GE+EF+ + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDPDADPVETVRGEIEFRHVDFAY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   FN+RI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1018  PSRPDVMVFKDFNVRIRAGQSQALVGASGSGKSSVIALIERFYDPVAGKVMIDGKDIRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +I LVQQEP LF  +I ENI YG E A+E+E+IE ++AAN H FIS LPEGY 
Sbjct  1078  NLKSLRLKIALVQQEPALFAANIFENIAYGKEGATESEVIEAARAANAHGFISGLPEGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T+VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1138  TMVGERGVQLSGGQKQRIAIARAVLKNPRVLLLDEATSALDAESECVLQEALERLMR---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+     I V+  G +VE GSHS L S+PDG YSRL+ LQS
Sbjct  1195  -GR------TTVVVAHRLSTIRGVHKIGVVQDGRIVEEGSHSELISRPDGAYSRLLQLQS  1247

Query  1625  MK  1630
              +
Sbjct  1248  HR  1249


 Score =   291 bits (745),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 187/537 (35%), Positives = 301/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  80    EVSKYALYFIYLGLVVCFSSYAEIACWMYTGERQVGALRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +   S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYQSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  199   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQHTLKL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V   S+
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMSL  316

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    + + G +EFK + F YPSRP
Sbjct  317   GQSFSNLGAFSKGKAAGYKLMEIINQKPSIIQDPLDGKCLDEVRGNIEFKDVTFSYPSRP  376

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
              V++   F++ + AG  VA+VG SG+GKS+V++L+ RFYD ++G++L+DG D++   L+ 
Sbjct  377   AVIIFRNFSIFLPAGKTVAVVGGSGSGKSTVVSLIERFYDPNDGQILLDGVDIKTLQLKF  436

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A  AE+   + AAN H+FI+ LP+GY+T VG
Sbjct  437   LRDQIGLVNQEPALFATTILENILYGKPDAKMAEVEAAASAANAHSFITLLPDGYNTQVG  496

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      GR 
Sbjct  497   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRLM----VGR-  551

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D IVV+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  552   -----TTVVVAHRLSTIKNVDSIVVIQQGQVVETGNHEELIAKA-GAYASLIRFQEM  602



>ref|XP_006603863.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Glycine max]
Length=1098

 Score =   423 bits (1087),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 249/545 (46%), Positives = 337/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  570   ERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  629

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  630   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  689

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE     
Sbjct  690   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSVFCHE-----  744

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
               RV     L RS      FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ +
Sbjct  745   -LRVPQSQSLRRSLTSGFLFGLSQ---LALY-ASEALILWYGAHLVSKGVSTFSKVIKVF  799

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+    ES+ GE+E +
Sbjct  800   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELR  859

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV++DG
Sbjct  860   HVDFAYPSRPDVMVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDG  919

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+H F+S 
Sbjct  920   KDIRKLNLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHGFVSG  979

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LPEGY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE 
Sbjct  980   LPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALER  1039

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+ +G YSR
Sbjct  1040  LMR----GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRHEGAYSR  1089

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1090  LLQLQ  1094


 Score =   287 bits (735),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 252/439 (57%), Gaps = 15/439 (3%)
 Frame = +2

Query  317   VSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVV  496
             V  +  WR+ L++ AV+P     G + A +  G +  +  +++    +A ++ A ++TV 
Sbjct  25    VGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVY  84

Query  497   SFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQ  676
             S+  E   +N    A+Q  L    K  +  G+  G +  +  ++ A+  WY  + ++  Q
Sbjct  85    SYVGESKALNSYSDAIQNTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQ  144

Query  677   SSFLNAIRSYQIFSLTVP--SITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEES  850
             +    A  +  IFS  V   S+ + ++ +            + + +++   I  D  E  
Sbjct  145   TDGGKAFTA--IFSAIVGGMSLGQSFSNLGAFSKGKAAGYKLMEIINQKPTIVEDPSEGK  202

Query  851   LSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRF  1030
                 + G +EFK + F YPSRP++ +   F++   AG  VA+VG SG+GKS+V++L+ RF
Sbjct  203   CLAEVNGNIEFKDVTFSYPSRPDMFIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERF  262

Query  1031  YDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEV  1210
             YD +EG+VL+D  D++   L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   
Sbjct  263   YDPNEGQVLLDNVDIKTLQLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAA  322

Query  1211  SKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDS  1390
             + AAN H+FI+ LP GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+
Sbjct  323   TSAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDA  382

Query  1391  GSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHS  1570
             GSE  V  AL+ L      GR      T + VAHRLST+ N D I V+ +G VVE G+H 
Sbjct  383   GSENIVQEALDRLM----VGR------TTVVVAHRLSTIRNVDTIAVIQQGQVVETGAHE  432

Query  1571  TLTSQPDGVYSRLVSLQSM  1627
              L ++  G Y+ L+  Q M
Sbjct  433   ELIAKA-GTYASLIRFQEM  450



>ref|XP_003579896.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1263

 Score =   426 bits (1095),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 236/536 (44%), Positives = 338/536 (63%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +  L+N++ WF+  E
Sbjct  735   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEEE  794

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  E + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  795   NNSSLVAARLATEAADVKSAIAERISVILQNMTSLMVSFVVGFIIEWRVAILILVTFPLL  854

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++     L+ PQ
Sbjct  855   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVPQ  914

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
              H  R+  I  G + G S      + A+ LW+   LV+ H S+F   I+ + +  +T  S
Sbjct  915   SHSLRRSQIS-GALYGLSQLSLYASEALILWFGAHLVRHHISTFSKVIKVFVVLVITANS  973

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++ VF  L+  TRI+PD+PE    ES+ GE+E + + F YPSR
Sbjct  974   VAETVSLAPEIIRGGESIRSVFAVLNSRTRIDPDEPETEQVESVRGEIELRHVDFAYPSR  1033

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VM+   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  NL+
Sbjct  1034  PDVMIFKDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLNLK  1093

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP+LF  SI ENI YG + A+E E+IE +K AN+H F+S LP+GY T V
Sbjct  1094  SLRLKIGLVQQEPVLFATSILENIAYGKDGATEEEVIEAAKVANVHGFVSALPDGYRTPV  1153

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  AL  + +    GR
Sbjct  1154  GERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALGRIMK----GR  1209

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1210  ------TAVLVAHRLSTIRCVDSIAVVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQ  1259


 Score =   288 bits (737),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 190/542 (35%), Positives = 300/542 (55%), Gaps = 24/542 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  91    EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDAR  149

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +++ +    V  +  WR+ L++ AV+P    
Sbjct  150   TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  209

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  210   AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQSTLKL  269

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  270   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRSGQTDGGKAFTA--IFSAIVGGLSL  327

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F Y
Sbjct  328   GQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDSADGRCLDE-VHGNIEFKEVSFSY  383

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VM+   F+L   AG   A+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++  
Sbjct  384   PSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTL  443

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GY+
Sbjct  444   QLKWLRDQIGLVNQEPALFATTIIENILYGKPDATMAEVEAAASAANAHSFIALLPNGYN  503

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ +     
Sbjct  504   TQVGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRIM----  559

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  560   IGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  613

Query  1622  SM  1627
              M
Sbjct  614   EM  615



>ref|XP_008804465.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Phoenix dactylifera]
Length=1275

 Score =   426 bits (1096),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 237/539 (44%), Positives = 339/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++   GL +  +  +QHY + ++GE   T +R  + +A L+NEL WF+  E
Sbjct  747   ERKTRQYVFMYVGTGLYAVVSYLVQHYFFSIMGENLTTRVRRMMLAAILRNELGWFDEEE  806

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + + +  + + VK +I++R+SVI+Q ++S++ +  V  IV+WR+ L+  A  P  
Sbjct  807   NNSSLVAAHLATDAADVKSVIAERISVILQNMTSLLTSFIVGFIVEWRVALLIIATFPLL  866

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GD   AH+    +A E  +NI+TV +F  ++ ++    ++  V  
Sbjct  867   VLANFAQQLSLKGFAGDMAKAHARTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELEVPQ  926

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             Q  L RS+   + FG+ Q   L L++ + A+ LWY   LV    S+F   I+ + I  +T
Sbjct  927   QCSLRRSQTSGLLFGLSQ---LSLYS-SEALILWYGAHLVHSGASTFSKVIKVFVILVIT  982

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ VF  L+R TRI+PD PE     SI GE+E + + F Y
Sbjct  983   ANSVAETVSLAPEIIRGGESIRSVFSILNRLTRIDPDDPEAKPVGSIRGEIELRHVDFAY  1042

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP++ V   FNLRI AG+  ALVG SG GKS+VIAL+ RFYD   GKV+IDG+D+R  
Sbjct  1043  PSRPDIPVFEDFNLRIHAGLSQALVGASGCGKSTVIALIERFYDPTAGKVMIDGEDIRGL  1102

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E++E ++AAN+H F+S LP+GY 
Sbjct  1103  NLKSLRLKIGLVQQEPVLFAASIFENIAYGKDGATEDEVLEAARAANVHGFVSALPKGYK  1162

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1163  TPVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALEQLMR---  1219

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L ++ DG Y RL+ LQ
Sbjct  1220  -GR------TTVLVAHRLSTIRGVDSIAVVQDGHIVEQGSHAELVARADGAYVRLLQLQ  1271


 Score =   285 bits (730),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 188/543 (35%), Positives = 295/543 (54%), Gaps = 26/543 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +G++   ++  +   +   GE+    LR     A L+ ++ +F+  +  
Sbjct  103   EVSKYALYFVYLGVIVCLSSYAEIACWMYTGERQAGALRRRYLEAVLKQDVGFFD-TDAR  161

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T +V+  IS++    +  +S+ +    V  I  WR+ L++ AV+P    
Sbjct  162   TGDIVFSVSTDTLSVQDAISEKFGNFIHYLSTFLAGLVVGFISAWRLALLSVAVIPGIAF  221

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   ++    A+Q  L  
Sbjct  222   AGGLYAYTLTGLTSKSRESYANAGIVAEQAIAQVRTVYSFVGESKALDSYSEAIQNTLKL  281

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  282   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMS-  338

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPE--ESLSES-----IEGEVEFKTIKFH  901
                 +    S +G          +   I   KP   + LS+      + G +EFK + F 
Sbjct  339   ----LGQAFSNLGAFSKGKAAGYKLMEIIQQKPSIIQDLSDGKCLPEVHGNLEFKDVTFS  394

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V++   F+L   AG   A+VG SG+GKS+V+ L+ RFYD ++G++L+D  D++ 
Sbjct  395   YPSRPDVIIFRDFSLSFPAGKTTAVVGGSGSGKSTVVVLIERFYDPNQGQILLDNVDIKT  454

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H FIS LP GY
Sbjct  455   LQLKWLREQIGLVSQEPALFATTILENILYGKPGATIAEVEAAASAANAHNFISLLPNGY  514

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T  GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L    
Sbjct  515   NTQAGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM---  571

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N D+I V+ +G +VE G+H  L ++   G Y+ L+  
Sbjct  572   -VGR------TTVVVAHRLSTIRNVDMIAVIQQGQIVETGTHEELLAKGTSGAYASLIRF  624

Query  1619  QSM  1627
             Q M
Sbjct  625   QEM  627



>gb|AIU41631.1| ABC transporter family protein [Hevea brasiliensis]
Length=1259

 Score =   426 bits (1095),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 242/539 (45%), Positives = 339/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  731   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  790

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  791   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  850

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++    + RV  
Sbjct  851   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCYELRVPQ  910

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  911   RRSLRRSQTSGLLFGLSQ---LALYA-SEALILWYGAHLVSKGSSTFSKVIKVFVVLVIT  966

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+ D PE    E++ GE+E + + F Y
Sbjct  967   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDSDDPEAEPVEAVHGEIELRHVDFAY  1026

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSR +V V    NLRI AG   ALVG SG GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1027  PSRSDVPVFKDLNLRIRAGQSQALVGASGCGKSSVIALIERFYDPTAGKVMIDGKDIRRL  1086

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG + A+EAE+IE ++AAN+H F+S LP+GY 
Sbjct  1087  NLKSLRLKIGLVQQEPALFAASIFDNIAYGKDGATEAEVIEAARAANVHGFVSALPDGYK  1146

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1147  TPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMR---  1203

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+ DG YSRL+ LQ
Sbjct  1204  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEQGSHSELISRVDGAYSRLLQLQ  1255


 Score =   287 bits (735),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 187/542 (35%), Positives = 295/542 (54%), Gaps = 26/542 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  89    EVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVGTLRKKYLEAVLKQDVGFFD-TDAR  147

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  148   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  207

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  ++++   +A ++ A ++ V S+  E   +N    A+Q  L  
Sbjct  208   AGGLYAYTLTGLTSKSRESYAQAGIIAEQAIAQVRAVYSYVGESKALNSYSDAIQNTLKL  267

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  268   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMS-  324

Query  743   LWTLIPTVLSAIGILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G           + + + +   I  D  +      + G +EFK + F 
Sbjct  325   ----LGQSFSNLGAFSKGKVAGYKLMEIIKQKPSIIQDPSDGKCLPGVNGNIEFKDVTFS  380

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+VM+   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++ 
Sbjct  381   YPSRPDVMIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDLKT  440

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+   +   + AAN H+FI+ LP GY
Sbjct  441   LQLRWLRDQIGLVNQEPALFATTILENILYGKPDATMDGVEAAASAANAHSFITLLPNGY  500

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L    
Sbjct  501   NTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM---  557

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T I VAHRLST+ N D I V+ +G VVE G+H  L ++    Y+ L+  Q
Sbjct  558   -VGR------TTIVVAHRLSTIRNVDTIAVIQQGQVVETGTHEELIAKGR-AYASLIRFQ  609

Query  1622  SM  1627
              M
Sbjct  610   EM  611



>ref|XP_007032497.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
 gb|EOY03423.1| ATP binding cassette subfamily B19 isoform 1 [Theobroma cacao]
Length=1256

 Score =   426 bits (1095),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 245/544 (45%), Positives = 340/544 (63%), Gaps = 18/544 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  +  A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVIAYLIQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  781   HNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++    + RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCYELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  901   KRSLGRSQTSGLLFGLSQ---LALY-ASEALILWYGAHLVSKGVSTFSKVIKVFVVLVVT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR T+I+PD PE    ESI GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTKIDPDDPEGEPVESIRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVSVFKDLNLRIRAGQNQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE+IE ++AAN+H F+S LP+GY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+ N D I V+  G +VE GSH+ L S+ +G YSRL+ LQ 
Sbjct  1194  -GR------TTVLVAHRLSTIRNVDSIGVVQDGRIVEQGSHAELISRAEGAYSRLLQLQH  1246

Query  1625  MKDH  1636
                H
Sbjct  1247  HHAH  1250


 Score =   300 bits (768),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 188/544 (35%), Positives = 299/544 (55%), Gaps = 20/544 (4%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S    +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+
Sbjct  74    SKMTHEVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD  133

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               +   G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+
Sbjct  134   -TDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVI  192

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ  547
             P     G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q
Sbjct  193   PGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQ  252

Query  548   PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
               L    K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V
Sbjct  253   NTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIV  310

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIK  895
               ++   +   + L A    K     L    + +P    D  +  +   + G +EFK + 
Sbjct  311   GGMSLGQSF--SNLGAFSKGKTAGYKLMEIIKQKPSIIQDHSDGKVLPEVNGNIEFKDVT  368

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D+
Sbjct  369   FSYPSRPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNMDI  428

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP 
Sbjct  429   KTLQLKWLRDQIGLVNQEPALFATTILENILYGKPDATMDEVEAATSAANAHSFITLLPN  488

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L  
Sbjct  489   GYNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM-  547

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+ 
Sbjct  548   ---VGR------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIR  597

Query  1616  LQSM  1627
              Q M
Sbjct  598   FQEM  601



>ref|XP_010552958.1| PREDICTED: ABC transporter B family member 19-like isoform X2 
[Tarenaya hassleriana]
Length=1099

 Score =   422 bits (1086),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 240/542 (44%), Positives = 340/542 (63%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++   GL +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  571   ERKTKEYVFVYIGTGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEE  630

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  +++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  631   HNSSLVAARLATDAADVKSAMAERISVILQNVTSLLTSFIVAFIVEWRVSLLILAAFPFL  690

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT   H++   +A E  +NI+TV +F  ++ ++    ++ R   
Sbjct  691   VLANFAQQLSLKGFAGDTAKVHAKTSMIAGEGVSNIRTVAAFNAQDRILSLFCHELRAPQ  750

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  751   RRSLSRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSRVIKVFVVLVVT  806

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRIEPD P     E+I GE+EF+ + F Y
Sbjct  807   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIEPDDPYADPVETIRGEIEFRHVDFAY  866

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   FNLRI AG   ALVG SG+GKSSVI+L+ RFYD   GKV+IDGKD+R  
Sbjct  867   PSRPDVMVFKDFNLRIRAGQSQALVGASGSGKSSVISLIERFYDPVAGKVMIDGKDIRRI  926

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR +IGLVQQEP LF  +I  NI YG + A+EAE+IE ++AAN H FIS LP+GY 
Sbjct  927   NLRSLRLKIGLVQQEPALFAATIFHNIAYGKDSATEAEVIEAARAANAHGFISGLPDGYK  986

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  A+E L +   
Sbjct  987   TPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEAIERLMR---  1043

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+     I V+  G +VE GSHS L ++P+G YSRL+ LQ+
Sbjct  1044  -GR------TTVVVAHRLSTIRGVHRIGVIQDGRIVEQGSHSELITRPEGEYSRLLQLQN  1096

Query  1625  MK  1630
              +
Sbjct  1097  HR  1098


 Score =   268 bits (685),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 253/443 (57%), Gaps = 23/443 (5%)
 Frame = +2

Query  317   VSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVV  496
             V  +  WR+ L++ AV+P     G + A +  G +  +  +++    +A ++ A ++TV 
Sbjct  26    VGFVSAWRLALLSVAVIPGIAFAGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVY  85

Query  497   SFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQ  676
             S+  E   ++    A+Q  L    K  +  G+  G +  +  ++ A+  WY  + ++  Q
Sbjct  86    SYVGESKALSSYSNAIQYTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQ  145

Query  677   SSFLNAIRSYQIFSLTV------PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDK  838
             +    A  +  IFS  V       S + L       ++   +++ + Q   R + I+   
Sbjct  146   TDGGKAFTA--IFSAIVGGMSLGQSFSNLGAFSKGKVAGYKLMEIINQ---RPSIIQDPF  200

Query  839   PEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIAL  1018
               + L E + G +EFK + F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L
Sbjct  201   GGKCLDE-VHGNIEFKDVTFSYPSRPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSL  259

Query  1019  LLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAE  1198
             + RFYD + G++ +DG D++   L+ LR QIGLV QEP LF  +I ENI YG   A+  E
Sbjct  260   IERFYDPNNGQIFLDGVDIKILQLKFLRDQIGLVNQEPALFATTIFENILYGKPDATMVE  319

Query  1199  IIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATS  1378
             +   + AAN H+FI+ LP GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATS
Sbjct  320   VEAAASAANAHSFITLLPNGYNTQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATS  379

Query  1379  ALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEM  1558
             ALD+GSE  V  AL+ L      GR      T + VAHRL T+ N D I V+ +G VVE 
Sbjct  380   ALDAGSESIVQEALDRLM----VGR------TTVVVAHRLCTIRNVDSISVIQQGQVVET  429

Query  1559  GSHSTLTSQPDGVYSRLVSLQSM  1627
             GSH  L ++  G Y+ L+  Q M
Sbjct  430   GSHEKLIAKA-GAYASLIRFQEM  451



>ref|XP_006395333.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
 gb|ESQ32619.1| hypothetical protein EUTSA_v10003528mg [Eutrema salsugineum]
Length=1255

 Score =   426 bits (1094),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 244/547 (45%), Positives = 346/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  723   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  781

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+   
Sbjct  782   FDEDEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILG  841

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  842   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  901

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+     FG+ Q   L L+  + A+ LWY   LV   +S+F   I+ + 
Sbjct  902   LRVPQKRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSEGKSTFSKVIKVFV  957

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G+++F+ 
Sbjct  958   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRH  1017

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1018  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1077

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE ++AAN H FIS L
Sbjct  1078  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGL  1137

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1138  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1197

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1198  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1247

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1248  LQLQTHR  1254


 Score =   284 bits (726),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 184/541 (34%), Positives = 299/541 (55%), Gaps = 24/541 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  85    EVSKYALYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  143

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  144   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  203

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  204   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  263

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V     
Sbjct  264   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTA--IFSAIVGGMSL  321

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L        +   +++ + Q   R T I+ D  +    + + G +EFK + F Y
Sbjct  322   GQSFSNLGAFSKGKAAGFKLMEIINQ---RPTIIQ-DPLDGKCLDQVHGNIEFKDVTFSY  377

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++  
Sbjct  378   PSRPDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTL  437

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYD
Sbjct  438   QLKFLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYD  497

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +     
Sbjct  498   TQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----  553

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q 
Sbjct  554   VGR------TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQE  606

Query  1625  M  1627
             M
Sbjct  607   M  607



>ref|XP_004148691.1| PREDICTED: ABC transporter B family member 19-like [Cucumis sativus]
Length=1250

 Score =   426 bits (1094),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 242/542 (45%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S  +RK+  +  I+  IG+ +     +QHY + ++GE   T +R  + +A L+NE+ WF+
Sbjct  719   SAMERKIKEFVFIYIGIGVYAVVAYLIQHYFFTIMGENLTTRVRRMMLAAILRNEVGWFD  778

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               E+N   + +R+  + + VK  I++R+SVI+Q ++S+  +  V+ IV+WR+ L+  A  
Sbjct  779   EEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLFTSFIVAFIVEWRVSLLILAAF  838

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +  + Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ R
Sbjct  839   PLLVLANMAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELR  898

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  +  L RS+   I FGI Q   L L+  + A+ LWY   LV    S+F   I+ + + 
Sbjct  899   IPQRQSLRRSQTAGILFGISQ---LALY-ASEALVLWYGVHLVSNGGSTFSKVIKVFVVL  954

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     +  VF  LDR TRI+PD PE    E++ GE+E + + 
Sbjct  955   VVTANSVAETVSLAPEIVRGGESIGSVFSILDRPTRIDPDDPEAETVETLRGEIELRHVD  1014

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+VMV    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+
Sbjct  1015  FAYPSRPDVMVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPLTGKVMIDGKDI  1074

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP LF  SI +NI YG + A+E+E+IE ++AAN+H F+S LP+
Sbjct  1075  RRLNLQSLRLKIGLVQQEPALFAASIFDNIAYGKDGATESEVIEAARAANVHGFVSGLPD  1134

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +
Sbjct  1135  GYNTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR  1194

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+ + D I V+  G +VE GSH+ L S+ +G YSRL+ 
Sbjct  1195  ----GR------TTVVVAHRLSTIRSVDSIGVVQDGRIVEQGSHNELLSRAEGAYSRLLQ  1244

Query  1616  LQ  1621
             LQ
Sbjct  1245  LQ  1246


 Score =   293 bits (750),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 192/539 (36%), Positives = 301/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVSKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDVVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFLSAWRLALLSIAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    ++Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDSIQNTLKI  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  316

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSES----IEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   ++ L       + G +EFK + F YPS
Sbjct  317   GQSF--SNLGAFSKGKAAGYKLMEIIKQKPTIIQDPLDGKCLGEVNGNIEFKDVTFSYPS  374

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+VM+   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L
Sbjct  375   RPDVMIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQL  434

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GYDT 
Sbjct  435   KWLRDQIGLVNQEPALFATTIYENILYGKPDATTAEVEAAAAAANAHSFITLLPNGYDTQ  494

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  495   VGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  550

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G YS L+  Q M
Sbjct  551   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHDELITK-SGAYSSLIRFQEM  602



>ref|NP_189528.1| ABC transporter B family member 19 [Arabidopsis thaliana]
 sp|Q9LJX0.1|AB19B_ARATH RecName: Full=ABC transporter B family member 19; Short=ABC transporter 
ABCB.19; Short=AtABCB19; AltName: Full=Multidrug 
resistance protein 11; AltName: Full=P-glycoprotein 19 [Arabidopsis 
thaliana]
 dbj|BAB02129.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
 gb|AEE77498.1| ABC transporter B family member 19 [Arabidopsis thaliana]
Length=1252

 Score =   426 bits (1094),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 244/547 (45%), Positives = 346/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  720   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+   
Sbjct  779   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILG  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  839   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  898

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + 
Sbjct  899   LRVPQKRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSKVIKVFV  954

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  955   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  1014

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1015  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1074

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+I+ ++AAN H FIS L
Sbjct  1075  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGL  1134

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1135  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1194

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1195  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1244

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1245  LQLQTHR  1251


 Score =   293 bits (749),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    + + G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  379   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKF  438

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  439   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVG  498

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  499   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  553

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  554   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  604



>ref|XP_004975845.1| PREDICTED: ABC transporter B family member 19-like [Setaria italica]
Length=1258

 Score =   426 bits (1094),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 231/530 (44%), Positives = 341/530 (64%), Gaps = 12/530 (2%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y  I+   GL +     +QHY + ++GE   T +R  + +  L+N++ WF++ ENN   +
Sbjct  736   YVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDQEENNSSLV  795

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
              +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ L+     P   +    
Sbjct  796   AARLATDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILITFPLLVLANFA  855

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQLHRSRK  571
             Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++     L+ PQ++  R+
Sbjct  856   QQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCGELRVPQMYSLRR  915

Query  572   ESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWT  751
               I   +   + L L+  + A+ LW+   LV+ H S+F   I+ + +  +T  S+ E  +
Sbjct  916   SQISGALFGLSQLSLYA-SEALILWFGAHLVRTHVSTFSKVIKVFVVLVITANSVAETVS  974

Query  752   LIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVL  931
             L P ++     ++ VF  L+  TRI+PD+P+    ES+ GE++F+ + F YP+RP+VMV 
Sbjct  975   LAPEIVRGGESIRSVFAILNSRTRIDPDEPDTEQVESVRGEIDFRHVDFAYPTRPDVMVF  1034

Query  932   NGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQI  1111
               F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDG+D+R  NL+ LR +I
Sbjct  1035  KDFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPLAGKVMIDGRDIRRLNLKSLRLKI  1094

Query  1112  GLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQ  1291
             GLVQQEP+LF  SI ENI YG + A+E E++E +KAAN+H F+S LP+GY T VGE+G Q
Sbjct  1095  GLVQQEPVLFATSILENIAYGKDGATEEEVVEAAKAANVHGFVSALPDGYRTPVGERGVQ  1154

Query  1292  LSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKM  1471
             LSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +    GR      
Sbjct  1155  LSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK----GR------  1204

Query  1472  TQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1205  TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQ  1254


 Score =   298 bits (764),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 190/540 (35%), Positives = 299/540 (55%), Gaps = 24/540 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  88    EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDAR  146

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +++ +    V  +  WR+ L++ AV+P    
Sbjct  147   TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  206

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  207   AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQNTLKL  266

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  267   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGLSL  324

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F Y
Sbjct  325   GQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDTADGRCLDE-VHGNIEFKEVAFSY  380

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VM+   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++  
Sbjct  381   PSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTL  440

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP GY+
Sbjct  441   QLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYN  500

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L     
Sbjct  501   THVGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----  556

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  557   VGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  610



>emb|CDY65012.1| BnaCnng45670D [Brassica napus]
Length=1253

 Score =   426 bits (1094),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 243/547 (44%), Positives = 346/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  721   YDS-MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  779

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A
Sbjct  780   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILA  839

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  840   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  899

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +   +RS+     FG+ Q   L L+  + A+ LWY   LV   +S+F   I+ + 
Sbjct  900   LRVPQKRSFYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSEGKSTFSKVIKVFV  955

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G+++F+ 
Sbjct  956   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRH  1015

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1016  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGK  1075

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE ++AAN H FIS L
Sbjct  1076  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGL  1135

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1136  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECMLQEALERL  1195

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1196  MR----GR------TTVVVAHRLSTIRGVDSIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1245

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1246  LQLQTHR  1252


 Score =   279 bits (713),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 183/542 (34%), Positives = 300/542 (55%), Gaps = 25/542 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSKYALYFVYLGLIVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V     
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTA--IFSAIVGGMSL  318

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L        +   +++ + Q   R T I+ D  +    + + G++EFK + F Y
Sbjct  319   GQSFSNLGAFSKGKAAGFKLMEIINQ---RPTIIQ-DPLDGKCLDQVRGDIEFKDVTFSY  374

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDE-GKVLIDGKDVRD  1081
             PSRP+V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD +  G++L+DG +++ 
Sbjct  375   PSRPDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGQILLDGVEIKT  434

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GY
Sbjct  435   LQLKFLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGY  494

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +    
Sbjct  495   ETQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM---  551

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q
Sbjct  552   -VGR------TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQ  603

Query  1622  SM  1627
              M
Sbjct  604   EM  605



>ref|XP_003543769.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
 gb|KHN13230.1| ABC transporter B family member 19 [Glycine soja]
Length=1249

 Score =   425 bits (1093),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 249/545 (46%), Positives = 338/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE     
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSVFCHE-----  895

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
               RV     L RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ +
Sbjct  896   -LRVPQSQSLRRSQTSGFLFGLSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVF  950

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+    ES+ GE+E +
Sbjct  951   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELR  1010

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+VMV    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV++DG
Sbjct  1011  HVDFAYPSRPDVMVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDG  1070

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+H F+S 
Sbjct  1071  KDIRKLNLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHGFVSG  1130

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LPEGY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE 
Sbjct  1131  LPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALER  1190

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSR
Sbjct  1191  LMR----GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRPEGAYSR  1240

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1241  LLQLQ  1245


 Score =   305 bits (781),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 187/537 (35%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  315

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  E      + G +EFK + F YPSRP
Sbjct  316   GQSFSNLGAFSKGKAAGYKLMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRP  375

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             ++ +   F++   AG  VA+VG SG+GKS+V++L+ RFYD +EG+VL+D  D++   L+ 
Sbjct  376   DMFIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKW  435

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GY+T VG
Sbjct  436   LRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVG  495

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  496   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  550

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  551   -----TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHEELIAKA-GTYASLIRFQEM  601



>gb|KGN63323.1| hypothetical protein Csa_2G428960 [Cucumis sativus]
Length=305

 Score =   397 bits (1021),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 242/302 (80%), Gaps = 0/302 (0%)
 Frame = +2

Query  341   MGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHV  520
             M LVAWAVMP HFIGGLIQAKSAKGFS D+  AH E+VSL S+SA NI+T+ SFC EE +
Sbjct  1     MALVAWAVMPFHFIGGLIQAKSAKGFSRDSAVAHHELVSLVSDSATNIRTIASFCQEEEI  60

Query  521   VNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIR  700
             + +AR++L+    +S++ESIK+GII G +LCLWNIAHA+ALWYTT+LV + Q+SF + IR
Sbjct  61    MKRARMSLEEPKRKSKRESIKYGIINGIALCLWNIAHAIALWYTTILVHKRQASFEDGIR  120

Query  701   SYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVE  880
             SYQIFSLTVPSITELWTLIPTV+SAIG+L P F TLDR T IE + P     E  EG +E
Sbjct  121   SYQIFSLTVPSITELWTLIPTVISAIGVLTPAFHTLDRKTLIESEIPRGQKIEKFEGRIE  180

Query  881   FKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLI  1060
             F+ +KF+YP+RPEV+VL  F+L I+AG +VAL+GPSGAGKSSV+ALLLRFYD +EG +LI
Sbjct  181   FQRVKFNYPTRPEVIVLTNFSLEIKAGSRVALIGPSGAGKSSVLALLLRFYDPEEGNILI  240

Query  1061  DGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFI  1240
             DGKD+++YNLR LR  IG V+QEP+LF  SIR NICYG E  SE E+++VS+ A ++  I
Sbjct  241   DGKDIKEYNLRILRTHIGFVRQEPVLFSSSIRYNICYGIEHVSETELLKVSRDAKVNDLI  300

Query  1241  SN  1246
              N
Sbjct  301   VN  302



>ref|XP_010939542.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Elaeis guineensis]
Length=1253

 Score =   425 bits (1093),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 239/539 (44%), Positives = 338/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  725   ERKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLTAMLRNEVGWFDEEE  784

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  + + VK  I++R+SVI+Q ++S++ +  V  IV+WR+  +  A  P  
Sbjct  785   NNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVGFIVEWRVAFLILATFPLL  844

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GD   AH++   +A E  +NI+TV +F  ++ ++    ++ RV  
Sbjct  845   VLANFAQQLSLKGFAGDMAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFHHELRVPQ  904

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             Q  L RS+   + FG+ Q +  C    + A+ LWY   LV+   S+F   I+ + +  +T
Sbjct  905   QCSLRRSQTSGLLFGLSQLSLYC----SEALILWYGAHLVRSGASTFSKVIKVFVVLVVT  960

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               SI E  +L P ++     ++ VF  L+R TRI+PD PE     SI GE+E + I F Y
Sbjct  961   ANSIAETVSLAPEIIRGGESIRSVFSILNRVTRIDPDDPEAEPVGSIHGEIELRHIDFAY  1020

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V + N FNLRI AG   ALVG SG+GKS++IAL+ RFYD   GKV++DGKD+R  
Sbjct  1021  PSRPDVPIFNDFNLRIHAGHSQALVGASGSGKSTIIALIERFYDPTAGKVMMDGKDIRRL  1080

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E+ E S+AA++H F+S LPEGY 
Sbjct  1081  NLKSLRLKIGLVQQEPVLFAASIFENIAYGKDGATEDEVXEASRAASVHGFVSALPEGYK  1140

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEA SALD  SE  +  ALE L +   
Sbjct  1141  TPVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEAMSALDVESECVLQEALEQLMR---  1197

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L ++PDG Y+RL+ LQ
Sbjct  1198  -GR------TTVLVAHRLSTIRGVDSIAVVQDGHIVEQGSHAELVARPDGAYARLLQLQ  1249


 Score =   285 bits (728),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 186/538 (35%), Positives = 294/538 (55%), Gaps = 16/538 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+    LR     A L+ ++ +F+  +  
Sbjct  81    EVSKYALYFVYLGLIVCLSSYAEIACWMYTGERQAGALRRRYLEAVLKQDVGFFD-TDAR  139

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFMSAWRLALLSVAVIPGIAF  199

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    LA ++ A ++TV SF  E   ++    A+Q  L  
Sbjct  200   AGGLYAYTLTGLTSKSRESYANAGILAEQAIAQVRTVYSFVGESKALSSYSEAIQSTLKL  259

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               +  +  G+  G +  +  ++ A+  WY  + V+  Q+    A  +  IFS  V   S+
Sbjct  260   GYRAGMAKGLGIGCTYGIACMSWALVFWYAGVFVRNGQTDGGKAFTA--IFSAIVGGMSL  317

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + + +   I  D  +      ++G +EFK + F YPSRP
Sbjct  318   GQAFSNLGAFSKGKAAGYKLMEIIQQKPSIIQDPSDGKCLPEVQGNLEFKDVTFSYPSRP  377

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++   F+L   AG   A+VG SG+GKS+V+ L+ RFYD ++G++L+D  D +   L+ 
Sbjct  378   DVIIFRDFSLFFPAGKTAAVVGGSGSGKSTVVVLIERFYDPNQGQILLDNVDTKTLQLKW  437

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H FIS LP GY+T  G
Sbjct  438   LREQIGLVSQEPALFATTILENILYGKPDATIAEVEAAASAANAHNFISLLPNGYNTQAG  497

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  498   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  552

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D+I VM +G +VE G+H  L ++   G Y+ L+  Q M
Sbjct  553   -----TTVVVAHRLSTIRNVDMIAVMQQGQIVETGTHEELLAKGSSGAYASLIRFQEM  605



>dbj|BAK05967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1266

 Score =   425 bits (1093),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 235/536 (44%), Positives = 337/536 (63%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   G  +     +QHY + ++GE   T +R  + +  L+N++ WF+  E
Sbjct  738   ERKTREYVFIYIGTGFYAVVAYLIQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEEE  797

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  E + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  798   NNSSLVAARLNTEAADVKSAIAERISVILQNMTSLLVSFIVGFIIEWRVAILILVTFPLL  857

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++     L+ PQ
Sbjct  858   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVPQ  917

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             +H  R+  +  G++ G S      + A+ LWY   LV+ H S+F   I+ + +  +T  S
Sbjct  918   MHSLRRSQVS-GVLYGLSQLSLYASEALILWYGAHLVRHHVSTFSRVIKVFVVLVITANS  976

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++ VF  L+  TRI+PD+PE    E + GE+E + + F YPSR
Sbjct  977   VAETVSLAPEIIRGGESVRSVFAVLNSRTRIDPDEPEGEPVEKVRGEIELRHVDFAYPSR  1036

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  NL+
Sbjct  1037  PDVMVFKEFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLNLK  1096

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP+LF  SI ENI YG +  +E E++E +K AN+H F+S LP+GY T V
Sbjct  1097  SLRLKIGLVQQEPVLFATSILENIGYGKDGVTEEEVVEAAKVANVHGFVSALPDGYRTPV  1156

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  V  AL  + +    GR
Sbjct  1157  GERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVVQEALGRIMK----GR  1212

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1213  ------TTVLVAHRLSTIRCVDSIAVVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQ  1262


 Score =   288 bits (738),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 190/542 (35%), Positives = 301/542 (56%), Gaps = 24/542 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  94    EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDAR  152

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +++ +    V  +  WR+ L++ AV+P    
Sbjct  153   TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  212

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  213   AGGLYAYTLTGPTSKSRESYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQSTLKL  272

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  273   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRSGQTDGGKAFTA--IFSAIVGGLSL  330

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F Y
Sbjct  331   GQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDSTDGRCLDE-VHGNIEFKEVSFSY  386

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   F+L   AG   A+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++  
Sbjct  387   PSRPDVMVFRDFSLFFPAGKTAAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNADIKSL  446

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I +NI YG   A+ AE+   + AAN H+FI+ LP GY+
Sbjct  447   QLKWLRDQIGLVNQEPALFATTIIDNILYGKPDATMAEVEAAASAANAHSFIALLPNGYN  506

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ +     
Sbjct  507   TQVGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRIM----  562

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ + D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  563   IGR------TTVVVAHRLSTIRSVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  616

Query  1622  SM  1627
              M
Sbjct  617   EM  618



>ref|XP_010266821.1| PREDICTED: ABC transporter B family member 13-like [Nelumbo nucifera]
Length=1248

 Score =   425 bits (1092),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 237/543 (44%), Positives = 341/543 (63%), Gaps = 18/543 (3%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             D   K +V    +I   +G ++     LQHY Y ++GE+  + +R  ++SA L+NE+ WF
Sbjct  714   DLHIKHEVRRVCLIMIGVGAITVPIYLLQHYFYTLMGEQITSRIRFLMFSAILRNEIGWF  773

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             +  EN+ GSLT+ +  + + V+  I+DR+S I+Q ++  V A  +S  + WR+  V  A 
Sbjct  774   DLDENSTGSLTTSLAVDATLVRAAIADRLSTILQNVALTVTAFAISFTLSWRLAAVMVAT  833

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL  544
              P      L +    +GF GD   A+S+ + +  E+  NI+TV +F  E+HVV +     
Sbjct  834   YPFLISSSLAEQLFLRGFGGDYNRAYSQDIVVVREAITNIRTVAAFGAEDHVVRQ----F  889

Query  545   QPQLHRSRKESIKFGIIQGT----SLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQI  712
               +L +S+K+S+  G I G     +L     ++A+ALWY +LL++   SSF + I+ + +
Sbjct  890   IHELSQSKKQSLLRGHISGVCYGLTLFFAFCSYALALWYASLLIKHKHSSFGDVIKCFMV  949

Query  713   FSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTI  892
               +T  SI E + L P V+     L  VF  L R T I+ +         + G +EF+ +
Sbjct  950   LLVTAFSIAETFALAPQVVKGSQALGSVFNILQRETAIDANSSTSEAVTQVNGLIEFRNV  1009

Query  893   KFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKD  1072
              F YP+RP+++VL+ FNL++ +G  +ALVG SG+GKSSVI+L+LRFYD   G +LIDG+D
Sbjct  1010  SFKYPTRPDILVLDDFNLQVPSGCSLALVGQSGSGKSSVISLILRFYDPISGVILIDGRD  1069

Query  1073  VRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLP  1252
             +R  NL+ LR ++GLVQQEP LF  +I ENI YG E ASE EI+  +KAAN H FIS +P
Sbjct  1070  IRGLNLKGLRMKMGLVQQEPALFSTTIYENIKYGKENASEIEIMNAAKAANAHGFISRMP  1129

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
             +GY T VGE+G QLSGGQKQR+AIARA+LK PAI+LLDEATSALD+ SER V  AL+ L 
Sbjct  1130  DGYQTHVGERGIQLSGGQKQRVAIARAILKDPAILLLDEATSALDTASERVVQEALDRLM  1189

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLV  1612
             +    GR      T I VAHRLST+ N+D I V+  G VVE GSH TL  +PD VY++L+
Sbjct  1190  E----GR------TTILVAHRLSTIHNADNIAVLKHGKVVETGSHETLILRPDSVYAQLI  1239

Query  1613  SLQ  1621
             ++Q
Sbjct  1240  NIQ  1242


 Score =   278 bits (711),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 198/548 (36%), Positives = 287/548 (52%), Gaps = 49/548 (9%)
 Frame = +2

Query  47    FASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER---PENNVGSLT  217
             F  +G+L + +  +    +   GE+    LR     + L+ ++ +F+R    EN +  ++
Sbjct  98    FVYLGVLVFASAWMGIAFWMQTGERQAACLRLKYLQSVLKRDIDFFDREARDENIIFCIS  157

Query  218   SRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQ  397
             S  +     V+  I D+    ++ ++   +   +     W++ LV  AV+P   I G   
Sbjct  158   SDAI----LVQDAIGDKTGHALRYLAQFCVGIVIGFTTVWQLSLVILAVVPLIVIAGGGY  213

Query  398   AKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKES  577
             A      S    AA++E    A E  + ++TV SF  E+  + K   +L   L+  +K  
Sbjct  214   AIIMSTLSRKGEAAYAEAGKDAEEIISQVRTVYSFVGEDKAIEKYSRSLTKALNLGKKSG  273

Query  578   IKFGI----IQGTSLCLWNIAHAVALWYTTLLVQRHQ--------SSFLNAIRSYQIFSL  721
             I  G+    I G   C W    A+ LWY ++LV RH+        S+ LN I S      
Sbjct  274   IVKGVGIGSIYGLLFCSW----ALLLWYASILV-RHRDTDGGKAFSTILNVIFSGLALGQ  328

Query  722   TVPSITELW---TLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTI  892
               PS+  +         ++S I       Q +D    I PD         + G++EF  +
Sbjct  329   AAPSLGAIGKGRAATSNIISMIQTDSSSSQQMDNGI-ILPD---------VSGKIEFSEV  378

Query  893   KFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKD  1072
              F YPSRP   V    +  I AG   ALVG SG+GKS++I+++ RFYD   GK+L+DG D
Sbjct  379   SFSYPSRPN-KVFEDLSFTIHAGQNFALVGQSGSGKSTIISMMERFYDPTSGKILLDGHD  437

Query  1073  VRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLP  1252
             ++   L+ LR Q+GLV QEP LF  SI  NI YG   A   +IIE SKAAN H+FI  LP
Sbjct  438   LKSLQLKWLRKQMGLVNQEPALFAMSIAGNIMYGKVDAEMEQIIEASKAANAHSFIQGLP  497

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
             +GY T VGE G+QLSGGQKQRI+IARA+L+ P I+LLDEATSALD+ SE  V  AL  + 
Sbjct  498   DGYHTQVGEGGAQLSGGQKQRISIARAVLRNPKILLLDEATSALDTESELIVQQALNKIM  557

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRL  1609
                       S+ T I VAHRLST+ + + I+V+  G +VE G+H  L S+  DG Y+ L
Sbjct  558   ----------SERTTIIVAHRLSTIRDVNKIIVLKNGKIVESGTHIELMSKGADGEYANL  607

Query  1610  VSLQSMKD  1633
             V+LQ + +
Sbjct  608   VNLQKLGN  615



>gb|KFK33760.1| hypothetical protein AALP_AA5G056700 [Arabis alpina]
Length=1251

 Score =   425 bits (1092),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 242/547 (44%), Positives = 347/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  719   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  777

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+   
Sbjct  778   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILG  837

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  838   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  897

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+     FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + 
Sbjct  898   LRVPQKRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGESTFSKVIKVFV  953

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR T+I+PD  +    E+I G+++F+ 
Sbjct  954   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTKIDPDDADADPVETIRGDIDFRH  1013

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1014  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1073

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE +++AN H FIS L
Sbjct  1074  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARSANAHGFISGL  1133

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1134  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1193

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1194  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1243

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1244  LQLQTHR  1250


 Score =   285 bits (728),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 180/537 (34%), Positives = 298/537 (55%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  81    QVSKYALYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  139

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  140   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  199

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  200   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLKL  259

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V   S+
Sbjct  260   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGTTDGGKAFTA--IFSAIVGGMSL  317

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    + ++G +EFK + F YPSRP
Sbjct  318   GQSFSNLGAFSKGKSAGYKLMEIINQRPTIIQDPLDGKCLDQVQGNIEFKDVTFSYPSRP  377

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD   G++L+DG +++   L+ 
Sbjct  378   DVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPSNGQILLDGVEIKTLQLKF  437

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  438   LRDQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVG  497

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  498   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  552

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  553   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELVAKA-GAYASLIRFQEM  603



>emb|CDY00109.1| BnaC09g01920D [Brassica napus]
Length=1245

 Score =   424 bits (1091),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 239/542 (44%), Positives = 345/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  717   ERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDE  776

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ I++WR+ L+     P  
Sbjct  777   HNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPLL  836

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ RV  
Sbjct  837   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHELRVPQ  896

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +   +RS+   + FG+ Q   L L+  + AV LWY   LV + +S+F   I+ + +  +T
Sbjct  897   KRSFYRSQTSGLLFGLSQ---LALYG-SEAVILWYGAHLVSQGKSTFSKVIKVFVVLVIT  952

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD  +   +E+I G++EF+ + F Y
Sbjct  953   ANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPAETIRGDIEFRHVDFAY  1012

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGKD+R  
Sbjct  1013  PSRPDVMVFTDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRL  1072

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE ++AAN H FIS LPEGY 
Sbjct  1073  NLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYK  1132

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1133  TPVGERGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMR---  1189

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+   D I V+  G +VE G HS L S+P+G YSRL+ LQ+
Sbjct  1190  -GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGRHSELVSRPEGAYSRLLQLQT  1242

Query  1625  MK  1630
              +
Sbjct  1243  HR  1244


 Score =   277 bits (709),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 181/538 (34%), Positives = 297/538 (55%), Gaps = 17/538 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSKYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTA--IFSAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    E + G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKSAGYKLMEIINQRPTIVQDPLDGKCLEQVHGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDE-GKVLIDGKDVRDYNLR  1093
             +V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD +  GK+L+DG +++   L+
Sbjct  379   DVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGKILLDGVEIKTLQLK  438

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT V
Sbjct  439   FLREQIGLVNQEPALFATTILENILYGKPNATLDEVEAAASAANAHSFITLLPKGYDTQV  498

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR
Sbjct  499   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR  554

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                   T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  555   ------TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGPYASLIRFQEM  605



>ref|XP_007151220.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
 gb|ESW23214.1| hypothetical protein PHAVU_004G027800g [Phaseolus vulgaris]
Length=1249

 Score =   424 bits (1091),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 340/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  781   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    N+ RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQTKMLSVFCNELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS      FG+ Q   L L+  + A+ LWY   LV R  S+F   I+ + +  +T
Sbjct  901   RQSLRRSLTSGFLFGLSQ---LALYA-SEALILWYGAHLVSRGASTFSKVIKVFVVLVIT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD P+    E++ GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDADPVETLRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV    +LRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV++DGKD+R  
Sbjct  1017  PSRPDVMVFKDLSLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDGKDIRKL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG + ASE E+IE ++AAN+H F+S LPEGY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFENIAYGKDGASEGEVIEAARAANVHGFVSGLPEGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSH+ L S+P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHAELVSRPEGAYSRLLQLQ  1245


 Score =   298 bits (762),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 188/537 (35%), Positives = 298/537 (55%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVSKYALYFVYLGLVVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A  +TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQARTVYSYVGESKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  315

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  E      + G +EFK + F YPSRP
Sbjct  316   GQSFSNLGAFSKGKAAGYKLMEIINQKPTIVEDSSEGKCLADVNGNIEFKDVTFSYPSRP  375

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V +   F++   AG  VA+VG SG+GKS+V++L+ RFYD +EG+VL+D  D++   L+ 
Sbjct  376   DVFIFRSFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKSLQLKW  435

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GY+T VG
Sbjct  436   LRDQIGLVNQEPALFATTILENILYGKADATMAEVEAATSAANAHSFITLLPNGYNTQVG  495

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  496   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VGR-  550

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  551   -----TTVVVAHRLSTIRNVDTIAVIQQGQVVETGTHEELIAKT-GTYASLIRFQEM  601



>ref|NP_001169660.1| uncharacterized protein LOC100383541 [Zea mays]
 gb|ACN34410.1| unknown [Zea mays]
 gb|AFW58473.1| hypothetical protein ZEAMMB73_248443 [Zea mays]
Length=1264

 Score =   424 bits (1090),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 233/539 (43%), Positives = 341/539 (63%), Gaps = 12/539 (2%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S  + K   Y  I+   GL +     +QHY + ++GE   T +R  + +  L+N++ WF+
Sbjct  733   SKMESKTREYVFIYIGTGLYAVVAYLVQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFD  792

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
             + ENN   + +R+  + + VK  I++R+SVI+Q ++S++++  V  I++WR+ L+     
Sbjct  793   QEENNSNLVAARLSTDAADVKSAIAERISVILQNMTSLLVSFVVGFIIEWRVALLILVTF  852

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ  547
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++     L+
Sbjct  853   PLLVLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELR  912

Query  548   -PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              PQ+H  R+  I   +   + L L+  + A+ LW+   LV+ H S+F   I+ + +  +T
Sbjct  913   VPQMHSLRRSQISGALFGLSQLSLYA-SEALILWFGAHLVRTHVSTFSKVIKVFVVLVIT  971

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     ++ VF  L+  TRI+PD P+    ES+ GE++F+ + F Y
Sbjct  972   ANSVAETVSLAPEIVRGGESIRSVFSVLNSRTRIDPDDPDAEQVESVRGEIDFRHVDFAY  1031

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RP+VMV    +LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1032  PTRPDVMVFKDLSLRIRAGQSQALVGASGSGKSTVIALVERFYDPLAGKVMIDGKDIRRL  1091

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP+LF  SI ENI YG + A+E E++E +K AN+H F+S LP+GY 
Sbjct  1092  NLKSLRLRIGLVQQEPVLFATSILENIAYGRDGATEEEVVEAAKVANVHGFVSALPDGYR  1151

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PA++LLDEATSALD+ SE  +  ALE + +   
Sbjct  1152  TPVGERGVQLSGGQKQRIAIARAVLKDPAVLLLDEATSALDAESECVLQEALERIMK---  1208

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1209  -GR------TAVLVAHRLSTIRGVDSIAVVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQ  1260


 Score =   296 bits (758),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 188/540 (35%), Positives = 299/540 (55%), Gaps = 24/540 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  94    EVSKYSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDAR  152

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +++ +    V  +  WR+ L++ AV+P    
Sbjct  153   TGDVVFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAF  212

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  213   AGGLYAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGETKALNSYSEAIQNTLKL  272

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  273   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGLSL  330

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +L+ + Q   R T ++       L E + G +EFK + F Y
Sbjct  331   GQSFSNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDTADGRCLDE-VHGNIEFKEVAFSY  386

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VM+   F+L   AG   A+VG SG+GKS+V+AL+ RFYD ++G+VL+D  D++  
Sbjct  387   PSRPDVMIFRDFSLFFPAGKTAAVVGGSGSGKSTVVALIERFYDPNQGQVLLDNVDIKTL  446

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+ AE+   + +AN H+FI+ LP GY+
Sbjct  447   QLKWLRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAAATSANAHSFIALLPNGYN  506

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VG++G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+GSE  V  AL+ L     
Sbjct  507   THVGDRGLQLSGGQKQRIAIARAMLKNPKLLLLDEATSALDAGSESIVQEALDRLM----  562

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D+I V+ +G VVE G+H  L ++   G Y+ L+  Q
Sbjct  563   VGR------TTVVVAHRLSTIRCVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQ  616



>gb|KHN45492.1| ABC transporter B family member 19 [Glycine soja]
Length=1214

 Score =   423 bits (1087),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 249/545 (46%), Positives = 337/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  686   ERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  745

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  746   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  805

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE     
Sbjct  806   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSVFCHE-----  860

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
               RV     L RS      FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ +
Sbjct  861   -LRVPQSQSLRRSLTSGFLFGLSQ---LALYA-SEALILWYGAHLVSKGVSTFSKVIKVF  915

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+    ES+ GE+E +
Sbjct  916   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELR  975

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV++DG
Sbjct  976   HVDFAYPSRPDVMVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDG  1035

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+H F+S 
Sbjct  1036  KDIRKLNLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHGFVSG  1095

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LPEGY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE 
Sbjct  1096  LPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALER  1155

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+ +G YSR
Sbjct  1156  LMR----GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRHEGAYSR  1205

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1206  LLQLQ  1210


 Score =   306 bits (783),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 187/537 (35%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  44    EVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  102

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  103   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  162

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  163   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  222

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  223   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  280

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  E      + G +EFK + F YPSRP
Sbjct  281   GQSFSNLGAFSKGKAAGYKLMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRP  340

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             ++ +   F++   AG  VA+VG SG+GKS+V++L+ RFYD +EG+VL+D  D++   L+ 
Sbjct  341   DMFIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKW  400

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GY+T VG
Sbjct  401   LRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVG  460

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  461   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLM----VGR-  515

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  516   -----TTVVVAHRLSTIRNVDTIAVIQQGQVVETGAHEELIAKA-GTYASLIRFQEM  566



>ref|XP_006306603.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
 gb|EOA39501.1| hypothetical protein CARUB_v10008108mg [Capsella rubella]
Length=1247

 Score =   424 bits (1089),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 237/543 (44%), Positives = 337/543 (62%), Gaps = 12/543 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             + S  KR+V    +IF    +++     LQHY Y ++GE+  + +R SL+SA L NE+ W
Sbjct  715   FPSLIKREVEKVIIIFVGTAIVTTPIYLLQHYFYTLMGERLTSRVRLSLFSAILVNEIGW  774

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  ENN GSLTS +  + + V+  ++DR+S IVQ IS  V A  ++    WR+  V  A
Sbjct  775   FDLDENNTGSLTSILSADATLVRSAVADRLSTIVQNISLTVTALALAFFYSWRVAAVVTA  834

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
               P      L +    KGF GD T A+S   SLA E+  NI+TV +F  E  +  +    
Sbjct  835   CFPLLIAASLTEQLFLKGFGGDYTRAYSRATSLAREAIVNIRTVAAFGAENQISEQFACE  894

Query  542   LQ-PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFS  718
             L  P  +   K  I  G   G S CL   ++++ LWY ++L++R +++F ++I+S+ +  
Sbjct  895   LSIPTKNALLKGHIS-GFGYGLSQCLAYCSYSLGLWYISVLMKRKETNFEDSIKSFMVLL  953

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKF  898
             +T  S+ E   L P ++     L  VF+ L R + I PD+P+  L   I+G++EF+ + F
Sbjct  954   VTAYSVAETLALTPDIVKGTQALGSVFRVLHRESEIHPDQPDSRLVTQIKGDIEFRNVSF  1013

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YP+RPE+ +    NLR+  G  +A+VGPSG+GKS+VI L++RFYD   GK+ IDG D++
Sbjct  1014  AYPTRPEIAIFKNLNLRVSPGKSLAVVGPSGSGKSTVIGLIMRFYDTSNGKLCIDGHDIK  1073

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
               NLR LR ++ LVQQEP LF  +I ENI YG+E ASEAEII+ +KAA+ H FI  + EG
Sbjct  1074  TLNLRSLRMKLALVQQEPALFSTTIYENIKYGNENASEAEIIQAAKAAHAHEFIIKMEEG  1133

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQH  1438
             Y T VG+KG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L + 
Sbjct  1134  YKTHVGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDKLMK-  1192

Query  1439  HKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSL  1618
                GR      T + VAHRLST+  +D+I V+ KG VVE GSH  L S+ DG Y +  SL
Sbjct  1193  ---GR------TTVLVAHRLSTIRKADMIAVLHKGRVVEKGSHIELVSKSDGFYKQFTSL  1243

Query  1619  QSM  1627
             Q +
Sbjct  1244  QDV  1246


 Score =   270 bits (691),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 188/542 (35%), Positives = 293/542 (54%), Gaps = 42/542 (8%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G+ +++ A IG+  W             GE+    LR +   + L  ++ +F+  E   
Sbjct  100   LGFVNLVSAWIGVACWMQT----------GERQAARLRINYLKSILAKDITFFD-TETRD  148

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +    I ++   V+  I D+   +++ +    +   +  +  W++ L+   V+P   + 
Sbjct  149   SNFIFHISSDAILVQDAIGDKTGHVLRYLCQFTVGFVIGFLSVWQLTLLTLGVVPLIAVA  208

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  + AA+++   +A E  + ++TV +F  EE  +     +L+  L  S
Sbjct  209   GGGYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVREEKAIESYSNSLKKALKLS  268

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFSLT  724
             +K  +  G+  G +  L   A A+  WY +LLV+  ++       + LN I S       
Sbjct  269   KKSGLAKGLGVGLTYSLLFGAWALLFWYASLLVRHGKTNGAKAFTTILNVIYSGFALGQA  328

Query  725   VPSITEL---WTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
             VPS++ +         + S IG        L+   R++      ++ E++ G++EF  + 
Sbjct  329   VPSLSAISKGRVAAANIFSMIG-----NNNLENPARLD----NGTILENVAGKIEFHRVS  379

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP  MV +  +  I +G   A VGPSG+GKS++I+++ RFY+ + G++L+DGKD+
Sbjct  380   FAYPSRPN-MVFDNLSFTIHSGKTFAFVGPSGSGKSTIISMVQRFYEPNSGEILLDGKDI  438

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   L+ LR  +GLV QEP LF  +I  NI  G E AS  +IIE +KAAN  +FI +LP+
Sbjct  439   KCLKLKWLREHMGLVSQEPALFATTIASNILLGKENASMVQIIEAAKAANADSFIKSLPD  498

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+S+ +
Sbjct  499   GYSTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDTESEKIVQQALDSVME  558

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                       K T I VAHRLST+ N D I+V+  G V+E GSH  L S+  G Y+ LV 
Sbjct  559   ----------KRTTIVVAHRLSTIRNVDKIIVLRNGQVMETGSHLELISR-GGDYATLVK  607

Query  1616  LQ  1621
              Q
Sbjct  608   CQ  609



>emb|CDX86408.1| BnaA06g31250D [Brassica napus]
Length=1237

 Score =   423 bits (1087),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 241/547 (44%), Positives = 346/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  705   YDS-MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  763

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A
Sbjct  764   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILA  823

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  824   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  883

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +   +RS+     FG+ Q   L L+  + A+ LWY   LV   +S+F   I+ + 
Sbjct  884   LRVPQKRSFYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSEGKSTFSKVIKVFV  939

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G+++F+ 
Sbjct  940   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRH  999

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1000  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGK  1059

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E++E +++AN H FIS L
Sbjct  1060  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVMEAARSANAHGFISGL  1119

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1120  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1179

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1180  MR----GR------TTVVVAHRLSTIRGVDSIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1229

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1230  LQLQTHR  1236


 Score =   281 bits (719),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 185/542 (34%), Positives = 300/542 (55%), Gaps = 25/542 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V     
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTA--IFSAIVGGMSL  318

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L        +   +++ + Q   R T I+ D  +    + + G++EFK + F Y
Sbjct  319   GQSFSNLGAFSKGKAAGFKLMEIINQ---RPTIIQ-DPLDGKCLDQVRGDIEFKDVTFSY  374

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDE-GKVLIDGKDVRD  1081
             PSRP+V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD +  G++L+DG +++ 
Sbjct  375   PSRPDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGQILLDGVEIKT  434

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GY
Sbjct  435   LQLKFLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGY  494

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             DT VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +    
Sbjct  495   DTQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM---  551

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q
Sbjct  552   -VGR------TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQ  603

Query  1622  SM  1627
              M
Sbjct  604   EM  605



>ref|XP_010552950.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Tarenaya hassleriana]
Length=1254

 Score =   423 bits (1088),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 240/542 (44%), Positives = 340/542 (63%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++   GL +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  726   ERKTKEYVFVYIGTGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEEE  785

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  +++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  786   HNSSLVAARLATDAADVKSAMAERISVILQNVTSLLTSFIVAFIVEWRVSLLILAAFPFL  845

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT   H++   +A E  +NI+TV +F  ++ ++    ++ R   
Sbjct  846   VLANFAQQLSLKGFAGDTAKVHAKTSMIAGEGVSNIRTVAAFNAQDRILSLFCHELRAPQ  905

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  L RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  906   RRSLSRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSRVIKVFVVLVVT  961

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRIEPD P     E+I GE+EF+ + F Y
Sbjct  962   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIEPDDPYADPVETIRGEIEFRHVDFAY  1021

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   FNLRI AG   ALVG SG+GKSSVI+L+ RFYD   GKV+IDGKD+R  
Sbjct  1022  PSRPDVMVFKDFNLRIRAGQSQALVGASGSGKSSVISLIERFYDPVAGKVMIDGKDIRRI  1081

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR LR +IGLVQQEP LF  +I  NI YG + A+EAE+IE ++AAN H FIS LP+GY 
Sbjct  1082  NLRSLRLKIGLVQQEPALFAATIFHNIAYGKDSATEAEVIEAARAANAHGFISGLPDGYK  1141

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  A+E L +   
Sbjct  1142  TPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEAIERLMR---  1198

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+     I V+  G +VE GSHS L ++P+G YSRL+ LQ+
Sbjct  1199  -GR------TTVVVAHRLSTIRGVHRIGVIQDGRIVEQGSHSELITRPEGEYSRLLQLQN  1251

Query  1625  MK  1630
              +
Sbjct  1252  HR  1253


 Score =   289 bits (739),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 188/541 (35%), Positives = 300/541 (55%), Gaps = 24/541 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  84    EVSKYALYFVYLGLVVCFSSYAEIACWMYTGERQVGALRKRYLQAVLKQDVGFFD-TDAR  142

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  143   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  202

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  203   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSNAIQYTLKL  262

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V     
Sbjct  263   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  320

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L       ++   +++ + Q   R + I+     + L E + G +EFK + F Y
Sbjct  321   GQSFSNLGAFSKGKVAGYKLMEIINQ---RPSIIQDPFGGKCLDE-VHGNIEFKDVTFSY  376

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD + G++ +DG D++  
Sbjct  377   PSRPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQIFLDGVDIKIL  436

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+
Sbjct  437   QLKFLRDQIGLVNQEPALFATTIFENILYGKPDATMVEVEAAASAANAHSFITLLPNGYN  496

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L     
Sbjct  497   TQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDAGSESIVQEALDRLM----  552

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRL T+ N D I V+ +G VVE GSH  L ++  G Y+ L+  Q 
Sbjct  553   VGR------TTVVVAHRLCTIRNVDSISVIQQGQVVETGSHEKLIAKA-GAYASLIRFQE  605

Query  1625  M  1627
             M
Sbjct  606   M  606



>ref|XP_009151836.1| PREDICTED: ABC transporter B family member 19 [Brassica rapa]
Length=1252

 Score =   423 bits (1087),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 241/547 (44%), Positives = 346/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  720   YDS-MERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A
Sbjct  779   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILA  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  839   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  898

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +   +RS+     FG+ Q   L L+  + A+ LWY   LV   +S+F   I+ + 
Sbjct  899   LRVPQKRSFYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSEGKSTFSKVIKVFV  954

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G+++F+ 
Sbjct  955   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIDFRH  1014

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1015  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLGGKVMIDGK  1074

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E++E +++AN H FIS L
Sbjct  1075  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVMEAARSANAHGFISGL  1134

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1135  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1194

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+P+G YSRL
Sbjct  1195  MR----GR------TTVVVAHRLSTIRGVDSIGVIQDGRIVEQGSHSELVSRPEGAYSRL  1244

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1245  LQLQTHR  1251


 Score =   286 bits (731),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 185/541 (34%), Positives = 300/541 (55%), Gaps = 24/541 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSKYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-----  727
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V     
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTA--IFSAIVGGMSL  318

Query  728   -PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S + L        +   +++ + Q   R T I+ D  +    + + G++EFK + F Y
Sbjct  319   GQSFSNLGAFSKGKAAGFKLMEIINQ---RPTIIQ-DPLDGKCLDQVRGDIEFKDVTFSY  374

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++  
Sbjct  375   PSRPDVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGQILLDGVEIKTL  434

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
              L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYD
Sbjct  435   QLKFLREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYD  494

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +     
Sbjct  495   TQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----  550

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q 
Sbjct  551   VGR------TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQE  603

Query  1625  M  1627
             M
Sbjct  604   M  604



>ref|XP_003554410.1| PREDICTED: ABC transporter B family member 19-like isoform X1 
[Glycine max]
Length=1250

 Score =   423 bits (1087),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 249/545 (46%), Positives = 337/545 (62%), Gaps = 30/545 (6%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSF----------CHEEHVVN  526
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F          CHE     
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKMLSVFCHE-----  896

Query  527   KARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
               RV     L RS      FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ +
Sbjct  897   -LRVPQSQSLRRSLTSGFLFGLSQ---LALY-ASEALILWYGAHLVSKGVSTFSKVIKVF  951

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD P+    ES+ GE+E +
Sbjct  952   VVLVITANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPDADPVESLRGEIELR  1011

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV++DG
Sbjct  1012  HVDFAYPSRPDVMVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIAGKVMVDG  1071

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
             KD+R  NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++AAN+H F+S 
Sbjct  1072  KDIRKLNLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARAANVHGFVSG  1131

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             LPEGY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE 
Sbjct  1132  LPEGYKTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALER  1191

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T + VAHRLST+   D I V+  G +VE GSHS L S+ +G YSR
Sbjct  1192  LMR----GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRHEGAYSR  1241

Query  1607  LVSLQ  1621
             L+ LQ
Sbjct  1242  LLQLQ  1246


 Score =   306 bits (783),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 187/537 (35%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVSKYALYFVYLGLVVCISSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  316

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  E      + G +EFK + F YPSRP
Sbjct  317   GQSFSNLGAFSKGKAAGYKLMEIINQKPTIVEDPSEGKCLAEVNGNIEFKDVTFSYPSRP  376

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             ++ +   F++   AG  VA+VG SG+GKS+V++L+ RFYD +EG+VL+D  D++   L+ 
Sbjct  377   DMFIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNEGQVLLDNVDIKTLQLKW  436

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GY+T VG
Sbjct  437   LRDQIGLVNQEPALFATTILENILYGKPDATMAEVEAATSAANAHSFITLLPNGYNTQVG  496

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      GR 
Sbjct  497   ERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSENIVQEALDRLM----VGR-  551

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  552   -----TTVVVAHRLSTIRNVDTIAVIQQGQVVETGAHEELIAKA-GTYASLIRFQEM  602



>ref|XP_002890755.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67014.1| P-glycoprotein 14 [Arabidopsis lyrata subsp. lyrata]
Length=1248

 Score =   422 bits (1086),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 240/542 (44%), Positives = 340/542 (63%), Gaps = 10/542 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             + S  KR+V   ++IF   G+++     LQHY Y ++GE+  + +R SL+SA L NE+ W
Sbjct  716   FPSLIKREVDKVAIIFVGAGIVTAPIYLLQHYFYTLMGERLTSRVRLSLFSAILSNEIGW  775

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  ENN GSLTS +  + + V+  I+DR+S IVQ +S  + A  ++    WR+  V  A
Sbjct  776   FDLDENNTGSLTSILAADATLVRSAIADRLSTIVQNLSLTITALALAFYYSWRVAAVVTA  835

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
               P      L +    KGF GD T A++   SLA E+  NI+TV +F  E+ +  +    
Sbjct  836   CFPLLIAASLTEQLFLKGFGGDYTRAYARATSLAREAITNIRTVAAFGAEKQISEQFTCE  895

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L      +       G   G S CL   ++A+ LWY ++L++R++++F ++I+S+ +  +
Sbjct  896   LSKPTKSALLRGHISGFGYGLSQCLAFCSYALGLWYISILIKRNETNFEDSIKSFMVLLV  955

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T  S+ E   L P ++     L  VF+ L R T I PD+P   L   I+G++EF+ + F 
Sbjct  956   TAYSVAETLALTPDIVKGTQALGSVFRVLHRKTEIPPDQPNSRLVTHIKGDIEFRNVSFA  1015

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP+RPE+ +    NLR+ AG  +A+VGPSG+GKS+VI L++RFYD   G + IDG+D++ 
Sbjct  1016  YPTRPEIAIFQNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPSNGNLCIDGQDIKT  1075

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
              NLR LR ++ LVQQEP LF  +I ENI YG+E ASEAEIIE +KAAN H FIS + EGY
Sbjct  1076  VNLRSLRKKLALVQQEPALFSTTIHENIKYGNENASEAEIIEAAKAANAHEFISRMEEGY  1135

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              T VG+KG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +  
Sbjct  1136  KTHVGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDKLMK--  1193

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T + VAHRLST+  +D IVV+ KG VVE GSH  L S+ DG Y +L SLQ
Sbjct  1194  --GR------TTVLVAHRLSTIRKADTIVVLHKGKVVEKGSHRELVSKSDGFYKKLTSLQ  1245

Query  1622  SM  1627
              +
Sbjct  1246  EV  1247


 Score =   283 bits (723),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 191/546 (35%), Positives = 296/546 (54%), Gaps = 50/546 (9%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR +   + L  ++++F+  E   
Sbjct  100   LGLVNLVSAWIGVACWMQT----------GERQTARLRINYLKSILAKDISFFD-TEARD  148

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +    I ++   V+  I D+   +++ +   +    +  +  W++ L+   V+P   I 
Sbjct  149   SNFIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAIA  208

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  + AA+++   +A E  + ++TV +F  EE  V     +L+  L  S
Sbjct  209   GGGYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALKLS  268

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFSLT  724
             ++  +  G+  G +  L   A A+  WY +LLV+  ++       + LN I S       
Sbjct  269   KRSGLAKGLGVGLTYSLLFCAWALLFWYASLLVRHGKTNGAKAFTTILNVIYSGFALGQA  328

Query  725   VPSITELWTLIPTVLSAIGILKPV-------FQTLDRCTRIEPDKPEESLSESIEGEVEF  883
             VPS++    +    ++A  I + +       F+ LD  T ++          ++ G +EF
Sbjct  329   VPSLS---AISKGRVAAANIFRMIGSNNLESFERLDNGTTLQ----------NVVGRIEF  375

Query  884   KTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLID  1063
               + F YPSRP  MV    +  I +G   A VGPSG+GKS++I+++ RFY+ + GK+L+D
Sbjct  376   CGVSFAYPSRPN-MVFENLSFTIHSGKTFAFVGPSGSGKSTIISMVQRFYEPNSGKILLD  434

Query  1064  GKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFIS  1243
             G D+++  L+ LR Q+GLV QEP LF  +I  NI  G E+AS  +IIE +KAAN  +FI 
Sbjct  435   GNDIKNLKLKWLREQMGLVSQEPALFATTIASNILLGKEKASMDQIIEAAKAANADSFIK  494

Query  1244  NLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALE  1423
             +LP GY+T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+
Sbjct  495   SLPNGYNTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALD  554

Query  1424  SLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYS  1603
             ++ +          K T I VAHRLST+ N D IVV+  G V+E GSHS L S+  G Y+
Sbjct  555   NVME----------KRTTIVVAHRLSTIRNVDKIVVLRDGQVMETGSHSELISR-GGDYA  603

Query  1604  RLVSLQ  1621
              LV+ Q
Sbjct  604   TLVNCQ  609



>ref|NP_174122.1| ABC transporter B family member 14 [Arabidopsis thaliana]
 sp|Q9C7F2.1|AB14B_ARATH RecName: Full=ABC transporter B family member 14; Short=ABC transporter 
ABCB.14; Short=AtABCB14; AltName: Full=Multidrug 
resistance protein 12; AltName: Full=P-glycoprotein 14 [Arabidopsis 
thaliana]
 gb|AAG51476.1|AC069471_7 P-glycoprotein, putative [Arabidopsis thaliana]
 gb|AEE30902.1| ABC transporter B family member 14 [Arabidopsis thaliana]
Length=1247

 Score =   422 bits (1086),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 244/544 (45%), Positives = 344/544 (63%), Gaps = 18/544 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             + S  KR+V   ++IF   G+++     LQHY Y ++GE+  + +R SL+SA L NE+ W
Sbjct  715   FPSLIKREVDKVAIIFVGAGIVTAPIYILQHYFYTLMGERLTSRVRLSLFSAILSNEIGW  774

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  ENN GSLTS +  + + V+  I+DR+S IVQ +S  + A  ++    WR+  V  A
Sbjct  775   FDLDENNTGSLTSILAADATLVRSAIADRLSTIVQNLSLTITALALAFFYSWRVAAVVTA  834

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
               P      L +    KGF GD T A+S   SLA E+ +NI+TV +F  E+ +  +    
Sbjct  835   CFPLLIAASLTEQLFLKGFGGDYTRAYSRATSLAREAISNIRTVAAFSAEKQISEQ----  890

Query  542   LQPQLHRSRKESIKFGIIQG----TSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
                +L +  K ++  G I G     S CL   ++A+ LWY ++L++R++++F ++I+S+ 
Sbjct  891   FTCELSKPTKSALLRGHISGFGYGLSQCLAFCSYALGLWYISVLIKRNETNFEDSIKSFM  950

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E   L P ++     L  VF+ L R T I PD+P   L   I+G++EF+ 
Sbjct  951   VLLVTAYSVAETLALTPDIVKGTQALGSVFRVLHRETEIPPDQPNSRLVTHIKGDIEFRN  1010

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YP+RPE+ +    NLR+ AG  +A+VGPSG+GKS+VI L++RFYD   G + IDG 
Sbjct  1011  VSFAYPTRPEIAIFKNLNLRVSAGKSLAVVGPSGSGKSTVIGLIMRFYDPSNGNLCIDGH  1070

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D++  NLR LR ++ LVQQEP LF  SI ENI YG+E ASEAEIIE +KAAN H FIS +
Sbjct  1071  DIKSVNLRSLRKKLALVQQEPALFSTSIHENIKYGNENASEAEIIEAAKAANAHEFISRM  1130

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
              EGY T VG+KG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ +E+ V  AL+ L
Sbjct  1131  EEGYMTHVGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSAEKQVQEALDKL  1190

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T I VAHRLST+  +D IVV+ KG VVE GSH  L S+ DG Y +L
Sbjct  1191  MK----GR------TTILVAHRLSTIRKADTIVVLHKGKVVEKGSHRELVSKSDGFYKKL  1240

Query  1610  VSLQ  1621
              SLQ
Sbjct  1241  TSLQ  1244


 Score =   277 bits (709),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 188/540 (35%), Positives = 294/540 (54%), Gaps = 38/540 (7%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G  +++ A IG+  W             GE+    LR +   + L  ++ +F+  E   
Sbjct  100   LGLVNLVSAWIGVACWMQT----------GERQTARLRINYLKSILAKDITFFD-TEARD  148

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +    I ++   V+  I D+   +++ +   +    +  +  W++ L+   V+P   I 
Sbjct  149   SNFIFHISSDAILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAIA  208

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  + AA+++   +A E  + ++TV +F  EE  V     +L+  L  S
Sbjct  209   GGGYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKSYSNSLKKALKLS  268

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFSLT  724
             ++  +  G+  G +  L   A A+  WY +LLV+  ++       + LN I S       
Sbjct  269   KRSGLAKGLGVGLTYSLLFCAWALLFWYASLLVRHGKTNGAKAFTTILNVIYSGFALGQA  328

Query  725   VPSITELWTLIPTVLSAIGILKPVFQT-LDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             VPS++    +    ++A  I K +    L+   R+E      +  +++ G++EF  + F 
Sbjct  329   VPSLS---AISKGRVAAANIFKMIGNNNLESSERLE----NGTTLQNVVGKIEFCGVSFA  381

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP  MV    +  I +G   A VGPSG+GKS++I+++ RFY+   G++L+DG D+++
Sbjct  382   YPSRPN-MVFENLSFTIHSGKTFAFVGPSGSGKSTIISMVQRFYEPRSGEILLDGNDIKN  440

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR Q+GLV QEP LF  +I  NI  G E+A+  +IIE +KAAN  +FI +LP GY
Sbjct  441   LKLKWLREQMGLVSQEPALFATTIASNILLGKEKANMDQIIEAAKAANADSFIKSLPNGY  500

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+++ +  
Sbjct  501   NTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDNVME--  558

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                     K T I +AHRLST+ N D IVV+  G V E GSHS L S+  G Y+ LV+ Q
Sbjct  559   --------KRTTIVIAHRLSTIRNVDKIVVLRDGQVRETGSHSELISR-GGDYATLVNCQ  609



>gb|KGN52452.1| Multidrug resistance protein 1, 2 [Cucumis sativus]
Length=1361

 Score =   425 bits (1092),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 242/542 (45%), Positives = 346/542 (64%), Gaps = 18/542 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S  +RK+  +  I+  IG+ +     +QHY + ++GE   T +R  + +A L+NE+ WF+
Sbjct  830   SAMERKIKEFVFIYIGIGVYAVVAYLIQHYFFTIMGENLTTRVRRMMLAAILRNEVGWFD  889

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               E+N   + +R+  + + VK  I++R+SVI+Q ++S+  +  V+ IV+WR+ L+  A  
Sbjct  890   EEEHNSSLVAARLATDAADVKSAIAERISVILQNMTSLFTSFIVAFIVEWRVSLLILAAF  949

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +  + Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ ++    ++ R
Sbjct  950   PLLVLANMAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCHELR  1009

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  +  L RS+   I FGI Q   L L+  + A+ LWY   LV    S+F   I+ + + 
Sbjct  1010  IPQRQSLRRSQTAGILFGISQ---LALY-ASEALVLWYGVHLVSNGGSTFSKVIKVFVVL  1065

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     +  VF  LDR TRI+PD PE    E++ GE+E + + 
Sbjct  1066  VVTANSVAETVSLAPEIVRGGESIGSVFSILDRPTRIDPDDPEAETVETLRGEIELRHVD  1125

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+VMV    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+
Sbjct  1126  FAYPSRPDVMVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPLTGKVMIDGKDI  1185

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP LF  SI +NI YG + A+E+E+IE ++AAN+H F+S LP+
Sbjct  1186  RRLNLQSLRLKIGLVQQEPALFAASIFDNIAYGKDGATESEVIEAARAANVHGFVSGLPD  1245

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +
Sbjct  1246  GYNTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR  1305

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+ + D I V+  G +VE GSH+ L S+ +G YSRL+ 
Sbjct  1306  ----GR------TTVVVAHRLSTIRSVDSIGVVQDGRIVEQGSHNELLSRAEGAYSRLLQ  1355

Query  1616  LQ  1621
             LQ
Sbjct  1356  LQ  1357


 Score =   293 bits (750),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 192/539 (36%), Positives = 301/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+  F++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  191   EVSKYALYFVYLGLIVCFSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFDT-DAR  249

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  250   TGDVVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIAF  309

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    ++Q  L  
Sbjct  310   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDSIQNTLKI  369

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  370   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  427

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSES----IEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   ++ L       + G +EFK + F YPS
Sbjct  428   GQSF--SNLGAFSKGKAAGYKLMEIIKQKPTIIQDPLDGKCLGEVNGNIEFKDVTFSYPS  485

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+VM+   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L
Sbjct  486   RPDVMIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNVDIKTLQL  545

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP GYDT 
Sbjct  546   KWLRDQIGLVNQEPALFATTIYENILYGKPDATTAEVEAAAAAANAHSFITLLPNGYDTQ  605

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L      G
Sbjct  606   VGERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRLM----VG  661

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G YS L+  Q M
Sbjct  662   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHDELITK-SGAYSSLIRFQEM  713



>ref|XP_003579371.1| PREDICTED: ABC transporter B family member 19-like [Brachypodium 
distachyon]
Length=1266

 Score =   423 bits (1087),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 237/546 (43%), Positives = 349/546 (64%), Gaps = 18/546 (3%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             ++ ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+
Sbjct  735   NEMEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFD  794

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN   + +R+  + + VK  I++R+SVI+Q I+S++ +  V  +++WR+ L+  A  
Sbjct  795   EEENNSSLVAARVAVDAADVKSAIAERISVILQNITSLMTSFIVGFVIEWRVALLILATF  854

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKAR  535
             P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R
Sbjct  855   PLLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQNKIMSLFSHELR  914

Query  536   VALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIF  715
             +  +  L RS+   + +G+ Q   LCL+  + A+ LWY + LV+ H S+F   I+ + + 
Sbjct  915   IPEEQILRRSQTAGLLYGLSQ---LCLY-CSEALILWYGSHLVRAHGSTFSKVIKVFVVL  970

Query  716   SLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIK  895
              +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     ++ G++E + + 
Sbjct  971   VVTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPESERVTTVRGDIELRHVD  1030

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP++ +   FNL+I+AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+
Sbjct  1031  FSYPSRPDIEIFKDFNLKIQAGRSQALVGASGSGKSTVIALIERFYDPTGGKVMIDGKDI  1090

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             R  NL+ LR +IGLVQQEP+LF  SI ENI YG E A+E E+IE +K AN+HTF+S LP+
Sbjct  1091  RRLNLKSLRLKIGLVQQEPVLFASSILENIAYGKEGATEEEVIEAAKTANVHTFVSQLPD  1150

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +
Sbjct  1151  GYKTAVGERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALERLMK  1210

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+   D I V+  G +VE G HS L ++P+G YSRL+ 
Sbjct  1211  ----GR------TTVLVAHRLSTIRGVDRIAVVQDGRIVEHGGHSELVARPEGAYSRLLQ  1260

Query  1616  LQSMKD  1633
             LQ  ++
Sbjct  1261  LQQHRN  1266


 Score =   305 bits (781),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 191/543 (35%), Positives = 297/543 (55%), Gaps = 26/543 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+    +  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  94    EVAKYALYFVYLGLVVCVASYSEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  152

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +++      V  +  WR+ L++ AV+P    
Sbjct  153   TGDIVFGVSTDTLLVQDAIGEKVGNFIHYLATFFAGLVVGFVSAWRLALLSVAVIPAIAF  212

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  213   AGGLYAYTLTGLTSRSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  272

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  273   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMS-  329

Query  743   LWTLIPTVLSAIGILKP-------VFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G           + + + +   I  D  +  L   + G +EFK + F 
Sbjct  330   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIVNDHKDGKLLAEVHGNIEFKDVIFS  385

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+VM+   F+L   AG  VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  386   YPSRPDVMIFRDFSLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  445

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  446   LQLRWLRDQIGLVNQEPALFATTILENILYGKPDATIAEVEAAATASNAHSFISLLPNGY  505

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L    
Sbjct  506   NTMVGERGIQLSGGQKQRIAIARAMLKDPKILLLDEATSALDADSESIVQEALDRLM---  562

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRLST+ N ++I V+ +G VVE G+H  L  +   G Y+ L+  
Sbjct  563   -VGR------TTVVVAHRLSTIRNVNMIAVIQQGQVVETGTHDELVVKGSSGAYASLIRF  615

Query  1619  QSM  1627
             Q M
Sbjct  616   QEM  618



>ref|XP_011094609.1| PREDICTED: ABC transporter B family member 1-like [Sesamum indicum]
Length=1378

 Score =   425 bits (1092),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 238/536 (44%), Positives = 328/536 (61%), Gaps = 12/536 (2%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             R++  Y  +   +   +   NTLQHY +  VGE     +R  +++A L+NE+AWF++ EN
Sbjct  823   REIAKYCYLLIGVSSAALIFNTLQHYFWDTVGENLTKRVREKMFAAVLKNEMAWFDQEEN  882

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
                 +++R+  + + V+  I DR+SVI+Q  + +++A T   ++ WR+ LV  AV P   
Sbjct  883   ESSRVSARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  942

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
                ++Q     GFSGD  AAH++   LA ES ANI+TV +F  E  +V     +LQ  L 
Sbjct  943   AATVLQKMFMNGFSGDLEAAHAKATQLAGESVANIRTVAAFNSEAKIVGLFTSSLQTPLR  1002

Query  560   RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSIT  739
             R   +    G   G +  L   ++A+ LWY + LV+   S F   IR + +  ++     
Sbjct  1003  RCFWKGQIAGSGYGIAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAA  1062

Query  740   ELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEES-LSESIEGEVEFKTIKFHYPSRP  916
             E  TL P  +     ++ VF  LDR T IEPD P+ + + + + GEVEFK + F YP+RP
Sbjct  1063  ETLTLAPDFIKGGRAMRSVFDLLDRKTEIEPDDPDATAVPDRLRGEVEFKHVDFSYPTRP  1122

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             ++ V    NLR  AG  +ALVGPSG GKSSVIAL+ RFY+   G+V+IDGKD+R YNL+ 
Sbjct  1123  DISVFRDLNLRARAGKTLALVGPSGCGKSSVIALVQRFYEPSSGRVMIDGKDIRKYNLKS  1182

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR  I +V QEP LF  +I ENI YG+E A+EAEIIE +  AN H FIS+L +GY T  G
Sbjct  1183  LRRHIAIVPQEPCLFATTIYENIAYGNESATEAEIIEAATLANAHKFISSLHDGYKTFAG  1242

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA L++P IMLLDEATSALD+ SER +  AL+         R+
Sbjct  1243  ERGVQLSGGQKQRIAIARAFLRKPDIMLLDEATSALDAESERCIQEALD---------RA  1293

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHS-TLTSQPDGVYSRLVSLQ  1621
                K T I VAHRLST+ N+ +I V+D G V E GSHS  L + PDG+Y R++ LQ
Sbjct  1294  CAGKTT-IVVAHRLSTIRNAHVIAVLDDGKVAEQGSHSHLLKNYPDGIYGRMIQLQ  1348


 Score =   297 bits (761),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 191/534 (36%), Positives = 299/534 (56%), Gaps = 20/534 (4%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y++ F  +G   W ++  +   +   GE+  T +R     A L  ++ +F+  E     +
Sbjct  175   YALYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALNQDIQYFD-TEVRTSDV  233

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPC-HFIGGL  391
                I  +   V+  IS+++   +  +++ V    V     W++ LV  AV+P    IGG+
Sbjct  234   VFAINTDAVMVQDAISEKLGNFLHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGGI  293

Query  392   IQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRK  571
               A  AK FS  +  A S+  ++  ++ A I+TV++F  E   +     AL+       +
Sbjct  294   HTAMLAK-FSSKSQEALSQAGNIVEQTVAQIRTVLAFVGESRALQSYSAALRVAQKIGYR  352

Query  572   ESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWT  751
                  G+  G +       +A+ LWY   LV+ H ++   AI +  +F++ +  +  L  
Sbjct  353   IGFAKGMGLGATYFTVFCCYALLLWYGGYLVRHHFTNGGLAIAT--MFAVMIGGLA-LGQ  409

Query  752   LIPTVLSAIGILK---PVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEV  922
               P++ +          +F+ +D    ++ +       ESI G++E K + F YPSRPE 
Sbjct  410   SAPSMAAFAKARVAAAKIFRIIDHKPEVDRNSESGLELESITGQLELKNVDFSYPSRPET  469

Query  923   MVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLR  1102
              +LN F+L + AG  +ALVG SG+GKS++++L+ RFYD   G+VL+DG D++   LR LR
Sbjct  470   QILNNFSLTVPAGKTIALVGSSGSGKSTIVSLIERFYDPTSGQVLLDGHDIKILKLRWLR  529

Query  1103  AQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEK  1282
              QIGLV QEP LF  +I+ENI  G   A+  EI E ++ AN H+FI  LP+GYDT VG++
Sbjct  530   QQIGLVSQEPALFATTIKENILLGRPDATLIEIEEAARVANAHSFIVKLPDGYDTQVGDR  589

Query  1283  GSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSP  1462
             G QLSGGQKQRIAIARA+LK PAI+LLDEATSALDS SE+ V  AL+        GR   
Sbjct  590   GLQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFM----IGR---  642

Query  1463  SKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
                T + +AHRLST+  +D++ V+ +G V E+G+H  L ++  + VY++L+ +Q
Sbjct  643   ---TTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDDLIARGENSVYAKLIKMQ  693



>ref|XP_007032499.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
 gb|EOY03425.1| ATP binding cassette subfamily B19 isoform 3 [Theobroma cacao]
Length=1213

 Score =   422 bits (1084),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 244/540 (45%), Positives = 340/540 (63%), Gaps = 19/540 (4%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  +  A L+NE+ WF+  E
Sbjct  684   ERKTKEYVFIYIGAGLYAVIAYLIQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEE  743

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  744   HNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLL  803

Query  377   FIGGLIQAK-SAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVN----KARVA  541
              +    Q + S KGF+GDT  AH++   +A E  +NI+TV +F  +  +++    + RV 
Sbjct  804   VLANFAQQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCYELRVP  863

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
              +  L RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +
Sbjct  864   QKRSLGRSQTSGLLFGLSQ---LALY-ASEALILWYGAHLVSKGVSTFSKVIKVFVVLVV  919

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T  S+ E  +L P ++     +  VF  LDR T+I+PD PE    ESI GE+E + + F 
Sbjct  920   TANSVAETVSLAPEIIRGGEAVGSVFSILDRSTKIDPDDPEGEPVESIRGEIELRHVDFA  979

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R 
Sbjct  980   YPSRPDVSVFKDLNLRIRAGQNQALVGASGSGKSSVIALIERFYDPIAGKVMIDGKDIRR  1039

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
              NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE+IE ++AAN+H F+S LP+GY
Sbjct  1040  LNLKSLRLKIGLVQQEPALFAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGY  1099

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +  
Sbjct  1100  KTPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR--  1157

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T + VAHRLST+ N D I V+  G +VE GSH+ L S+ +G YSRL+ LQ
Sbjct  1158  --GR------TTVLVAHRLSTIRNVDSIGVVQDGRIVEQGSHAELISRAEGAYSRLLQLQ  1209


 Score =   300 bits (768),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 188/544 (35%), Positives = 299/544 (55%), Gaps = 20/544 (4%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S    +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+
Sbjct  37    SKMTHEVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD  96

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               +   G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+
Sbjct  97    -TDARTGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVI  155

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ  547
             P     G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q
Sbjct  156   PGIAFAGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQ  215

Query  548   PQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
               L    K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V
Sbjct  216   NTLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIV  273

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIK  895
               ++   +   + L A    K     L    + +P    D  +  +   + G +EFK + 
Sbjct  274   GGMSLGQSF--SNLGAFSKGKTAGYKLMEIIKQKPSIIQDHSDGKVLPEVNGNIEFKDVT  331

Query  896   FHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDV  1075
             F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VL+D  D+
Sbjct  332   FSYPSRPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNMDI  391

Query  1076  RDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPE  1255
             +   L+ LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP 
Sbjct  392   KTLQLKWLRDQIGLVNQEPALFATTILENILYGKPDATMDEVEAATSAANAHSFITLLPN  451

Query  1256  GYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQ  1435
             GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L  
Sbjct  452   GYNTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM-  510

Query  1436  HHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVS  1615
                 GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+ 
Sbjct  511   ---VGR------TTVVVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIR  560

Query  1616  LQSM  1627
              Q M
Sbjct  561   FQEM  564



>emb|CAN71068.1| hypothetical protein VITISV_031708 [Vitis vinifera]
Length=1344

 Score =   424 bits (1090),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 233/546 (43%), Positives = 341/546 (62%), Gaps = 18/546 (3%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             D   KR+V   S+IF    +L+ F   LQHY Y ++GE+  T +R  ++SA L NE+ WF
Sbjct  808   DFQIKREVDHISLIFVGAAILTIFIYLLQHYFYTLMGERLTTRIRLLMFSAILSNEIGWF  867

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             +  EN+ GSLTS++  + +  +  ++DR+S IVQ ++  V A  ++  + WR+  V  A 
Sbjct  868   DLDENSTGSLTSKLAADATLXRSALADRLSTIVQNVALTVTAFVIAFTLSWRIASVIIAS  927

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL  544
              P      + +    KGF GD T A+++  ++A E+ ANI+TV +F  E+ +  +    L
Sbjct  928   FPLLIGASITEQLFLKGFGGDYTRAYAQATAVAREAIANIRTVAAFGAEDRISLQFASEL  987

Query  545   -QPQ---LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQI  712
              QP    L R       +G+ Q  + C    ++A+ LWY ++L++ + S+F + I+S+ +
Sbjct  988   NQPNKQALLRGHISGFGYGVSQLFAFC----SYALGLWYASVLIKHNDSNFGDIIKSFMV  1043

Query  713   FSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTI  892
               +T  S+ E   L P ++     L  VF  L R T I  D P  S+   I+G++EF+ +
Sbjct  1044  LIITAFSVAETLALTPDIVKGSQALGSVFSILQRKTAINRDXPTSSVVTDIQGDIEFRNV  1103

Query  893   KFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKD  1072
              F YP+RP++ +    NL+I AG  +A+VG SG+GKS+VI+L++RFYD   G V+IDG D
Sbjct  1104  SFRYPARPDLTIFKDLNLKISAGKSLAIVGQSGSGKSTVISLVMRFYDPTSGAVMIDGFD  1163

Query  1073  VRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLP  1252
             ++  NLR LR +IGLVQQEP LF  +I ENI YG+E ASE EI++ ++AAN H FIS +P
Sbjct  1164  IKGLNLRSLRMKIGLVQQEPALFSTTIYENIRYGNEEASEIEIMKAARAANAHXFISRMP  1223

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
             EGY T VG++G QLSGGQKQR+AIARA+LK P+I+LLDEATSALD+ SE+ V  AL++L 
Sbjct  1224  EGYQTQVGDRGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTASEKLVQEALDTLM  1283

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLV  1612
             +    GR      T I +AHRLST+ N+D I V+  G VVE G H  L ++P  +Y +LV
Sbjct  1284  E----GR------TTILIAHRLSTIHNADSIAVLQHGKVVETGDHRQLITRPGSIYKQLV  1333

Query  1613  SLQSMK  1630
             SLQ  K
Sbjct  1334  SLQQEK  1339


 Score =   272 bits (695),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 186/511 (36%), Positives = 275/511 (54%), Gaps = 29/511 (6%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+    LR     + L+ ++ +F+  E    ++T  I N+   ++  I D++   ++ +
Sbjct  210   GERQTARLRLKYLQSVLRQDINFFDT-EARDKNITFHISNDAILLQDAIGDKIGHGLRYL  268

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             S   +   +     W++ L+  AV+P   I G          S    AA++E   +A E+
Sbjct  269   SQFFVGFAIGFTSVWQLTLLTVAVVPLMAIAGGAYTVIMTTLSEKGEAAYAEAGKVAEEA  328

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              + ++TV SF  E+  V     +LQ  L   +K     GI  G +  L   A A+ LWY 
Sbjct  329   ISQVRTVYSFVGEDRAVETYSRSLQKALKLGKKSGFAKGIGIGFTYGLLFCAWALLLWYA  388

Query  653   TLLVQRHQ--------SSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTL  808
             + LV RH         ++ LN I S        P++  +        + + +++      
Sbjct  389   SKLV-RHGDTNGGKAFTTILNVIFSGFALGQAAPNLAAIAKGRAAAANIVNMIET-----  442

Query  809   DRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPS  988
             D       D     +   + G++EF  + F YPSRP  MV    +  I AG   A+VGPS
Sbjct  443   DSTASKRLD--NGIMLPKVAGQLEFCEVCFAYPSRPS-MVFENLSFSIYAGKTFAVVGPS  499

Query  989   GAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENIC  1168
             G+GKS++I+++ RFY+   GK+L+DG D+++  L+ LRAQ+GLV QEP LF  +I  NI 
Sbjct  500   GSGKSTIISMVQRFYEPTSGKILLDGHDIKNLRLKWLRAQMGLVSQEPALFATTIAGNIL  559

Query  1169  YGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRP  1348
             YG E A   ++IE +KAAN H+F+  LP+GY T VGE G+QLSGGQKQRIAIARA+L+ P
Sbjct  560   YGKEDADMDQVIEAAKAANAHSFVQGLPDGYQTQVGEGGTQLSGGQKQRIAIARAVLRNP  619

Query  1349  AIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIV  1528
              I+LLDEATSALD+ SE  V  AL+ +  +           T I VAHRLST+ + + I+
Sbjct  620   KILLLDEATSALDAESELIVQKALDKIMLNR----------TTIVVAHRLSTIRDVNKII  669

Query  1529  VMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
             V+  G VVE G+H  L SQ  G Y+ LVSLQ
Sbjct  670   VLKNGQVVESGTHLELISQ-GGEYATLVSLQ  699



>emb|CDP07374.1| unnamed protein product [Coffea canephora]
Length=1259

 Score =   422 bits (1086),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 231/546 (42%), Positives = 340/546 (62%), Gaps = 18/546 (3%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             D+   ++V   S+IF  I LL+     LQHY Y ++GE+  T +R  ++SA L NE+ WF
Sbjct  720   DTRITQEVHRVSLIFLGIALLNIPIYLLQHYFYTLMGERLTTRVRLRMFSAILSNEIGWF  779

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             +  EN+ GSL S++  + + V+  ++DR+S +VQ ++  V +  ++  + WR+  V  A 
Sbjct  780   DMDENSTGSLMSKLAADATLVRSALADRLSTVVQNVALTVTSFVIAFTLSWRIAAVIIAT  839

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHV----VNKA  532
              P      + + +  KGF G+  AA+    +LA E+  NI+TV +F  EE +    +++ 
Sbjct  840   FPLLIGASIAEQQFLKGFGGNYAAAYYRTTALAREAIVNIRTVAAFGAEERISIQFISEL  899

Query  533   RVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQI  712
                 +  L R     + +G+ Q  + C    ++A+ LWY ++L+++  S+F + I+S+ +
Sbjct  900   SGPNRQALLRGHISGLGYGLTQLFAFC----SYALGLWYASVLIEQKSSNFGDIIKSFMV  955

Query  713   FSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTI  892
               +T  ++ E   L P ++     L  VF  L R T I  D P   ++  I G++EF+ I
Sbjct  956   LLVTAFAVAETLALAPDIVKGSQALGSVFNILHRKTAINSDDPTARIASKIRGDIEFRNI  1015

Query  893   KFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKD  1072
              F YP+RP + +    NL+I AG  +A+VG SG+GKS+VI+L++RFYD   G VLIDG D
Sbjct  1016  NFQYPARPRITIFENLNLKITAGRSLAVVGQSGSGKSTVISLVMRFYDPTSGTVLIDGFD  1075

Query  1073  VRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLP  1252
             ++ YNL+ LR  IGLVQQEP+LF  +I ENI YG+E ASE EI++ +KAAN H F+S +P
Sbjct  1076  IKSYNLKSLRLSIGLVQQEPVLFSTTIYENIRYGNEMASEIEIMKAAKAANAHGFVSRMP  1135

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
              GY T VGEKG QLSGGQKQR+AIARA+LK P+I+LLDEATSALD+ +E  V  AL+ L 
Sbjct  1136  NGYHTHVGEKGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDAAAEMQVQEALDKLM  1195

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLV  1612
             +    GR      T I VAHRLST+  +D I V+  G VVE+GSH  L S+P+G+YS+LV
Sbjct  1196  E----GR------TTILVAHRLSTIHEADNIAVLQHGKVVEIGSHKQLISRPEGIYSQLV  1245

Query  1613  SLQSMK  1630
             SLQ  K
Sbjct  1246  SLQQEK  1251


 Score =   278 bits (712),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 196/540 (36%), Positives = 295/540 (55%), Gaps = 29/540 (5%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             V  Y+V    +GL+   +  +    +   GE+  T LR     + L+  +++F+  E   
Sbjct  94    VSKYAVYLVYLGLVILMSAWIGVACWAQTGERQTTRLRLKYLQSILKKNISFFD-TEAMD  152

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +LT  I ++   V+  I D++   ++ +S   +   +  I  W++ L+  AV+P   I 
Sbjct  153   KNLTFHISSDAILVQDAIGDKIGHSLRYLSQFFVGFAIGFISVWQLTLLTLAVVPLIAIA  212

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G          S    AA++E   +A E  + ++TV SF  EE       ++L   L   
Sbjct  213   GGAYTLIMSTISQKGEAAYAEAGKIAEEVISQVRTVYSFVGEEKAAKAYSISLNKALRLG  272

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQ--------SSFLNAIRSYQIFSL  721
             +K  I  G+  G +  L   A A+ LWY ++LV RH+        ++ LN + S      
Sbjct  273   KKIGIAKGVGVGFTYGLLLCAWALLLWYASILV-RHRDTNGGKAFTTILNVLFSGFALGQ  331

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
               P++  +      V +   IL  +   +D+  R +  K        + GE+EF  + F 
Sbjct  332   AAPNLASIAKGRAAVTN---ILSMIEDDIDQHNRSDEGKA----LPGVNGEIEFTEVYFS  384

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP+RP  M+    +  + AG  +A+VGPSG+GKS++I+L+ RFY+   G++L+DG D++D
Sbjct  385   YPARP-TMIFENLSFLVSAGQTIAVVGPSGSGKSTIISLVQRFYEPISGRILLDGHDLKD  443

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L  LR Q+GLV QEP LF  +I ENI +G E A+  ++IE + AAN H+F+  LP+GY
Sbjct  444   LKLNWLREQMGLVSQEPALFGTTIAENILFGKEGANMDQVIEAAVAANAHSFVQGLPDGY  503

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              + VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE  V  AL+++    
Sbjct  504   QSQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEMIVQQALDTVM---  560

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              FGR      T I VAHRLST+ ++D I+V+  G V EMGSH  L S   G Y+ LVSLQ
Sbjct  561   -FGR------TTIIVAHRLSTIRDADKIIVLRHGQVAEMGSHEELMSS-GGDYASLVSLQ  612



>ref|XP_006856780.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
 gb|ERN18247.1| hypothetical protein AMTR_s00055p00102180 [Amborella trichopoda]
Length=1265

 Score =   423 bits (1087),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 238/539 (44%), Positives = 338/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             K ++   S+IF    +++     LQHY Y  +GE+    +R+ ++S  L+NE+ WF+  E
Sbjct  733   KHEIERISLIFVGAAVVTLPIYLLQHYFYTWMGERLTARVRSMMFSVILRNEVGWFDLDE  792

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN GSLTS +  + + V+  ++DR+S IVQ IS  V A T++ ++ WRM  V  A  P  
Sbjct  793   NNCGSLTSHLAADATLVRSALADRISTIVQNISLTVTAFTIAFMLTWRMAAVVIATFPLL  852

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
                 + +    +GF GD  +A+    ++A E+  NI+T+V+FC E+ V   A  AL+  L
Sbjct  853   IGASIGEQLFLRGFGGDYNSAYFRASAVAREAINNIRTIVAFCAEDRV--SALFALE--L  908

Query  557   HRSRKESIKFGIIQG----TSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +  RK S+  G I G     S      ++A+ALWY +LL++  +S F + ++S+ +  +T
Sbjct  909   YLPRKRSLLRGNISGLGYGMSQFFMYCSYAIALWYASLLMRHGKSDFGDIMKSFMVLVIT  968

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
                + E   L P ++     L  VF  L+R T IEPD P   +   + G++E K + F Y
Sbjct  969   ALGVAETLALAPDIVKGSQALASVFNILERKTLIEPDDPSSEVVTEVSGDIELKNVGFRY  1028

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P RPEV+V +  NL++EAG  VA+VG SG+GKSSVIALL+RFYD   G +LIDG D+R  
Sbjct  1029  PVRPEVVVFDDLNLKVEAGCTVAIVGQSGSGKSSVIALLMRFYDPISGCILIDGHDIRGM  1088

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+  R ++GLVQQEP LF  +I ENI YG + ASE E++  SKAA+ H FIS +P+GY+
Sbjct  1089  NLKSYRKRVGLVQQEPALFSTTIYENILYGRDGASEVEVLRASKAAHAHGFISCMPDGYN  1148

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G  LSGGQKQR+AIARA+LK P+I+LLDEATSALD+ SE  V  AL+ L +   
Sbjct  1149  TRVGERGVLLSGGQKQRVAIARAILKDPSILLLDEATSALDATSENLVQRALDKLME---  1205

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST++N+D IVV++ G V E GSH  LT+   G Y++LVSLQ
Sbjct  1206  -GR------TTVVVAHRLSTIMNADKIVVLENGKVKESGSHEELTNMVGGTYTQLVSLQ  1257


 Score =   271 bits (694),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 191/510 (37%), Positives = 278/510 (55%), Gaps = 25/510 (5%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+  T LR   + + L  ++++F+    +   L   I  +T  V+  I D++   +  +
Sbjct  128   GERQATCLRLKYFHSVLNQDISFFDTSITSANVLNC-ISRDTILVQDAIGDKVGHCLHYL  186

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             +  ++   +     W++ L+  AV+P   I G     +  G S    AA++E   +A E 
Sbjct  187   ARFLVGFALGFSSVWQLTLLTLAVVPLMVIAGGAYTVTMAGLSKKGEAAYAEAAKVAEEV  246

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              + I+TV SF  E+        +L+  L   RK  +  G+  G +  L   A A+ LWY 
Sbjct  247   ISQIRTVHSFVGEDKASKAYSTSLETSLKLGRKSGMAKGLGVGITYGLLFGAWALLLWYA  306

Query  653   TLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEP  832
              +LV RHQ++  N  +++      V S   L    P  LSA    +     L   + IE 
Sbjct  307   GVLV-RHQAT--NGGKAFTTILNVVISGISLGQAAPN-LSAFAEGRAAASNL--MSMIEK  360

Query  833   DKPEESLSES------IEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGA  994
                   LSE+      + G + F  + F YPSR   ++    +L I AG   A+VGPSG+
Sbjct  361   GPSVSVLSENGVVLPNVAGNIAFCGVTFSYPSRAG-LIFEDLSLSIPAGSTFAIVGPSGS  419

Query  995   GKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYG  1174
             GKS++++L+ RFYD   G +++DG D++   ++ LR+QIGLV QEP LF  +I ENI YG
Sbjct  420   GKSTILSLVERFYDPTSGVIMLDGHDLKSLKMKWLRSQIGLVSQEPALFATTIAENISYG  479

Query  1175  SERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAI  1354
             +E +    I+E +KAAN  +FI  LPE Y T VG  G+QLSGGQKQRIAIARA+L+ P I
Sbjct  480   NESSDIQMIMEAAKAANADSFIRRLPENYSTQVGYGGTQLSGGQKQRIAIARAVLRNPKI  539

Query  1355  MLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVM  1534
             +LLDEATSALD+ SE  V  AL+++      GR      T I +AHRLSTV N++ I V+
Sbjct  540   LLLDEATSALDTESEHLVQQALDTIM----LGR------TTIIIAHRLSTVRNANCIAVL  589

Query  1535  DKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
               G VVE G+H  L S   DGVY+ L+SLQ
Sbjct  590   QNGKVVECGTHEQLISTGKDGVYASLLSLQ  619



>gb|KHG22495.1| ABC transporter B family member 19 [Gossypium arboreum]
Length=1249

 Score =   422 bits (1085),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 340/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  +  A L+NE+ WF+  E
Sbjct  721   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLGAILRNEVGWFDEEE  780

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   L +++  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  781   HNSSLLAAKLAADAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILGTFPLL  840

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ RV  
Sbjct  841   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRVPQ  900

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  901   MQSLRRSQVSGLLFGLSQ---LALY-ASEALILWYGAHLVNKGASTFSKVIKVFVVLVVT  956

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE    ESI GE+E + + F Y
Sbjct  957   ANSVAETVSLAPEIIRGGEAVGSVFSILDRSTRIDPDDPEAEPIESIRGEIELRHVDFAY  1016

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V+V    NLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1017  PSRPDVIVFKDLNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTAGKVVIDGKDIRRL  1076

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE+IE ++AAN+H F+S LP+GY 
Sbjct  1077  NLKSLRLKIGLVQQEPALFAASIFDNIAYGKEGATEAEVIEAARAANVHGFVSALPDGYK  1136

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1137  TPVGERGVQLSGGQKQRIAIARAVLKDPTILLLDEATSALDAESECVLQEALERLMR---  1193

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+ N D I V+  G +VE GSHS L ++P+G YSRL+ LQ
Sbjct  1194  -GR------TTVLVAHRLSTIRNVDSIGVVQDGRIVEQGSHSELIARPEGAYSRLLQLQ  1245


 Score =   293 bits (750),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 188/539 (35%), Positives = 300/539 (56%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  79    EVAKYALYFVYLGLIVCLSSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  137

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  138   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  197

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  198   AGGLYAYTLTGLTSKSRESYANAGIIAEQAIAQVRTVYSYVGESKALNSYSDAIQNTLKL  257

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  ++ 
Sbjct  258   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  315

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS----ESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P   E+ L       + G +EFK + F YPS
Sbjct  316   GQSF--SNLGAFSKGKTAGYKLMEIIKQKPSITEDHLDGKVLPEVNGNIEFKDVTFSYPS  373

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  +A+VG SG+GKS+V++++ RFYD +EG+VL+D  D++   L
Sbjct  374   RPDVIIFRNFSIFFPAGKTMAVVGGSGSGKSTVVSMVERFYDPNEGQVLLDNVDIKILQL  433

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR+QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP GY+T 
Sbjct  434   KWLRSQIGLVNQEPALFATTILENILYGKPDATMDEVEAAASAANAHSFITLLPNGYNTQ  493

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      G
Sbjct  494   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----VG  549

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE+G+H  L S+  G Y+ L+  Q M
Sbjct  550   R------TTVVVAHRLSTIRNVDSIAVIQQGQVVEIGTHEELISKA-GAYASLIRFQEM  601



>dbj|BAC41846.1| putative P-glycoprotein [Arabidopsis thaliana]
Length=1252

 Score =   422 bits (1085),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 243/547 (44%), Positives = 345/547 (63%), Gaps = 19/547 (3%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             YDS  +RK   Y  I+   GL +     +QHY + ++GE   T +R  + SA L+NE+ W
Sbjct  720   YDS-MERKTKEYVFIYIGAGLYAVGAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGW  778

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E+N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+   
Sbjct  779   FDEDEHNSSLIAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILG  838

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NK  529
               P   +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++
Sbjct  839   TFPLLVLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFCHE  898

Query  530   ARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQ  709
              RV  +  L+RS+     FG+ Q   L L+  + A+ LWY   LV +  S+F   I+ + 
Sbjct  899   LRVPQKRSLYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSKGVSTFSKVIKVFV  954

Query  710   IFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKT  889
             +  +T  S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ 
Sbjct  955   VLVITANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRH  1014

Query  890   IKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGK  1069
             + F YPSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGK
Sbjct  1015  VDFAYPSRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGK  1074

Query  1070  DVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNL  1249
             D+R  NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+I+ ++AAN H FIS L
Sbjct  1075  DIRRLNLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIDAARAANAHGFISGL  1134

Query  1250  PEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESL  1429
             PEGY T VGE+G QLSGGQKQRIAIARA+LK P ++LLDEATSALD+ SE  +  ALE L
Sbjct  1135  PEGYKTPVGERGVQLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEALERL  1194

Query  1430  QQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRL  1609
              +    GR      T + VAHRLST+   D I V+    +VE GSHS L S+P+G YSRL
Sbjct  1195  MR----GR------TTVVVAHRLSTIRGVDCIGVIQDERIVEQGSHSELVSRPEGAYSRL  1244

Query  1610  VSLQSMK  1630
             + LQ+ +
Sbjct  1245  LQLQTHR  1251


 Score =   293 bits (749),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 299/537 (56%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  YS+ F  +GL+  F++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSRYSLYFVYLGLVVCFSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALNAYSDAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    + + G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKAAGYKLMEIINQRPTIIQDPLDGKCLDQVHGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VM+   FN+   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  379   DVMIFRNFNIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNSGQILLDGVEIKTLQLKF  438

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  439   LREQIGLVNQEPALFATTILENILYGKPDATMVEVEAAASAANAHSFITLLPKGYDTQVG  498

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  499   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  553

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  554   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  604



>ref|XP_010267196.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
1-like [Nelumbo nucifera]
Length=1349

 Score =   423 bits (1087),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 237/536 (44%), Positives = 327/536 (61%), Gaps = 12/536 (2%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             R++G Y  +   +       NTLQH+ + VVGE     +R  +  A L+NE+AWF+R EN
Sbjct  796   REIGKYCYLLIGVSSAVLLFNTLQHFFWDVVGENLTKRVREKMLKAVLKNEIAWFDREEN  855

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
                 + +R+  + + V+  I DR+SVI+Q  + +++A T   I+ WR+ LV  AV P   
Sbjct  856   ESARIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFILQWRLSLVLIAVFPVVV  915

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
                ++Q    KGFSGD  AAH++   LA E+ AN++TV +F  E ++V     +L   L 
Sbjct  916   AATVLQKMFMKGFSGDLEAAHAKATQLAGEAVANVRTVAAFNSEANIVGLFSSSLDSPLR  975

Query  560   RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSIT  739
             R   +    G   G +  L   ++A+ LWY + LV+   S F   IR + +  ++     
Sbjct  976   RCFWKGQIAGSCYGVAQFLLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAA  1035

Query  740   ELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLS-ESIEGEVEFKTIKFHYPSRP  916
             E  TL P  +     ++ VF  LDR T IEPD P+ + + +S++GEVEFK + F YPSRP
Sbjct  1036  ETLTLAPDFIKGGRAMRSVFDLLDRKTEIEPDDPDFTPAPDSLKGEVEFKHVDFAYPSRP  1095

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V V    +LR  AG  +ALVGPSG GKSSVIAL+ RFYD   G+VLIDGKDVR YNL+ 
Sbjct  1096  DVQVFQDLSLRARAGKTLALVGPSGCGKSSVIALVQRFYDPSSGRVLIDGKDVRKYNLKS  1155

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR  + LV QEP LF  +I +NI YG +  +EAE+IE +  AN H FIS+LP+GY T VG
Sbjct  1156  LRRHMALVPQEPCLFAATIHDNIAYGRDSVTEAEVIEAATLANAHKFISSLPDGYGTWVG  1215

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQ+QRIAIARA +++  +MLLDEATSALD+ SE+ +  ALE           
Sbjct  1216  ERGVQLSGGQRQRIAIARAFIRKAEVMLLDEATSALDTESEKCIQEALE----------R  1265

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
             + S  T I VAHRLST+ N+ +I V+D G V E GSHS L +  PDG Y+R++ LQ
Sbjct  1266  ACSGRTTIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLNHYPDGCYARMIQLQ  1321


 Score =   305 bits (781),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 191/535 (36%), Positives = 299/535 (56%), Gaps = 18/535 (3%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y+  F  +G   W ++  +   +   GE+  T +R     A L  ++ +F+  +     +
Sbjct  148   YAFYFLVVGAAIWTSSWAEISCWMWTGERQSTKMRIKYLEAALNQDVQFFD-TQVRTSDV  206

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
                I  +   V+  IS+++   +  +++ V    V     W++ LV  A++P   + G I
Sbjct  207   VFAINTDAVLVQDAISEKLGNFLHYLATFVSGFVVGFTAVWQLALVTLAIVPIIALIGAI  266

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKE  574
                +    S  +  A S+  ++A ++   I+TV+SF  E   +     AL+       K 
Sbjct  267   HTTTLAKLSSKSQEALSQAGNIAEQTIVQIRTVLSFVGESRALEAYSSALRVAQKLGYKS  326

Query  575   SIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL  754
                 GI  G +       +A+ LWY   LV+ H ++   AI +  +FS+ +  +  L   
Sbjct  327   GFAKGIGLGATYFTVFCCYALLLWYGGYLVRHHFTNGGLAIAT--MFSVMIGGLA-LGQS  383

Query  755   IPTVLS---AIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVM  925
              P++ +   A      +F  +D    I+ +       ES+ G+VE K + F YPSRP+V 
Sbjct  384   APSMTAFTKAKVAAAKIFHIIDHKPGIDRNTESGLELESVSGQVELKNVDFSYPSRPDVC  443

Query  926   VLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRA  1105
             +L+ F+L + AG  +ALVG SG+GKS+V++L+ RFYD   G+VL+DG+D++   LR LR 
Sbjct  444   ILSNFSLNVPAGKTIALVGSSGSGKSTVVSLIERFYDPTSGQVLLDGRDIKTLKLRWLRQ  503

Query  1106  QIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKG  1285
             QIGLV QEP LF  +I+EN+  G   A++ E+ E ++ AN H+FI  LPEGYDT+VGE+G
Sbjct  504   QIGLVSQEPALFATTIKENMLLGRPDATQVEMEEAARVANAHSFIVKLPEGYDTLVGERG  563

Query  1286  SQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPS  1465
              QLSGGQKQRIAIARA+LK PAI+LLDEATSALDS SE+ V  AL+        GR    
Sbjct  564   LQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFM----IGR----  615

Query  1466  KMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
               T + +AHRLST+  +D++ V+ +G   E+G+H  L ++  +GVY++L+ +Q M
Sbjct  616   --TTLVIAHRLSTIRKADLVAVLQQGSASEIGTHDELIAKGENGVYAKLIRMQEM  668



>gb|KHG30028.1| ABC transporter B family member 1 [Gossypium arboreum]
Length=1363

 Score =   423 bits (1088),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 244/551 (44%), Positives = 336/551 (61%), Gaps = 23/551 (4%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +R++G Y  +   +   +   NTLQH  + +VGE     +R  + +A L+NE+AWF++ E
Sbjct  809   RREIGKYCYLLIGLSSAALLFNTLQHSFWDIVGENLTKRVREKMLTAVLKNEMAWFDQEE  868

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             N    +++R+  + + V+  I DR+SVIVQ  + +++A T   ++ WR+ LV  AV P  
Sbjct  869   NESARISARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLIAVFPVV  928

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
                 ++Q    KGFSGD  AAH++   LA E+ AN++TV +F  E  +V     +LQ  L
Sbjct  929   VAATVLQKMFMKGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSENKIVGLFSSSLQTPL  988

Query  557   HR----SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
              R     +     FG+ Q     L+  ++A+ LWY + LV+   S F   IR + +  ++
Sbjct  989   RRCFWKGQIAGSGFGVAQ---FSLY-ASYALGLWYASWLVKHGISDFSKTIRVFMVLMVS  1044

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEES-LSESIEGEVEFKTIKFH  901
                  E  TL P  +     ++ VF  LDR T IEPD P+ + + + + GEVE K I F 
Sbjct  1045  ANGAAETLTLAPDFVKGGRAMRSVFDLLDRKTEIEPDDPDATQVPDRLRGEVELKHIDFS  1104

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V +    NLR  AG  +ALVGPSG GKSSVIAL+ RFY+   G+V+IDGKD+R 
Sbjct  1105  YPSRPDVPIFRDLNLRARAGKTLALVGPSGCGKSSVIALIQRFYEPSSGRVMIDGKDIRK  1164

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
             YNL+ LR  I +V QEP LF  +I ENI YG E A+EAEIIE    AN H FIS+LPEGY
Sbjct  1165  YNLKSLRKHIAIVPQEPCLFASTIYENIAYGHESAAEAEIIEAGTLANAHKFISSLPEGY  1224

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              T VGE+G QLSGGQKQRIAIARAL+++  +MLLDEATSALD+ SER+V  AL+      
Sbjct  1225  KTFVGERGVQLSGGQKQRIAIARALVRKAELMLLDEATSALDAESERSVQEALD------  1278

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHS-TLTSQPDGVYSRLVSL  1618
                R+   K T I VAHRLST+ N+ +I V+D G V E GSHS  L + PDG Y+R++ L
Sbjct  1279  ---RACSGKTT-IVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSYLLKNYPDGCYARMIQL  1334

Query  1619  QSMKDH*HTQL  1651
             Q      H+Q+
Sbjct  1335  QRFT---HSQV  1342


 Score =   298 bits (764),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 189/535 (35%), Positives = 296/535 (55%), Gaps = 18/535 (3%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y+  F  +G   W ++  +   +   GE+  T +R     A L  ++ +F+  E     +
Sbjct  162   YAFYFLVVGAAIWASSWAEISCWMWTGERQTTKMRIKYLEAALDQDIQYFD-TEVRTSDV  220

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
                I  +   V+  IS+++   +  +++ V    V     W++ LV  AV+P   + G I
Sbjct  221   VFAINTDAVMVQDAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAI  280

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKE  574
                +    S  +  A S+  ++  ++   I+ V++F  E   +     AL+       K 
Sbjct  281   HTTTLAKLSTKSQEALSQGGNIVEQTVVQIRVVLAFVGESRALQAYSSALKVAQKIGYKT  340

Query  575   SIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL  754
                 G+  G +  +    +A+ LWY   LV+ H ++   AI +  +F++ +  +  L   
Sbjct  341   GFAKGMGLGATYFVVFCCYALLLWYGGYLVRHHYTNGGLAIAT--MFAVMIGGLG-LGQS  397

Query  755   IPTV---LSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVM  925
              P++   + A      +F+ +D    I+ +       ES+ G VE K + F YPSRP+V 
Sbjct  398   APSMSAFVKAKVAAAKIFRIIDNKPGIDRNSESGLELESVTGLVELKNVDFAYPSRPDVR  457

Query  926   VLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRA  1105
             +LN F+L + AG  +ALVG SG+GKS+V++L+ RFYD   G+VL+DG D++   LR LR 
Sbjct  458   ILNNFSLTVPAGKTIALVGSSGSGKSTVVSLIERFYDPSSGEVLLDGHDIKTLKLRWLRQ  517

Query  1106  QIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKG  1285
             QIGLV QEP LF  +I+ENI  G   A++ EI E ++ AN H+FI  LP+G+DT VGE+G
Sbjct  518   QIGLVSQEPALFATTIKENILLGRPDANQIEIEEAARVANAHSFIVKLPDGFDTQVGERG  577

Query  1286  SQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPS  1465
              QLSGGQKQRIAIARA+LK PAI+LLDEATSALDS SE+ V  AL+        GR    
Sbjct  578   LQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFM----IGR----  629

Query  1466  KMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
               T + +AHRLST+  +D++ V+ +G V E+G+H  L ++  +G Y++L+ +Q M
Sbjct  630   --TTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDELIAKGENGAYAKLIRMQEM  682



>emb|CDY20012.1| BnaA09g02390D [Brassica napus]
Length=1253

 Score =   421 bits (1082),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 237/542 (44%), Positives = 343/542 (63%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  725   ERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDE  784

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ I++WR+ L+     P  
Sbjct  785   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPLL  844

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ RV  
Sbjct  845   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHELRVPQ  904

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +   +RS+     FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + +  +T
Sbjct  905   KRSFYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSQGKSTFSKVIKVFVVLVIT  960

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G++EF+ + F Y
Sbjct  961   ANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIEFRHVDFAY  1020

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VM+   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGKD+R  
Sbjct  1021  PSRPDVMLFTDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRL  1080

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE ++AAN H FIS LPEGY 
Sbjct  1081  NLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYK  1140

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1141  TPVGERGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMR---  1197

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+   D I V+  G +VE G HS L S+P+G YSRL+ LQ+
Sbjct  1198  -GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGRHSELVSRPEGAYSRLLQLQT  1250

Query  1625  MK  1630
              +
Sbjct  1251  HR  1252


 Score =   278 bits (711),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 181/538 (34%), Positives = 297/538 (55%), Gaps = 17/538 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSRYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTA--IFSAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    E + G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKAAGYKLMEIINQRPTIVQDPLDGKCLEQVHGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDE-GKVLIDGKDVRDYNLR  1093
             +V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD +  GK+L+DG +++   L+
Sbjct  379   DVIIFRNFSIVFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNAGKILLDGVEIKTLQLK  438

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT V
Sbjct  439   FLREQIGLVNQEPALFATTILENILYGKPNATLDEVEAAASAANAHSFITLLPKGYDTQV  498

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR
Sbjct  499   GERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR  554

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                   T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  555   ------TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGPYASLIRFQEM  605



>ref|XP_011077318.1| PREDICTED: ABC transporter B family member 1 [Sesamum indicum]
 ref|XP_011077319.1| PREDICTED: ABC transporter B family member 1 [Sesamum indicum]
 ref|XP_011077320.1| PREDICTED: ABC transporter B family member 1 [Sesamum indicum]
Length=1349

 Score =   422 bits (1086),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 237/536 (44%), Positives = 328/536 (61%), Gaps = 12/536 (2%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             R++  Y  +   +   +   NTLQH+ + VVGE     +R  +  A L+NE+AWF+R EN
Sbjct  806   REIAKYCYLLIGVSSAALIFNTLQHFFWDVVGENLTKRVREKMLVAVLKNEMAWFDREEN  865

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
                 + +R+  + + V+  I DR+SVI+Q  + +++A T   ++ WR+ LV  AV P   
Sbjct  866   ESSRIAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  925

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
                ++Q     GFSGD  AAHS+   LA E+ AN++TV +F  E  +V     +LQP L 
Sbjct  926   AATVLQKMFMNGFSGDLEAAHSKATQLAGEAVANVRTVAAFNSESKIVGLFTSSLQPPLS  985

Query  560   RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSIT  739
             R   +    G   G +  L   ++A+ LWY + LV+   S F   IR + +  ++     
Sbjct  986   RCFWKGQIAGSGYGIAQFLLYGSYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAA  1045

Query  740   ELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESL-SESIEGEVEFKTIKFHYPSRP  916
             E  TL P  +     ++ VF+ LDR T IEPD P+ ++  + + GEVEFK + F YP+RP
Sbjct  1046  ETLTLAPDFIKGGRAMRSVFELLDRRTEIEPDDPDATIIPDRLRGEVEFKHVDFSYPTRP  1105

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             ++ +    +LR  AG  +ALVGPSG GKSSVI+L+ RFY+   G+V+IDGKD+R YNL+ 
Sbjct  1106  DIAIFRDLSLRARAGKTLALVGPSGCGKSSVISLIQRFYEPSSGRVIIDGKDIRKYNLKS  1165

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR  I +V QEP LF  +I ENI YG E A+E+EIIE +  AN H FIS+LP GY T VG
Sbjct  1166  LRRHIAVVPQEPCLFATTIYENIAYGHESATESEIIEAATLANAHKFISSLPNGYKTFVG  1225

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA L++  IMLLDEATSALD+ SER +  AL+         R+
Sbjct  1226  ERGVQLSGGQKQRIAIARAFLRKAEIMLLDEATSALDAESERCIQEALD---------RA  1276

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHS-TLTSQPDGVYSRLVSLQ  1621
                K T I VAHRLST+ N+ +I V+D G V E GSHS  L S PDG+Y+R++ LQ
Sbjct  1277  CAGKTT-ILVAHRLSTIRNAHVIAVLDDGKVAEQGSHSHLLKSYPDGIYARMIQLQ  1331


 Score =   305 bits (780),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 193/533 (36%), Positives = 296/533 (56%), Gaps = 18/533 (3%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y+  F  +G   W ++  +   +   GE+  T +R     A L  ++ +F+  E     +
Sbjct  158   YAFYFLIVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALNQDIEFFD-TEVRTSDV  216

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
                I  E   V+  IS+++   +  +++ V    V     W++ LV  AV+P   + G I
Sbjct  217   VFAINTEAVMVQDAISEKLGNFLHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAVIGAI  276

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKE  574
                +    SG +  A S+  ++A ++   I+TV++F  E   +     AL+       + 
Sbjct  277   HTVTLAKLSGKSQEALSQAGNIAEQTIVQIRTVLAFVGESRALQAYSAALKVAQKIGYRS  336

Query  575   SIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL  754
                 G+  G +       +A+ LWY   +V+ H ++   AI +  +F++ +  +  L   
Sbjct  337   GFAKGMGLGATYFTVFCCYALLLWYGGYMVRHHFTNGGLAIAT--MFAVMIGGLA-LGQS  393

Query  755   IPTVLSAIGILK---PVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVM  925
              P++ +          +F+ +D    +E ++      ESI G++E K + F YPSRPE  
Sbjct  394   APSMAAFAKARVAAAKIFRIIDHKPGVERNRKSGLELESITGQLELKNVDFAYPSRPETR  453

Query  926   VLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRA  1105
             VLN F+L + AG  +ALVG SG+GKS+V++L+ RFYD   G+VL+DG D++   LR LR 
Sbjct  454   VLNNFSLTVPAGKTIALVGSSGSGKSTVVSLIERFYDPPSGQVLLDGHDIKTLKLRWLRQ  513

Query  1106  QIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKG  1285
             QIGLV QEP LF  +I+ENI  G   AS  EI E S+ AN H+FI  LP+GYDT VGE+G
Sbjct  514   QIGLVSQEPALFATTIKENILLGRPDASLIEIEEASRVANAHSFIVKLPDGYDTQVGERG  573

Query  1286  SQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPS  1465
              QLSGGQKQRIAIARA+LK PAI+LLDEATSALDS SE+ V  AL+        GR    
Sbjct  574   LQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFM----IGR----  625

Query  1466  KMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQ  1621
               T + +AHRLST+  +D++ V+ +G V E+G+H  L ++  +G Y++L+ +Q
Sbjct  626   --TTLVIAHRLSTIRKADLVAVLQQGSVSEIGTHDELIAKGENGFYAKLIRMQ  676



>ref|XP_009111610.1| PREDICTED: ABC transporter B family member 19-like [Brassica 
rapa]
Length=1252

 Score =   421 bits (1081),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 237/542 (44%), Positives = 343/542 (63%), Gaps = 18/542 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+  E
Sbjct  724   ERKTKEYVFIYIGAGIYAVIAYLIQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDEDE  783

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I++R+SVI+Q ++S++ +  V+ I++WR+ L+     P  
Sbjct  784   HNSSLVAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIIEWRVSLLILCTFPLL  843

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ RV  
Sbjct  844   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQSKILSLFSHELRVPQ  903

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +   +RS+     FG+ Q   L L+  + A+ LWY   LV + +S+F   I+ + +  +T
Sbjct  904   KRSFYRSQTSGFLFGLSQ---LALYG-SEALILWYGAHLVSQGKSTFSKVIKVFVVLVIT  959

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD  +    E+I G+++F+ + F Y
Sbjct  960   ANSVAETVSLAPEIIRGGEAVGSVFSVLDRQTRIDPDDADADPVETIRGDIKFRHVDFAY  1019

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+VMV   FNLRI AG   ALVG SG+GKSSVIA++ RFYD   GKV+IDGKD+R  
Sbjct  1020  PSRPDVMVFTDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRL  1079

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  +I +NI YG + A+E+E+IE ++AAN H FIS LPEGY 
Sbjct  1080  NLKSLRLKIGLVQQEPALFAATIFDNIAYGKDGATESEVIEAARAANAHGFISGLPEGYK  1139

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P+++LLDEATSALD+ SE  +  ALE L +   
Sbjct  1140  TPVGERGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDAESECVLQEALERLMR---  1196

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+   D I V+  G +VE G HS L S+P+G YSRL+ LQ+
Sbjct  1197  -GR------TTVVVAHRLSTIRGVDCIGVIQDGRIVEQGRHSELVSRPEGAYSRLLQLQT  1249

Query  1625  MK  1630
              +
Sbjct  1250  HR  1251


 Score =   283 bits (724),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 180/537 (34%), Positives = 298/537 (55%), Gaps = 16/537 (3%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  82    EVSRYALYFVYLGLVVCVSSYAEIACWMYSGERQVAALRKKYLEAVLKQDVGFFD-TDAR  140

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  141   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSVAVIPGIAF  200

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   ++    A+Q  L  
Sbjct  201   AGGLYAYTLTGITSKSRESYANAGVIAEQAIAQVRTVYSYVGESKALSSYSEAIQYTLKL  260

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVP--SI  736
               K  +  G+  G +  +  ++ A+  WY  + ++   +    A  +  IFS  V   S+
Sbjct  261   GYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRSGTTDGGKAFTA--IFSAIVGGMSL  318

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              + ++ +            + + +++   I  D  +    E ++G +EFK + F YPSRP
Sbjct  319   GQSFSNLGAFSKGKAAGYKLMEIINQRPTIVQDPLDGKCLEQVQGNIEFKDVTFSYPSRP  378

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++   F++   +G  VA+VG SG+GKS+V++L+ RFYD + G++L+DG +++   L+ 
Sbjct  379   DVIIFRNFSIFFPSGKTVAVVGGSGSGKSTVVSLIERFYDPNNGEILLDGVEIKTLQLKF  438

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I ENI YG   A+  E+   + AAN H+FI+ LP+GYDT VG
Sbjct  439   LREQIGLVNQEPALFATTILENILYGKPNATIDEVEAAASAANAHSFITLLPKGYDTQVG  498

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ +      GR 
Sbjct  499   ERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDASSESIVQEALDRVM----VGR-  553

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
                  T + VAHRL T+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  554   -----TTVVVAHRLCTIRNVDSIAVIQQGQVVETGTHEELIAK-SGAYASLIRFQEM  604



>ref|XP_006473688.1| PREDICTED: ABC transporter B family member 13-like isoform X2 
[Citrus sinensis]
Length=1034

 Score =   416 bits (1069),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 232/549 (42%), Positives = 342/549 (62%), Gaps = 20/549 (4%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +DS  KR V   ++IF  + +++     LQHY Y ++GE     +R S++SA L NE+ W
Sbjct  496   HDSQIKRVVDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGW  555

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  ENN G L S +  + + V+  ++DR+S+IVQ ++  V A  ++ I+ WR+  V  A
Sbjct  556   FDLDENNTGLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSWRLAAVVAA  615

Query  362   VMPCHFIGGLIQAK-SAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHV-VNKAR  535
              +P   IG  +  +   KGF GD   A+S   S+A E+ ANI+TV ++  E+ + +  A 
Sbjct  616   SLPL-LIGAFVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKRISIQFAS  674

Query  536   VALQPQ---LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
                QP    L R       +G+ Q  SLC    ++A+ LWY ++L+++  S+F + ++S+
Sbjct  675   ELSQPNKQALLRGHISGFGYGVSQLLSLC----SYALGLWYASVLIKQKGSNFGDIMKSF  730

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  ++ E   L P ++     L PVF  L R T I+PD P       I+G +E +
Sbjct  731   MVLIITALAVAETLALAPDIVKGSQALGPVFGILYRKTAIQPDDPASKEVTEIKGNIELR  790

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YP RP++ +    NL++ AG  +A+VG SG+GKS+VI+L++RFYD   G VLIDG
Sbjct  791   NVSFKYPVRPDITIFENLNLKVSAGRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDG  850

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
              D+R +NLR LR +IGLVQQEP LF  +I ENI YG+E ASE E+++ +KAAN H FIS 
Sbjct  851   YDIRTFNLRSLRRKIGLVQQEPALFSTTIYENIKYGNEDASEIELMKATKAANAHGFISR  910

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             +PEGY + VG++G QLSGGQKQR+AIARA+LK P+I+LLDEATSALD+ SE  +  AL+ 
Sbjct  911   MPEGYQSHVGDRGVQLSGGQKQRVAIARAILKNPSILLLDEATSALDTASENLIQEALDK  970

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T I VAHRLST+ N+D I V+ +G V E+GSH  L  + +G+Y +
Sbjct  971   LME----GR------TTIMVAHRLSTIRNADKIAVLQQGKVAEIGSHEQLLRKENGIYKQ  1020

Query  1607  LVSLQSMKD  1633
             L+ LQ  K+
Sbjct  1021  LIRLQQDKN  1029


 Score =   264 bits (675),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 160/389 (41%), Positives = 222/389 (57%), Gaps = 27/389 (7%)
 Frame = +2

Query  482   IKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLL  661
             ++ V +F  E   +     +L+  L + +K  +  GI  G +  L   A A+ LWY  +L
Sbjct  26    VRAVYAFVGEAKAIESYSHSLKEALKQGKKSGVAKGIGVGLTYGLLFCAWALLLWYAGIL  85

Query  662   VQRHQ--------SSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRC  817
             V RH         ++ +N I S        P++  +        + + I+K    + +R 
Sbjct  86    V-RHGDTNGGKAFTTIINVIFSGFALGQAAPNLAAIAKGKAAAANIVSIIKENSHSSER-  143

Query  818   TRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAG  997
                 P     +L + + G++EF  + F YPSRP  MV    N  ++AG   A VGPSG+G
Sbjct  144   ----PGDDGITLPK-LAGQIEFCEVCFAYPSRPH-MVFENLNFSVDAGKTFAFVGPSGSG  197

Query  998   KSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGS  1177
             KS++I+++ R Y+   GK+L+DG D++   L+ LR Q+GLV QEP LF  SI  NI  G 
Sbjct  198   KSTIISMVQRLYEPTSGKILLDGHDLKSLQLKWLREQMGLVSQEPALFATSIANNILLGK  257

Query  1178  ERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIM  1357
             E AS   +IE +KAAN H+F+  LP+GY T VGE G+QLSGGQKQRIAIARA+L+ P I+
Sbjct  258   EDASMDRVIEAAKAANAHSFVEGLPDGYQTQVGEGGTQLSGGQKQRIAIARAVLRNPKIL  317

Query  1358  LLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMD  1537
             LLDEATSALD+ SE  V  ALE +           S  T I VAHRLSTV + D I+V+ 
Sbjct  318   LLDEATSALDAESELIVQRALEKIM----------SNRTTIVVAHRLSTVRDVDTIMVLK  367

Query  1538  KGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              G VVE G+H  L S+  G Y+ LV+LQS
Sbjct  368   NGQVVESGTHVDLISK-GGEYAALVNLQS  395



>ref|XP_010501626.1| PREDICTED: ABC transporter B family member 14-like [Camelina 
sativa]
Length=1233

 Score =   420 bits (1080),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 232/532 (44%), Positives = 331/532 (62%), Gaps = 10/532 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             + S  KR+V    +IF   G+++     LQHY Y ++GE+  + +R SL+SA + NE+ W
Sbjct  695   FPSLIKREVEKVIIIFVGTGIVTTPIYLLQHYFYTLMGERLTSRVRLSLFSAIILNEIGW  754

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  ENN GSLTS +  + + V+  I+DR+S IVQ IS  V A  ++    WR+  V  A
Sbjct  755   FDLDENNTGSLTSILSADATLVRSAIADRLSTIVQNISLTVTALALAFFYSWRVAAVVTA  814

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
               P      L +    KGF GD T A+S   SLA E+  NI+TV +F  E+ +  +    
Sbjct  815   CFPLLIAASLTEQLFLKGFGGDYTRAYSRATSLAREAIVNIRTVAAFGAEKQISEQFTCE  874

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L      +  +    G   G S CL   ++A+ LWY ++L+QR ++ F ++I+S+ +  +
Sbjct  875   LSKPTKNALLKGHISGFGYGLSQCLAYCSYALGLWYISVLIQRKETKFEDSIKSFMVLLV  934

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T  S+ E   L P ++     L  VF+ L R + I PD+P   L   ++G++EF+ + F 
Sbjct  935   TAYSVAETLALTPDIVKGTQALGSVFRVLHRESEIPPDQPNSRLVTQVKGDIEFRNVSFA  994

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP+RPE+ +    NL + AG  +A+VG SG+GKS+V+ L++RFYD   GK+ IDG+D++ 
Sbjct  995   YPTRPEIAIFQNLNLWVSAGKSLAVVGASGSGKSTVVGLIMRFYDTTSGKLCIDGQDIKT  1054

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
              NLR LR +I LVQQEP LF  +I ENI YG+E ASEAEIIE +KA+N H FI  + +GY
Sbjct  1055  INLRSLRKKIALVQQEPALFSTTIHENIKYGNENASEAEIIEAAKASNAHEFIIKMEKGY  1114

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              T VG+KG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +  
Sbjct  1115  KTHVGDKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTSSEKLVQEALDKLMK--  1172

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGV  1597
               GR      T + VAHRLST+  +D+IVV+ KG VVE GSH  L S+ DG+
Sbjct  1173  --GR------TTVLVAHRLSTIRKADMIVVLHKGRVVEKGSHRELVSKSDGI  1216


 Score =   276 bits (705),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 185/540 (34%), Positives = 293/540 (54%), Gaps = 38/540 (7%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G ++++ A IG+  W             GE+    LR +   + L  ++ +F+  E   
Sbjct  81    LGLFNLVSAWIGVACWMQT----------GERQTARLRINYLKSILAKDITFFD-TETRD  129

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +    I ++   V+  I D++  +++ +   +    +  +  W++ L+   V+P   + 
Sbjct  130   SNFIFHISSDAILVQDAIGDKIGHVLRYLCQFIAGFVIGFLSVWQLTLLTLGVVPLIAVA  189

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  + AA+++   +A E  + ++TV +F  EE  V     +L+  L  S
Sbjct  190   GGGYAIVMSTISEKSEAAYADAGKVAEEVMSQVRTVYAFVGEEKAVKTYASSLKKALKLS  249

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSS-------FLNAIRSYQIFSLT  724
             ++  +  G+  G +  L   A A   WY +LLV+  ++S        LN I S       
Sbjct  250   KRSGLAKGLGVGLTYSLLFFAWAFLFWYASLLVRHDKTSGAKAFTTILNVIYSGFALGQA  309

Query  725   VPSITELWTLIPTVLSAIGILKPVFQT-LDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             VPS++    +    ++A  I + +    ++   R++      +  E++ GE+EF  + F 
Sbjct  310   VPSLS---AITKGRVAAANIFRMIGNNNIESSERLD----NGTTLENVAGEIEFHRVSFA  362

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP  MV +  +  I +    A VGPSG+GKS++I+++ RFY+ + G++L+DG D++ 
Sbjct  363   YPSRPN-MVFDNLSFTICSCKTFAFVGPSGSGKSTIISMVQRFYEPNSGEILLDGNDIKS  421

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR Q+GLV QEP LF  +I  NI  G   AS  +I E +KAAN  +FI +LP GY
Sbjct  422   MKLKWLREQMGLVSQEPALFATTIASNILLGKGNASMVQIEEAAKAANADSFIKSLPNGY  481

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD  SE+ V  AL+++ +  
Sbjct  482   NTQVGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDVESEKIVQQALDNVME--  539

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                     K T I VAHRLST+ N+D I+V+  G V+E+GSHS L S+  G Y+ LV  Q
Sbjct  540   --------KRTTIVVAHRLSTIRNADKILVLRDGHVMEIGSHSELISR-GGHYATLVKCQ  590



>ref|XP_004499289.1| PREDICTED: ABC transporter B family member 13-like [Cicer arietinum]
Length=1247

 Score =   421 bits (1081),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 230/546 (42%), Positives = 344/546 (63%), Gaps = 26/546 (5%)
 Frame = +2

Query  8     SDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFE  187
             S  K++V   ++IF  + +++     LQHY Y ++GE+    +R  ++SA L NE+AWF+
Sbjct  716   SKIKQEVAHVALIFVGVAVVTIPIYLLQHYFYSLMGERLTARVRLLMFSAILTNEVAWFD  775

Query  188   RPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVM  367
               ENN GSLT+ +  + + V+  ++DR+S IVQ ++  V A  ++  + W++ LV  A +
Sbjct  776   LDENNTGSLTAMLAADATLVRSTLADRLSTIVQNVALTVTAFVIAFTLSWKLTLVVAACL  835

Query  368   PCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ  547
             P      + +    KGF GD + A+S+  SLA E+ ANI+TV +F  E+ +     +   
Sbjct  836   PLLIGASITEQLFLKGFGGDYSHAYSKATSLAREAIANIRTVAAFGAEDRI----SIQFA  891

Query  548   PQLHRSRKESI--------KFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRS  703
              +L++  K++          +G+ Q  + C    ++A+ LWY ++L+++ +S+F + ++S
Sbjct  892   SELNKPNKQAFLRGHISGFGYGVTQLFAFC----SYALGLWYASVLIKKKESNFGDIMKS  947

Query  704   YQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEF  883
             + +  +T  +I E   L P ++     L  VF  L R T I P+     +   ++GEV+F
Sbjct  948   FMVLIITALAIAETLALTPDIVKGSQALGSVFSILYRRTAINPNDRNNKMITEVKGEVKF  1007

Query  884   KTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLID  1063
             + + F YP RP++ +    NLR+ AG  +A+VG SG+GKS+VIAL++RFYD + G VLID
Sbjct  1008  QNVCFKYPMRPDITIFQNLNLRVSAGKSLAVVGQSGSGKSTVIALVMRFYDPNSGSVLID  1067

Query  1064  GKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFIS  1243
             G D++D NLR LR +IGLVQQEP LF  ++ ENI YG E ASE E+++ ++AAN H FIS
Sbjct  1068  GCDIKDLNLRSLRQRIGLVQQEPALFSTTVYENIKYGKEEASEVEVMKAARAANAHEFIS  1127

Query  1244  NLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALE  1423
              +PEGY T VGE+G QLSGGQKQR+AIARA+LK P+I+LLDEATSALD+ SER V  AL+
Sbjct  1128  RMPEGYRTEVGERGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTVSERLVQEALD  1187

Query  1424  SLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYS  1603
              L +    GR      T I VAHRLSTV ++D I V+  G V EMGSH  L ++P  +Y 
Sbjct  1188  KLME----GR------TTILVAHRLSTVRDADSIAVLQHGKVAEMGSHDRLMAKPGSIYK  1237

Query  1604  RLVSLQ  1621
             +LVSLQ
Sbjct  1238  QLVSLQ  1243


 Score =   276 bits (707),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 184/514 (36%), Positives = 281/514 (55%), Gaps = 27/514 (5%)
 Frame = +2

Query  113   GEKAMTNLRNSLYSATLQNELAWFERPENNVGSLTSRIVNETSTVKIIISDRMsvivqci  292
             GE+    LR     + L+ ++ +F+  E    ++   I ++   V+  I D+    ++ +
Sbjct  119   GERQTARLRLKYLQSVLKKDINFFDN-EARDANIIFHISSDAILVQDAIGDKTGHAMRYL  177

Query  293   ssiviATTVSMIVDWRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslases  472
             S  ++   +     W++ L+  AV+P   I G          S    AA++E   +A E 
Sbjct  178   SQFIVGFGIGFTSVWQLTLLTLAVVPFIAIAGGAYTMIMSTLSEKGEAAYAEAGKVAEEV  237

Query  473   aaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYT  652
              + ++TV SF  EE  V     +L   L   +K     G+  G +  L   A A+ LWY 
Sbjct  238   ISQVRTVYSFVGEEKAVGSYSKSLDKALKLGKKSGFAKGVGVGFTYGLLFCAWALLLWYA  297

Query  653   TLLVQRHQS-------SFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLD  811
              +LV+ H++       + +N I S        P+   L ++     +A  I+  +    +
Sbjct  298   GILVRHHKTNGGKAFTTIINVIFSGFALGQAAPN---LGSIAKGRAAAANIMNMIASVSE  354

Query  812   RCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSG  991
                R++    + ++   + G+++F  + F YPSR   M+    +  + AG  VA+VGPSG
Sbjct  355   SSKRLD----DGTVLPQVAGKIDFCEVCFAYPSRSN-MIFENLSFSVNAGKTVAVVGPSG  409

Query  992   AGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICY  1171
             +GKS++I+L+ RFY+   GK+L+DG D+++  LR LR Q+GLV QEP LF  +I  NI +
Sbjct  410   SGKSTIISLIQRFYEPSSGKILLDGYDLKNVQLRWLREQMGLVSQEPALFATTIAGNILF  469

Query  1172  GSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPA  1351
             G E A   +IIE +KAAN H+FI+ LP+GY+T VGE G+QLSGGQKQRIAIARA+L+ P 
Sbjct  470   GKEDADMNQIIEAAKAANAHSFIAGLPQGYNTQVGEGGTQLSGGQKQRIAIARAVLRNPK  529

Query  1352  IMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVV  1531
             I+LLDEATSALD+ SE  V  ALE +  +           T I VAHRLST+ + D I+V
Sbjct  530   ILLLDEATSALDAESEIIVEQALEKIMLNR----------TTIIVAHRLSTIRDVDTIIV  579

Query  1532  MDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMKD  1633
             +  G V E GSH  L S+ +G Y  LVSLQ+ ++
Sbjct  580   LKNGQVAESGSHLELMSK-NGEYVSLVSLQASQN  612



>gb|EMT10010.1| Putative multidrug resistance protein [Aegilops tauschii]
Length=745

 Score =   407 bits (1047),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 233/548 (43%), Positives = 341/548 (62%), Gaps = 26/548 (5%)
 Frame = +2

Query  5     DSDAKR-KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             D D  R K   Y++IF ++ +LS+  N  QHY +G +GE     +R  + +  L  E+ W
Sbjct  209   DHDEIRDKTRAYALIFVALAVLSFLINIGQHYNFGAMGEYLTKRIREQMLTKILTFEIGW  268

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+R EN+ G++ S++  + + V+ ++ DRM++++Q +S+++IA T+ +++ WR+ LV  A
Sbjct  269   FDRDENSSGAICSQLAKDANVVRSLVGDRMALVIQTVSAVLIACTMGLVIAWRLALVMIA  328

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV---NKA  532
             V P   +    +    K  S  +  A SE   LA+E+ +N++T+ +F  ++ ++   N+A
Sbjct  329   VQPLIIVCFYARRVLLKSMSKKSIQAQSESSKLAAEAVSNLRTITAFSSQDRILGLFNQA  388

Query  533   RVALQPQLHRSRKESIK----FGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIR  700
             +       +  RKESI+     G+  GTS+ L     A+  W+   L+ +H  +     +
Sbjct  389   Q-------NGPRKESIRQSWIAGLGLGTSMSLMTCTWALDFWFGGRLIAQHHITAKALFQ  441

Query  701   SYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVE  880
             ++ I   T   I +  ++   +      +  VF  LDR T I+PD PE    E ++GEV+
Sbjct  442   TFMILVSTGRVIADAGSMTTDLAKGSDAIASVFAVLDRVTEIDPDNPEGYKPEKLKGEVD  501

Query  881   FKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLI  1060
              + + F YPSRP+V++  GF+L I++G   ALVG SG+GKS++I L+ RFYD   G V I
Sbjct  502   IRGVDFAYPSRPDVIIFKGFSLSIQSGKSTALVGQSGSGKSTIIGLIERFYDPVRGMVKI  561

Query  1061  DGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFI  1240
             DG+D++ YNLR LR  IGLV QEP LF  +IRENI YG+E ASEAEI   +++AN H FI
Sbjct  562   DGRDIKTYNLRALRRHIGLVSQEPTLFAGTIRENIVYGTETASEAEIENAARSANAHDFI  621

Query  1241  SNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSAL  1420
             SNL +GYDT  GE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALDS SE+ V  AL
Sbjct  622   SNLKDGYDTWCGERGVQLSGGQKQRIAIARAILKNPAILLLDEATSALDSQSEKVVQEAL  681

Query  1421  ESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGV  1597
             + +      GR+S      + VAHRLST+ N D+I V+DKG VVE G+HS+L S+ P G 
Sbjct  682   DRVM----VGRTS------VVVAHRLSTIQNCDLITVLDKGIVVEKGTHSSLMSKGPSGT  731

Query  1598  YSRLVSLQ  1621
             Y  LVSLQ
Sbjct  732   YYSLVSLQ  739


 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 10/114 (9%)
 Frame = +2

Query  1292  LSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPSKM  1471
             +SGGQKQRIAIARA+LK P I+LLDEATSALD+ SER V  AL+        GR      
Sbjct  1     MSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALD----LASVGR------  50

Query  1472  TQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSMKD  1633
             T I VAHRLST+ N+D+I VM  G V E+GSH  L +  +G+YS LV LQ  ++
Sbjct  51    TTIVVAHRLSTIRNADMIAVMQYGEVKELGSHEELIANENGLYSSLVRLQQTRE  104



>ref|XP_009113714.1| PREDICTED: ABC transporter B family member 14 [Brassica rapa]
Length=1232

 Score =   419 bits (1078),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 238/542 (44%), Positives = 340/542 (63%), Gaps = 10/542 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             + S  KR V   +++F  +G+++     LQHY Y ++GE+  + +R SL+SA L NE+ W
Sbjct  700   FPSVIKRDVEKVAIVFVGVGVVTPLIYLLQHYFYTLMGERLTSRVRLSLFSAVLSNEVGW  759

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  +NN GSLTS +  + + V+  ++DR+S IVQ +S    A  V+    WR+  V  A
Sbjct  760   FDMEDNNTGSLTSILAADATLVRSALADRLSTIVQNLSLTFTALAVAFFYSWRVAAVVTA  819

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
               P      L +    KGF GD T A+S+  S+A E+  NI+TV SF  E+ +  +    
Sbjct  820   CFPLLIAASLTEQLFLKGFGGDYTRAYSKATSVAREAIENIRTVASFGAEKTISEQFACE  879

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L+     +       G   G S CL   ++A+ LWY ++L++R +++F ++I+S+ +  +
Sbjct  880   LRKPTKNAFLRGHISGFGYGLSQCLAFCSYALGLWYISVLIKREETNFADSIKSFMVLLV  939

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
             T  S+ E   L P ++     L+ VF+ L R T I PDKP   L   I+G +EF+ + F 
Sbjct  940   TAYSVAETLALTPDIVKGTQALRSVFRVLHRETEIHPDKPNSILVTQIKGNIEFRNVGFA  999

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YP+R ++ +    NL++ AG  +A+VGPSG+GKS+VI L++RFYDV+ G + IDG+D++ 
Sbjct  1000  YPARLDIPIFQNLNLKVSAGKSLAVVGPSGSGKSTVIGLIMRFYDVNYGNLCIDGQDIKT  1059

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
              NLR LR ++ LVQQEP LF  +I ENI YG+E ASEAEIIE +KAAN H FIS + EGY
Sbjct  1060  LNLRSLRKKLALVQQEPALFSTTIYENIKYGNENASEAEIIEAAKAANAHEFISRMEEGY  1119

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              T VGEKG QLSGGQKQR+AIARA+LK P+++LLDEATSALD+ SE+ V  AL+ L +  
Sbjct  1120  RTHVGEKGVQLSGGQKQRVAIARAVLKDPSVLLLDEATSALDTTSEKLVQEALDKLMK--  1177

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T + VAHRLST+  +D I V+ KG VVE GSH  L S+ DG Y +L SLQ
Sbjct  1178  --GR------TTVLVAHRLSTIRKADTIAVLHKGRVVEKGSHRELVSKSDGFYKKLTSLQ  1229

Query  1622  SM  1627
              +
Sbjct  1230  EV  1231


 Score =   277 bits (708),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 186/537 (35%), Positives = 292/537 (54%), Gaps = 32/537 (6%)
 Frame = +2

Query  26    VGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNV  205
             +G+ +++ A +G+  W             GE+    LR +   + L  ++ +F+  E   
Sbjct  89    LGFVNLVSAWMGVACWMQT----------GERQTARLRINYLKSILAKDITFFD-TEARD  137

Query  206   GSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIG  385
              +    I ++T  V+  I D+   +++ +   +    +  +  W++ L+  AV+P   I 
Sbjct  138   SNFIFHISSDTILVQDAIGDKTGHVLRYLCQFIAGFVIGFLSVWQLTLLTLAVVPLIAIA  197

Query  386   GLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRS  565
             G   A      S  + AA+++   +A E  + ++TV ++  E+  VN    +L+  L   
Sbjct  198   GGGYAVIMSTISKKSEAAYADAGKVAEEVLSQVRTVYAYVGEKKAVNSYSKSLKKALKLG  257

Query  566   RKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITEL  745
             ++  +  G+  G +  L   A A+  WY +LLV RH  +  N  +++      + S   L
Sbjct  258   KRSGLAKGLGVGLTYGLLFCAWALLFWYASLLV-RHGKT--NGAKAFTTILNVIYSGFSL  314

Query  746   WTLIPTVLSAIG----ILKPVFQTLDRCTRIEPDKPEESLS-ESIEGEVEFKTIKFHYPS  910
                 P+ LSAI         +F+ +   T    +K +   + +++ G +EF  + F YPS
Sbjct  315   GQAAPS-LSAISKGRVAAANIFRMIGNNTLQGSEKLDNGTTLQNVSGNIEFHQVSFAYPS  373

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP  MV    +  I +G   A VGPSG+GKS++I+L+ RFY+   G++L+DG D++   L
Sbjct  374   RPN-MVFENLSFTINSGKTFAFVGPSGSGKSTIISLVQRFYEPKSGEILLDGNDIKSLKL  432

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR Q+GLV QEP LF  +I  NI  G E A   +IIE +KAAN   FI +LP+GY T 
Sbjct  433   KWLRKQMGLVSQEPALFATTIASNILLGKEDAHMDQIIEAAKAANADNFIKSLPDGYSTQ  492

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+ SE+ V  AL+++ +     
Sbjct  493   VGEGGTQLSGGQKQRIAIARAVLRNPKILLLDEATSALDAESEKIVQQALDNIME-----  547

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                  K T I +AHRLST+ N D I+V+  G V+E GSH+ L S+  G Y+ LV+ Q
Sbjct  548   -----KRTTIVIAHRLSTIRNVDKILVLRNGQVIETGSHAELISR-GGDYANLVNCQ  598



>ref|XP_008341564.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
19-like [Malus domestica]
Length=1250

 Score =   419 bits (1077),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 243/540 (45%), Positives = 342/540 (63%), Gaps = 18/540 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  ++  +GL +     +QHY   ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFMYVGVGLYAVVAYLIQHYFXSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   LT+++  + + VK  +S+R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   HNSNLLTAKLATDAADVKSAVSERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ R+ L
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNXQNKILSLFCHELRLPL  901

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS+   + FG+ Q       + + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  902   LGSLRRSQTAGVLFGLSQ----FALHASEALILWYGAHLVSKGVSTFSKVIKVFIVLVVT  957

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF  LDR TRI+PD PE  + ES+ GE+E + + F Y
Sbjct  958   ANSVAETVSLAPEIIRGGEAVGSVFSILDRQTRIDPDDPEAEVVESVRGEIELRHVDFAY  1017

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP++MV   F+LRI  G   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  1018  PSRPDIMVFKDFSLRIRTGHSQALVGXSGSGKSSVIALIERFYDPLVGKVMIDGKDIRRL  1077

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI ENI YG E A+EAE+IE ++ AN+H F+S LP+GY 
Sbjct  1078  NLKSLRLKIGLVQQEPALFAASIFENIAYGKEGATEAEVIEAARTANVHGFVSGLPDGYK  1137

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  +  ALE L +   
Sbjct  1138  TPVGERGVQLSGGQKQRIAIARAVLKDPRILLLDEATSALDAESECVLQEALERLMK---  1194

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQS  1624
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG YSRL+ LQ+
Sbjct  1195  -GR------TTVLVAHRLSTIRGVDSIGVVQDGRIVEHGSHSELVSRPDGAYSRLLQLQN  1247


 Score =   299 bits (766),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 190/539 (35%), Positives = 298/539 (55%), Gaps = 20/539 (4%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   T+  +   +   GE+ ++ LR     A L+ ++ +F+  +  
Sbjct  80    EVAKYALYFVYLGLIVCVTSYAEIACWMYTGERQVSTLRKKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   I  +T  V+  IS+++   +  +S+ +    V  +  WR+ L++ AV+P    
Sbjct  139   TGDIVFSISTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWRLALLSIAVIPGIVF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L  
Sbjct  199   AGGLYAYTLTGLTSKSRQSYANAGIVADQAIAQVRTVYSYVGESKALNSYSDAIQNTLQL  258

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V  I+ 
Sbjct  259   GYKAGMAKGLGLGCTYGIACMSWALVYWYAGVFIRNGQTDGGKAFTA--IFSAIVGGISL  316

Query  743   LWTLIPTVLSAIGILKPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFHYPS  910
               +   + L A    K     L    + +P    D  E      + G +EFK + F YPS
Sbjct  317   GQSF--SNLGAFSKGKSAGYKLMEIIKQKPTIVQDPLEGKCLSDVSGNIEFKEVTFSYPS  374

Query  911   RPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNL  1090
             RP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD ++G+VLID  D++   L
Sbjct  375   RPDVIIFRNFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYDPNQGQVLIDSVDIKTLQL  434

Query  1091  RKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTV  1270
             + LR QIGLV QEP LF  +I ENI YG   A+  ++   + +AN H+FI+ LP+GY+T 
Sbjct  435   KWLRDQIGLVNQEPALFATTILENILYGKPDATMEDVEVAASSANAHSFITLLPKGYNTQ  494

Query  1271  VGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFG  1450
             VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L      G
Sbjct  495   VGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDASSESIVQEALDRLM----VG  550

Query  1451  RSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQSM  1627
             R      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+  Q M
Sbjct  551   R------TTVIVAHRLSTIRNVDSIAVIQQGQVVETGTHEELIAKA-GAYASLIRFQEM  602



>dbj|BAJ96840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1271

 Score =   419 bits (1078),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 237/545 (43%), Positives = 347/545 (64%), Gaps = 18/545 (3%)
 Frame = +2

Query  11    DAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFER  190
             + ++K   Y  I+   G+ +     +QHY + ++GE   T +R  + SA L+NE+ WF+ 
Sbjct  741   EMEKKTKLYVFIYIGTGIYAVVAYLVQHYFFSIMGENLTTRVRRMMLSAILRNEVGWFDE  800

Query  191   PENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMP  370
              ENN   + +R+  + + VK  I++R+SVI+Q I+S++ +  V  I++WR+ ++  A  P
Sbjct  801   EENNSSLVAARVAVDAADVKSAIAERISVILQNITSLMTSFIVGFIIEWRVAILILATFP  860

Query  371   CHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARV  538
                +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  V+    ++ R+
Sbjct  861   LLVLANFAQQLSMKGFAGDTAKAHAKSSMVAGEGVSNIRTVAAFNAQNKVMSLFSHELRI  920

Query  539   ALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFS  718
               +  L RS+   + +G+ Q   LCL+  + A+ LWY + LV+ H S+F   I+ + +  
Sbjct  921   PEEQILRRSQTAGLLYGLSQ---LCLY-CSEALILWYGSHLVRSHGSTFSKVIKVFVVLV  976

Query  719   LTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKF  898
             +T  S+ E  +L P ++     ++ +F  L+R TRIEPD PE     ++ G++E + + F
Sbjct  977   VTANSVAETVSLAPEIIRGGESIRSIFGILNRATRIEPDDPEAERVTTVRGDIELRHVDF  1036

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YPSRP++ +   FNL+I+AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R
Sbjct  1037  SYPSRPDIEIFKDFNLKIQAGRSQALVGASGSGKSTVIALIERFYDPTGGKVMIDGKDIR  1096

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
               NL+ LR +IGLVQQEP+LF  SI ENI YG E A+E E+IE +K AN+H F+S LP+G
Sbjct  1097  RLNLKSLRRKIGLVQQEPVLFASSILENIAYGKEGATEEEVIEAAKTANVHAFVSQLPDG  1156

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQH  1438
             Y T VGE+G Q SGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L + 
Sbjct  1157  YRTAVGERGVQPSGGQKQRIAIARAVLKDPAILLLDEATSALDAESESVLQEALERLMK-  1215

Query  1439  HKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSL  1618
                GR      T + VAHRLST+   D I V+  G VVE G HS L ++P+G YSRL+ L
Sbjct  1216  ---GR------TTVLVAHRLSTIRGVDRIAVVQDGRVVEHGGHSELVARPEGAYSRLLQL  1266

Query  1619  QSMKD  1633
             Q+ ++
Sbjct  1267  QNHRN  1271


 Score =   302 bits (773),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 191/541 (35%), Positives = 295/541 (55%), Gaps = 26/541 (5%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+    +  +   +   GE+ +  LR +   A L+ ++ +F+  +  
Sbjct  99    EVAKYALYFVYLGLVVCVASYAEIACWMYTGERQVIALRKAYLDAVLRQDVGFFD-TDAR  157

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  I +++   +  +++      V  +  WR+ L++ AV+P    
Sbjct  158   TGDIVFGVSTDTLLVQDAIGEKVGNFMHYLATFFAGLVVGFVSAWRLALLSVAVIPAIAF  217

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A ++ A ++TV SF  E   +N    A+Q  L  
Sbjct  218   AGGLYAYTLTGLTSKSRESYANAGVVAEQAIAQVRTVYSFVGESKALNSYSEAIQNTLKL  277

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITE  742
               K  +  G+  G +  +  ++ A+  WY  + ++  QS    A  +  IFS  V  ++ 
Sbjct  278   GYKAGMAKGLGIGCTYGIACMSWALVFWYAGVFIRNGQSDGGKAFTA--IFSAIVGGMS-  334

Query  743   LWTLIPTVLSAIGIL---KPVFQTLDRCTRIEP----DKPEESLSESIEGEVEFKTIKFH  901
                 +    S +G     K     L    R +P    D  +  L   + G +EFK + F 
Sbjct  335   ----LGQAFSNLGAFSKGKIAGYKLLEVIRQKPSIVHDHKDGKLLAEVHGNIEFKDVTFS  390

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+ M+   F+L   AG  VA+VG SG+GKS+V+AL+ RFYD +EG+VL+D  D++ 
Sbjct  391   YPSRPDAMIFRDFSLFFPAGKTVAVVGGSGSGKSTVVALIERFYDPNEGQVLLDNVDIKT  450

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + A+N H+FIS LP GY
Sbjct  451   LQLRWLRDQIGLVNQEPALFATTIIENILYGKPDATIAEVEAAATASNAHSFISLLPNGY  510

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T+VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+ SE  V  AL+ L    
Sbjct  511   NTMVGERGIQLSGGQKQRIAIARAMLKDPKILLLDEATSALDADSENIVQEALDRLM---  567

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSL  1618
               GR      T + VAHRL T+ N ++I V+ +G VVE G+H  L ++   G Y+ L+  
Sbjct  568   -VGR------TTVIVAHRLCTIRNVNMIAVLQQGQVVETGTHDELLAKGSSGAYASLIRF  620

Query  1619  Q  1621
             Q
Sbjct  621   Q  621



>gb|AIU41628.1| ABC transporter family protein [Hevea brasiliensis]
Length=1363

 Score =   421 bits (1081),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 242/550 (44%), Positives = 333/550 (61%), Gaps = 23/550 (4%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             R++G Y  +   +   +   NTLQH+ + +VGE     +R  + SA L+NE+AWF++ EN
Sbjct  810   REIGKYCYLLIGLSSAALIFNTLQHFFWDIVGENLTKRVREKMLSAVLKNEMAWFDQEEN  869

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
                 + +R+  + + V+  I DR+SVIVQ  + +++A T   ++ WR+ LV  +V P   
Sbjct  870   ESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFVLQWRLALVLISVFPLVV  929

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
                ++Q     GFSGD  AAH++   LA E+ AN++TV +F  E  +V      LQ  L 
Sbjct  930   AATVLQKMFMTGFSGDLEAAHAKATQLAGEAIANVRTVAAFNSESQIVGLFDTNLQIPLR  989

Query  560   R----SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
             R     +     FGI Q     L+  ++A+ LWY + LV+   S F   IR + +  ++ 
Sbjct  990   RCFWKGQIAGSGFGIAQ---FSLY-ASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSA  1045

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEES-LSESIEGEVEFKTIKFHY  904
                 E  TL P  +     ++ VF  LDR T IEPD P+ + + + + GEVE K + F Y
Sbjct  1046  NGAAETLTLAPDFIKGGRAMRSVFDLLDRKTEIEPDDPDATAVPDRLRGEVELKHVDFSY  1105

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RP+V +    NLR  AG  +ALVGPSG GKSSVIAL+ RFY+   G+V+IDGKD+R Y
Sbjct  1106  PTRPDVPIFRDLNLRARAGKTLALVGPSGCGKSSVIALIQRFYEPSSGRVMIDGKDIRKY  1165

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR  I +V QEP LF  +I ENI YG E A+EAEIIE +  AN H FIS LP+GY 
Sbjct  1166  NLKSLRKHIAMVPQEPCLFAATIYENIAYGHESATEAEIIEAATLANAHKFISGLPDGYK  1225

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARAL++R  +MLLDEATSALD+ SER+V  AL+       
Sbjct  1226  TFVGERGVQLSGGQKQRIAIARALVRRAELMLLDEATSALDAESERSVQEALD-------  1278

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHS-TLTSQPDGVYSRLVSLQ  1621
               R+   K T I VAHRLST+ N+ +I V+D G V E GSHS  L + PDG Y+R++ LQ
Sbjct  1279  --RACSGKTT-IVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYPDGCYARMIQLQ  1335

Query  1622  SMKDH*HTQL  1651
                   H+Q+
Sbjct  1336  RFT---HSQV  1342


 Score =   305 bits (780),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 190/536 (35%), Positives = 296/536 (55%), Gaps = 20/536 (4%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y+  F  +G   W ++  +   +   GE+  T +R     A L  ++ +F+  E     +
Sbjct  162   YAFYFLIVGAAIWASSWAEISCWMWTGERQTTRMRIKYLEAALNQDIQYFD-TEVRTSDV  220

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
                I  +   V+  IS+++   +  +++ V    V     W++ LV  AV+P   +   I
Sbjct  221   VFAINTDAVMVQDAISEKLGNFLHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAVIAAI  280

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKE  574
                +    SG +  A S+  ++  ++   I+ V++F  E   +     AL+       K 
Sbjct  281   HTNTLAKLSGKSQEALSQAGNIVEQTIVQIRVVLAFVGESRALQGYSSALKVAQRVGYKS  340

Query  575   SIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL  754
                 G+  G +  +    +A+ LWY   LV+ H ++   AI +  +F++ +  +  L   
Sbjct  341   GFAKGMGLGATYFVVFCCYALLLWYGGYLVRHHYTNGGLAIAT--MFAVMIGGLA-LGQS  397

Query  755   IPTVLSAIGILK----PVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEV  922
              P+ + A    K     +F+ +D    ++ +       +S+ G VE K + F YPSRP+V
Sbjct  398   APS-MGAFAKAKVAATKIFRIIDHKPAVDRNSESGLELDSVTGLVELKNVDFSYPSRPDV  456

Query  923   MVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLR  1102
              +LN F L + AG  +ALVG SG+GKS+V++L+ RFYD + G+VL+DG D++   LR LR
Sbjct  457   RILNNFTLNVSAGKTIALVGSSGSGKSTVVSLIERFYDPNSGQVLLDGHDIKTLKLRWLR  516

Query  1103  AQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEK  1282
              QIGLV QEP LF  +I+ENI  G   A + EI E ++ AN H+FI  LPEG+DT VGE+
Sbjct  517   QQIGLVSQEPALFATTIKENILLGRPDADQIEIEEAARVANAHSFIVKLPEGFDTQVGER  576

Query  1283  GSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSP  1462
             G QLSGGQKQRIAIARA+LK PAI+LLDEATSALDS SE+ V  AL+        GR   
Sbjct  577   GLQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFM----IGR---  629

Query  1463  SKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
                T + +AHRLST+  +D++ V+ +G V E+G+H  L ++  +GVY++L+ +Q M
Sbjct  630   ---TTLVIAHRLSTIRKADLVAVLQQGSVTEIGTHDELIAKGENGVYAKLIRMQEM  682



>ref|XP_009396844.1| PREDICTED: ABC transporter B family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=1241

 Score =   418 bits (1075),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 218/535 (41%), Positives = 341/535 (64%), Gaps = 12/535 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +R+V   +++F    +L+ F + ++H  +G++GE+    +R  ++   L+NE+ WF+   
Sbjct  716   QREVKKIALLFCGGAVLTVFFHVIEHLNFGIMGERLTLRVRERMFGVILRNEIGWFDDMS  775

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             N    LTSR+  + + ++ I+ DR ++++Q I  IV +  ++ I++WR+ LV  A  P  
Sbjct  776   NTSAMLTSRLETDATLLRTIVVDRSTILLQNIGMIVTSLIIAFILNWRITLVVLATYPLM  835

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
               G + +    +G+ G+ +  + +   LA+E+ +NI+TV +FC E+ V++     L+   
Sbjct  836   VSGHISEKLFMRGYGGNLSKTYLKANMLAAEAVSNIRTVAAFCSEQKVIDLYVEELREPS  895

Query  557   HRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSI  736
              RS +     GI  G S C    ++ +ALWY ++L+ +  +SF + ++S+ +  +T  ++
Sbjct  896   RRSFRRGQTAGIFYGVSQCFLFSSYGLALWYGSVLMGKGLASFKSVMKSFMVLIVTALAM  955

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              E   L P ++    +   VF+ LDR T + P+  E+     +EG +E + ++F YPSRP
Sbjct  956   GETLALAPDIIKGNQMAASVFEVLDRRTEVPPEVGEDV--GRVEGAIEMRGVEFCYPSRP  1013

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V++  GF+LR+ AG  +ALVG SG+GKS+V++L+LRFYD   GKV+IDGKD+R   L++
Sbjct  1014  DVLIFRGFDLRVTAGKSMALVGMSGSGKSTVLSLILRFYDATAGKVMIDGKDIRRLRLKE  1073

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR  IG+VQQEP+LF  +I +NI YG + A+EAE++E +K AN H+FIS LPEGY T  G
Sbjct  1074  LRKHIGMVQQEPVLFATTIYDNIVYGKDGATEAEVVEAAKLANAHSFISALPEGYSTKAG  1133

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA++K PAI+LLDEATSALD  SER V  ALE + ++      
Sbjct  1134  ERGIQLSGGQKQRIAIARAIIKNPAILLLDEATSALDVESERVVQHALERVMRNR-----  1188

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                  T + VAHRLST+ N+D+I V+  G +VE GSHSTL    +G Y +L+SLQ
Sbjct  1189  -----TTVMVAHRLSTIHNADVISVLQDGRIVEQGSHSTLVENRNGAYFKLISLQ  1238


 Score =   306 bits (783),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 195/553 (35%), Positives = 305/553 (55%), Gaps = 11/553 (2%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             + +    +V  YS+ F  +G+   F++  +   +   GE+    +R +   + L  ++A 
Sbjct  74    FPTTVSHRVAKYSLDFVYLGIAILFSSWTEVACWMHTGERQAAKMRLAYLRSMLDQDIAV  133

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  E + G + + I ++   V+  IS+++   +  IS  +    +     W++ LV  +
Sbjct  134   FD-TEASTGEVIAAITSDIIVVQDAISEKVGNFMHYISRFIAGFAIGFARVWQISLVTLS  192

Query  362   VMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVA  541
             ++P   I G I A  A G       ++ +   +A E   N++TV +F  EE  V   R A
Sbjct  193   IVPLIAIAGGIYAYVATGLIARVRKSYVKAGEIAEEVIGNVRTVQAFVGEEKAVRSYRSA  252

Query  542   LQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSL  721
             L       +K  +  G+  G+  C+  ++ A+ +W+T+++V +  ++   +  +     +
Sbjct  253   LMNTYEYGKKGGLAKGLGLGSMHCVLFLSWALLVWFTSIVVHKKIANGGESFTTMLNVVI  312

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
                S+ +    I T L A      +F+ ++R T              ++G ++F  I F 
Sbjct  313   AGLSLGQAAPNISTFLRARTAAYSIFEMIERNTVNRTSAKTGRKLAGVDGHIKFVNIHFS  372

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP+V++ NG NL I +G  VALVG SG+GKS+VI+L+ RFY+   G +L+DG D++D
Sbjct  373   YPSRPDVLIFNGLNLDIPSGKIVALVGGSGSGKSTVISLIERFYEPQRGHILLDGHDIKD  432

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
              +L+ LR QIGLV QEP LF  SIRENI YG + A+  EI + +K +    FI +LP+ Y
Sbjct  433   LDLKWLRQQIGLVNQEPALFATSIRENILYGKDDATIDEIAQSAKLSEAINFIKHLPDRY  492

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
             +T VGE+G QLSGGQKQRIAI+RA+LK P+I+LLDEATSALD+ SE++V  AL+ +    
Sbjct  493   ETQVGERGVQLSGGQKQRIAISRAILKNPSILLLDEATSALDAESEKSVQEALDRVM---  549

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
               GR      T + VAHRLST+ N+DII V+  G +VE G+H  L S P   Y+ LV LQ
Sbjct  550   -IGR------TTVVVAHRLSTIRNADIIAVVQGGRIVETGTHDQLMSHPTSAYASLVKLQ  602

Query  1622  SMKDH*HTQLHEG  1660
                 H      EG
Sbjct  603   ETAHHQRPSPAEG  615



>ref|XP_011083466.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
13-like [Sesamum indicum]
Length=1247

 Score =   418 bits (1074),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 227/543 (42%), Positives = 334/543 (62%), Gaps = 18/543 (3%)
 Frame = +2

Query  5     DSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWF  184
             DS  K++V   S IF    +++     LQHY Y ++GE+ +  +R  ++ A L NE+AWF
Sbjct  709   DSRIKQEVRQMSFIFIGAAMVTVLVYLLQHYFYTLMGERLIARVRLLMFKAMLSNEVAWF  768

Query  185   ERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAV  364
             ++ EN+ GSL S++  + + V+  ++DR+S ++Q I+  V A  ++ ++ WR+     A 
Sbjct  769   DKDENSTGSLASKLATDATLVRSALADRISTVIQNIALAVTAFVIAFVLSWRIAAGVVAT  828

Query  365   MPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVAL  544
              P      + +    KGF GD   A+     +A E+ ANI+TV +F  EE V  K     
Sbjct  829   FPLLIGANIAEQLFLKGFGGDYVTAYYRATEVAREAIANIRTVAAFGAEERVTAK----F  884

Query  545   QPQLHRSRKESIKFGII----QGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQI  712
               +L++ RK ++  G I     G SL     ++A+ LWY ++L++  +S F + ++S+ +
Sbjct  885   ASELYKPRKRALLRGNILGFGYGISLFFAYSSYAIGLWYASVLIRNKKSEFGDVMKSFMV  944

Query  713   FSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTI  892
               +T  ++ E   L P ++    +L  VF  L R + I+P+ P  ++   + G+VEFK +
Sbjct  945   LIITALAVAETLALAPNLVKGSQVLGSVFDILQRKSAIDPNSPSSTMVTDVGGDVEFKNV  1004

Query  893   KFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKD  1072
              F YP+RP++ + NG NL+I  G  +A+VG S +GKS+VI+LLLRFYD   G +LIDG D
Sbjct  1005  SFKYPTRPDITIFNGLNLKISKGKSMAIVGQSDSGKSTVISLLLRFYDPTSGTILIDGLD  1064

Query  1073  VRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLP  1252
             ++  NL+ LR +IGLVQQEP+LF  +I ENI YG+  ASE EII  +KAA+ H FIS +P
Sbjct  1065  IKTVNLKSLRLRIGLVQQEPVLFSTTIYENIKYGNSNASEIEIINAAKAASAHGFISRMP  1124

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
             EG+ T VGEKG QLSGGQKQR+AIARA+LK P+I+LLDEATSALD+ SE  V  AL  L 
Sbjct  1125  EGFHTQVGEKGVQLSGGQKQRVAIARAILKDPSILLLDEATSALDTKSEMQVQEALNRLM  1184

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLV  1612
             Q    GR      T + +AHRLSTV ++D I V+  G  VE GSH  L ++P  +Y +LV
Sbjct  1185  Q----GR------TTVLIAHRLSTVQDADAITVLQNGRAVESGSHEELINKPGSIYFQLV  1234

Query  1613  SLQ  1621
              LQ
Sbjct  1235  HLQ  1237


 Score =   274 bits (700),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 184/540 (34%), Positives = 284/540 (53%), Gaps = 36/540 (7%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++    +GL+ W +       +   GE+    LR     + L+  + +F+  E  
Sbjct  92    EVSKYALYLVYLGLVVWLSAWTGVACWTQTGERQTALLRQKYLESVLKKNIQFFD-TEAG  150

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
               ++   I ++   V+  I D++   +  +S  VI  ++   + W++ L+  A++P   +
Sbjct  151   QHNILFHISSDAILVQDAIGDKICHAICYLSQFVIGFSLGFSMVWQLTLLTLAIVPLIAV  210

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G          S     A++E   L  E  + ++TV SF  EE  +     +L+  L  
Sbjct  211   AGGAYTIIMSTLSKRGENAYAEAGKLTEEVISQVRTVYSFVGEEKAIETYSRSLENALKL  270

Query  563   SRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQS-------SFLNAIRSYQIFSL  721
             ++K  I  GI  G +  L   A A+ LWY ++LV+   S       + +N + S      
Sbjct  271   AKKTGIAKGIGIGFTYGLLFCAWALLLWYASILVRHGHSNGGKAFTTIINVVYSGFALGQ  330

Query  722   TVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFH  901
               P++  +      V S I +++      D   R      E  + + ++G+++F  + F 
Sbjct  331   AAPNLAAIAKGRAAVASIISMIE------DDANRPSKGSHEGIVLQRVDGKIDFVDVCFA  384

Query  902   YPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRD  1081
             YPSRP  MV    +  + AG  +A+VGPSG+GKS++I++L RFYD   GK+L+DG D+ +
Sbjct  385   YPSRP-TMVFEDLSFSVFAGKSLAIVGPSGSGKSTIISMLQRFYDPTSGKILLDGHDLTN  443

Query  1082  YNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGY  1261
               L+ LR+Q+GLV QEP LF  SI +NI +G E A   +IIE +KA+N H+FI  LP+GY
Sbjct  444   LQLKWLRSQMGLVSQEPALFATSIADNIFFGKEGADMDQIIEAAKASNAHSFIQGLPDGY  503

Query  1262  DTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHH  1441
              T VGE G+QLSGGQKQRIAIARA+L+ P I+LLDEATSALD+                 
Sbjct  504   HTQVGEGGTQLSGGQKQRIAIARAILRDPKILLLDEATSALDA-----------------  546

Query  1442  KFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                       T I VAHRLST+ + D+I+V+  G VVE G+H  L S+  G Y+ LV+LQ
Sbjct  547   ---EXXXXXRTTIVVAHRLSTIRDVDMIIVLKNGRVVETGTHMELMSKA-GEYASLVNLQ  602



>emb|CDP06775.1| unnamed protein product [Coffea canephora]
Length=1246

 Score =   418 bits (1074),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 236/536 (44%), Positives = 325/536 (61%), Gaps = 12/536 (2%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             R++  Y  +   +   +   NTLQH+ + VVGE     +R  + +A L+NE+AWF++ EN
Sbjct  694   REIAKYCYLLIGLSSAALIFNTLQHFFWDVVGENLTKRVREKMLAAVLKNEMAWFDQEEN  753

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
                 + +R+  + + V+  I DR+SVI+Q  + +++A T   ++ WR+ LV  AV P   
Sbjct  754   ESSRVAARLALDANNVRSAIGDRISVIMQNSALMLVACTAGFVLQWRLALVLIAVFPVVV  813

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
                ++Q    KGFSGD  AAH++   LA E+ AN++TV +F  E  +V+     L+  L 
Sbjct  814   AATVLQKMFMKGFSGDLEAAHAKGTQLAGEAVANLRTVAAFNSELKIVSLFTSNLETPLK  873

Query  560   RSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSIT  739
             R   +    G   G +      ++A+ LWY + LV+   S F   IR + +  ++     
Sbjct  874   RCFWKGQIAGSGYGIAQFSLYASYALGLWYASWLVKHGISDFSKTIRVFMVLMVSANGAA  933

Query  740   ELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESL-SESIEGEVEFKTIKFHYPSRP  916
             E  TL P  +     ++ VF  LDR T IEPD PE +L  + + GEVEFK + F YPSRP
Sbjct  934   ETLTLAPDFIKGGRAMRSVFDLLDRKTEIEPDDPEATLVPDRLRGEVEFKHVDFSYPSRP  993

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             ++ +   FNLR  AG  +ALVGPSG GKSSVIAL  RFY+   G+++IDGKD+R YNL+ 
Sbjct  994   DIAIFRDFNLRARAGKTLALVGPSGCGKSSVIALTERFYEPSSGRIMIDGKDIRKYNLKS  1053

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
              R  I LV QEP LF  +I ENI YG E A+EAEI E +  AN H FI++LP+GY T VG
Sbjct  1054  FRRHIALVPQEPCLFATTIYENIAYGHESATEAEITEAATLANAHKFIASLPDGYKTFVG  1113

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA L++  IMLLDEATSALD+ SER V  ALE +         
Sbjct  1114  ERGVQLSGGQKQRIAIARAFLRKADIMLLDEATSALDAESERCVQEALERV---------  1164

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHS-TLTSQPDGVYSRLVSLQ  1621
               S  T I VAHRLST+ N+ +I V+D G V E GSHS  L + P+G+Y+R++ LQ
Sbjct  1165  -CSGKTTIVVAHRLSTIRNAHVIAVVDDGKVAEQGSHSHLLKNYPEGIYARMIHLQ  1219


 Score =   311 bits (798),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 198/548 (36%), Positives = 304/548 (55%), Gaps = 25/548 (5%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             Y+  F  +G   W ++  +   +   GE+  T +R     A L  ++ +F+  E     +
Sbjct  46    YAFYFLVVGAAIWASSWAEISCWMWTGERQSTKMRIKYLEAALNQDIQFFD-TEVRTSDV  104

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
                I  +   ++  IS+++   +  +++ V    V     W++ LV  AV+P   I G I
Sbjct  105   VYAINTDAVMIQDAISEKLGNFIHYMATFVSGFVVGFTAVWQLALVTLAVVPLIAIIGGI  164

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKE  574
                +    S  +  A S+  ++A ++   I+TV+++  E   +     AL+       K 
Sbjct  165   HTTTLAKLSAKSQEALSQAGNIAEQTIVQIRTVLAYVGESRALQAYSAALRISQRLGYKS  224

Query  575   SIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSITELWTL  754
                 G+  G +       +A+ LWY   LV+ H ++   AI +  +F++ +  +  L   
Sbjct  225   GFAKGMGLGATYFTVFCCYALLLWYGGYLVRHHFTNGGLAIAT--MFAVMIGGLA-LGQS  281

Query  755   IPTVLSAIGILK---PVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRPEVM  925
              P++ +          +F+ +D+   ++ +       ES+ G+VE K + F YPSRP+V 
Sbjct  282   APSMAAFAKARVAAAKIFRIIDQKPSVDRNNDRGLELESVTGQVELKNVDFCYPSRPDVQ  341

Query  926   VLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRKLRA  1105
             +LNGF+L + AG  +ALVG SG+GKS+V++L+ RFYD + G+VL+DG D++   LR LR 
Sbjct  342   ILNGFSLTVPAGKTIALVGSSGSGKSTVVSLIERFYDPNSGQVLLDGHDIKTLKLRWLRQ  401

Query  1106  QIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVGEKG  1285
             QIGLV QEP LF  SI+ENI  G   AS  EI E ++ AN H+FI  LP+GYDT VGE+G
Sbjct  402   QIGLVSQEPALFATSIKENILLGRPEASVVEIEEAARVANAHSFIVKLPDGYDTQVGERG  461

Query  1286  SQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRSSPS  1465
              QLSGGQKQRIAIARA+LK PAI+LLDEATSALDS SE+ V  AL+        GR    
Sbjct  462   LQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSESEKLVQEALDRFM----IGR----  513

Query  1466  KMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSMKDH*H  1642
               T + +AHRLST+  +D++VV+ +G V E+G+H  L S+  +GVY++L+ +Q       
Sbjct  514   --TTLVIAHRLSTIRKADLVVVLQQGSVSEIGTHDELISKGENGVYAKLIRMQEAA----  567

Query  1643  TQLHEGAI  1666
                HE AI
Sbjct  568   ---HEAAI  572



>ref|XP_011085762.1| PREDICTED: ABC transporter B family member 19-like [Sesamum indicum]
Length=1250

 Score =   418 bits (1074),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 248/535 (46%), Positives = 338/535 (63%), Gaps = 10/535 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  722   ERKTKEYVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  781

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   L +R+  + + VK  I++R+SVI+Q ++S++ +  V+ IV+WR+ L+  A  P  
Sbjct  782   NNSSLLAARLATDAADVKSAIAERISVILQNMTSLLTSFIVAFIVEWRVSLLILATFPLL  841

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQL  556
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +E +++     L    
Sbjct  842   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQEKILSLFAHELHIPQ  901

Query  557   HRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPSI  736
              RS + S+  G++ G S      + A+ LWY   LV    S+F   I+ + +  +T  S+
Sbjct  902   RRSLRRSLCSGLLFGLSQLALYGSEALILWYGAHLVSIGASTFSKVIKVFVVLVVTANSV  961

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
              E  +L P ++     +  VF  LDR TRI+PD PE    ESI GE+E + + F YPSRP
Sbjct  962   AETVSLAPEIVRGGEAVGSVFSILDRPTRIDPDDPEAEHVESIRGEIELRHVDFAYPSRP  1021

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +V V   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  NL+ 
Sbjct  1022  DVPVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPIIGKVMIDGKDIRRLNLKS  1081

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR +IGLVQQEP LF  SI +NI YG E A+EAE++E ++AAN+HTF+S LP+GY T VG
Sbjct  1082  LRLKIGLVQQEPALFASSIFDNIAYGKEGATEAEVVEAARAANVHTFVSGLPDGYKTPVG  1141

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P+I+LLDEATSALD+ SE  +  ALE L +    GR 
Sbjct  1142  ERGVQLSGGQKQRIAIARAILKDPSILLLDEATSALDAESECVLQEALERLMR----GR-  1196

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                  T I VAHRLST+   D I V+  G +VE GSH  L S+PDG YSRL+ LQ
Sbjct  1197  -----TTIVVAHRLSTIRGVDSIGVVQDGRIVEQGSHGDLISRPDGAYSRLLQLQ  1246


 Score =   281 bits (720),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 191/545 (35%), Positives = 302/545 (55%), Gaps = 32/545 (6%)
 Frame = +2

Query  23    KVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENN  202
             +V  Y++ F  +GL+   ++  +   +   GE+ +  LR     A L+ ++ +F+  +  
Sbjct  80    EVAKYALYFVYLGLVVCLSSYAEIACWMYTGERQVGALRRKYLEAVLKQDVGFFD-TDAR  138

Query  203   VGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFI  382
              G +   +  +T  V+  IS+++   +  +S+ +    V  +  W++ L++ AV+P    
Sbjct  139   TGDIVFSVSTDTLLVQDAISEKVGNFIHYLSTFLAGLVVGFVSAWKLALLSVAVIPGIAF  198

Query  383   GGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHR  562
              G + A +  G +  +  +++    +A +S A ++TV S+  E     KA  A    +  
Sbjct  199   AGGLYAYTLTGLTSKSRESYASAGIIAEQSIAQVRTVYSYVGE----TKALSAYSDLIQN  254

Query  563   SRKESIKFGIIQGTSL-CLWNIAH---AVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV-  727
             + K   K G+ +G  L C + IA    A+  WY  + ++  Q+    A  +  IFS  V 
Sbjct  255   TLKLGYKAGMAKGLGLGCTYGIACMSWALVFWYAGVFIRNGQTDGGKAFTA--IFSAIVG  312

Query  728   -----PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTI  892
                   S + L        +   +++ + Q   + T ++     + LSE + G +EFK +
Sbjct  313   GMSLGQSFSNLGAFSKGKAAGYKLIEIIKQ---KPTIVQDASDGKCLSE-VNGNIEFKNV  368

Query  893   KFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKD  1072
              F YPSRP++++   F++   AG  +A+VG SG+GKS+V++L+ RFYD ++G++L+D  D
Sbjct  369   TFSYPSRPDIVIFRDFSIFFPAGKTIAVVGGSGSGKSTVVSLIERFYDPNQGEILLDNVD  428

Query  1073  VRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLP  1252
             ++   L  LR QIGLV QEP LF  +I ENI YG   A+ AE+   + AAN H+FI+ LP
Sbjct  429   IKTLQLNWLRNQIGLVNQEPALFATTILENILYGKPDATMAEVEAAANAANAHSFITLLP  488

Query  1253  EGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQ  1432
              GY+T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ L 
Sbjct  489   NGYNTQVGERGVQLSGGQKQRIAIARAMLKDPKILLLDEATSALDAGSESIVQEALDRLM  548

Query  1433  QHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLV  1612
                  GR      T + VAHRLST+ N D I V+ +G VVE G+H  L ++  G Y+ L+
Sbjct  549   ----VGR------TTVVVAHRLSTIRNVDSIAVLQQGQVVETGTHEELIAKA-GAYASLI  597

Query  1613  SLQSM  1627
               Q M
Sbjct  598   RFQEM  602



>gb|EMT32511.1| ABC transporter B family member 19 [Aegilops tauschii]
Length=1274

 Score =   418 bits (1075),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 232/536 (43%), Positives = 334/536 (62%), Gaps = 12/536 (2%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   Y  I+   G  +     +QHY + ++GE   T +R  + +  L+N++ WF+  E
Sbjct  746   ERKTREYVFIYIGTGFYAVVAYLIQHYFFSIMGENLTTRVRRMMLAVILRNDVGWFDEEE  805

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             NN   + +R+  E + VK  I++R+SVI+Q ++S++++  V  I++WR+ ++     P  
Sbjct  806   NNSSLVAARLNTEAADVKSAIAERISVILQNMTSLLVSFIVGFIIEWRVAILILVTFPLL  865

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQ-PQ  553
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  ++ +++     L+ PQ
Sbjct  866   VLANFAQQLSMKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQDKILSLFCSELRVPQ  925

Query  554   LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTVPS  733
             +H  R+  +  G++ G S      + A+ LWY   LV+   S+F   I+ + +  +T  S
Sbjct  926   MHSLRRSQVS-GVLYGLSQLSLYASEALILWYGAHLVRHPVSTFSRVIKVFVVLVITANS  984

Query  734   ITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSR  913
             + E  +L P ++     ++  F  L+  TRI+PD PE    E + GE+E + + F YPSR
Sbjct  985   VAETVSLAPEIIRGGEAVRSGFAVLNSRTRIDPDGPEAEQVEKVRGEIELRHVDFSYPSR  1044

Query  914   PEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLR  1093
             P+VMV   F+LRI AG   ALVG SG+GKS+VIAL+ RFYD   GKV+IDGKD+R  NL+
Sbjct  1045  PDVMVFKEFSLRIRAGQSQALVGASGSGKSTVIALIERFYDPMAGKVMIDGKDIRRLNLK  1104

Query  1094  KLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVV  1273
              LR +IGLVQQEP+LF  SI ENI YG +  +E E++E +K AN+H F+S LP+GY T V
Sbjct  1105  SLRLKIGLVQQEPVLFATSILENIAYGKDGVTEEEVVEAAKVANVHGFVSALPDGYRTPV  1164

Query  1274  GEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGR  1453
             GE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  AL  + +    GR
Sbjct  1165  GERGVQLSGGQKQRIAIARAVLKDPAILLLDEATSALDAESECVLQEALGRIMK----GR  1220

Query  1454  SSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
                   T + VAHRLST+   D I V+  G VVE GSH  L S+PDG YSRL+ LQ
Sbjct  1221  ------TTVLVAHRLSTIRCVDSIAVVQDGRVVEQGSHGDLVSRPDGAYSRLLQLQ  1270


 Score =   289 bits (740),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 189/538 (35%), Positives = 299/538 (56%), Gaps = 24/538 (4%)
 Frame = +2

Query  35    YSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPENNVGSL  214
             YS+ F  +GL+   ++ L+   +   GE+ +  LR     A L+ ++ +F+  +   G +
Sbjct  106   YSLYFVYLGLVVCASSYLEIACWMYTGERQVGALRRRYLEAVLRQDVGFFD-TDARTGDV  164

Query  215   TSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHFIGGLI  394
                +  +T  V+  I +++   +  +++ +    V  +  WR+ L++ AV+P     G +
Sbjct  165   VFSVSTDTLLVQDAIGEKVGNFIHYLATFLAGLVVGFVSAWRLALLSIAVIPGIAFAGGL  224

Query  395   QAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLHRSRKE  574
              A +  G +  +  +++    +A ++ A ++TV S+  E   +N    A+Q  L    K 
Sbjct  225   YAYTLTGLTSKSRDSYANAGIIAEQAIAQVRTVYSYVGESKALNSYSEAIQSTLKLGYKA  284

Query  575   SIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV------PSI  736
              +  G+  G +  +  ++ A+  WY  + ++  Q+    A  +  IFS  V       S 
Sbjct  285   GMAKGLGIGCTYGIACMSWALVFWYAGVFIRSGQTDGGKAFTA--IFSAIVGGLSLGQSF  342

Query  737   TELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHYPSRP  916
             + L       ++   +L+ + Q   R T ++       L E + G +EFK + F YPSRP
Sbjct  343   SNLGAFSKGKIAGYKLLEVIRQ---RPTIVQDSTDGRCLDE-VHGNIEFKEVSFSYPSRP  398

Query  917   EVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDYNLRK  1096
             +VMV   F+L   AG   A+VG SG+GKS+V++L+ RFYD ++G+VL+D  D++   L+ 
Sbjct  399   DVMVFRDFSLFFPAGKTAAVVGGSGSGKSTVVSLIERFYDPNQGQVLLDNADIKSLQLKW  458

Query  1097  LRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYDTVVG  1276
             LR QIGLV QEP LF  +I +NI YG   A+ AE+   + AAN H+FI+ LP GY+T VG
Sbjct  459   LRDQIGLVNQEPALFATTIIDNILYGKPDATMAEVEAAASAANAHSFIALLPNGYNTQVG  518

Query  1277  EKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHKFGRS  1456
             E+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GSE  V  AL+ +      GR 
Sbjct  519   ERGLQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGSESIVQEALDRIM----IGR-  573

Query  1457  SPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQ-PDGVYSRLVSLQSM  1627
                  T + VAHRLST+ + D+I V+ +G VVE G+H  L ++   G Y+ L+  Q M
Sbjct  574   -----TTVVVAHRLSTIRSVDMIAVIQQGQVVETGTHDELLAKGSSGAYAALIRFQEM  626



>gb|KDO72552.1| hypothetical protein CISIN_1g000856mg [Citrus sinensis]
Length=987

 Score =   412 bits (1058),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 338/539 (63%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             +RK   +  I+   GL +     +QHY + ++GE   T +R  + +A L+NE+ WF+  E
Sbjct  459   ERKTKEFVFIYIGAGLYAVVAYLIQHYFFSIMGENLTTRVRRMMLAAILRNEVGWFDEEE  518

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             +N   + +R+  + + VK  I+DR+SVI+Q ++S++ +  V+ IV+WR+ L+     P  
Sbjct  519   HNSSLVAARLATDAADVKSAIADRISVILQNMTSLLTSFIVAFIVEWRVSLLILGTYPLL  578

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVV----NKARVAL  544
              +    Q  S KGF+GDT  AH++   +A E  +NI+TV +F  +  ++    ++ RV  
Sbjct  579   VLANFAQQLSLKGFAGDTAKAHAKTSMIAGEGVSNIRTVAAFNAQNKILSLFCHELRVPQ  638

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
                L RS    I FGI Q       + + A+ LWY   LV +  S+F   I+ + +  +T
Sbjct  639   SQTLRRSLTAGILFGISQ----FALHASEALILWYGVHLVGKGVSTFSKVIKVFVVLVVT  694

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
               S+ E  +L P ++     +  VF TLDR TRI+PD P+    E+I GE+E + + F Y
Sbjct  695   ANSVAETVSLAPEIIRGGESVGSVFSTLDRSTRIDPDDPDAEPVETIRGEIELRHVDFAY  754

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             PSRP+V+V   FNLRI AG   ALVG SG+GKSSVIAL+ RFYD   GKV+IDGKD+R  
Sbjct  755   PSRPDVVVFKDFNLRIRAGQSQALVGASGSGKSSVIALIERFYDPTAGKVMIDGKDIRRL  814

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NL+ LR +IGLVQQEP LF  SI +NI YG E A+EAE++E ++AAN+H F+S LP  Y 
Sbjct  815   NLKSLRLKIGLVQQEPALFAASIFDNIAYGKEGATEAEVVEAARAANVHGFVSALPNAYK  874

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G QLSGGQKQRIAIARA+LK PAI+LLDEATSALD+ SE  +  ALE L +   
Sbjct  875   TPVGERGVQLSGGQKQRIAIARAVLKNPAILLLDEATSALDAESECVLQEALERLMR---  931

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T + VAHRLST+   D I V+  G +VE GSHS L S+PDG YSRL+ LQ
Sbjct  932   -GR------TTVLVAHRLSTIRGVDCIGVVQDGRIVEQGSHSELVSRPDGAYSRLLQLQ  983


 Score =   244 bits (624),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 173/257 (67%), Gaps = 11/257 (4%)
 Frame = +2

Query  857   ESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYD  1036
             + + G +EFK + F YPSRP+V++   F++   AG  VA+VG SG+GKS+V++L+ RFYD
Sbjct  94    DEVNGNIEFKNVTFSYPSRPDVIIFRDFSIFFPAGKTVAVVGGSGSGKSTVVSLIERFYD  153

Query  1037  VDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSK  1216
              + G VL+D  D++   LR LR QIGLV QEP LF  +I ENI YG   A+ AE+   + 
Sbjct  154   PNAGHVLLDNVDIKTLQLRWLRDQIGLVNQEPALFATTILENILYGKPEATMAEVEAAAS  213

Query  1217  AANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGS  1396
             AAN H+FI+ LP GY T VGE+G QLSGGQKQRIAIARA+LK P I+LLDEATSALD+GS
Sbjct  214   AANAHSFITLLPNGYSTQVGERGVQLSGGQKQRIAIARAMLKNPKILLLDEATSALDAGS  273

Query  1397  ERAVVSALESLQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTL  1576
             E  V  AL+ L      GR      T + VAHRLST+ N D + V+ +G VVE G+H  L
Sbjct  274   ESIVQEALDRLM----VGR------TTVVVAHRLSTIRNVDTVAVIQQGQVVETGTHEEL  323

Query  1577  TSQPDGVYSRLVSLQSM  1627
              ++  G Y+ L+  Q M
Sbjct  324   IAKA-GAYASLIRFQEM  339



>ref|XP_002981381.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
 gb|EFJ17569.1| hypothetical protein SELMODRAFT_114581 [Selaginella moellendorffii]
Length=1239

 Score =   417 bits (1072),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 234/539 (43%), Positives = 332/539 (62%), Gaps = 18/539 (3%)
 Frame = +2

Query  17    KRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPE  196
             K +V  YS+IF  IG+     ++L HY +GV GE     +R  +++A  + E++WF+R E
Sbjct  708   KSEVQKYSIIFVCIGVSVGMIHSLLHYSFGVTGESLTKRIRELMFTAVTRFEVSWFDRDE  767

Query  197   NNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCH  376
             N    + S++      V+  + DR+++I+Q  S +V A  ++ IV+WR+ LV  A +P  
Sbjct  768   NGSSQIASKLSTNAGFVRATMGDRVAIILQNSSLLVSAFLIAFIVEWRIALVVTASLPLL  827

Query  377   FIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHE----EHVVNKARVAL  544
                G+ +    KGF+G+   AH     L  E+ +NI+TV +F  E    E V ++  V  
Sbjct  828   VASGISEQMFLKGFAGNIEKAHERATKLTGEAVSNIRTVAAFNAEAKMVELVTDELEVPK  887

Query  545   QPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLT  724
             +    R +   I +G+    S  L+  +  + LWY  L+V+  ++SF NAI+++ +  +T
Sbjct  888   RSSFVRGQIAGIGYGV---GSFFLFA-SFGLGLWYAGLVVRDGKASFGNAIKAFLVLVIT  943

Query  725   VPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFKTIKFHY  904
                I E   L P ++     LK VF  LDR T I PD P     ++++GE+E +++ F+Y
Sbjct  944   SNGIGESLGLSPDIVKGGQALKSVFAILDRKTEINPDDPSAETVKNMKGEIELRSVDFYY  1003

Query  905   PSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVRDY  1084
             P+RPEV +    NL++  G  +A+VG SG+GKSSVI+L+ RFYD   GKVL+DGKD+R  
Sbjct  1004  PTRPEVTIFKNLNLKVHIGQSLAIVGASGSGKSSVISLVERFYDPVAGKVLVDGKDIRLL  1063

Query  1085  NLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEGYD  1264
             NLR  R  +GLVQQEP LF  SI+ENI YG E A+E+EIIE + AAN H FIS LP+GY 
Sbjct  1064  NLRSYRRFVGLVQQEPALFATSIQENIRYGKEDATESEIIEAATAANAHNFISALPDGYK  1123

Query  1265  TVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQHHK  1444
             T VGE+G+QLSGGQKQR+AIARA+LK P I+LLDEATSALD+ SE  V  AL+ L +   
Sbjct  1124  TSVGERGAQLSGGQKQRVAIARAVLKNPTILLLDEATSALDAESEHIVQEALDRLMK---  1180

Query  1445  FGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSRLVSLQ  1621
              GR      T I VAHRLST+ N+D I V+  G +VE GSH  L ++ DG YS L+ LQ
Sbjct  1181  -GR------TTIVVAHRLSTIRNADKIAVIQDGTIVEQGSHWELVAKADGAYSHLIKLQ  1232


 Score =   326 bits (836),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 203/544 (37%), Positives = 311/544 (57%), Gaps = 28/544 (5%)
 Frame = +2

Query  20    RKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAWFERPEN  199
             R+V  YS+ F  +G+   F +  +  L+   GE+ ++ +R     A L+ ++++F+  E 
Sbjct  66    RQVSQYSLYFVYLGIAILFASWAEVALWMQAGERQVSRMRIVYLEAMLKQDISYFDL-EA  124

Query  200   NVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWAVMPCHF  379
               G +   +     T++  I ++M   +  +S+ +    V     W++GLV  A++P   
Sbjct  125   RTGDIVDNLSGNMLTIQEAIGEKMGGFLHFVSTFIGGFVVGFATVWQLGLVTLAILPVIA  184

Query  380   IGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHVVNKARVALQPQLH  559
             + G    K+  G +     A +E  ++  E  A I+TV SF  E   +     AL+  L 
Sbjct  185   VVGGFYTKAITGIA-SKGQADTEPGNIVEEMTAQIRTVYSFVGETKALAAYTNALKKSLK  243

Query  560   RSRKESIK--FGI--IQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSYQIFSLTV  727
                K      FG+  + GT  C W    A+ LWY  +LV++  ++  + + +  IF++ +
Sbjct  244   LGYKSGAAKGFGVGGLYGTMFCAW----ALLLWYGGVLVRKGDATGGSVLST--IFAVLI  297

Query  728   PSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSES---IEGEVEFKTIKF  898
               I+ L    P++  A+   +   QT+ +    +P     S  E+   +EG V+ + + F
Sbjct  298   GGIS-LGQASPSI-GALAKARAATQTILKAINHKPTINTSSKGETLSIVEGRVDLQDVHF  355

Query  899   HYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDGKDVR  1078
              YPSRP++ V  GF+L I A   VA+VG SG+GKS+V++L+ RFYD   G++L+DG D+R
Sbjct  356   SYPSRPDIKVFEGFSLSIPAAKCVAIVGGSGSGKSTVVSLIERFYDPSSGRILVDGHDIR  415

Query  1079  DYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISNLPEG  1258
               +L+ LR+QIGLV QEP LF  +IR NI YG   A+  EI + +KAAN H+FIS LP+G
Sbjct  416   TLDLKWLRSQIGLVNQEPALFATTIRNNILYGKPSATREEIEDAAKAANAHSFISQLPDG  475

Query  1259  YDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALESLQQH  1438
             Y+T  GE+G QLSGGQKQRIAIARA+LK P+I+L DEATSALD+ SE  V  AL+ L   
Sbjct  476   YETQAGERGVQLSGGQKQRIAIARAILKNPSILLFDEATSALDAESEHVVQDALDKLMHG  535

Query  1439  HKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPD-GVYSRLVS  1615
             H          T + +AHRLSTV N+D I V+ +G +VE+G+H  L+S+ D G Y+ LV 
Sbjct  536   H----------TTVIIAHRLSTVQNADTIAVVQEGKIVELGTHDELSSRGDGGAYATLVH  585

Query  1616  LQSM  1627
             LQ+M
Sbjct  586   LQNM  589



>gb|KDO84909.1| hypothetical protein CISIN_1g000851mg [Citrus sinensis]
Length=1082

 Score =   414 bits (1063),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 232/549 (42%), Positives = 341/549 (62%), Gaps = 20/549 (4%)
 Frame = +2

Query  2     YDSDAKRKVGWYSVIFASIGLLSWFTNTLQHYLYGVVGEKAMTNLRNSLYSATLQNELAW  181
             +DS  KR V   ++IF  + +++     LQHY Y ++GE     +R S++SA L NE+ W
Sbjct  544   HDSQIKRVVDQVALIFVGLAVVTIPVYLLQHYFYTLMGEHLTARVRLSMFSAILSNEIGW  603

Query  182   FERPENNVGSLTSRIVNETSTVKIIISDRMsvivqcissiviATTVSMIVDWRMGLVAWA  361
             F+  ENN G L S +  + + V+  ++DR+S+IVQ ++  V A  ++ I+ WR+  V  A
Sbjct  604   FDLDENNTGLLISTLAADATLVRSALADRLSIIVQNVALTVTAFVIAFILSWRLAAVVAA  663

Query  362   VMPCHFIGGLIQAK-SAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEEHV-VNKAR  535
              +P   IG  +  +   KGF GD   A+S   S+A E+ ANI+TV ++  E+ + +  A 
Sbjct  664   SLPL-LIGAFVAEQLFLKGFGGDYNRAYSRATSVAREAIANIRTVAAYGIEKRISIQFAS  722

Query  536   VALQPQ---LHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQSSFLNAIRSY  706
                QP    L R       +G+ Q  SLC    ++A+ LWY ++L+++  S+F + ++S+
Sbjct  723   ELSQPNKQALLRGHISGFGYGVSQLLSLC----SYALGLWYASVLIKQKGSNFGDIMKSF  778

Query  707   QIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEESLSESIEGEVEFK  886
              +  +T  ++ E   L P ++     L PVF  L R T I+PD P       I+G +E +
Sbjct  779   MVLIITALAVAETLALAPDIVKGSQALGPVFGILYRKTAIQPDDPASKEVTEIKGNIELR  838

Query  887   TIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRFYDVDEGKVLIDG  1066
              + F YP RP++ +    NL++ AG  +A+VG SG+GKS+VI+L++RFYD   G VLIDG
Sbjct  839   NVSFKYPVRPDITIFENLNLKVSAGRSLAVVGQSGSGKSTVISLVMRFYDPISGTVLIDG  898

Query  1067  KDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEVSKAANIHTFISN  1246
              D+R  NLR LR +IGLVQQEP LF  +I ENI YG+E ASE E+++ +KAAN H FIS 
Sbjct  899   YDIRTLNLRSLRRKIGLVQQEPALFSTTIYENIKYGNEDASEIELMKATKAANAHGFISR  958

Query  1247  LPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDEATSALDSGSERAVVSALES  1426
             +PEGY + VG++G QLSGGQKQR+AIARA+LK P+I+LLDEATSALD+ SE  +  AL+ 
Sbjct  959   MPEGYQSHVGDRGVQLSGGQKQRVAIARAILKNPSILLLDEATSALDTASENLIQEALDK  1018

Query  1427  LQQHHKFGRSSPSKMTQITVAHRLSTVVNSDIIVVMDKGCVVEMGSHSTLTSQPDGVYSR  1606
             L +    GR      T I VAHRLST+ N+D I V+ +G V E+GSH  L  + +G+Y +
Sbjct  1019  LME----GR------TTIMVAHRLSTIRNADKIAVLQQGKVAEIGSHEQLLRKENGIYKQ  1068

Query  1607  LVSLQSMKD  1633
             L+ LQ  K+
Sbjct  1069  LIRLQQDKN  1077


 Score =   263 bits (671),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 173/438 (39%), Positives = 243/438 (55%), Gaps = 27/438 (6%)
 Frame = +2

Query  335   WRMGLVAWAVMPCHFIGGLIQAKSAKGFSGDTTaahsevvslasesaaNIKTVVSFCHEE  514
             W++ L+  AV+P   + G     +    S    AA+ E   +A E  + ++ V +F  E 
Sbjct  25    WQLTLLTLAVVPLIAVAGGAYTITMSTLSEKGEAAYGEAGKVAEEIISQVRAVYAFVGEA  84

Query  515   HVVNKARVALQPQLHRSRKESIKFGIIQGTSLCLWNIAHAVALWYTTLLVQRHQ------  676
               +     +L+  L + +K  +  GI  G +  L   A A+ LWY  +LV RH       
Sbjct  85    KAIESYSHSLKEALKQGKKSGVAKGIGVGLTYGLLFCAWALLLWYAGILV-RHGDTNGGK  143

Query  677   --SSFLNAIRSYQIFSLTVPSITELWTLIPTVLSAIGILKPVFQTLDRCTRIEPDKPEES  850
               ++ +N I S        P++  +        + I I+K    + +R     P     +
Sbjct  144   AFTTIINVIFSGFALGQAAPNLAAIAKGKAAAANIISIIKENSHSSER-----PGDDGIT  198

Query  851   LSESIEGEVEFKTIKFHYPSRPEVMVLNGFNLRIEAGMKVALVGPSGAGKSSVIALLLRF  1030
             L + + G++EF  + F YPSRP  MV    N  ++AG   A VGPSG+GKS++I+++ R 
Sbjct  199   LPK-LAGQIEFSEVCFAYPSRPH-MVFENLNFSVDAGKTFAFVGPSGSGKSTIISMVQRL  256

Query  1031  YDVDEGKVLIDGKDVRDYNLRKLRAQIGLVQQEPLLFCCSIRENICYGSERASEAEIIEV  1210
             Y+   GK+L+DG D++   L+ LR Q+GLV QEP LF  SI  NI  G E AS   +IE 
Sbjct  257   YEPTSGKILLDGHDLKSLQLKWLREQMGLVSQEPALFATSIANNILLGKEDASMDRVIEA  316

Query  1211  SKAANIHTFISNLPEGYDTVVGEKGSQLSGGQKQRIAIARALLKRPAIMLLDE