BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77848_g1_i1 len=877 path=[1:0-876]

Length=877
                                                                      Score     E

ref|XP_003634198.1|  PREDICTED: protein MOTHER of FT and TF 1           234   2e-73   
ref|XP_011072991.1|  PREDICTED: protein MOTHER of FT and TF 1           234   5e-73   
ref|XP_009621088.1|  PREDICTED: protein MOTHER of FT and TF 1           233   7e-73   
ref|XP_007036754.1|  PEBP family protein isoform 1                      235   8e-73   
gb|AIE37919.1|  phosphatidylethanolamine-binding protein                233   1e-72   
emb|CAN80336.1|  hypothetical protein VITISV_038913                     232   1e-72   Vitis vinifera
ref|XP_009757930.1|  PREDICTED: protein MOTHER of FT and TF 1           232   2e-72   
ref|XP_010537488.1|  PREDICTED: protein MOTHER of FT and TF 1           228   7e-71   
gb|EYU17649.1|  hypothetical protein MIMGU_mgv1a014889mg                228   8e-71   
ref|XP_006341565.1|  PREDICTED: protein MOTHER of FT and TF 1-like      228   1e-70   
ref|XP_011047546.1|  PREDICTED: protein MOTHER of FT and TF 1-like      227   2e-70   
emb|CDY21719.1|  BnaA09g44700D                                          227   2e-70   
ref|XP_009117626.1|  PREDICTED: protein MOTHER of FT and TF 1           228   3e-70   
emb|CDX81861.1|  BnaC08g37400D                                          226   4e-70   
gb|AHG97810.1|  MOTHER OF FT AND TFL1 1                                 226   4e-70   
ref|XP_010260703.1|  PREDICTED: protein MOTHER of FT and TF 1           226   5e-70   
ref|XP_002321507.1|  MOTHER of FT and TF1 family protein                226   6e-70   Populus trichocarpa [western balsam poplar]
gb|AET05551.2|  mother of FT and TFL1-like protein                      224   2e-69   
emb|CDY60777.1|  BnaC05g50120D                                          224   2e-69   
ref|XP_006305921.1|  hypothetical protein CARUB_v10011138mg             224   2e-69   
ref|XP_004503299.1|  PREDICTED: protein MOTHER of FT and TF 1-like      224   3e-69   
ref|XP_003631075.1|  Protein MOTHER of FT and TF                        224   4e-69   
ref|XP_010476978.1|  PREDICTED: protein MOTHER of FT and TF 1           223   4e-69   
ref|NP_173250.1|  protein MOTHER of FT and TF 1                         223   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451659.1|  hypothetical protein CICLE_v10009697mg             223   9e-69   
ref|XP_010498189.1|  PREDICTED: protein MOTHER of FT and TF 1-like      223   1e-68   
ref|XP_002892983.1|  E12A11                                             222   1e-68   
ref|XP_006416640.1|  hypothetical protein EUTSA_v10009636mg             222   2e-68   
ref|XP_010032693.1|  PREDICTED: protein MOTHER of FT and TF 1           220   1e-67   
ref|XP_009149260.1|  PREDICTED: protein MOTHER of FT and TF 1           220   1e-67   
ref|XP_007160508.1|  hypothetical protein PHAVU_002G327700g             220   1e-67   
ref|NP_001281044.1|  uncharacterized protein LOC103455721               219   2e-67   
ref|XP_007209687.1|  hypothetical protein PRUPE_ppa012388mg             219   3e-67   
gb|KFK43979.1|  hypothetical protein AALP_AA1G199000                    219   3e-67   
ref|XP_009360092.1|  PREDICTED: protein MOTHER of FT and TF 1           219   3e-67   
ref|XP_004299541.1|  PREDICTED: protein MOTHER of FT and TF 1-like      218   5e-67   
gb|AFP33419.1|  mother of FT and TFL1                                   218   5e-67   
gb|ABK22769.1|  unknown                                                 218   9e-67   Picea sitchensis
ref|XP_010097584.1|  hypothetical protein L484_017394                   217   1e-66   
ref|XP_004235817.1|  PREDICTED: protein MOTHER of FT and TF 1           217   2e-66   
gb|AFK45387.1|  unknown                                                 217   2e-66   
ref|XP_009403936.1|  PREDICTED: protein MOTHER of FT and TF 1-like      216   4e-66   
ref|XP_008374830.1|  PREDICTED: protein MOTHER of FT and TF 1           216   4e-66   
ref|XP_004136734.1|  PREDICTED: protein MOTHER of FT and TF 1-like      215   1e-65   
gb|AJD87372.1|  MFT                                                     214   2e-65   
ref|XP_008443056.1|  PREDICTED: protein MOTHER of FT and TF 1-like      214   3e-65   
gb|AIJ02001.1|  mother of FT and TFL1-like 1                            213   6e-65   
gb|AHM25239.1|  flowering locus T                                       213   6e-65   
gb|AEH59565.1|  MFT1-like protein                                       213   7e-65   
gb|ACA24491.1|  mother of flowering locus T-like protein                213   9e-65   
gb|AHY23236.1|  flowering locus T                                       213   1e-64   
ref|XP_007036755.1|  PEBP (phosphatidylethanolamine-binding prote...    211   1e-64   
gb|ABF65987.1|  CETS1                                                   212   2e-64   Glycine max [soybeans]
ref|XP_008360924.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOTH...    212   2e-64   
ref|NP_001236894.1|  uncharacterized LOC100306314 precursor             211   4e-64   
ref|XP_009387733.1|  PREDICTED: protein MOTHER of FT and TF 1-like      210   6e-64   
gb|ABB90591.1|  terminal flower 1                                       209   1e-63   Aquilegia formosa
ref|XP_004169652.1|  PREDICTED: LOW QUALITY PROTEIN: protein MOTH...    209   1e-63   
ref|XP_008240174.1|  PREDICTED: protein MOTHER of FT and TF 1           209   2e-63   
ref|XP_008787928.1|  PREDICTED: protein MOTHER of FT and TF 1-like      209   2e-63   
ref|XP_010274753.1|  PREDICTED: protein MOTHER of FT and TF 1-like      210   5e-63   
ref|XP_010936814.1|  PREDICTED: protein MOTHER of FT and TF 1-like      207   1e-62   
ref|XP_009393599.1|  PREDICTED: protein MOTHER of FT and TF 1-like      206   2e-62   
ref|XP_006841865.1|  hypothetical protein AMTR_s00003p00271590          207   8e-62   
ref|XP_004967983.1|  PREDICTED: protein MOTHER of FT and TF 1-like      204   1e-61   
ref|XP_006849745.1|  hypothetical protein AMTR_s00024p00249400          204   1e-61   
ref|XP_010277909.1|  PREDICTED: protein MOTHER of FT and TF 1-like      204   1e-61   
ref|XP_003566347.1|  PREDICTED: protein MOTHER of FT and TF 1-like      203   3e-61   
ref|XP_002457494.1|  hypothetical protein SORBIDRAFT_03g008270          203   4e-61   Sorghum bicolor [broomcorn]
ref|NP_001147266.1|  MFT2 - Corn MFT-like protein                       203   5e-61   Zea mays [maize]
ref|XP_001764385.1|  predicted protein                                  202   7e-61   
gb|KHN21660.1|  Protein MOTHER of FT and TF 1                           203   7e-61   
ref|XP_001769136.1|  predicted protein                                  202   7e-61   
dbj|BAK78893.1|  MFT                                                    202   9e-61   
dbj|BAK06374.1|  predicted protein                                      202   2e-60   
ref|XP_010268882.1|  PREDICTED: protein MOTHER of FT and TF 1-like      201   2e-60   
ref|NP_001106249.1|  ZCN10 protein                                      201   2e-60   Zea mays [maize]
gb|AEH59566.1|  MFT2-like protein                                       201   2e-60   
dbj|BAK78896.1|  MFT                                                    201   2e-60   
dbj|BAK78908.1|  Mother of FT and TFL1                                  201   3e-60   
ref|XP_008782387.1|  PREDICTED: protein MOTHER of FT and TF 1-like      201   3e-60   
ref|XP_009356062.1|  PREDICTED: protein MOTHER of FT and TF 1-like      200   1e-59   
ref|XP_010940015.1|  PREDICTED: protein MOTHER of FT and TF 1-like      199   1e-59   
gb|AGY34592.1|  MFT-A1                                                  198   3e-59   
gb|ACN54544.1|  mother of FT and TFL1-like protein variant a            199   4e-59   Physcomitrella patens
ref|XP_008441938.1|  PREDICTED: protein MOTHER of FT and TF 1-like      197   6e-59   
gb|AGJ98454.1|  MFT1                                                    197   8e-59   
gb|KHG10593.1|  Protein MOTHER of FT and TF 1 -like protein             197   1e-58   
gb|EAY84662.1|  hypothetical protein OsI_06032                          197   1e-58   Oryza sativa Indica Group [Indian rice]
gb|AFW79812.1|  MFT2-Corn MFT-like protein                              196   2e-58   
ref|NP_001057701.1|  Os06g0498800                                       195   5e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007025823.1|  Phosphatidylethanolamine-binding protein, pu...    195   6e-58   
ref|XP_001758845.1|  predicted protein                                  194   2e-57   
ref|XP_010096797.1|  hypothetical protein L484_002399                   194   2e-57   
ref|NP_001106248.1|  ZCN9 protein                                       194   2e-57   Zea mays [maize]
ref|NP_001041806.1|  Os01g0111600                                       193   3e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001152713.1|  MFT2 - Corn MFT-like protein                       193   3e-57   Zea mays [maize]
gb|ABX11011.1|  ZCN9                                                    193   3e-57   Zea mays [maize]
ref|XP_004232787.1|  PREDICTED: protein MOTHER of FT and TF 1           193   3e-57   
gb|AAO31791.1|  SP2G                                                    193   4e-57   Solanum lycopersicum
ref|XP_006449196.1|  hypothetical protein CICLE_v10016917mg             192   1e-56   
ref|XP_004146579.1|  PREDICTED: protein MOTHER of FT and TF 1-like      192   1e-56   
gb|EMT22371.1|  hypothetical protein F775_09897                         192   1e-56   
ref|XP_002990227.1|  TF1-like protein                                   191   2e-56   
ref|XP_002436981.1|  hypothetical protein SORBIDRAFT_10g013070          191   2e-56   Sorghum bicolor [broomcorn]
ref|XP_006643665.1|  PREDICTED: protein MOTHER of FT and TF 1-like      191   2e-56   
gb|ACN54543.1|  mother of FT and TFL1-like protein                      191   3e-56   Physcomitrella patens
ref|XP_009757896.1|  PREDICTED: protein MOTHER of FT and TF 1-like      191   4e-56   
ref|XP_006467912.1|  PREDICTED: protein MOTHER of FT and TF 1-like      190   4e-56   
ref|XP_001778686.1|  predicted protein                                  189   1e-55   
ref|XP_002990226.1|  hypothetical protein SELMODRAFT_229523             189   2e-55   
ref|XP_009589130.1|  PREDICTED: protein MOTHER of FT and TF 1-like      189   2e-55   
ref|XP_006656987.1|  PREDICTED: protein MOTHER of FT and TF 1-like      188   3e-55   
ref|XP_010686259.1|  PREDICTED: protein MOTHER of FT and TF 1-like      187   6e-55   
gb|KDP20872.1|  hypothetical protein JCGZ_21343                         187   7e-55   
ref|XP_004246534.1|  PREDICTED: CEN-like protein 2                      186   2e-54   
gb|AFW79811.1|  hypothetical protein ZEAMMB73_034486                    186   3e-54   
gb|ABK25607.1|  unknown                                                 185   3e-54   Picea sitchensis
gb|ACN54547.1|  mother of FT and TFL1-like protein                      186   4e-54   Physcomitrella patens
ref|NP_001236597.1|  brother of FT and TFL1 protein                     185   5e-54   
ref|XP_002528731.1|  phosphatidylethanolamine-binding protein, pu...    184   8e-54   Ricinus communis
gb|AEH59567.1|  flowering locus T/Terminal flower1-like protein         184   9e-54   
gb|ADC32542.1|  terminal flower 1-like protein                          184   1e-53   Leavenworthia crassa
ref|XP_007027716.1|  Centroradialis                                     184   1e-53   
gb|KDP42735.1|  hypothetical protein JCGZ_23675                         184   1e-53   
ref|XP_004515713.1|  PREDICTED: CEN-like protein 1-like                 184   1e-53   
ref|XP_009766168.1|  PREDICTED: protein TERMINAL FLOWER 1-like          184   1e-53   
gb|EYU27885.1|  hypothetical protein MIMGU_mgv1a022275mg                183   1e-53   
ref|XP_006341132.1|  PREDICTED: CEN-like protein 2-like isoform X2      183   2e-53   
ref|XP_007025824.1|  Phosphatidylethanolamine-binding protein, pu...    183   2e-53   
ref|XP_006341131.1|  PREDICTED: CEN-like protein 2-like isoform X1      182   4e-53   
ref|XP_010049502.1|  PREDICTED: protein TERMINAL FLOWER 1-like          182   4e-53   
emb|CDO99645.1|  unnamed protein product                                182   4e-53   
emb|CDP15403.1|  unnamed protein product                                182   4e-53   
gb|ABW24962.1|  terminal flower 1b                                      182   5e-53   Gossypium arboreum [tree cotton]
gb|AGX25250.1|  MCN1                                                    182   6e-53   
ref|XP_003563887.1|  PREDICTED: protein MOTHER of FT and TF 1-like      182   6e-53   
ref|XP_009592311.1|  PREDICTED: protein SELF-PRUNING-like isoform X2    182   6e-53   
gb|ABY62770.1|  terminal flower 1b                                      182   6e-53   Gossypium hirsutum [American cotton]
gb|AEO72025.1|  TFL1-like protein                                       182   8e-53   
gb|ABW24964.1|  terminal flower 1b                                      181   1e-52   Gossypium hirsutum [American cotton]
gb|KDO75687.1|  hypothetical protein CISIN_1g030480mg                   181   1e-52   
ref|XP_009592303.1|  PREDICTED: protein SELF-PRUNING-like isoform X1    181   2e-52   
gb|AGX25240.1|  MCN1                                                    181   2e-52   
gb|ADW82821.1|  flowering time locus T-like protein 1                   181   2e-52   
ref|XP_009411957.1|  PREDICTED: CEN-like protein 2                      181   2e-52   
gb|ADW82819.1|  flowering time locus T-like protein 1                   181   2e-52   
gb|AAZ38709.1|  FT-like protein                                         181   2e-52   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001106264.1|  ZCN11 protein                                      181   2e-52   Zea mays [maize]
ref|XP_003635936.1|  CEN-like protein                                   180   3e-52   
gb|ABV59389.1|  flowering locus T 1                                     180   3e-52   Hordeum vulgare subsp. vulgare [barley]
gb|ABW24968.1|  terminal flower 1b                                      180   3e-52   Gossypium hirsutum [American cotton]
ref|XP_009614479.1|  PREDICTED: protein TERMINAL FLOWER 1-like          180   3e-52   
ref|XP_004308107.1|  PREDICTED: CEN-like protein 1-like                 180   3e-52   
gb|ADW82818.1|  flowering time locus T-like protein 1                   180   3e-52   
gb|AID67177.1|  MFT2-like protein                                       179   3e-52   
ref|XP_006430226.1|  hypothetical protein CICLE_v10013475mg             180   4e-52   
gb|AID67173.1|  MFT2-like protein                                       179   6e-52   
ref|XP_006398842.1|  hypothetical protein EUTSA_v10015708mg             179   6e-52   
gb|AFK31069.1|  Hd3a                                                    179   8e-52   
gb|AFK31127.1|  Hd3a                                                    179   9e-52   
gb|AID67184.1|  MFT2-like protein                                       178   1e-51   
ref|XP_007025825.1|  PEBP (phosphatidylethanolamine-binding prote...    178   1e-51   
gb|AID67182.1|  MFT2-like protein                                       178   1e-51   
gb|AIJ02002.1|  FT/TFL1-like 2                                          179   1e-51   
ref|XP_006365770.1|  PREDICTED: CEN-like protein 1-like                 179   1e-51   
ref|XP_009374732.1|  PREDICTED: protein TERMINAL FLOWER 1-like          179   1e-51   
gb|AID67210.1|  MFT2-like protein                                       178   1e-51   
ref|XP_010101582.1|  hypothetical protein L484_015411                   178   1e-51   
gb|AID67196.1|  MFT2-like protein                                       178   1e-51   
gb|AGN29206.1|  TFL1                                                    179   1e-51   
gb|AFK31124.1|  Hd3a                                                    179   1e-51   
ref|NP_001280887.1|  protein TERMINAL FLOWER 1-like                     178   2e-51   
gb|ABW24966.1|  terminal flower 1b                                      178   2e-51   Gossypium raimondii
ref|XP_006587343.1|  PREDICTED: CEN-like protein 1-like isoform X2      178   2e-51   
ref|XP_009384535.1|  PREDICTED: CEN-like protein 1                      178   2e-51   
ref|XP_004228449.1|  PREDICTED: CEN-like protein 1                      178   2e-51   
ref|XP_008788083.1|  PREDICTED: protein SELF-PRUNING-like               178   2e-51   
gb|AFK31163.1|  Hd3a                                                    178   2e-51   
ref|NP_001267935.1|  MFT-like protein                                   178   2e-51   
gb|AAW23034.1|  flowering locus T                                       178   2e-51   Triticum aestivum [Canadian hard winter wheat]
dbj|BAI49900.1|  FT-like protein                                        178   2e-51   Phyllostachys meyeri
gb|ADO64261.1|  KSN                                                     178   2e-51   
gb|AEO72023.1|  TFL1-like protein                                       178   3e-51   
gb|ABI34864.1|  FT                                                      178   3e-51   Aegilops tauschii
ref|XP_006353340.1|  PREDICTED: CEN-like protein 1-like                 178   3e-51   
gb|AFK31070.1|  Hd3a                                                    178   3e-51   
ref|NP_001173006.1|  Os02g0531600                                       177   3e-51   
dbj|BAD10966.1|  TFL1-like protein                                      177   3e-51   Eriobotrya japonica [loquat]
gb|ACL27223.1|  fasciculate                                             177   3e-51   Capsicum frutescens [bird pepper]
ref|XP_009130785.1|  PREDICTED: protein TERMINAL FLOWER 1               177   3e-51   
dbj|BAK08043.1|  predicted protein                                      177   3e-51   
dbj|BAO03055.1|  Hd3a                                                   177   3e-51   
dbj|BAI49901.1|  FT-like protein                                        177   4e-51   Phyllostachys meyeri
gb|AHX00603.1|  TFL1a                                                   177   4e-51   
ref|NP_001289244.1|  protein TERMINAL FLOWER 1-like                     177   4e-51   
ref|NP_001280770.1|  CEN-like protein 1                                 177   4e-51   
gb|ABY91243.1|  CTRSTFL-like protein                                    177   4e-51   Citrus trifoliata [hardy orange]
ref|XP_004234370.1|  PREDICTED: CEN-like protein 1                      177   4e-51   
gb|ABR23052.1|  terminal flower-like protein                            177   4e-51   Picea abies
gb|AID67220.1|  MFT2-like protein                                       177   4e-51   
gb|KDP22308.1|  hypothetical protein JCGZ_26139                         177   4e-51   
dbj|BAI49899.1|  FT-like protein                                        177   4e-51   Phyllostachys meyeri
gb|AEO72027.1|  TFL1-like protein                                       177   4e-51   
gb|AGX25242.1|  MCN3                                                    177   4e-51   
gb|AIU44253.1|  TFL1                                                    177   5e-51   
gb|AFK31116.1|  Hd3a                                                    177   5e-51   
gb|AFK31129.1|  Hd3a                                                    177   5e-51   
gb|AFK32780.1|  TFL1-like protein                                       177   5e-51   
ref|XP_010089842.1|  hypothetical protein L484_022359                   177   5e-51   
dbj|BAG72295.1|  Hd3a                                                   177   5e-51   Oryza rufipogon [common wild rice]
ref|NP_001276314.1|  uncharacterized protein LOC100783608               177   5e-51   
gb|ABQ85553.1|  flowering locus T-like/terminal flower1-like protein    177   6e-51   Picea abies
gb|AFK31134.1|  Hd3a                                                    177   6e-51   
ref|XP_006289547.1|  hypothetical protein CARUB_v10003093mg             177   6e-51   
gb|AID67229.1|  MFT2-like protein                                       176   6e-51   
ref|XP_002873117.1|  hypothetical protein ARALYDRAFT_487163             177   6e-51   
gb|ADP95116.1|  flowering locus T-like protein                          177   7e-51   
ref|XP_009792306.1|  PREDICTED: CEN-like protein 2                      177   7e-51   
ref|XP_010490878.1|  PREDICTED: protein TERMINAL FLOWER 1-like          177   7e-51   
dbj|BAO03056.1|  Hd3a                                                   177   7e-51   
ref|NP_001267006.1|  protein TERMINAL FLOWER 1-like                     177   7e-51   
ref|XP_006481791.1|  PREDICTED: protein TERMINAL FLOWER 1 isoform X1    177   7e-51   
gb|ADL62862.1|  terminal flower 1                                       176   8e-51   
ref|XP_010543489.1|  PREDICTED: protein TERMINAL FLOWER 1               177   8e-51   
ref|NP_001066172.1|  Os12g0152000                                       176   8e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655810.1|  PREDICTED: protein HEADING DATE 3A-like            177   8e-51   
gb|ABY79180.1|  At5g03840                                               176   9e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AEZ63950.1|  FLOWERING LOCUS T2                                      176   9e-51   
dbj|BAJ22383.1|  terminal flower 1b                                     176   9e-51   
ref|XP_010423657.1|  PREDICTED: protein TERMINAL FLOWER 1               176   1e-50   
gb|AHB86977.1|  PEBP                                                    176   1e-50   
gb|AFA42328.1|  TFL1-like protein                                       176   1e-50   
dbj|BAO02982.1|  Hd3a                                                   176   1e-50   
ref|XP_008241250.1|  PREDICTED: CEN-like protein 2                      176   1e-50   
gb|AAM27947.1|AF466807_1  terminal flower 1                             176   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ADF30920.1|  Dt1                                                     176   1e-50   
ref|NP_001275848.1|  terminal flower                                    176   1e-50   
dbj|BAH37010.1|  terminal flower1-like protein                          176   1e-50   Raphanus sativus
gb|AGS32268.1|  TFL1-1                                                  176   1e-50   
gb|AAM27952.1|AF466812_1  terminal flower 1                             176   1e-50   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH30240.1|  FT-like protein                                        176   1e-50   Oryza rufipogon [common wild rice]
gb|AFK31132.1|  Hd3a                                                    176   1e-50   
gb|AGX25254.1|  MCN5                                                    176   1e-50   
gb|AGE45850.1|  phosphatidylethanolamine-binding protein                176   1e-50   
gb|ACA25439.1|  flowering locus T                                       176   1e-50   Triticum aestivum [Canadian hard winter wheat]
dbj|BAH30250.1|  FT-like protein                                        176   2e-50   Oryza rufipogon [common wild rice]
dbj|BAM73643.1|  terminal flower1 homologue                             176   2e-50   
emb|CDY14173.1|  BnaC02g02900D                                          176   2e-50   
gb|AFK31118.1|  Hd3a                                                    176   2e-50   
gb|AEH43348.1|  TFL1                                                    176   2e-50   
ref|XP_006647339.1|  PREDICTED: protein SELF-PRUNING-like               176   2e-50   
dbj|BAD10970.1|  TFL1-like protein                                      176   2e-50   Cydonia oblonga [wen po]
ref|XP_006365775.1|  PREDICTED: CEN-like protein 1-like                 176   2e-50   
ref|XP_007162890.1|  hypothetical protein PHAVU_001G189200g             177   2e-50   
ref|NP_001240029.1|  CEN-like protein 2-like                            176   2e-50   
ref|NP_001280794.1|  protein TERMINAL FLOWER 1-like                     176   2e-50   
ref|XP_003625808.1|  TFL1                                               176   2e-50   
gb|ABY79175.1|  At5g03840                                               176   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AEO72024.1|  TFL1-like protein                                       176   2e-50   
gb|AFK31136.1|  Hd3a                                                    176   2e-50   
emb|CDX80890.1|  BnaC03g01440D                                          176   2e-50   
ref|NP_196004.1|  protein TERMINAL FLOWER 1                             176   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AFU82577.1|  Hd3a protein                                            176   2e-50   
dbj|BAD10972.1|  TFL1-like protein                                      175   2e-50   Eriobotrya japonica [loquat]
pdb|3AXY|A  Chain A, Structure Of Florigen Activation Complex Con...    175   2e-50   
dbj|BAD10964.1|  TFL1-like protein                                      175   2e-50   Cydonia oblonga [wen po]
pdb|1WKO|A  Chain A, Terminal Flower 1 (Tfl1) From Arabidopsis Th...    176   2e-50   
dbj|BAO03059.1|  RFT1                                                   176   2e-50   
dbj|BAO03052.1|  Hd3a                                                   176   2e-50   
ref|NP_001274853.1|  CEN-like protein 1-like                            175   2e-50   
dbj|BAB61027.1|  Hd3a                                                   176   2e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001106252.1|  LOC100127524                                       176   2e-50   Zea mays [maize]
gb|ADF30943.1|  Dt1                                                     175   2e-50   
ref|XP_009393383.1|  PREDICTED: CEN-like protein 2                      175   2e-50   
emb|CBN73215.1|  flowering locus T protein                              175   2e-50   
emb|CBI40863.3|  unnamed protein product                                175   2e-50   
ref|XP_010452279.1|  PREDICTED: protein TERMINAL FLOWER 1-like          175   2e-50   
gb|AAM27957.1|AF466817_1  terminal flower 1                             175   3e-50   Arabidopsis lyrata [lyrate rockcress]
dbj|BAG72302.1|  Hd3a                                                   175   3e-50   
dbj|BAG72292.1|  Hd3a                                                   175   3e-50   
dbj|BAA33417.1|  BNTFL1-3                                               175   3e-50   
gb|AFK31122.1|  Hd3a                                                    175   3e-50   
dbj|BAA33415.1|  BNTFL1-1                                               175   3e-50   
ref|XP_010912272.1|  PREDICTED: protein SELF-PRUNING-like               175   3e-50   
ref|XP_009401773.1|  PREDICTED: CEN-like protein 1                      175   3e-50   
ref|NP_001052733.1|  Os04g0411400                                       175   3e-50   
gb|ABC33722.1|  FT3                                                     175   3e-50   
gb|AFK31152.1|  Hd3a                                                    175   3e-50   
ref|NP_001267654.1|  protein SELF-PRUNING-like                          175   3e-50   
ref|NP_001267931.1|  TFL1B protein                                      175   3e-50   
ref|XP_010255492.1|  PREDICTED: CEN-like protein 1                      175   3e-50   
ref|XP_009125522.1|  PREDICTED: protein TERMINAL FLOWER 1-like          175   3e-50   
ref|NP_001056860.1|  Os06g0157700                                       175   3e-50   
ref|XP_011000909.1|  PREDICTED: CEN-like protein 2                      175   3e-50   
gb|ACJ61501.1|  terminal flower                                         175   3e-50   
gb|AHZ46122.1|  TFL1-like flowering time protein                        175   3e-50   
dbj|BAH56285.1|  FT-like protein                                        175   4e-50   
ref|XP_004952639.1|  PREDICTED: protein SELF-PRUNING-like               175   4e-50   
dbj|BAO03057.1|  Hd3a                                                   175   4e-50   
gb|AGX25252.1|  MCN3                                                    175   4e-50   
dbj|BAD10971.1|  TFL1-like protein                                      175   4e-50   
ref|XP_006652260.1|  PREDICTED: protein SELF-PRUNING-like               175   4e-50   
dbj|BAO02994.1|  Hd3a                                                   175   4e-50   
gb|ACF18111.1|  terminal flower 1                                       174   4e-50   
dbj|BAO02921.1|  Hd3a                                                   175   4e-50   
dbj|BAH24198.1|  homologous protein to MFT                              174   4e-50   
gb|AFK93854.1|  phosphatidylethanolamine-binding protein                175   4e-50   
ref|XP_009122666.1|  PREDICTED: protein TERMINAL FLOWER 1-like          175   4e-50   
dbj|BAG72285.1|  Hd3a                                                   175   4e-50   
gb|AGX25243.1|  MCN4                                                    174   4e-50   
gb|AIA10351.1|  TFL1                                                    174   5e-50   
ref|XP_007202664.1|  hypothetical protein PRUPE_ppa012369mg             174   5e-50   
dbj|BAH30238.1|  FT-like protein                                        175   5e-50   
ref|XP_004494168.1|  PREDICTED: protein CENTRORADIALIS-like             174   5e-50   
dbj|BAD10965.1|  TFL1-like protein                                      174   5e-50   
ref|XP_009379789.1|  PREDICTED: protein SELF-PRUNING-like               174   5e-50   
dbj|BAG72293.1|  Hd3a                                                   174   5e-50   
ref|XP_010693475.1|  PREDICTED: CEN-like protein 1                      174   5e-50   
dbj|BAJ22384.1|  terminal flower 1a                                     174   5e-50   
gb|AID67244.1|  MFT2-like protein                                       173   6e-50   
emb|CAH67157.1|  H0717B12.4                                             174   6e-50   
gb|ABR53775.2|  TFL1y                                                   174   6e-50   
ref|XP_007015849.1|  Centroradialis                                     174   6e-50   
ref|XP_002450283.1|  hypothetical protein SORBIDRAFT_05g003200          174   6e-50   
sp|Q41261.1|CEN_ANTMA  RecName: Full=Protein CENTRORADIALIS             174   6e-50   
ref|XP_008234274.1|  PREDICTED: CEN-like protein 1                      174   7e-50   
dbj|BAA33419.1|  BRTFL1-2                                               174   7e-50   
gb|KDO61123.1|  hypothetical protein CISIN_1g035977mg                   174   7e-50   
emb|CAC21564.1|  centroradialis                                         174   7e-50   
dbj|BAO03165.1|  RFT1                                                   174   7e-50   
emb|CAI38702.1|  self-pruning protein                                   174   7e-50   
gb|EMS62911.1|  hypothetical protein TRIUR3_23342                       174   7e-50   
gb|AFK31166.1|  Hd3a                                                    174   7e-50   
ref|XP_010278585.1|  PREDICTED: CEN-like protein 1                      174   7e-50   
emb|CBN73219.1|  flowering locus T protein                              174   7e-50   
ref|XP_010907126.1|  PREDICTED: protein SELF-PRUNING-like               174   8e-50   
dbj|BAD22601.1|  flowering locus T like protein                         174   8e-50   
emb|CAC21563.1|  centroradialis                                         174   8e-50   
ref|XP_009780427.1|  PREDICTED: CEN-like protein 1                      174   8e-50   
gb|KHN14994.1|  Protein CENTRORADIALIS-like                             174   8e-50   
ref|NP_001056859.1|  Os06g0157500                                       174   9e-50   
ref|NP_001239629.1|  protein TERMINAL FLOWER 1-like                     174   9e-50   
gb|KHN18765.1|  Protein TERMINAL FLOWER 1                               174   9e-50   
gb|ACF18112.1|  terminal flower 1                                       173   9e-50   
dbj|BAD10962.1|  TFL1-like protein                                      174   9e-50   
dbj|BAO02881.1|  Hd3a                                                   174   9e-50   
ref|XP_006836050.1|  hypothetical protein AMTR_s00114p00070400          174   9e-50   
ref|NP_001241437.1|  protein TERMINAL FLOWER 1-like                     174   1e-49   
ref|NP_001106241.1|  ZCN2 protein                                       174   1e-49   
gb|AFK31068.1|  Hd3a                                                    174   1e-49   
ref|XP_003575068.1|  PREDICTED: CEN-like protein 2                      174   1e-49   
dbj|BAO02930.1|  Hd3a                                                   174   1e-49   
ref|XP_006663820.1|  PREDICTED: CEN-like protein 2-like                 174   1e-49   
dbj|BAO02906.1|  Hd3a                                                   174   1e-49   
gb|AFK31142.1|  Hd3a                                                    174   1e-49   
gb|AFK31131.1|  Hd3a                                                    174   1e-49   
ref|XP_011088881.1|  PREDICTED: protein CENTRORADIALIS                  174   1e-49   
gb|AFK31165.1|  Hd3a                                                    174   1e-49   
dbj|BAO02929.1|  Hd3a                                                   174   1e-49   
gb|AFK31150.1|  Hd3a                                                    174   1e-49   
ref|XP_002312811.1|  TFL1a family protein                               173   1e-49   
ref|XP_011077877.1|  PREDICTED: CEN-like protein 2                      173   1e-49   
gb|AGT41971.1|  TFL1                                                    173   1e-49   
gb|AFK31062.1|  Hd3a                                                    174   1e-49   
gb|ACF18113.1|  terminal flower 1                                       173   1e-49   
ref|XP_006662737.1|  PREDICTED: CEN-like protein 2-like                 173   1e-49   
gb|KEH17362.1|  terminal flower 1                                       173   2e-49   
gb|AFV67448.1|  centroradialis                                          173   2e-49   
ref|XP_007152319.1|  hypothetical protein PHAVU_004G119700g             173   2e-49   
dbj|BAO03050.1|  Hd3a                                                   173   2e-49   
dbj|BAI66119.1|  terminal flower 1b                                     173   2e-49   
ref|XP_010523529.1|  PREDICTED: protein BROTHER of FT and TFL 1         173   2e-49   
gb|AFK31059.1|  Hd3a                                                    173   2e-49   
ref|NP_001276169.1|  CEN-like protein 2-like                            173   2e-49   
ref|XP_004978696.1|  PREDICTED: CEN-like protein 2-like                 173   2e-49   
gb|AGX25241.1|  MCN2                                                    173   2e-49   
ref|XP_008784004.1|  PREDICTED: CEN-like protein 2                      173   2e-49   
gb|AGX25244.1|  MCN5                                                    173   2e-49   
ref|XP_009777303.1|  PREDICTED: CEN-like protein 2                      173   2e-49   
gb|AFK31147.1|  Hd3a                                                    173   2e-49   
dbj|BAH30239.1|  FT-like protein                                        173   2e-49   
ref|XP_010444040.1|  PREDICTED: protein BROTHER of FT and TFL 1         173   2e-49   
gb|AHF27445.1|  flowering locus T-like 3                                173   2e-49   
gb|AIA10356.1|  TFL1                                                    173   2e-49   
gb|ABX11008.1|  ZCN6                                                    173   2e-49   
emb|CBN73209.1|  flowering locus T protein                              173   2e-49   
ref|XP_007221173.1|  hypothetical protein PRUPE_ppa021829mg             173   2e-49   
gb|AAM27953.1|AF466813_1  terminal flower 1                             173   2e-49   
gb|EMT05258.1|  hypothetical protein F775_30982                         173   2e-49   
gb|AFV67441.1|  centroradialis                                          172   2e-49   
ref|XP_010244607.1|  PREDICTED: CEN-like protein 2                      173   2e-49   
gb|KHN27653.1|  CEN-like protein 2                                      173   2e-49   
gb|ABI94605.1|  flowering locus T-like 1                                173   2e-49   
ref|XP_009390747.1|  PREDICTED: CEN-like protein 2                      172   3e-49   
ref|XP_002442808.1|  hypothetical protein SORBIDRAFT_08g003210          172   3e-49   
ref|XP_004228452.1|  PREDICTED: CEN-like protein 1                      172   3e-49   
ref|NP_001239678.1|  protein SELF-PRUNING-like                          172   3e-49   
dbj|BAG72301.1|  Hd3a                                                   172   3e-49   
gb|ACY80737.1|  TFL1A protein                                           172   3e-49   
ref|NP_001065771.1|  Os11g0152500                                       172   3e-49   
ref|XP_009611784.1|  PREDICTED: CEN-like protein 4                      172   3e-49   
gb|AFK31126.1|  Hd3a                                                    172   3e-49   
ref|XP_011094540.1|  PREDICTED: protein HEADING DATE 3A-like            172   3e-49   
gb|AFW75584.1|  ZCN15                                                   172   3e-49   
ref|XP_010271687.1|  PREDICTED: protein SELF-PRUNING-like               172   3e-49   
gb|AEU08964.1|  flowering locus T                                       172   4e-49   
ref|XP_003564300.1|  PREDICTED: protein HEADING DATE 3A                 172   4e-49   
ref|XP_003568618.1|  PREDICTED: protein MOTHER of FT and TF 1-like      172   4e-49   
gb|AFK31094.1|  Hd3a                                                    172   4e-49   
ref|XP_003579695.1|  PREDICTED: CEN-like protein 2                      172   4e-49   
ref|XP_002453931.1|  hypothetical protein SORBIDRAFT_04g021650          172   4e-49   
gb|AFK31072.1|  Hd3a                                                    172   4e-49   
gb|AFK31058.1|  Hd3a                                                    172   4e-49   
ref|XP_009420516.1|  PREDICTED: CEN-like protein 2                      172   4e-49   
emb|CAJ44126.1|  centroradialis flower development regulation pro...    172   4e-49   
gb|ADZ72835.1|  flowering locus T-like protein                          172   4e-49   
ref|XP_009381764.1|  PREDICTED: protein HEADING DATE 3A-like            172   5e-49   
ref|XP_002436509.1|  hypothetical protein SORBIDRAFT_10g003940          172   5e-49   
dbj|BAA33421.1|  BOTFL1-2                                               172   5e-49   
gb|AFK31162.1|  Hd3a                                                    172   5e-49   
ref|XP_009151327.1|  PREDICTED: protein BROTHER of FT and TFL 1         173   5e-49   
gb|AFA25738.1|  hypothetical protein                                    172   5e-49   
gb|AFK31119.1|  Hd3a                                                    172   6e-49   
ref|XP_002489297.1|  hypothetical protein SORBIDRAFT_0010s003120        172   6e-49   
gb|ACF18100.1|  terminal flower 1                                       171   6e-49   
gb|ACA25438.1|  flowering locus T                                       172   6e-49   
gb|AAR03725.1|  TFL1a                                                   172   6e-49   
gb|AFR54358.2|  flowering locus T-like protein                          172   6e-49   
gb|ADF30918.1|  Dt1                                                     172   6e-49   
gb|AFV67432.1|  centroradialis                                          172   6e-49   
dbj|BAH30236.1|  FT-like protein                                        172   6e-49   
gb|ABP73384.1|  TFL1                                                    172   6e-49   
ref|XP_010911427.1|  PREDICTED: protein HEADING DATE 3A-like            172   7e-49   
ref|NP_001267929.1|  TFL1A protein                                      171   7e-49   
gb|ACF18115.1|  terminal flower 1                                       171   7e-49   
ref|XP_006281443.1|  hypothetical protein CARUB_v10027522mg             172   7e-49   
ref|XP_004979174.1|  PREDICTED: protein FLOWERING LOCUS T-like          171   8e-49   
ref|XP_010031504.1|  PREDICTED: protein CENTRORADIALIS-like             171   8e-49   
dbj|BAL70256.1|  centroradialis                                         171   8e-49   
dbj|BAN13572.1|  terminal flower1-like protein                          171   9e-49   
gb|AEZ63949.1|  FLOWERING LOCUS T1                                      171   9e-49   
gb|AFK31075.1|  Hd3a                                                    171   9e-49   
gb|ABP73380.1|  TFL1                                                    171   9e-49   
dbj|BAO03231.1|  RFT1                                                   171   9e-49   
sp|Q9XH42.1|CET4_TOBAC  RecName: Full=CEN-like protein 4                171   9e-49   
gb|AHF27444.1|  flowering locus T-like 2                                171   1e-48   
gb|AEK06124.1|  terminal flowering 1 protein 1                          171   1e-48   
gb|KDP31551.1|  hypothetical protein JCGZ_15206                         171   1e-48   
gb|ACF18104.1|  terminal flower 1                                       171   1e-48   
gb|AEU08961.1|  flowering locus T                                       171   1e-48   
gb|AFK31113.1|  Hd3a                                                    171   1e-48   
emb|CDX86931.1|  BnaC03g52010D                                          172   1e-48   
gb|AEU08960.1|  flowering locus T                                       171   1e-48   
ref|XP_009611986.1|  PREDICTED: CEN-like protein 1                      171   1e-48   
ref|XP_006480699.1|  PREDICTED: protein HEADING DATE 3A-like            171   1e-48   
gb|EPS71350.1|  hypothetical protein M569_03409                         171   1e-48   
ref|XP_006655811.1|  PREDICTED: protein HEADING DATE 3A-like            171   1e-48   
ref|NP_001106254.1|  ZCN17 protein                                      171   1e-48   
gb|AAQ93599.1|  CEN/TFL1-like GTP-associated binding protein            171   1e-48   
dbj|BAM10941.1|  flowering locus T-like protein                         171   1e-48   
ref|NP_201010.1|  protein BROTHER of FT and TFL 1                       171   1e-48   
ref|XP_004964799.1|  PREDICTED: protein HEADING DATE 3A-like            171   1e-48   
gb|AFK31164.1|  Hd3a                                                    171   1e-48   
ref|XP_003596800.1|  Terminal flower                                    171   1e-48   
gb|ABY91244.1|  CTRSFT1-like protein                                    171   2e-48   
gb|ADF80896.1|  terminal flower 1                                       171   2e-48   
gb|AEU08962.1|  flowering locus T                                       171   2e-48   
ref|XP_007150078.1|  hypothetical protein PHAVU_005G124600g             171   2e-48   
gb|AAM46142.1|AF378127_1  terminal flower-like protein 1                170   2e-48   
gb|ABP73382.1|  TFL1                                                    170   2e-48   
gb|AEO72026.1|  TFL1-like protein                                       170   2e-48   
gb|AFV67438.1|  centroradialis                                          170   2e-48   
gb|ADR51710.1|  VRN-3                                                   170   2e-48   
ref|XP_006394441.1|  hypothetical protein EUTSA_v10005589mg             170   2e-48   
gb|AEH43349.1|  BFT                                                     170   2e-48   
emb|CAI61981.1|  TERMINAL FLOWER 1 protein                              170   3e-48   
gb|ADA77529.1|  flowering locus T protein                               170   3e-48   
gb|AFV67437.1|  centroradialis                                          170   3e-48   
gb|AFV67436.1|  centroradialis                                          170   3e-48   
gb|AGH33864.1|  flowering locus T protein                               170   3e-48   
gb|KDO46010.1|  hypothetical protein CISIN_1g030371mg                   170   3e-48   
ref|XP_006428231.1|  hypothetical protein CICLE_v10012629mg             172   3e-48   
ref|XP_010458097.1|  PREDICTED: protein BROTHER of FT and TFL 1-like    170   3e-48   
ref|XP_009802796.1|  PREDICTED: CEN-like protein 1                      170   3e-48   
dbj|BAH56284.1|  FT-like protein                                        170   3e-48   
dbj|BAO03230.1|  RFT1                                                   170   3e-48   
ref|NP_001105959.1|  LOC100037785                                       170   3e-48   
dbj|BAO03109.1|  RFT1                                                   170   3e-48   
ref|XP_004163314.1|  PREDICTED: CEN-like protein 2-like                 170   4e-48   
ref|XP_004487504.1|  PREDICTED: CEN-like protein 2-like                 170   4e-48   
ref|NP_001106245.1|  ZCN6 protein                                       170   4e-48   
gb|ABW24963.1|  terminal flower 1a                                      169   4e-48   
ref|XP_008786924.1|  PREDICTED: protein HEADING DATE 3A-like            170   4e-48   
gb|ACF18122.1|  terminal flower 1                                       169   4e-48   
gb|EMT01575.1|  hypothetical protein F775_20739                         170   4e-48   
dbj|BAH82787.1|  flowering locus T protein                              169   4e-48   
emb|CAI61980.1|  TERMINAL FLOWER 1 protein                              170   4e-48   
gb|ADO61015.1|  terminal flower 1                                       169   4e-48   
gb|ABX11019.1|  ZCN17                                                   169   4e-48   



>ref|XP_003634198.1| PREDICTED: protein MOTHER of FT and TF 1 [Vitis vinifera]
 emb|CBI15548.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPT++M+VYYG K +T+G DVKPS+  + P+V + G   +FY
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTINMSVYYGAKHVTNGCDVKPSLTVNPPKVTLSGHPDEFY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T + T+GKEA+PY+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVADIPGGT-NATRGKEALPYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  LG ++ P  SR +F TRAFA+ L+L  PVATVYFNA KEPA
Sbjct  123  FQQKAPLGLVEQP-GSRAHFSTRAFANQLDLGLPVATVYFNAQKEPA  168



>ref|XP_011072991.1| PREDICTED: protein MOTHER of FT and TF 1 [Sesamum indicum]
Length=174

 Score =   234 bits (596),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            NVDPLVVGRVIGDVVDMFVPTV M+VYYG K + +G D+KPSM A  PRV I G + + Y
Sbjct  4    NVDPLVVGRVIGDVVDMFVPTVSMSVYYGSKHVNNGCDIKPSMAAAPPRVTITGHANELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIVTDIPG + ++T+G+E +PY+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVTDIPGRS-NVTRGREVLPYIGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+Q   +  ++ PV SR +F TRAFA  L+L  PVATVYFNAHKEPA
Sbjct  123  FRQNASVEGVEAPV-SRTHFNTRAFAQELDLGMPVATVYFNAHKEPA  168



>ref|XP_009621088.1| PREDICTED: protein MOTHER of FT and TF 1 [Nicotiana tomentosiformis]
Length=173

 Score =   233 bits (595),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
             VDPLVVGRVIGDVVDMFVP+V M+V++G K +T+G D+KPS+ AD P++ +GG +   Y
Sbjct  4    KVDPLVVGRVIGDVVDMFVPSVTMSVHFGNKHVTNGCDIKPSIAADPPKITVGGHAADLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIVTDIPG T ++ +GKE + YMGP+P VGIHRYI+VL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVTDIPGCT-NVARGKEVLGYMGPRPPVGIHRYIVVL  122

Query  523  FQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+QK  + G LQPP+ +R++FCTRAFAH L+L  PVATVYFNAHKEPA
Sbjct  123  FRQKGPMPGILQPPL-ARSHFCTRAFAHQLDLGVPVATVYFNAHKEPA  169



>ref|XP_007036754.1| PEBP family protein isoform 1 [Theobroma cacao]
 gb|EOY21255.1| PEBP family protein isoform 1 [Theobroma cacao]
Length=225

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV M+VYYG + +T+G D+KPS   + P+V I G S + Y
Sbjct  57   SVDPLVVGRVIGDVVDMFVPTVTMSVYYGSRHVTNGCDIKPSTTINPPKVSINGHSDELY  116

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV+DIPG T+  T+GKE + YMGP+P VGIHRYILVL
Sbjct  117  TLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNP-TRGKEILVYMGPRPPVGIHRYILVL  175

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            FQQK  LG++Q P  SR NF TR FA HL L  PVATVYFNA KEP +
Sbjct  176  FQQKGPLGQVQQPA-SRANFSTRLFAQHLNLGQPVATVYFNAQKEPVS  222



>gb|AIE37919.1| phosphatidylethanolamine-binding protein [Gossypium barbadense]
 gb|KHG23631.1| Protein MOTHER of FT and TF 1 -like protein [Gossypium arboreum]
Length=172

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV M+VYYG K +++G D+KPSM  + P+V I G   QFY
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVTMSVYYGSKHVSNGCDIKPSMAINPPKVAIDGLPDQFY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV+DIPG T+  T+GKE + YMGP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPTMREWVHWIVSDIPGGTNP-TRGKEILAYMGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            FQQK  LG +Q P T R NF TR FA HL L  PVATVYFNA KEP +
Sbjct  123  FQQKGPLGAVQQPAT-RANFSTRFFADHLNLGLPVATVYFNAQKEPVS  169



>emb|CAN80336.1| hypothetical protein VITISV_038913 [Vitis vinifera]
Length=172

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPT++M+VYYG K +T+G DVKPS+  + P+V + G   +FY
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTINMSVYYGAKHVTNGCDVKPSLTVNPPKVTLSGHPDEFY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T + T+GKEA+PY+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVADIPGGT-NATRGKEALPYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  LG ++ P  SR +F TR FA+ L+L  PVATVYFNA KEPA
Sbjct  123  FQQKAPLGLVEQP-GSRAHFSTRXFANQLDLGLPVATVYFNAQKEPA  168



>ref|XP_009757930.1| PREDICTED: protein MOTHER of FT and TF 1 [Nicotiana sylvestris]
Length=173

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
             VDPLVVGRVIGDVVDMFVP+V M+V++G K +T+G D+KPS+ AD P++ +GG +   Y
Sbjct  4    KVDPLVVGRVIGDVVDMFVPSVTMSVHFGNKHVTNGCDIKPSIAADPPKITVGGHAADLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIVTDIPG + ++ +GKE + Y+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVTDIPGCS-NVARGKEVLGYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+QK  + G LQPP+ +R++FCTRAFAH L+L  PVATVYFNAHKEPA
Sbjct  123  FRQKAPMPGILQPPL-ARSHFCTRAFAHQLDLGVPVATVYFNAHKEPA  169



>ref|XP_010537488.1| PREDICTED: protein MOTHER of FT and TF 1 [Tarenaya hassleriana]
Length=172

 Score =   228 bits (581),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPT +M+VYYGPK IT+G ++KPS+ A  P++ I G S   Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTANMSVYYGPKHITNGCEIKPSLAASPPKLTISGLSHDLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP +RE VHWIV DIPG T+  T+G E +PYM P+PTVGIHRYI VL
Sbjct  64   TLVMTDPDAPSPSEPSLREWVHWIVVDIPGGTNP-TRGIEILPYMEPRPTVGIHRYITVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+QK  +G +Q P  SR NF TR FA HL L  PVATVYFNA KEPA+
Sbjct  123  FRQKTAVGGMQQP-PSRANFSTRMFASHLGLGLPVATVYFNAQKEPAS  169



>gb|EYU17649.1| hypothetical protein MIMGU_mgv1a014889mg [Erythranthe guttata]
Length=174

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            NVDPLVVGRVIGDVVDMFVPTV+M+VYYG K + +G D+KPS+ A  PR+ I G   Q Y
Sbjct  4    NVDPLVVGRVIGDVVDMFVPTVNMSVYYGSKHVNNGCDIKPSLAASPPRLTITGYPNQLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIVTDIPG + ++T+GKE + Y+GP+P VGIHRYI+VL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVTDIPGCS-NVTRGKEVLEYVGPRPPVGIHRYIIVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+QK+ L  ++ P  SR++F TRAFA  L+L  PVATVYFNAHKEPA
Sbjct  123  FRQKRGLDGVEAP-PSRSHFNTRAFAQDLDLGIPVATVYFNAHKEPA  168



>ref|XP_006341565.1| PREDICTED: protein MOTHER of FT and TF 1-like [Solanum tuberosum]
Length=173

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 3/168 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
             VDPLVVGRVIGDVVDMFVP+V M+V+Y  K +T+G D+KPS+  + P++ IGG   +FY
Sbjct  4    KVDPLVVGRVIGDVVDMFVPSVTMSVHYANKHVTNGCDIKPSIAIEPPKITIGGHPDEFY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIVTDIPG + ++ +GKE + Y+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPTMREWVHWIVTDIPGCS-NVARGKEVLGYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+Q   + G LQPPV +R +FCTR FAH L+L +PVATVYFNAHKEPA
Sbjct  123  FRQNAPMQGILQPPV-ARAHFCTRVFAHQLDLGTPVATVYFNAHKEPA  169



>ref|XP_011047546.1| PREDICTED: protein MOTHER of FT and TF 1-like [Populus euphratica]
 ref|XP_011000469.1| PREDICTED: protein MOTHER of FT and TF 1 [Populus euphratica]
Length=173

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVP V+M+VYYG K +++G D+KPS+  D P+V I G S + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPAVNMSVYYGSKHVSNGCDIKPSLSVDPPKVTISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  T+GKE + Y+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPRMREWVHWIVADIPGGTNP-TRGKEILSYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  LG +  P  +R++F TR +A HL+L  PVATVYFNA KEPA
Sbjct  123  FQQKMPLGSMMEPPQNRSHFNTRLYAAHLDLGLPVATVYFNAQKEPA  169



>emb|CDY21719.1| BnaA09g44700D [Brassica napus]
Length=173

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V+I G+S + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVNISGNSNELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  +KGKE +PYM P+P VGIHRYI VL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNP-SKGKEILPYMEPRPPVGIHRYIFVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA HL+L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGMMVQQPP--SRANFSTRMFAGHLDLGLPVATVYFNAQKEPAS  170



>ref|XP_009117626.1| PREDICTED: protein MOTHER of FT and TF 1 [Brassica rapa]
Length=206

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V+I G+S + Y
Sbjct  37   SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVNISGNSNELY  96

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  +KGKE +PYM P+P VGIHRYI VL
Sbjct  97   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNP-SKGKEILPYMEPRPPVGIHRYIFVL  155

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA HL+L  PVATVYFNA KEPA+
Sbjct  156  FRQNSPVGMMVQQPP--SRANFSTRMFAGHLDLGLPVATVYFNAQKEPAS  203



>emb|CDX81861.1| BnaC08g37400D [Brassica napus]
Length=173

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 134/170 (79%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V I G+S + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVSISGNSNELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  +KGKE +PYM P+P VGIHRYI VL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNP-SKGKEILPYMEPRPPVGIHRYIFVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA HL+L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGMMVQQPP--SRANFSTRMFAGHLDLGLPVATVYFNAQKEPAS  170



>gb|AHG97810.1| MOTHER OF FT AND TFL1 1 [Jatropha curcas]
 gb|KDP41127.1| hypothetical protein JCGZ_03618 [Jatropha curcas]
 gb|AID51389.1| mother of FT and TFL1 1 [Jatropha curcas]
 gb|AID51391.1| mother of FT and TFL1 1 [Jatropha curcas]
Length=172

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+D+FVP+V M+VYYG K +T+G DVKPS  ++ P++ I G     Y
Sbjct  4    SVDPLVVGRVIGDVIDLFVPSVTMSVYYGSKHVTNGCDVKPSTASNPPKLTISGHPNDLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHW+V DIPG T+  TKGKE + Y+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWVVADIPGGTNP-TKGKEILSYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+QK  +G ++ P  SR NF TR FA HLEL  PVATVYFNA KEPAA
Sbjct  123  FRQKAAMGVVEQP-QSRANFNTRLFAAHLELGLPVATVYFNAQKEPAA  169



>ref|XP_010260703.1| PREDICTED: protein MOTHER of FT and TF 1 [Nelumbo nucifera]
Length=176

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 4/174 (2%)
 Frame = +1

Query  148  MMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD  327
            M++  +V+PLVVGRVIGDVVDMFVPTV M+VY+GPK +T+G D+KPSM  + P+V + G 
Sbjct  1    MIMAVSVEPLVVGRVIGDVVDMFVPTVSMSVYFGPKHVTNGCDIKPSMATNPPKVVVSGH  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
            +   YTLVMTDPDAPSPSEP MRE VHWIV DIPG T   +KGKE +PYMGP+P VGIHR
Sbjct  61   TDDLYTLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTSP-SKGKEILPYMGPRPPVGIHR  119

Query  508  YILVLFQQKKVLGE--LQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            YILVLF+Q+  + +  +Q P T R NF TRAFA+ L+L  PVAT+YFNA KEPA
Sbjct  120  YILVLFRQRYSMKDAVIQQPAT-RANFNTRAFANQLDLGVPVATIYFNAQKEPA  172



>ref|XP_002321507.1| MOTHER of FT and TF1 family protein [Populus trichocarpa]
 dbj|BAD22677.1| flowering locus T like protein [Populus nigra]
 gb|ABC26020.1| MFT-like protein [Populus trichocarpa]
 dbj|BAG12898.1| FLOWERING LOCUS T/ TERMINAL FLOWER 1-like protein [Populus nigra]
 gb|EEF05634.1| MOTHER of FT and TF1 family protein [Populus trichocarpa]
Length=173

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVP V M+VYYG K +++G D+KPS+  D P+V I G S + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPAVKMSVYYGSKHVSNGCDIKPSLSVDPPKVTISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  T+GKE + Y+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPRMREWVHWIVADIPGGTNP-TRGKEILSYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  LG +  P  +R++F TR +A HL+L  PVATVYFNA KEPA
Sbjct  123  FQQKMPLGSMVEPPQNRSHFNTRLYAAHLDLGLPVATVYFNAQKEPA  169



>gb|AET05551.2| mother of FT and TFL1-like protein [Medicago truncatula]
Length=173

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M+  +VDPLVVGRVIGDVVDMF+P+V M+VY+GPK +T+G D+KPSM  + P+V + G+ 
Sbjct  1    MMAASVDPLVVGRVIGDVVDMFIPSVGMSVYFGPKHVTNGCDIKPSMAINPPKVTLTGNM  60

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
               YTLVMTDPDAPSPSEP MREL+HWIV DIPG T+   +GKE +PY+GPKP VGIHRY
Sbjct  61   DNLYTLVMTDPDAPSPSEPSMRELIHWIVVDIPGGTNP-KRGKEILPYIGPKPPVGIHRY  119

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ILVLF+QK  +G ++ P TSR +F TR FA  + L  PVATVYFN+ KEP A
Sbjct  120  ILVLFEQKGPIGMVEQP-TSRVSFNTRYFASQMNLGLPVATVYFNSQKEPQA  170



>emb|CDY60777.1| BnaC05g50120D [Brassica napus]
Length=174

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M+  +VDPLVVGRVIGDV+DM++PT +M+VY GPK IT+G ++KPS+  + P+V+I G+S
Sbjct  1    MMAASVDPLVVGRVIGDVLDMYIPTANMSVYVGPKHITNGCEIKPSVAVNPPKVNISGNS  60

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + YTLVMTDPDAPSPSEP MRE VHWIV DIPG T+  +KGKE +PYM PKP VGIHRY
Sbjct  61   DELYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNP-SKGKEILPYMEPKPPVGIHRY  119

Query  511  ILVLFQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            I VLF+Q   +G +  QPP  SR NF TR FA HL+L  PVATVYFNA KEPA+
Sbjct  120  IFVLFRQISPVGLMVQQPP--SRANFSTRMFAGHLDLGLPVATVYFNAQKEPAS  171



>ref|XP_006305921.1| hypothetical protein CARUB_v10011138mg [Capsella rubella]
 gb|EOA38819.1| hypothetical protein CARUB_v10011138mg [Capsella rubella]
Length=173

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V+I G S + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTALNPPKVNISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  +KG+E +PYM P+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNP-SKGQEILPYMEPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA HL+L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGLMVQQPP--SRANFSTRMFAGHLDLGLPVATVYFNAQKEPAS  170



>ref|XP_004503299.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cicer arietinum]
Length=173

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M+  +VDPLVVGRVIGDVVDMF+P+V M+VY+GPK +T+G D+KPS+  + PRV + G+ 
Sbjct  1    MMAASVDPLVVGRVIGDVVDMFIPSVGMSVYFGPKHVTNGCDIKPSIAINPPRVTLTGNI  60

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
               YTLVMTDPDAPSPSEP MREL+HWIV DIPG T+   +GKE +PY+GPKP VGIHR+
Sbjct  61   DNLYTLVMTDPDAPSPSEPSMRELIHWIVVDIPGGTNP-KRGKEILPYIGPKPPVGIHRF  119

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ILVLF+QK  +G ++ P TSR +F TR FA  L+L  PVATVYFN+ KEP A
Sbjct  120  ILVLFKQKGPMGLVEQP-TSRVSFNTRYFASQLDLGLPVATVYFNSQKEPQA  170



>ref|XP_003631075.1| Protein MOTHER of FT and TF [Medicago truncatula]
 gb|ABE80135.1| PEBP [Medicago truncatula]
Length=172

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMF+P+V M+VY+GPK +T+G D+KPSM  + P+V + G+    Y
Sbjct  4    SVDPLVVGRVIGDVVDMFIPSVGMSVYFGPKHVTNGCDIKPSMAINPPKVTLTGNMDNLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MREL+HWIV DIPG T+   +GKE +PY+GPKP VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMRELIHWIVVDIPGGTNP-KRGKEILPYIGPKPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+QK  +G ++ P TSR +F TR FA  + L  PVATVYFN+ KEP A
Sbjct  123  FEQKGPIGMVEQP-TSRVSFNTRYFASQMNLGLPVATVYFNSQKEPQA  169



>ref|XP_010476978.1| PREDICTED: protein MOTHER of FT and TF 1 [Camelina sativa]
Length=173

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            ++DPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V+I G S + Y
Sbjct  4    SIDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTTLNPPKVNISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP +RE VHWIV DIPG T+  +KGKE +PYM PKP VGIHRYI VL
Sbjct  64   TLVMTDPDAPSPSEPSLREWVHWIVVDIPGGTNP-SKGKEILPYMEPKPPVGIHRYIFVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +     SR NF TR FA HL+L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGLMVQQPLSRANFSTRMFAGHLDLGLPVATVYFNAQKEPAS  170



>ref|NP_173250.1| protein MOTHER of FT and TF 1 [Arabidopsis thaliana]
 sp|Q9XFK7.1|MFT_ARATH RecName: Full=Protein MOTHER of FT and TF 1 [Arabidopsis thaliana]
 gb|AAD37380.1|AF147721_1 E12A11 protein [Arabidopsis thaliana]
 gb|AAF78390.1|AC069551_23 T10O22.8 [Arabidopsis thaliana]
 gb|AAF97827.1|AC034107_10 Identical to E12A11 protein from Arabidopsis thaliana gb|AF147721 
and contains a phosphatidylethanolamine-binding PF|01161 
domain. ESTs gb|AA042630, gb|AI992611, gb|AV537489, gb|AV553444, 
gb|AV549397 come from this gene [Arabidopsis thaliana]
 gb|AAG48769.1|AF332406_1 putative terminal Flower 1 protein [Arabidopsis thaliana]
 gb|AEE29676.1| protein MOTHER of FT and TF 1 [Arabidopsis thaliana]
Length=173

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V+I G S + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTAVNPPKVNISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  ++GKE +PYM P+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNP-SRGKEILPYMEPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA H +L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGLMVQQPP--SRANFSTRMFAGHFDLGLPVATVYFNAQKEPAS  170



>ref|XP_006451659.1| hypothetical protein CICLE_v10009697mg [Citrus clementina]
 ref|XP_006490744.1| PREDICTED: protein MOTHER of FT and TF 1-like [Citrus sinensis]
 dbj|BAF93494.1| MOTHER of FT and TFL1-like protein [Citrus unshiu]
 gb|ESR64899.1| hypothetical protein CICLE_v10009697mg [Citrus clementina]
 gb|KDO62889.1| hypothetical protein CISIN_1g037140mg [Citrus sinensis]
Length=172

 Score =   223 bits (567),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVP+V M+VYYG K +T+G DVKPSM    P+++I G S + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPSVGMSVYYGSKHVTNGCDVKPSMATSPPKLNITGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+   +G E +PYMGP+P VGIHRYI+VL
Sbjct  64   TLVMTDPDAPSPSEPRMREWVHWIVVDIPGGTNP-AQGMEILPYMGPRPPVGIHRYIMVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            FQQK  LG ++ P T R NF TR FA +L+L  PVAT+YFN  KEPA+
Sbjct  123  FQQKAPLGLVEQPPT-RANFNTRLFAGNLDLGLPVATIYFNCQKEPAS  169



>ref|XP_010498189.1| PREDICTED: protein MOTHER of FT and TF 1-like [Camelina sativa]
 ref|XP_010459415.1| PREDICTED: protein MOTHER of FT and TF 1-like [Camelina sativa]
Length=173

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT  M+VY+GPK IT+G ++KPS   + P+V+I G S + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTATMSVYFGPKHITNGCEIKPSTTLNPPKVNISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP +RE VHWIV DIPG T+  +KGKE +PYM PKP VGIHRYI VL
Sbjct  64   TLVMTDPDAPSPSEPSLREWVHWIVVDIPGGTNP-SKGKEILPYMEPKPPVGIHRYIFVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +     SR NF TR FA HL+L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGLMVQQPLSRANFSTRMFAGHLDLGLPVATVYFNAQKEPAS  170



>ref|XP_002892983.1| E12A11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69242.1| E12A11 [Arabidopsis lyrata subsp. lyrata]
Length=173

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V+I G S + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTAINPPKVNISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T   ++GKE +PYM P+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTSP-SRGKEILPYMEPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA H +L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGLMVQQPP--SRANFSTRMFAGHFDLGLPVATVYFNAQKEPAS  170



>ref|XP_006416640.1| hypothetical protein EUTSA_v10009636mg [Eutrema salsugineum]
 gb|ESQ34993.1| hypothetical protein EUTSA_v10009636mg [Eutrema salsugineum]
Length=173

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V+I G + + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAAVNPPKVNISGHADELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T   ++GKE +PYM P+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTIP-SRGKEILPYMEPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA HL L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGLMVQQPP--SRANFSTRMFAGHLNLGLPVATVYFNAQKEPAS  170



>ref|XP_010032693.1| PREDICTED: protein MOTHER of FT and TF 1 [Eucalyptus grandis]
 gb|KCW83994.1| hypothetical protein EUGRSUZ_B00867 [Eucalyptus grandis]
Length=172

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVP V+M+V YG K +T+G D+KPS+  + P++ I G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPCVNMSVSYGSKHVTNGCDIKPSLAVNAPKISISGHPDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVM DPDAPSPSEP MRE +HWIV DIPG T+   +GKE +PY+GP+P VGIHRYILVL
Sbjct  64   TLVMVDPDAPSPSEPSMREWIHWIVVDIPGGTNP-NRGKEILPYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +G +  P  SR NF TR FA HL+L  PVATVYFN+ KEPA
Sbjct  123  FQQKTPIGHIDHP-NSRANFNTRLFAAHLDLGLPVATVYFNSQKEPA  168



>ref|XP_009149260.1| PREDICTED: protein MOTHER of FT and TF 1 [Brassica rapa]
 emb|CDY26185.1| BnaA06g12320D [Brassica napus]
Length=173

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 132/171 (77%), Gaps = 5/171 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DM++PT +M+VY GPK IT+G ++KPS     P+V+I G+  + Y
Sbjct  4    SVDPLVVGRVIGDVLDMYIPTANMSVYVGPKHITNGCEIKPSAAVKPPKVNISGNPDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+  +KGKE +PYM PKP VGIHRYI VL
Sbjct  64   TLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNP-SKGKEILPYMEPKPPVGIHRYIFVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            F+Q   +G +  QPP  SR NF TR FA HL+L  PVATVYFNA KEPA+ 
Sbjct  123  FRQISPVGLMVQQPP--SRANFSTRMFAGHLDLGLPVATVYFNAQKEPASG  171



>ref|XP_007160508.1| hypothetical protein PHAVU_002G327700g [Phaseolus vulgaris]
 gb|ESW32502.1| hypothetical protein PHAVU_002G327700g [Phaseolus vulgaris]
Length=172

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 130/168 (77%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVP+V+M+VYYG K +TSG D+KPS+  + P++ + G     Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPSVNMSVYYGSKHVTSGCDIKPSIAVNPPKLTLTGKKENLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TL+MTDPDAPSPSEP MRE +HW+V DIPG T+   +GKE +PY GPKP VGIHRYI VL
Sbjct  64   TLIMTDPDAPSPSEPNMREWIHWVVADIPGCTNPF-RGKEIIPYTGPKPPVGIHRYIFVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+QK  +G ++ P  SR NF TR FA  ++L  PVATVYFN+ KEPA+
Sbjct  123  FEQKAPMGPVEQP-ESRGNFSTRTFAKDMDLGLPVATVYFNSQKEPAS  169



>ref|NP_001281044.1| uncharacterized protein LOC103455721 [Malus domestica]
 gb|AGX15187.1| MFTb [Malus domestica]
Length=172

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV M+VY+G K +T+G D+KPSM  + P++ + G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVSMSVYFGSKHVTNGCDIKPSMAINPPKITVSGHPGELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV+DIPG ++ + +GKE +PY+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVSDIPGGSNPL-RGKEILPYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL-QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +G + QPP  SR +F TR FA  L+L  PV+TVYFN+ KEPA
Sbjct  123  FQQKAPMGLVEQPP--SRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA  168



>ref|XP_007209687.1| hypothetical protein PRUPE_ppa012388mg [Prunus persica]
 gb|EMJ10886.1| hypothetical protein PRUPE_ppa012388mg [Prunus persica]
Length=172

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV+M+VY+G K +T+G D+KPSM  + P++ + G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVNMSVYFGSKHVTNGCDIKPSMAINPPKITVSGQPGELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T  + +GKE + Y+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVADIPGGTSPV-RGKEILAYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +G ++ P +SR +F TR FA  L+L  PV+TVYFN+ KEPA
Sbjct  123  FQQKGPMGLVEQP-SSRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA  168



>gb|KFK43979.1| hypothetical protein AALP_AA1G199000 [Arabis alpina]
Length=173

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 132/170 (78%), Gaps = 5/170 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDV+DMF+PT +M+VY+GPK IT+G ++KPS   + P+V I G   + Y
Sbjct  4    SVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSAALNPPKVIISGHPDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE +HWIV DIPG T+  ++GKE +PYM P+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPNMREWIHWIVVDIPGGTNP-SRGKEILPYMEPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL--QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q   +G +  QPP  SR NF TR FA H +L  PVATVYFNA KEPA+
Sbjct  123  FRQNSPVGLMVQQPP--SRANFSTRMFAGHFDLGLPVATVYFNAQKEPAS  170



>ref|XP_009360092.1| PREDICTED: protein MOTHER of FT and TF 1 [Pyrus x bretschneideri]
Length=172

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 4/168 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV M+VY+G K + +G D+KPSM  + P++ + G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVSMSVYFGSKHVANGCDIKPSMAINPPKITVSGHPGELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV+DIPG T+ + +GKE +PY+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNPL-RGKEILPYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL-QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +G + QPP  SR +F TR FA  L+L  PV+TVYFN+ KEPA
Sbjct  123  FQQKAPMGLVEQPP--SRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA  168



>ref|XP_004299541.1| PREDICTED: protein MOTHER of FT and TF 1-like [Fragaria vesca 
subsp. vesca]
Length=172

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV+M+VY+G K +T+G D+KPS+    P+V   G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVNMSVYFGSKHVTNGCDIKPSIAVSPPKVTFSGHPGELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWI+ DIPG T+ I +GKE +PY+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWILADIPGGTNPI-RGKEILPYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +G ++ P T R +F TR FA  L+L  PV+TVYFNA KEPA
Sbjct  123  FQQKAPMGLVEQPPT-RAHFNTRYFAAQLDLGLPVSTVYFNAQKEPA  168



>gb|AFP33419.1| mother of FT and TFL1 [Arachis hypogaea]
 gb|AFP33422.1| mother of FT and TFL1 [Arachis hypogaea]
Length=176

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 133/173 (77%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M+  +VDPLVVGRVIGDV+DMFVP+V M+VYYG K +T+G D+KPSM    P+V + GG+
Sbjct  3    MMGASVDPLVVGRVIGDVIDMFVPSVGMSVYYGSKHVTNGCDIKPSMAISPPKVTLTGGN  62

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
                YTLVMTDPDAPSPSEP MRE +HW+V DIPG T+  T+GKE V YMGP+P VGIHR
Sbjct  63   IHSLYTLVMTDPDAPSPSEPTMREWLHWVVVDIPGGTNP-TQGKEIVAYMGPRPPVGIHR  121

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            YIL+LF+QK VLG ++ P  +R +F TR FA    L  PVATVYFN+ KEPA+
Sbjct  122  YILILFEQKGVLGGVEQP-AARASFNTRYFARQFNLGLPVATVYFNSQKEPAS  173



>gb|ABK22769.1| unknown [Picea sitchensis]
 gb|ACN40175.1| unknown [Picea sitchensis]
Length=174

 Score =   218 bits (554),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+ DPLVVGRVIGDV+DMFVP+ DMAVYYG K +T+G ++KPS   DRP+V I G     
Sbjct  3    RSTDPLVVGRVIGDVIDMFVPSNDMAVYYGSKQVTNGCEIKPSATVDRPKVQIAGRHFDD  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVMTDPDAPSPSEP MRE VHW+VTDIPG T D  +G+E +PYMGP+P +GIHRYI
Sbjct  63   SLYTLVMTDPDAPSPSEPNMREWVHWVVTDIPGAT-DAAQGREILPYMGPRPPIGIHRYI  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
             VLF+Q   +  + PP  +RNNF TRAFA    L  PV+  YFNA KEP 
Sbjct  122  FVLFKQSGPMVMMMPP-QARNNFSTRAFASEYSLGLPVSAAYFNAQKEPG  170



>ref|XP_010097584.1| hypothetical protein L484_017394 [Morus notabilis]
 gb|EXB69116.1| hypothetical protein L484_017394 [Morus notabilis]
Length=172

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 134/169 (79%), Gaps = 4/169 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMF+PT+ ++VY+G K +T+G D+KPS+    P+V I G S + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFIPTLSVSVYFGSKHVTNGCDIKPSIAISPPKVAISGHSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T+   +GKE +PY+GP+P VGIHR+ILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTNP-NRGKEILPYVGPRPPVGIHRFILVL  122

Query  523  FQQKKVLGEL-QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+QK  LG + QPP  +R NF TR FA +L+L  PVATVYFN+ KEPA+
Sbjct  123  FRQKAPLGLVDQPP--TRANFNTRYFAGNLDLGLPVATVYFNSQKEPAS  169



>ref|XP_004235817.1| PREDICTED: protein MOTHER of FT and TF 1 [Solanum lycopersicum]
Length=173

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 3/168 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
             VDPLVVGRVIGDVVDMFVP+V M+V+Y  K + +G D+KPS+  + P++ IGG   +FY
Sbjct  4    KVDPLVVGRVIGDVVDMFVPSVTMSVHYANKHVNNGCDIKPSIATEPPKIAIGGQPDEFY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIVTDIPG + ++ +GKE + Y+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPTMREWVHWIVTDIPGCS-NVGRGKEVLGYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGEL-QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+Q   + E+ Q PV +R +F TR FAH L+L  PVATVYFNAHKEPA
Sbjct  123  FRQNAPMQEIFQAPV-ARAHFRTRMFAHQLDLGVPVATVYFNAHKEPA  169



>gb|AFK45387.1| unknown [Lotus japonicus]
Length=189

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVP+V+M+VY+G K +T+G D+KPS+    P+V + G+    Y
Sbjct  21   SVDPLVVGRVIGDVVDMFVPSVNMSVYFGSKHVTNGCDIKPSICISPPKVTLTGNMDNLY  80

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP +RE +HWIV DIPG T+   +GKE +PY+GP+P VGIHR+I VL
Sbjct  81   TLVMTDPDAPSPSEPSLREWIHWIVVDIPGGTNP-NRGKEVLPYVGPRPPVGIHRFIFVL  139

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+QK+ LG ++ P T R +F TR FA  LEL  PVATVYFN+ KEPA 
Sbjct  140  FKQKRPLGLVEQPPT-RASFNTRYFAQQLELGLPVATVYFNSQKEPAT  186



>ref|XP_009403936.1| PREDICTED: protein MOTHER of FT and TF 1-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 2/167 (1%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIGDVVD+FVPT+ M V +G K + +G D+KPSM A+ P V I G     YT
Sbjct  5    VDPLVVGRVIGDVVDLFVPTISMMVRFGLKHVNNGCDIKPSMAANPPSVQIAGRQADLYT  64

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPDAPSPS+P MRE +HW+V ++PG T D ++G+EAVPYMGP+P VGIHRY+LVLF
Sbjct  65   LVMTDPDAPSPSDPTMREWLHWMVINMPGGT-DPSRGQEAVPYMGPRPPVGIHRYVLVLF  123

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            QQK  L  + PP T R NF TR+ A   +L  PVATVYFN+ KEPAA
Sbjct  124  QQKSRLPGVAPPAT-RANFNTRSLAAQYDLGLPVATVYFNSQKEPAA  169



>ref|XP_008374830.1| PREDICTED: protein MOTHER of FT and TF 1 [Malus domestica]
 ref|XP_009347832.1| PREDICTED: protein MOTHER of FT and TF 1-like [Pyrus x bretschneideri]
Length=192

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 134/172 (78%), Gaps = 4/172 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            ++  +VDPLVVGRVIGDVVDMFVPT+ M+VY+G K +T+G D+KPSM  + P++   G  
Sbjct  20   LMAASVDPLVVGRVIGDVVDMFVPTLSMSVYFGSKHVTNGCDIKPSMAINPPKITFTGHP  79

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + YTLVMTDPDAPSPSEP MRE VHWIV+DIPG T+ + +GKE +PY+GP+P VGIHRY
Sbjct  80   GELYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNPL-RGKEILPYVGPRPPVGIHRY  138

Query  511  ILVLFQQKKVLGEL-QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            ILVLFQQK  +G + QPP  SR +F TR FA  L+L  PV+TVYFN  KEPA
Sbjct  139  ILVLFQQKAPVGLVEQPP--SRAHFNTRFFAAQLDLGLPVSTVYFNCQKEPA  188



>ref|XP_004136734.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis sativus]
 gb|KGN59303.1| hypothetical protein Csa_3G807330 [Cucumis sativus]
Length=176

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPT  M+VY+  K +T+G D+KPS+  + PR+ I G     Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTATMSVYFNSKHVTNGCDIKPSLAVNPPRLVISGHPCDLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWI+ DIPG   ++T+GKE VPY GP+P +GIHRYIL+L
Sbjct  64   TLVMTDPDAPSPSEPHMREWVHWIIVDIPGGA-NLTQGKEIVPYSGPRPPIGIHRYILLL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+QK  +G +  P  SR NF TR FA H  LD PVA  YFN+ KEPA
Sbjct  123  FKQKGPIGMIDQP-ASRANFNTRLFARHFNLDLPVAATYFNSQKEPA  168



>gb|AJD87372.1| MFT [Fragaria x ananassa]
Length=172

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFV TV+M+VY+G K +T+G D+KPS+    P V   G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVLTVNMSVYFGSKHVTNGCDIKPSLAVSPPTVTFSGHPGELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWI+ DIPG T+ I +GKE +PY+GP+P VGIHRYILVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWILADIPGGTNPI-RGKEILPYVGPRPPVGIHRYILVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +G ++ P T R +F TR FA  L+L  PV+TVYFNA KEPA
Sbjct  123  FQQKAPMGLVEQPPT-RAHFNTRYFAAQLDLGPPVSTVYFNAQKEPA  168



>ref|XP_008443056.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis melo]
Length=176

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPT  M+VY+  K +T+G D+KPS+  + PR+ I G     Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTATMSVYFNSKHVTNGCDIKPSLAVNPPRLVISGHPCDLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWI+ DIPG   ++++GKE VPY GP+P +GIHRYIL+L
Sbjct  64   TLVMTDPDAPSPSEPHMREWVHWIIVDIPGGA-NLSQGKEIVPYSGPRPPIGIHRYILLL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+QK  +G +  P  SR NF TR FA H  LD PVA  YFN+ KEPA
Sbjct  123  FKQKGPIGMIDQP-ASRANFNTRLFARHFNLDLPVAATYFNSQKEPA  168



>gb|AIJ02001.1| mother of FT and TFL1-like 1 [Pinus sylvestris]
Length=174

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 124/170 (73%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+ DPLVVGRVIGDV+DMFVP++DMAVYYG K +T+G ++KPS   DRP V I G     
Sbjct  3    RSTDPLVVGRVIGDVIDMFVPSMDMAVYYGSKQVTNGCEIKPSATVDRPNVQIAGRHFDE  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVMTDPDAPSPSEP MRE VHWIVTDIPG T D  +G+E +PYMGP+P +GIHRYI
Sbjct  63   SLYTLVMTDPDAPSPSEPNMREWVHWIVTDIPGAT-DAAQGREILPYMGPRPPIGIHRYI  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
             VLF+Q   +  +  P  +RNNF TRAFA    L  PV+  YFNA KEP 
Sbjct  122  FVLFKQPGPMVMMM-PPQARNNFSTRAFASQYSLGLPVSAAYFNAQKEPG  170



>gb|AHM25239.1| flowering locus T [Agapanthus praecox subsp. orientalis]
Length=177

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIG+VVD+FVPT+ M+V YG K I +G DVKPS+ A+ P V++GG  ++ YT
Sbjct  7    VDPLVVGRVIGEVVDLFVPTLTMSVSYGSKHINNGCDVKPSIAAEPPTVNLGGRMSELYT  66

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVM DPDAPSPS+P MRE VHW+V +IPG T D ++G+E VPYMGP+P +GIHRY+LVLF
Sbjct  67   LVMIDPDAPSPSDPTMREWVHWVVVNIPGGT-DPSQGQEVVPYMGPRPPLGIHRYVLVLF  125

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +QK  L  + PP  SR NF TR FA   +L  PVATVYFNA KEPA+
Sbjct  126  RQKAGLPGITPP-ESRANFNTRYFAARYDLGLPVATVYFNAQKEPAS  171



>gb|AEH59565.1| MFT1-like protein [Picea abies]
Length=174

 Score =   213 bits (542),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 123/170 (72%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+ DPLVVGRVIGDV+DMFVP+ DMAVYYG K +  G ++KPS   DRP+V I G     
Sbjct  3    RSTDPLVVGRVIGDVIDMFVPSNDMAVYYGSKQVRDGCEIKPSATVDRPKVQIAGRHFDD  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVMTDPD+PSPSEP MRE VHW+VTDIPG T D  +G+E +PYMGP+P +GIHRYI
Sbjct  63   SLYTLVMTDPDSPSPSEPNMREWVHWVVTDIPGAT-DAAQGREILPYMGPRPPIGIHRYI  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
             VLF+Q   +  + PP  +RNNF TRAFA    L  PV+  YFNA KEP 
Sbjct  122  FVLFKQSGPMVMMVPP-QARNNFSTRAFASEYSLGLPVSAAYFNAQKEPG  170



>gb|ACA24491.1| mother of flowering locus T-like protein [Glycine max]
Length=190

 Score =   213 bits (542),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  ISKMMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI  318
            I+ +++  +VDPLVVGRVIGDVVDMF+P+V+M+VY+G K +T+G D+KPS+    P++ +
Sbjct  14   ITFVVMAASVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPKLTL  73

Query  319  GGDSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVG  498
             G+    YTLVMTDPDAPSPSEP MRE +HWI+ DIPG T+   +GKE V Y+GP+P +G
Sbjct  74   TGNMDNLYTLVMTDPDAPSPSEPSMREWIHWILVDIPGGTNPF-RGKEIVSYVGPRPPIG  132

Query  499  IHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            IHRYI VLFQQK  LG ++ P T R +F TR FA  L+L  PVATVYFN+ KEPA
Sbjct  133  IHRYIFVLFQQKGPLGLVEQPPT-RASFNTRYFARQLDLGLPVATVYFNSQKEPA  186



>gb|AHY23236.1| flowering locus T [Agapanthus praecox subsp. orientalis]
Length=177

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIG+VVD+FVPT+ M+V YG K I +G DVKPS+ A+ P V++GG  ++ YT
Sbjct  7    VDPLVVGRVIGEVVDLFVPTLTMSVSYGSKHINNGCDVKPSIAAEPPTVNLGGRMSELYT  66

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVM DPDAPSPS+P MRE VHW+V +IPG T D ++G+E VPYMGP+P +GIHRY+LVLF
Sbjct  67   LVMIDPDAPSPSDPTMREWVHWVVVNIPGGT-DPSQGQEVVPYMGPRPPLGIHRYVLVLF  125

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +QK  L  + PP  SR NF TR FA   +L  PVATVYFNA KEPA+
Sbjct  126  RQKAGLPVITPP-ESRANFNTRYFAARYDLGLPVATVYFNAQKEPAS  171



>ref|XP_007036755.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 2 [Theobroma cacao]
 gb|EOY21256.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 2 [Theobroma cacao]
Length=159

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 125/168 (74%), Gaps = 15/168 (9%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV M+VYYG + +T+G D+KPS   + P+           
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVTMSVYYGSRHVTNGCDIKPSTTINPPK-----------  52

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
              VMTDPDAPSPSEP MRE VHWIV+DIPG T+  T+GKE + YMGP+P VGIHRYILVL
Sbjct  53   --VMTDPDAPSPSEPSMREWVHWIVSDIPGGTNP-TRGKEILVYMGPRPPVGIHRYILVL  109

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            FQQK  LG++Q P  SR NF TR FA HL L  PVATVYFNA KEP +
Sbjct  110  FQQKGPLGQVQQP-ASRANFSTRLFAQHLNLGQPVATVYFNAQKEPVS  156



>gb|ABF65987.1| CETS1 [Glycine max]
Length=172

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMF+P+V+M+VY+G K +T+G D+KPS+    P++ + G+    Y
Sbjct  4    SVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPKLTLTGNMDNLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE +HWI+ DIPG T+   +GKE V Y+GP+P +GIHRYI VL
Sbjct  64   TLVMTDPDAPSPSEPSMREWIHWILVDIPGGTNPF-RGKEIVSYVGPRPPIGIHRYIFVL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  LG ++ P T R +F TR FA  L+L  PVATVYFN+ KEPA
Sbjct  123  FQQKGPLGLVEQPPT-RASFNTRYFARQLDLGLPVATVYFNSQKEPA  168



>ref|XP_008360924.1| PREDICTED: LOW QUALITY PROTEIN: protein MOTHER of FT and TF 1-like 
[Malus domestica]
Length=172

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV M+VY+G K +T+G D+KPSM  + P++ + G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVSMSVYFGSKHVTNGCDIKPSMAINPPKITVSGHPGELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWIV+DIPG ++ + +GKE +PY+GP+P VGIHR ILV 
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVSDIPGGSNPL-RGKEILPYVGPRPPVGIHRXILVX  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +G ++    SR +F TR FA  L+L  PV+TVYFN+ KEPA
Sbjct  123  FQQKAPMGLVE-QXPSRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA  168



>ref|NP_001236894.1| uncharacterized LOC100306314 precursor [Glycine max]
 gb|ACU14433.1| unknown [Glycine max]
Length=190

 Score =   211 bits (538),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = +1

Query  139  ISKMMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI  318
            I+ +++  +VDPLVVGRVIGDVVDMF+P+V+M+VY+G K +T+G D+KPS+    P++ +
Sbjct  14   ITFVVMAASVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPKLAL  73

Query  319  GGDSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVG  498
             G+    YTLVMTDPDAPSPSEP MRE +HWI+ DIPG T+   +GKE V Y+GP+P +G
Sbjct  74   TGNMDNLYTLVMTDPDAPSPSEPSMREWIHWILVDIPGGTNPF-RGKEIVSYVGPRPPIG  132

Query  499  IHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            IHRYI VLFQQK  LG ++ P T R +F TR FA  L+L  PVATVYFN+ KEP 
Sbjct  133  IHRYIFVLFQQKGPLGLVEQPPT-RASFNTRYFARQLDLGLPVATVYFNSQKEPT  186



>ref|XP_009387733.1| PREDICTED: protein MOTHER of FT and TF 1-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIGDVVD+FVPT++M V +G K + +G D+KPSM A+ P V+I G  +  YT
Sbjct  5    VDPLVVGRVIGDVVDLFVPTINMTVSFGSKHVNNGCDIKPSMAANPPSVYISGQQSDLYT  64

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPDAPSPS+P MRE +HW+V ++PG T D ++G+EAVPYMGP P VGIHRY+LVLF
Sbjct  65   LVMTDPDAPSPSDPTMREWLHWMVINMPGGT-DPSRGEEAVPYMGPAPRVGIHRYVLVLF  123

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            +QK  L  +  P T R NF TR FA   +L  PVATV+FN+ KEPA
Sbjct  124  RQKSRLPGVASPAT-RANFNTRWFAAQHDLSFPVATVFFNSQKEPA  168



>gb|ABB90591.1| terminal flower 1 [Aquilegia formosa]
Length=166

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 124/165 (75%), Gaps = 3/165 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVG+VIGDVVDMF+PT++M+VYYG K +T+G D+KPS+    P VHI G S + Y
Sbjct  4    SVDPLVVGKVIGDVVDMFIPTINMSVYYGSKHVTNGCDIKPSLATAPPTVHISGFSDELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVM+DPDAPSPSEP  RE +HWIV +IPG  + +T+GKE +PYMGP P VGIHRY L+L
Sbjct  64   TLVMSDPDAPSPSEPTKREWLHWIVVNIPGAGY-VTRGKEVLPYMGPAPPVGIHRYALLL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
            F+QK  L    PP+  R NF TR FAH  +L  PVA  YFNA KE
Sbjct  123  FRQKNPLSIDNPPL--RANFKTRNFAHQFDLGLPVACAYFNAQKE  165



>ref|XP_004169652.1| PREDICTED: LOW QUALITY PROTEIN: protein MOTHER of FT and TF 1-like 
[Cucumis sativus]
Length=176

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 124/167 (74%), Gaps = 2/167 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPT  M+VY+  K +T+G D+KPS+  + PR+ I G     Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTATMSVYFNSKHVTNGCDIKPSLAVNPPRLVISGHPCDLY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE VHWI+ DIPG   ++T+GKE VPY GP+P +GIHRYIL+L
Sbjct  64   TLVMTDPDAPSPSEPHMREWVHWIIVDIPGGA-NLTQGKEIVPYSGPRPPIGIHRYILLL  122

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+QK  +G +  P  SR NF TR FA    LD PVA  YFN+ KEPA
Sbjct  123  FKQKGPIGMIDQP-ASRANFNTRLFAGISSLDLPVAATYFNSQKEPA  168



>ref|XP_008240174.1| PREDICTED: protein MOTHER of FT and TF 1 [Prunus mume]
Length=178

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 130/172 (76%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPTV+M+VY+G K +T+G D+KPSM  + P++ + G   + Y
Sbjct  4    SVDPLVVGRVIGDVVDMFVPTVNMSVYFGSKHVTNGCDIKPSMAINPPKITVSGQPGELY  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDI-----TKGKEAVPYMGPKPTVGIHR  507
            TLVMTDPDAPSPSEP MRE VHWIV DIPG T  +     T  K+ + Y+GP+P VGIHR
Sbjct  64   TLVMTDPDAPSPSEPSMREWVHWIVADIPGGTSPVRGKIFTLYKKILAYVGPRPPVGIHR  123

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            YILVLFQQK  +G ++   +SR +F TR FA  L+L  PV+TVYFN+ KEPA
Sbjct  124  YILVLFQQKGPMGLVE-QQSSRAHFNTRFFAAQLDLGLPVSTVYFNSQKEPA  174



>ref|XP_008787928.1| PREDICTED: protein MOTHER of FT and TF 1-like [Phoenix dactylifera]
Length=175

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 123/168 (73%), Gaps = 3/168 (2%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIGDVVD+FVPT+ M+V YG K + +G DVKPSM  + P   I G     YT
Sbjct  5    VDPLVVGRVIGDVVDLFVPTMSMSVSYGSKHVNNGCDVKPSMAINPPTAQIAGQRADLYT  64

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPDAPSPS+P MRE +HW+V +IPG T DI++G+EAV YMGP+P +GIHRY+LVLF
Sbjct  65   LVMTDPDAPSPSDPTMREWLHWVVVNIPGGT-DISRGEEAVAYMGPRPPLGIHRYVLVLF  123

Query  526  QQKK--VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            QQK    +G       SR NF TRAFA   +L  PVA VYFNA KEPA
Sbjct  124  QQKSRFSMGAGVSLPASRANFNTRAFAARHDLGLPVAAVYFNAQKEPA  171



>ref|XP_010274753.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nelumbo nucifera]
Length=222

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 129/173 (75%), Gaps = 5/173 (3%)
 Frame = +1

Query  148  MMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD  327
            M V   VDPLVVGRVIGDVVDMFVPTV M+ Y+G + IT+G D+KPSM  + P+V + G 
Sbjct  46   MSVAAAVDPLVVGRVIGDVVDMFVPTVTMSAYFGTEHITNGCDIKPSMAVNPPKVVVSGR  105

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
            +   YTLVMTDPDAPSPS+P MRE VHWIV DIPG T+ I +GK+ +PY+GP+P+VGIHR
Sbjct  106  NDDLYTLVMTDPDAPSPSQPTMREWVHWIVVDIPGGTNPI-RGKDIMPYVGPQPSVGIHR  164

Query  508  YILVLFQQKKVLG---ELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
            YILVLF QK  +    +LQ P T R NF TR FA   +L  PVATVYFNA KE
Sbjct  165  YILVLFSQKNPVKDSIQLQQPAT-RVNFNTREFAKQHDLGLPVATVYFNAQKE  216



>ref|XP_010936814.1| PREDICTED: protein MOTHER of FT and TF 1-like [Elaeis guineensis]
Length=175

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 125/170 (74%), Gaps = 7/170 (4%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIG+VVD+FVPT+ M+V YG K + +G D+KPSM  + P V I G  +  YT
Sbjct  5    VDPLVVGRVIGEVVDLFVPTMSMSVNYGSKHVNNGCDMKPSMAINPPTVQITGRGSDLYT  64

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPDAPSPSEP MRE +HW+V +IPG T D ++G+E VPYMGP+P VGIHRY+LVLF
Sbjct  65   LVMTDPDAPSPSEPTMREWLHWVVVNIPGGT-DPSQGEEVVPYMGPRPPVGIHRYVLVLF  123

Query  526  QQKKV----LGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            QQK      +G   P   SR NF TRAFA   +L  PVA VYFNA KEPA
Sbjct  124  QQKSRFSMGIGLSLP--ASRANFNTRAFAAQRDLGLPVAVVYFNAQKEPA  171



>ref|XP_009393599.1| PREDICTED: protein MOTHER of FT and TF 1-like [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 2/168 (1%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIGDVVD+FVPTV M V +G K +++G D+KPSM A+ P V I G  +  
Sbjct  3    RYVDPLVVGRVIGDVVDLFVPTVSMTVRFGSKHVSNGCDIKPSMAANPPTVQIAGQQSDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVMTDPDAPSPS+P MRE +HW++ ++PG T   ++G+E VPYMGP+  +GIHRY++V
Sbjct  63   YTLVMTDPDAPSPSDPTMREWLHWMMVNMPGGTFP-SQGEEVVPYMGPRLPLGIHRYVMV  121

Query  520  LFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+QK     + PP T R NF TR+FA H +L  PVATVYFN+ KEPA
Sbjct  122  LFRQKSRFPGVTPPAT-RLNFNTRSFAAHHDLGLPVATVYFNSQKEPA  168



>ref|XP_006841865.1| hypothetical protein AMTR_s00003p00271590 [Amborella trichopoda]
 gb|ERN03540.1| hypothetical protein AMTR_s00003p00271590 [Amborella trichopoda]
Length=225

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 127/179 (71%), Gaps = 4/179 (2%)
 Frame = +1

Query  136  YISKMMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVH  315
            ++S  M R +V+PL VG+VIGDV+DMFVPTVD++V Y  K + +G ++KPS  A+RPR  
Sbjct  46   FLSPSMAR-SVEPLAVGKVIGDVIDMFVPTVDVSVSYVSKQVANGCELKPSGTAERPRFQ  104

Query  316  IGGDS--TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKP  489
            +   S     YTLVMTDPDAPSPSEP MRE +HWIV DIPG + D  +G+E V YMGPKP
Sbjct  105  LSARSLDDNLYTLVMTDPDAPSPSEPTMREWLHWIVVDIPGGS-DAMRGREIVSYMGPKP  163

Query  490  TVGIHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
              GIHRY+  LF+Q+  LG +     +RNNF TRAFA  L L  PVA VYFNA KEPA+
Sbjct  164  PTGIHRYVFSLFKQQGPLGSVARAPEARNNFSTRAFAARLGLGLPVAAVYFNAQKEPAS  222



>ref|XP_004967983.1| PREDICTED: protein MOTHER of FT and TF 1-like [Setaria italica]
Length=171

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R V+PLVVGRVIG+VVD+FVP++ M V YGPK I++G  +KPS  A  P V I G     
Sbjct  3    RFVEPLVVGRVIGEVVDLFVPSISMTVAYGPKDISNGRLLKPSATAAPPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTL+MTDPDAPSPS+P MRE +HWIVT+IPG T D TKG+E V YMGP+P VGIHRY+LV
Sbjct  63   YTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGT-DATKGEEVVEYMGPRPPVGIHRYVLV  121

Query  520  LFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+QK  +    P    R NF TRAFA   EL  P A VYFNA KEPA
Sbjct  122  LFEQKTRVNAEAP--GERANFNTRAFAAAHELGLPTAVVYFNAQKEPA  167



>ref|XP_006849745.1| hypothetical protein AMTR_s00024p00249400 [Amborella trichopoda]
 gb|ERN11326.1| hypothetical protein AMTR_s00024p00249400 [Amborella trichopoda]
Length=174

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVG+VIGDV+DMF+P+V   V+YGPK +T+G D+KPS+    P V I G     
Sbjct  3    RTVDPLVVGKVIGDVMDMFMPSVRFVVHYGPKQVTNGCDIKPSITVHPPNVQIAGHPDNL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            +T+VMTDPDAPSPSEP MRE VHWIVT+IPG + D ++G+E +PY+ P+P +GIHR+I V
Sbjct  63   FTIVMTDPDAPSPSEPSMREWVHWIVTNIPGGS-DPSQGREILPYIAPRPPIGIHRFIFV  121

Query  520  LFQQKKVLGELQPPVTS-RNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+Q+  L  +  P+ S R NF TRAFA H  L  PVA VYFNA KEPA
Sbjct  122  LFKQQTPLSLVAHPLPSTRANFSTRAFAAHNGLGLPVAAVYFNAQKEPA  170



>ref|XP_010277909.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nelumbo nucifera]
Length=175

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 5/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+++PLVVG+VIGDV+DMF PT++  V+YG K I +G ++KPS+VA++PRVH+ G   S 
Sbjct  3    RSIEPLVVGKVIGDVLDMFTPTIEFTVHYGSKQIANGCEIKPSVVANKPRVHLSGSRLSN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVMTDPDAPSPSEP +RE ++WIV DIP  + D T GKE V YMGP P  GIHRY+
Sbjct  63   SLYTLVMTDPDAPSPSEPNLREWLNWIVVDIPEGS-DATNGKEMVVYMGPSPPTGIHRYV  121

Query  514  LVLFQQKKVLGE-LQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
              LFQQK  + E ++ PV +R+NF TR+FA  + L  PVA VYFNA KEPA+
Sbjct  122  FALFQQKGPMTEGIRLPV-ARSNFSTRSFAAEIGLGLPVAAVYFNAQKEPAS  172



>ref|XP_003566347.1| PREDICTED: protein MOTHER of FT and TF 1-like [Brachypodium distachyon]
Length=175

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVD+FVP+V MAV YGPK I++G  +KPSM A +P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSVAMAVAYGPKDISNGCHIKPSMAAAQPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVMTDPDAPSPS+P MRE +HWIV +IPG T D TKG   VPYMGP P VGIHRY+LV
Sbjct  63   YTLVMTDPDAPSPSDPTMREYLHWIVVNIPGGT-DATKGDTVVPYMGPAPPVGIHRYVLV  121

Query  520  LFQQK-KVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+QK + +  +      R  F TRAFA   +L  PVA VYFN+ KEPA
Sbjct  122  LFEQKTRAVDGMTAAPADRAYFSTRAFAAAHDLGLPVAVVYFNSQKEPA  170



>ref|XP_002457494.1| hypothetical protein SORBIDRAFT_03g008270 [Sorghum bicolor]
 gb|EES02614.1| hypothetical protein SORBIDRAFT_03g008270 [Sorghum bicolor]
Length=171

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVD+FVP++ M V YGPK I++G  +KPS  A  P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYGPKDISNGCLLKPSATAAPPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTL+MTDPDAPSPS+P MRE +HWIVT+IPG T D +KG+E V YMGP+P VGIHRY+LV
Sbjct  63   YTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGT-DASKGEEVVEYMGPRPPVGIHRYVLV  121

Query  520  LFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+QK  +    P    R NF TRAFA   EL  P A VYFNA KEPA
Sbjct  122  LFEQKTRVHAEAP--RERANFNTRAFAAAHELGLPTAVVYFNAQKEPA  167



>ref|NP_001147266.1| MFT2 - Corn MFT-like protein [Zea mays]
 gb|ACG26468.1| MFT2 - Corn MFT-like protein [Zea mays]
Length=172

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVD+FVP+V M V YGPK I++G  +KPS  A  P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSVSMTVAYGPKDISNGCLLKPSATAAPPLVRISGRRDDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTL+MTDPDAPSPS+P MRE +HWIVT+IPG T D  KG+E V YMGP+P VGIHRY+LV
Sbjct  63   YTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGT-DANKGEEVVEYMGPRPPVGIHRYVLV  121

Query  520  LFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LFQQK  +    P    R NF TRAFA   EL  P A VYFNA KEPA
Sbjct  122  LFQQKTRVHAEGP--GERANFNTRAFAAAHELGLPTAVVYFNAQKEPA  167



>ref|XP_001764385.1| predicted protein [Physcomitrella patens]
 gb|EDQ70652.1| predicted protein [Physcomitrella patens]
Length=180

 Score =   202 bits (515),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 123/176 (70%), Gaps = 8/176 (5%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS--T  333
            R++DPLVVG+VIGDV+D FVP+VDMA++Y  + +T+G  +KPS  A  P + +  +S   
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSSRQVTNGCQMKPSATAQAPEIQLSDNSEGN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGN-----THDITKGKEAVPYMGPKPTVG  498
             +YTL+MTDPDAPSPSEP +RE +HWIVTDIPGN     TH  + G+E VPYMGP+P +G
Sbjct  63   NYYTLIMTDPDAPSPSEPSLREWLHWIVTDIPGNSGEQVTHTSSSGRELVPYMGPRPPIG  122

Query  499  IHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            IHRY  +LF+Q      + PP T RNNF TR FA H  L  PVA  Y NA KEP +
Sbjct  123  IHRYAFILFKQPSTPFLISPP-TVRNNFSTRNFASHYGLGLPVAATYCNAQKEPGS  177



>gb|KHN21660.1| Protein MOTHER of FT and TF 1 [Glycine soja]
Length=200

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 134/185 (72%), Gaps = 12/185 (6%)
 Frame = +1

Query  139  ISKMMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRP----  306
            I+ +++  +VDPLVVGRVIGDVVDMF+P+V+M+VY+G K +T+G D+KPS+    P    
Sbjct  14   ITFVVMAASVDPLVVGRVIGDVVDMFIPSVNMSVYFGSKHVTNGCDIKPSIAISPPTRPS  73

Query  307  ------RVHIGGDSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAV  468
                  ++ + G+    YTLVMTDPDAPSPSEP MRE +HWIV DIPG T+   +GKE V
Sbjct  74   IAISPPKLTLTGNMDNLYTLVMTDPDAPSPSEPSMREWIHWIVVDIPGGTNPF-RGKEIV  132

Query  469  PYMGPKPTVGIHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNA  648
             Y+GP+P +GIHRYI VLFQQK  LG ++  + +R +F TR FA  L+L  PVATVYFN+
Sbjct  133  SYVGPRPPIGIHRYIFVLFQQKGPLGLVE-QLPTRASFNTRYFARQLDLGLPVATVYFNS  191

Query  649  HKEPA  663
             KEPA
Sbjct  192  QKEPA  196



>ref|XP_001769136.1| predicted protein [Physcomitrella patens]
 gb|EDQ66008.1| predicted protein [Physcomitrella patens]
Length=176

 Score =   202 bits (515),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS--T  333
            R+VDPLVVGRVIGDV+DMF P+VDMAV Y  + +++G  +KPS   + P VH+ G++   
Sbjct  3    RSVDPLVVGRVIGDVIDMFAPSVDMAVVYTSRKVSNGCQMKPSATNEAPTVHVTGNNGDN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             F+TL+MTDPDAPSPSEP +RE VHWIVTDIPGN+   T GKE VPY+GP P +GIHRYI
Sbjct  63   NFFTLIMTDPDAPSPSEPSLREWVHWIVTDIPGNSSTTTSGKEVVPYVGPCPPIGIHRYI  122

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VLF+Q      L    + RNNF TR FA    L  PVA  YFNA KEP +
Sbjct  123  FVLFKQPTGKPLLVTAPSVRNNFNTRTFAVEHGLGFPVAATYFNAAKEPGS  173



>dbj|BAK78893.1| MFT [Triticum monococcum subsp. aegilopoides]
 gb|AGY34590.1| MFT-A1a [Triticum aestivum]
Length=175

 Score =   202 bits (514),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 125/172 (73%), Gaps = 6/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVDMFVP+V MAV YG + +++G  VKPS+ AD+P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVMTDPDAPSPSEP MRE +HWIV +IPG T D TKG+  VPYMGP+P VGIHRY+LV
Sbjct  63   YTLVMTDPDAPSPSEPTMREYLHWIVVNIPGGT-DATKGEVVVPYMGPRPPVGIHRYVLV  121

Query  520  LFQQKKVLGELQPPVTS---RNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            LF+QK     +  P  S   R  F TRAFA + EL  PVA VYFN+ KEP+ 
Sbjct  122  LFEQKTRFPYV--PAASPDDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSG  171



>dbj|BAK06374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVDMFVP+V MAV YG + +++G  VKPS+ AD+P V I G     
Sbjct  3    RCVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVMTDPDAPSPSEP MRE +HWIV +IPG T D TKG+  VPYMGP+P VGIHRY+LV
Sbjct  63   YTLVMTDPDAPSPSEPTMREYLHWIVVNIPGGT-DATKGEVVVPYMGPRPPVGIHRYVLV  121

Query  520  LFQQKKVLGELQPPV-TSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            LF+QK     +       R  F TRAFA + EL  PVA VYFN+ KEP+ 
Sbjct  122  LFEQKTRFPYVDAASPEDRAYFNTRAFAGNHELGLPVAVVYFNSQKEPSG  171



>ref|XP_010268882.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nelumbo nucifera]
Length=175

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  154  VRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--  327
            +RR+++PL VG+VIGDV+DMF PT++  V+YG K + +G ++KPS  A++P+V + G   
Sbjct  1    MRRSIEPLAVGKVIGDVLDMFSPTLEFTVHYGSKQVANGCEIKPSAAANKPKVQLSGSRL  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
            S   YTLVMTDPDAPSPSEP MRE +HWIV DI     D TKGKE V YMGP+P  GIHR
Sbjct  61   SNNLYTLVMTDPDAPSPSEPTMREWLHWIVVDI-AEGSDATKGKELVSYMGPRPPTGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            Y+  LFQQK  + E   P  +R +F TR FA    L  PVA VYFNA KEPA
Sbjct  120  YVFTLFQQKGPITEETRPPDARGSFNTRNFAAQNGLGLPVAAVYFNAQKEPA  171



>ref|NP_001106249.1| ZCN10 protein [Zea mays]
 ref|XP_008669500.1| PREDICTED: protein MOTHER of FT and TF 1-like [Zea mays]
 gb|ABW96233.1| ZCN10 [Zea mays]
 gb|ABX11012.1| ZCN10 [Zea mays]
 gb|ACG24375.1| MFT2 - Corn MFT-like protein [Zea mays]
 tpg|DAA38133.1| TPA: MFT2-Corn MFT-like protein [Zea mays]
 tpg|DAA53766.1| TPA: MFT2-Corn MFT-like protein [Zea mays]
Length=172

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVD+FVP+V M V YGPK I++G  +KPS  A  P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSVSMTVAYGPKDISNGCLLKPSATAAPPLVRISGRRDDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTL+MTDPDAPSPS+P MRE +HWIVT+IPG T D  KG+E V YMGP+P VGIHRY+LV
Sbjct  63   YTLIMTDPDAPSPSDPTMREYLHWIVTNIPGGT-DANKGEEVVEYMGPRPPVGIHRYVLV  121

Query  520  LFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+QK  +    P    R NF TRAFA   EL  P A VYFNA KEPA
Sbjct  122  LFEQKTRVHAEGP--GERANFNTRAFAAAHELGLPTAVVYFNAQKEPA  167



>gb|AEH59566.1| MFT2-like protein [Picea abies]
Length=175

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 123/171 (72%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            + V F+Q+  +  +  P   R+NF TRAFA    L  PVA VYFNA KEPA
Sbjct  122  VFVAFRQQDPMVMMMAPQV-RHNFSTRAFAAQYGLGLPVAAVYFNAQKEPA  171



>dbj|BAK78896.1| MFT [Triticum aestivum]
Length=175

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 124/172 (72%), Gaps = 6/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVDMFVP+V MAV YG + +++G  VKPS+ AD+P V I G     
Sbjct  3    RCVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVMTDPDAPSPSEP MRE +HWIV ++PG T D TKG+  VPYMGP+P VGIHRY+LV
Sbjct  63   YTLVMTDPDAPSPSEPTMREYLHWIVVNVPGGT-DATKGEVVVPYMGPRPPVGIHRYVLV  121

Query  520  LFQQKK---VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            LF+QK     +    P    R  F TRAFA + EL  PVA VYFN+ KEP+ 
Sbjct  122  LFEQKTRFPYVAAASP--DDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSG  171



>dbj|BAK78908.1| Mother of FT and TFL1 [Triticum aestivum]
 dbj|BAK78909.1| Mother of FT and TFL1 [Triticum aestivum]
 dbj|BAK78895.1| MFT [Triticum aestivum]
 dbj|BAK78894.1| MFT [Triticum monococcum]
 gb|AGY34591.1| MFT-A1b [Triticum aestivum]
Length=175

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 125/172 (73%), Gaps = 6/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVDMFVP+V MAV YG + +++G  VKPS+ AD+P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVMTDPDAPSPSEP M+E +HWIV +IPG T D TKG+  VPYMGP+P VGIHRY+LV
Sbjct  63   YTLVMTDPDAPSPSEPTMKEYLHWIVVNIPGGT-DATKGEVVVPYMGPRPPVGIHRYVLV  121

Query  520  LFQQKKVLGELQPPVTS---RNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            LF+QK     +  P  S   R  F TRAFA + EL  PVA VYFN+ KEP+ 
Sbjct  122  LFEQKTRFPYV--PAASPDDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSG  171



>ref|XP_008782387.1| PREDICTED: protein MOTHER of FT and TF 1-like [Phoenix dactylifera]
Length=175

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIG+VVD+FVPTV M V YG K + +G  VKPSM  + P V I G  +  YT
Sbjct  5    VDPLVVGRVIGEVVDLFVPTVTMTVSYGLKHVNNGCHVKPSMAINPPMVQIAGRGSDLYT  64

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LV  DPDAPSPSEP MRE +HW+V +IPG T D ++G+E VPYMGP+P VGIHRY+LVLF
Sbjct  65   LVTIDPDAPSPSEPTMREWLHWVVVNIPGGT-DPSQGEEVVPYMGPRPPVGIHRYVLVLF  123

Query  526  QQKK--VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            +QK    +G       SR NF TRAFA H +L  PVA VYFNA KEPA
Sbjct  124  RQKSRFSMGMGLSLPASRANFNTRAFAAHHDLGLPVAAVYFNAQKEPA  171



>ref|XP_009356062.1| PREDICTED: protein MOTHER of FT and TF 1-like [Pyrus x bretschneideri]
Length=192

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 127/172 (74%), Gaps = 4/172 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            ++  +VDPLVVGRVIGDVVDMFVPT+ M+VY+G K +T+G D+KPSM  + P++   G  
Sbjct  20   LMAASVDPLVVGRVIGDVVDMFVPTLSMSVYFGSKHVTNGCDIKPSMAINPPKITFTGHP  79

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + YTLVMTDPDAPSPSEP MRE VHWIV+DIPG T+ + +G   +P     P VGIHRY
Sbjct  80   GELYTLVMTDPDAPSPSEPSMREWVHWIVSDIPGGTNPL-RGNLQIPREKIFPPVGIHRY  138

Query  511  ILVLFQQKKVLGEL-QPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            ILVLFQQK  +G + QPP  SR +F TR FA  L+L  PV+TVYFN  KEPA
Sbjct  139  ILVLFQQKAPVGLVEQPP--SRAHFNTRFFAAQLDLGLPVSTVYFNCQKEPA  188



>ref|XP_010940015.1| PREDICTED: protein MOTHER of FT and TF 1-like [Elaeis guineensis]
Length=175

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFYT  345
            VDPLVVGRVIG+VVD+FVPT+ M+V YG K + +G DVKPSM  + P V I G     YT
Sbjct  5    VDPLVVGRVIGEVVDLFVPTMSMSVSYGTKHVNNGCDVKPSMAINPPTVQIAGRRADLYT  64

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPDAPSPS+P MRE +HW+V +IPG T D + G+E V YMGP+P VGIHRY LVLF
Sbjct  65   LVMTDPDAPSPSDPTMREWLHWVVVNIPGGT-DTSHGEEVVAYMGPRPPVGIHRYALVLF  123

Query  526  QQKKVL--GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            QQK     G       SR NF TR FA   +L  PVA VYFNA KEPA
Sbjct  124  QQKSRFSTGAGVALPASRANFNTRTFAARHDLGLPVAAVYFNAQKEPA  171



>gb|AGY34592.1| MFT-A1 [Triticum turgidum subsp. durum]
Length=175

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 124/172 (72%), Gaps = 6/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVDMFVP+V MAV YG + +++G  VKPS+ AD+P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDMFVPSVAMAVAYGARDLSNGCHVKPSLAADQPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVMTDPDAPSPSEP M+E +HWIV +IPG T D TKG+  VPYMGP+P VGIHRY LV
Sbjct  63   YTLVMTDPDAPSPSEPTMKEYLHWIVVNIPGGT-DATKGEVVVPYMGPRPPVGIHRYELV  121

Query  520  LFQQKKVLGELQPPVTS---RNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            LF+QK     +  P  S   R  F TRAFA + EL  PVA VYFN+ KEP+ 
Sbjct  122  LFEQKTRFPCV--PAASPDDRAYFNTRAFAANHELGLPVAVVYFNSQKEPSG  171



>gb|ACN54544.1| mother of FT and TFL1-like protein variant a [Physcomitrella 
patens]
Length=192

 Score =   199 bits (505),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 123/188 (65%), Gaps = 20/188 (11%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS--T  333
            R++DPLVVG+VIGDV+D FVP+VDMA++Y  + +T+G  +KPS  A  P + +  +S   
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSSRQVTNGCQMKPSATAQAPEIQLSDNSEGN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGN-----------------THDITKGKE  462
             +YTL+MTDPDAPSPSEP +RE +HWIVTDIPGN                 TH  + G+E
Sbjct  63   NYYTLIMTDPDAPSPSEPSLREWLHWIVTDIPGNSGGSETTSGFSWLQEQVTHTSSSGRE  122

Query  463  AVPYMGPKPTVGIHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYF  642
             VPYMGP+P +GIHRY  +LF+Q      + PP T RNNF TR FA H  L  PVA  Y 
Sbjct  123  LVPYMGPRPPIGIHRYAFILFKQPSTPFLISPP-TVRNNFSTRNFASHYGLGLPVAATYC  181

Query  643  NAHKEPAA  666
            NA KEP +
Sbjct  182  NAQKEPGS  189



>ref|XP_008441938.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis melo]
Length=174

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD-STQ  336
            R+VD LVVGRVIGDV+DMF P  D++V YG K + +G ++KP + ADRP VHI    S Q
Sbjct  3    RSVDSLVVGRVIGDVLDMFTPAADVSVSYGSKQVANGCEIKPFVAADRPTVHIQAPISNQ  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTLVM DPDAPSPSEP  RE +HWIV DIP    D  KGKE V YMGP+P  GIHRY+ 
Sbjct  63   LYTLVMVDPDAPSPSEPTFREWLHWIVVDIPEGA-DANKGKEVVQYMGPQPPTGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
              F+Q   LG    P T+R+NF TR FA    L  PVA VYFN+ K+PA+
Sbjct  122  AFFKQNTHLGGRLRPPTTRSNFSTRQFASQHALGLPVAAVYFNSQKQPAS  171



>gb|AGJ98454.1| MFT1 [Gossypium barbadense]
Length=175

 Score =   197 bits (501),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 120/172 (70%), Gaps = 5/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+V+PLVVGRVIGDV+DMF P  +  V YG K +T+G D+KPS  AD+P V I G   S+
Sbjct  3    RSVEPLVVGRVIGDVLDMFTPASEFTVRYGTKQVTNGCDIKPSAAADKPHVQILGHPFSS  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVM DPDAPSPSEP +RE +HWIV DIP    D TKG+E V YMGP+P  GIHRYI
Sbjct  63   NLYTLVMVDPDAPSPSEPRLREWLHWIVVDIP-EGQDATKGRELVAYMGPQPPTGIHRYI  121

Query  514  LVLFQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            L LF+Q+  + G +Q    +R NF TR FA    L  PVA VYFN+ KEPAA
Sbjct  122  LALFKQEGAMEGRIQ-VAGARANFSTRRFAAQNRLGLPVAAVYFNSQKEPAA  172



>gb|KHG10593.1| Protein MOTHER of FT and TF 1 -like protein [Gossypium arboreum]
Length=175

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 120/172 (70%), Gaps = 5/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+V+PLVVGRVIGDV+DMF P  +  V YG K +T+G D+KPS  AD+P V I G   S+
Sbjct  3    RSVEPLVVGRVIGDVLDMFTPASEFTVRYGTKQVTNGCDIKPSAAADKPHVQILGHPFSS  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVM DPDAPSPSEP +RE +HWIV DIP    D TKG+E V YMGP+P  GIHRYI
Sbjct  63   NLYTLVMVDPDAPSPSEPRLREWLHWIVVDIP-EGQDATKGRELVAYMGPQPPTGIHRYI  121

Query  514  LVLFQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            L LF+Q+  + G +Q    +R NF TR FA    L  PVA VYFN+ KEPAA
Sbjct  122  LALFKQEGAMEGRIQ-VADARANFSTRRFAAQNRLGLPVAAVYFNSQKEPAA  172



>gb|EAY84662.1| hypothetical protein OsI_06032 [Oryza sativa Indica Group]
Length=174

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 122/170 (72%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVD+FVP++ M   YG + I++G  V+PS     P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTAAYGDRDISNGCLVRPSAADYPPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTL+MTDPDAPSPS+P MRE +HWIV +IPG T D +KG+E V YMGP+PTVGIHRY+LV
Sbjct  63   YTLIMTDPDAPSPSDPSMREFLHWIVVNIPGGT-DASKGEEMVEYMGPRPTVGIHRYVLV  121

Query  520  LFQQKK--VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+QK   V G L PP   R NF TRAFA + +L  P A VYFN+ +EPA
Sbjct  122  LFEQKARFVDGALMPP-ADRPNFNTRAFAAYHQLGLPTAVVYFNSQREPA  170



>gb|AFW79812.1| MFT2-Corn MFT-like protein [Zea mays]
Length=172

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            R VDPLVVGRVIG+VVD+FVP++ M V Y GPK I++G  +KPS  A  P V I G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGPKDISNGCLLKPSATAAPPLVRISGRRND  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS P MRE +HWIV +IPG T D TKG+E V YMGP+P VGIHRY+L
Sbjct  63   LYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGT-DATKGEEVVEYMGPRPPVGIHRYVL  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK  +    P    R NF TRAFA   EL  P A VYFNA KEPA+
Sbjct  122  VLFEQKTRVHAEAP--GDRANFKTRAFAAAHELGLPTAVVYFNAQKEPAS  169



>ref|NP_001057701.1| Os06g0498800 [Oryza sativa Japonica Group]
 dbj|BAD45362.1| putative terminal flower 1 [Oryza sativa Japonica Group]
 dbj|BAF19615.1| Os06g0498800 [Oryza sativa Japonica Group]
 gb|EAZ01059.1| hypothetical protein OsI_23087 [Oryza sativa Indica Group]
Length=176

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVD+FVPT  M+V +G K +T+G ++KPS+ A  P V I G   + +
Sbjct  4    HVDPLVVGRVIGDVVDLFVPTTAMSVRFGTKDLTNGCEIKPSVAAAPPAVQIAGRVNELF  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
             LVMTDPDAPSPSEP MRE +HW+V +IPG T D ++G   VPYMGP+P VGIHRY++VL
Sbjct  64   ALVMTDPDAPSPSEPTMREWLHWLVVNIPGGT-DPSQGDVVVPYMGPRPPVGIHRYVMVL  122

Query  523  FQQKKVLGELQPPV-TSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK  +    P    +R  F TRAFA   +L  PVA +YFNA KEPA
Sbjct  123  FQQKARVAAPPPDEDAARARFSTRAFADRHDLGLPVAALYFNAQKEPA  170



>ref|XP_007025823.1| Phosphatidylethanolamine-binding protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY28445.1| Phosphatidylethanolamine-binding protein, putative isoform 1 
[Theobroma cacao]
Length=175

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 121/171 (71%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+V+PLVVGRVIGDV+D+F P  ++ V+Y  K + +G D+KPS  AD+P V I     S+
Sbjct  3    RSVEPLVVGRVIGDVLDIFTPAAELTVHYSTKQVHNGCDIKPSSAADKPHVRILSPVVSS  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVM DPDAP+PSEP +RE +HWIV DIP   HD TKGKE VPYMGP+P  GIHRYI
Sbjct  63   SLYTLVMVDPDAPTPSEPRLREWLHWIVVDIP-EGHDATKGKEMVPYMGPQPPTGIHRYI  121

Query  514  LVLFQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LVLF+Q++   G  Q P  +R NF TR FA    L  PVA VYFN+ KEPA
Sbjct  122  LVLFKQERATEGGCQLP-DARANFSTRQFAAQNSLGLPVAAVYFNSQKEPA  171



>ref|XP_001758845.1| predicted protein [Physcomitrella patens]
 gb|EDQ76351.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 5/173 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS--T  333
            R++DPL+VG+VIGDV+D FVP VDMA++Y  + +T+G  +KPS  A  P + +   S   
Sbjct  3    RSIDPLIVGKVIGDVIDTFVPRVDMAIHYSTRQVTNGCQLKPSATAQAPEIQLSDKSGDN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNT--HDITKGKEAVPYMGPKPTVGIHR  507
             +YTLVMTDPDAPSPSEP +RE +HWIVTDIPGN+   +   G++ VPY+GP+P +GIHR
Sbjct  63   NYYTLVMTDPDAPSPSEPSLREWLHWIVTDIPGNSGGSETNTGEKLVPYIGPRPPIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            YI VLF+Q      + PP  +RNNF TR FA +  L  PVA  Y N+ KEPA+
Sbjct  123  YIFVLFKQPSQSFLISPPA-ARNNFSTRNFAAYYGLGLPVAATYCNSQKEPAS  174



>ref|XP_010096797.1| hypothetical protein L484_002399 [Morus notabilis]
 gb|EXB66020.1| hypothetical protein L484_002399 [Morus notabilis]
Length=177

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 117/172 (68%), Gaps = 5/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG--DST  333
            R+++PLVVG+VIGDVVDMF P V++ V YG K + +G ++KPS  ADRP+  I G  +  
Sbjct  3    RSLEPLVVGKVIGDVVDMFSPAVELTVRYGSKQVGNGCEIKPSAAADRPKAQILGPPNHA  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVM DPDAPSPSEP +RE +HWIV DIP    D TKGKE VPYMGPKP  GIHRY+
Sbjct  63   NLYTLVMVDPDAPSPSEPTLREWLHWIVVDIP-EGLDATKGKEVVPYMGPKPPTGIHRYM  121

Query  514  LVLFQQKK--VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
              LF+Q+   +L    P   +R NF TR FA    L  PVA VYFN+ KEP 
Sbjct  122  FALFRQRSGTILAGNVPSPEARGNFRTRQFAAQYGLGLPVAAVYFNSQKEPG  173



>ref|NP_001106248.1| ZCN9 protein [Zea mays]
 gb|ABW96232.1| ZCN9 [Zea mays]
Length=172

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            R VDPLVVGRVIG+VVD+FVP++ M V Y G K I++G  +KPS  A  P V I G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGSKDISNGCLLKPSATAAPPLVRISGRRND  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS P MRE +HWIV +IPG T D TKG+E V YMGP+P VGIHRY+L
Sbjct  63   LYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGT-DATKGEEVVEYMGPRPPVGIHRYVL  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK  +    P    R NF TRAFA   EL  P A VYFNA KEPA+
Sbjct  122  VLFEQKTRVHAEAP--GDRANFKTRAFAAAHELGLPTAVVYFNAQKEPAS  169



>ref|NP_001041806.1| Os01g0111600 [Oryza sativa Japonica Group]
 dbj|BAB39886.1| putative SP2G [Oryza sativa Japonica Group]
 dbj|BAF03720.1| Os01g0111600 [Oryza sativa Japonica Group]
 dbj|BAG98997.1| unnamed protein product [Oryza sativa Japonica Group]
Length=174

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 122/170 (72%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVD+FVP++ M   YG + I++G  V+PS     P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTAAYGDRDISNGCLVRPSAADYPPLVRISGRRNDL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTL+MTDPDAPSPS+P MRE +HWIV +IPG T D +KG+E V YMGP+PTVGIHRY+LV
Sbjct  63   YTLIMTDPDAPSPSDPSMREFLHWIVVNIPGGT-DASKGEEMVEYMGPRPTVGIHRYVLV  121

Query  520  LFQQKK--VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            L++QK   V G L PP   R NF TRAFA + +L  P A V+FN+ +EPA
Sbjct  122  LYEQKARFVDGALMPP-ADRPNFNTRAFAAYHQLGLPTAVVHFNSQREPA  170



>ref|NP_001152713.1| MFT2 - Corn MFT-like protein [Zea mays]
 gb|ACG49094.1| MFT2 - Corn MFT-like protein [Zea mays]
Length=172

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            R VDPLVVGRVIG+VVD+FVP++ M V Y GPK I++G  +KPS  A  P V I G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGPKDISNGCLLKPSATAAPPLVRISGRRND  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS P MRE +HWIV +IPG T D TKG+E V YMGP+P VGIHRY+L
Sbjct  63   LYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGT-DATKGEEVVEYMGPRPPVGIHRYVL  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            VLF+QK  +    P    R NF T AFA   EL  P A VYFNA KEPA
Sbjct  122  VLFEQKTRVHAEAP--GDRANFKTHAFAAAHELGLPTAVVYFNAQKEPA  168



>gb|ABX11011.1| ZCN9 [Zea mays]
Length=172

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            R VDPLVVGRVIG+VVD+FVP++ M V Y G K I++G  +KPS  A  P V I G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGSKDISNGCLLKPSATAAPPLVRISGRRND  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS P MRE +HWIV +IPG T D TKG+E V YMGP+P VGIHRY+L
Sbjct  63   LYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGT-DATKGEEVVEYMGPRPPVGIHRYVL  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            VLF+QK  +    P    R NF TRAFA   EL  P A VYFNA KEPA
Sbjct  122  VLFEQKTRVHAEAP--GDRANFKTRAFAAAHELGLPTAVVYFNAQKEPA  168



>ref|XP_004232787.1| PREDICTED: protein MOTHER of FT and TF 1 [Solanum lycopersicum]
Length=181

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 118/172 (69%), Gaps = 4/172 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITS-GSDVKPSMVADRPRVHIGGD--S  330
            R+VDPLVVG+VIGDV+DMFVP VD  V Y  K I++ G ++KP+  A +PRVHI G   S
Sbjct  9    RSVDPLVVGKVIGDVLDMFVPVVDFTVEYASKQISNNGVEIKPAEAAQKPRVHIKGSLHS  68

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
               YTLVM DPDAPSPSEP  RE +HWIVTDIP    D ++G+E V YMGPKP  GIHRY
Sbjct  69   NNLYTLVMADPDAPSPSEPTFREWLHWIVTDIPEGG-DASQGREMVEYMGPKPPAGIHRY  127

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +  LF+QK+       P   R+NF TR FA    LD PVA +YFN+ KE AA
Sbjct  128  VFTLFRQKEAEQVPHKPPQGRSNFKTRQFASDNGLDLPVAALYFNSQKEHAA  179



>gb|AAO31791.1| SP2G [Solanum lycopersicum]
Length=178

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 118/172 (69%), Gaps = 4/172 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITS-GSDVKPSMVADRPRVHIGGD--S  330
            R+VDPLVVG+VIGDV+DMFVP VD  V Y  K I++ G ++KP+  A +PRVHI G   S
Sbjct  6    RSVDPLVVGKVIGDVLDMFVPVVDFTVEYASKQISNNGVEIKPAEAAQKPRVHIKGSLHS  65

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
               YTLVM DPDAPSPSEP  RE +HWIVTDIP    D ++G+E V YMGPKP  GIHRY
Sbjct  66   NNLYTLVMADPDAPSPSEPTFREWLHWIVTDIPEGG-DASQGREMVEYMGPKPPAGIHRY  124

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +  LF+QK+       P   R+NF TR FA    LD PVA +YFN+ KE AA
Sbjct  125  VFTLFRQKEAEQVPHKPPQGRSNFKTRQFASDNGLDLPVAALYFNSQKEHAA  176



>ref|XP_006449196.1| hypothetical protein CICLE_v10016917mg [Citrus clementina]
 gb|ESR62436.1| hypothetical protein CICLE_v10016917mg [Citrus clementina]
Length=176

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 119/170 (70%), Gaps = 6/170 (4%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI---GGDS  330
            R+++PLVVGRVIGDVVDMF P  +M V+YG K + +G ++KPS  AD+P V I      S
Sbjct  3    RSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPAPAS  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
            +  YTLVM DPDAPSPSEP  RE +HWIV DIP  + D TKGKE V YMGP+P  GIHRY
Sbjct  63   SNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGS-DATKGKELVAYMGPQPPTGIHRY  121

Query  511  ILVLFQQK-KVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
            + VLF QK KV+   +PP  +R+NF TR FA    L  PVA VYFN+ KE
Sbjct  122  VFVLFNQKGKVMAGCRPP-DARSNFSTRRFAADNGLQPPVAAVYFNSQKE  170



>ref|XP_004146579.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis sativus]
 ref|XP_004158023.1| PREDICTED: protein MOTHER of FT and TF 1-like [Cucumis sativus]
 gb|KGN64620.1| hypothetical protein Csa_1G071830 [Cucumis sativus]
Length=174

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD-STQ  336
            R+VD LVVGRVIGDV+DMF P  D++V YG K + +G ++KP + ADRP V I    S Q
Sbjct  3    RSVDSLVVGRVIGDVLDMFTPAADVSVSYGSKHVANGGEIKPFVAADRPTVLIQAPVSNQ  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTLVM DPDAPSPSEP  RE +HWIV DIP    D  KGKE V YMGP+P  GIHRY+ 
Sbjct  63   LYTLVMVDPDAPSPSEPTFREWLHWIVVDIPEGA-DANKGKEVVHYMGPQPPTGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             +F+Q   LG    P T+R+NF TR FA    L  PVA VYFN+ K+PA+
Sbjct  122  AVFKQNTPLGGRLRPPTTRSNFKTRQFASQNGLGLPVAAVYFNSQKQPAS  171



>gb|EMT22371.1| hypothetical protein F775_09897 [Aegilops tauschii]
Length=180

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 124/172 (72%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVPT+ + V +G K +T+G ++KPS+    P + I G +   +
Sbjct  4    HVDPLVVGRVIGDVVDMFVPTMPVTVRFGTKDLTNGCEIKPSIADAAPSIQIAGRAGDLF  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP M+E +HW+V +IPG + D ++G+E VPYMGPKP +GIHRY+LVL
Sbjct  64   TLVMTDPDAPSPSEPTMKEWLHWLVVNIPGGS-DPSQGEEVVPYMGPKPPLGIHRYVLVL  122

Query  523  FQQK-KVLGELQPPVTS----RNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            FQQK +VL       T+    R  F  RAFA   +L  PVA +YFNA KEPA
Sbjct  123  FQQKARVLAPAPGGDTAASAMRARFGPRAFAERHDLGLPVAAMYFNAQKEPA  174



>ref|XP_002990227.1| TF1-like protein [Selaginella moellendorffii]
 ref|XP_002992458.1| hypothetical protein SELMODRAFT_229690 [Selaginella moellendorffii]
 gb|EFJ06396.1| hypothetical protein SELMODRAFT_229690 [Selaginella moellendorffii]
 gb|EFJ08787.1| TF1-like protein [Selaginella moellendorffii]
Length=174

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 118/171 (69%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG--DST  333
            R++DPLV+GRVIGDV+DMFVP VDM+V YG K + +G ++KPS    RP V +G   +  
Sbjct  3    RSMDPLVLGRVIGDVLDMFVPAVDMSVCYGSKQVNNGCELKPSATQARPIVQVGSPHEEG  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVM DPDAPSPSEP MRE VHWIV DIPG   D ++G+E + Y+GPKP  GIHRYI
Sbjct  63   ALYTLVMVDPDAPSPSEPSMREWVHWIVADIPGGA-DASQGREILQYIGPKPPTGIHRYI  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             V+F+Q   +  L  P   RNNF TR FA    L  PV  VY+NA KEPA+
Sbjct  122  FVVFRQMGPV--LMLPPLMRNNFSTRWFAQEYFLGLPVGAVYYNAQKEPAS  170



>ref|XP_002436981.1| hypothetical protein SORBIDRAFT_10g013070 [Sorghum bicolor]
 gb|EER88348.1| hypothetical protein SORBIDRAFT_10g013070 [Sorghum bicolor]
Length=182

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 123/176 (70%), Gaps = 12/176 (7%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVD+FVPTV M+V +G K +T+G ++KPS+ A  P V I G +   +
Sbjct  4    HVDPLVVGRVIGDVVDLFVPTVAMSVRFGTKDVTNGCEIKPSLTAAAPVVQIAGRANDLF  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAV-PYMGPKPTVGIHRYILV  519
            TLVMTDPDAPSPSEP MREL+HW+V +IPG   D ++G E V PY+GP P VGIHRY+LV
Sbjct  64   TLVMTDPDAPSPSEPTMRELIHWLVVNIPGGA-DPSQGSETVMPYLGPCPPVGIHRYVLV  122

Query  520  LFQQKKVLGELQPPV--------TSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            ++QQK       PPV         SR  F  RAFA   +L  PVA +YFNA KEPA
Sbjct  123  VYQQKARF--RAPPVLAPGAEVEASRARFRNRAFADRHDLGLPVAAMYFNAQKEPA  176



>ref|XP_006643665.1| PREDICTED: protein MOTHER of FT and TF 1-like [Oryza brachyantha]
Length=174

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R VDPLVVGRVIG+VVD+FVP++ M   YG + I++G   +PS     P V I G     
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTAAYGDRDISNGCLGRPSAAXXPPLVRISGRRNHL  62

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTL+MTDPDAPSPS+P MRE +HWIV +IPG T D  KG+  V YMGP+P VGIHRY+LV
Sbjct  63   YTLIMTDPDAPSPSDPSMREYLHWIVVNIPGGT-DAFKGEAMVEYMGPRPPVGIHRYVLV  121

Query  520  LFQQKK--VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            LF+QK   V G + PP   R NF TRAFA H +L  P A VYFN+ +EPA
Sbjct  122  LFEQKARFVDGAMMPP-AGRANFNTRAFAAHHQLGLPTAVVYFNSQREPA  170



>gb|ACN54543.1| mother of FT and TFL1-like protein [Physcomitrella patens]
Length=192

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 122/188 (65%), Gaps = 20/188 (11%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS--T  333
            R++DPL+VG+VIGDV+D FVP VDMA++Y  + +T+G  +KPS  A  P + +   S   
Sbjct  3    RSIDPLIVGKVIGDVIDTFVPRVDMAIHYSTRQVTNGCQLKPSATAQAPEIQLSDKSGDN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGN-----------------THDITKGKE  462
             +YTLVMTDPDAPSPSEP +RE +HWIVTDIPGN                 T   + G+E
Sbjct  63   NYYTLVMTDPDAPSPSEPSLREWLHWIVTDIPGNSGGSETNTGFPWLSEQATSTSSSGRE  122

Query  463  AVPYMGPKPTVGIHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYF  642
             VPY+GP+P +GIHRYI VLF+Q      + PP  +RNNF TR FA +  L  PVA  Y 
Sbjct  123  LVPYIGPRPPIGIHRYIFVLFKQPSQSFLISPPA-ARNNFSTRNFAAYYGLGLPVAATYC  181

Query  643  NAHKEPAA  666
            N+ KEPA+
Sbjct  182  NSQKEPAS  189



>ref|XP_009757896.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nicotiana sylvestris]
Length=180

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 115/168 (68%), Gaps = 3/168 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG--DST  333
            R+VDPLVVG+VIGDVVDMFVP V+ +V YG K I++G ++KP+  A +PR+HI G  DS 
Sbjct  6    RSVDPLVVGKVIGDVVDMFVPVVEFSVEYGSKQISNGVEIKPAAAAHKPRLHIQGSPDSN  65

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVM DPDAPSPSEP  RE +HWIVTDIP    D ++G+E   YMGP+P  GIHRY+
Sbjct  66   NLYTLVMADPDAPSPSEPTFREWLHWIVTDIP-EGGDASEGRELTEYMGPQPPTGIHRYV  124

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
              LF+Q +       P   R NF TR FA    L  PVA +YFN+ KE
Sbjct  125  FTLFRQTEAEQVPHKPPAGRANFNTRKFASDNGLGLPVAALYFNSQKE  172



>ref|XP_006467912.1| PREDICTED: protein MOTHER of FT and TF 1-like [Citrus sinensis]
 gb|KDO75688.1| hypothetical protein CISIN_1g030480mg [Citrus sinensis]
Length=176

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 118/170 (69%), Gaps = 6/170 (4%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD---S  330
            R+++PLVVGRVIGDVVDMF P  +M V+YG K + +G ++KPS  AD+P V I      S
Sbjct  3    RSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPAS  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
            +  YTLVM DPDAPSPSEP  RE +HWIV DIP  + D TKGKE V YMGP+P  GIHRY
Sbjct  63   SNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGS-DATKGKELVAYMGPQPPTGIHRY  121

Query  511  ILVLFQQK-KVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
            +  LF QK KV+   +PP  +R+NF TR FA    L  PVA VYFN+ KE
Sbjct  122  VFALFNQKGKVMAGCRPP-DARSNFSTRRFAADNGLQPPVAAVYFNSQKE  170



>ref|XP_001778686.1| predicted protein [Physcomitrella patens]
 gb|EDQ56479.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 121/179 (68%), Gaps = 11/179 (6%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS--T  333
            R++DPLVVG+VIGDV+D FVP+VDMA++Y  + +T+G  + PS  A  P +H+   S   
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSTRQVTNGCQMMPSATAQAPEIHLSDKSGGN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNT--HDITK------GKEAVPYMGPKP  489
              YTL+M DPDAPSPSEP +RE +HWIVTDIPGN+   ++T       G+E VPYMGP+P
Sbjct  63   NLYTLIMIDPDAPSPSEPTLREWLHWIVTDIPGNSGGSEMTSAPSKSCGRELVPYMGPRP  122

Query  490  TVGIHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VGIHRYI VLF+Q      + PP T R+NF TR FA    L  PVA  Y NA KEP +
Sbjct  123  PVGIHRYIFVLFKQPLTPFHITPP-TVRSNFNTRYFAAQCGLGLPVAATYLNAQKEPGS  180



>ref|XP_002990226.1| hypothetical protein SELMODRAFT_229523 [Selaginella moellendorffii]
 gb|EFJ08786.1| hypothetical protein SELMODRAFT_229523 [Selaginella moellendorffii]
Length=170

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 116/169 (69%), Gaps = 5/169 (3%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG--DSTQF  339
            +DPLV+GRVIGDV+DMFVP VDM+V YG K + +G ++KPS    RP V +G   +    
Sbjct  1    MDPLVLGRVIGDVLDMFVPAVDMSVCYGSKQVNNGCELKPSATQARPIVQVGSPHEEGAL  60

Query  340  YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILV  519
            YTLVM DPDAPSPSEP MRE VHWIV DIPG   D ++G+E + Y+GPKP  GIHRYI V
Sbjct  61   YTLVMVDPDAPSPSEPSMREWVHWIVADIPGGA-DASQGREILQYIGPKPPTGIHRYIFV  119

Query  520  LFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +F+Q   +  L  P   RNNF TR FA    L  PV  VY+NA KEPA+
Sbjct  120  VFRQMGPV--LMLPPLMRNNFSTRWFAQEYFLGLPVGAVYYNAQKEPAS  166



>ref|XP_009589130.1| PREDICTED: protein MOTHER of FT and TF 1-like [Nicotiana tomentosiformis]
Length=184

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPK-AITSGSDVKPSMVADRPRVHIGG--DS  330
            R+VDPLVVG+VIGDV+DMFVP ++  V YG K  I++G ++KP+  A RPRVHI G  DS
Sbjct  9    RSVDPLVVGKVIGDVLDMFVPVIEFTVEYGSKKQISNGVEIKPAAAAQRPRVHIQGSRDS  68

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
               YTLVM DPDAPSPSEP  RE +HWIVTDIP    D ++G+E + YMG +P  GIHRY
Sbjct  69   NNLYTLVMADPDAPSPSEPTFREWLHWIVTDIP-EGGDASEGREVMEYMGAQPPTGIHRY  127

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            +  LF+Q +       P   R NF TR FA    L  PVA +YFN+HKE AA+
Sbjct  128  VFTLFRQTEAEQVPHKPPERRANFNTRKFASDNGLGFPVAALYFNSHKEHAAA  180



>ref|XP_006656987.1| PREDICTED: protein MOTHER of FT and TF 1-like [Oryza brachyantha]
Length=176

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVDMFVP   M+V +G K +T+G ++KPS+ A  P V I G +++ +
Sbjct  4    HVDPLVVGRVIGDVVDMFVPATAMSVRFGTKDLTNGCELKPSVAAAPPAVQIAGRASELF  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MRE +HW+V +IPG T D ++G+  VPYMGPKP VGIHRY+LVL
Sbjct  64   TLVMTDPDAPSPSEPSMREWLHWLVVNIPGGT-DPSQGEVVVPYMGPKPPVGIHRYVLVL  122

Query  523  FQQ-KKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F++   V         +R  F TRAFA    L  PVA  YFNA KEPA
Sbjct  123  FRRGAGVAAPPPDADAARARFSTRAFADRHGLGLPVAATYFNAQKEPA  170



>ref|XP_010686259.1| PREDICTED: protein MOTHER of FT and TF 1-like [Beta vulgaris 
subsp. vulgaris]
Length=189

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 116/170 (68%), Gaps = 3/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG--DST  333
            R++DPLVVGRVIGDV+DMFVP  D  V YG K I +G ++KPS+  +RP V I G   + 
Sbjct  17   RSIDPLVVGRVIGDVLDMFVPVADFRVQYGTKHIFNGCEIKPSLAIERPIVQISGIPSTD  76

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              Y+L+M DPDAPSPSEP MRE +HW+V DIP    D +KG+E V YMGPKP  GIHRY+
Sbjct  77   NHYSLIMVDPDAPSPSEPKMREWLHWVVADIPQGL-DASKGRELVEYMGPKPPTGIHRYV  135

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
             VLF+QK  + +      +RNNF TR FA    L  PVA VYFN+ KE A
Sbjct  136  FVLFRQKGPIAKPWQLPHARNNFSTRNFAIQNGLGLPVAAVYFNSQKEAA  185



>gb|KDP20872.1| hypothetical protein JCGZ_21343 [Jatropha curcas]
 gb|AID51390.1| mother of FT and TFL1 2 [Jatropha curcas]
 gb|AID51395.1| mother of FT and TFL1 2 [Jatropha curcas]
Length=175

 Score =   187 bits (475),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 118/171 (69%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--ST  333
            R+++PLVVG+VIG+V+DM+ P  +  V+YG K + +G ++KPS+ A +P VHI G   S+
Sbjct  3    RSLEPLVVGKVIGEVLDMYNPVAEFTVHYGSKQVANGCEIKPSVAAQKPHVHILGSRLSS  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTLVM DPDAPSPSEP  RE + WIV DIP  + D TKG E V YMGP+P  GIHRY+
Sbjct  63   DLYTLVMVDPDAPSPSEPKWREWLLWIVVDIPEGS-DATKGHELVSYMGPQPPTGIHRYV  121

Query  514  LVLFQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
              LF+QK  L G +QPP   R NF TR FA    L  PVA VYFN+ KEPA
Sbjct  122  FALFKQKGALMGRIQPP-DGRGNFNTRHFAAQSGLGLPVAAVYFNSQKEPA  171



>ref|XP_004246534.1| PREDICTED: CEN-like protein 2 [Solanum lycopersicum]
 gb|AAO31795.1| SP9D [Solanum lycopersicum]
Length=172

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 121/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R+++PL+VGRVIGDV+D F PT+ M++ Y  K + +G ++ PS+V+ RP+V + GGD   
Sbjct  3    RSLEPLIVGRVIGDVIDSFNPTIKMSITYNNKLVCNGHELFPSVVSSRPKVEVQGGDLRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P MRE +HWI+TDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYMREHLHWIITDIPGTT-DATFGRELVSYETPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK      QP  TSR++F TR FA    L+ PV  V+FNA +E AA
Sbjct  122  VLFKQKSRSSVSQP--TSRDHFNTRNFAQENNLEQPVTAVFFNAQRETAA  169



>gb|AFW79811.1| hypothetical protein ZEAMMB73_034486 [Zea mays]
Length=190

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 120/188 (64%), Gaps = 22/188 (12%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            R VDPLVVGRVIG+VVD+FVP++ M V Y GPK I++G  +KPS  A  P V I G    
Sbjct  3    RFVDPLVVGRVIGEVVDLFVPSISMTVAYDGPKDISNGCLLKPSATAAPPLVRISGRRND  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITK------------------GKE  462
             YTL+MTDPDAPSPS P MRE +HWIV +IPG T D TK                  G+E
Sbjct  63   LYTLIMTDPDAPSPSNPTMREYLHWIVINIPGGT-DATKAHAKRRHRSALTRAGVGAGEE  121

Query  463  AVPYMGPKPTVGIHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYF  642
             V YMGP+P VGIHRY+LVLF+QK  +    P    R NF TRAFA   EL  P A VYF
Sbjct  122  VVEYMGPRPPVGIHRYVLVLFEQKTRVHAEAP--GDRANFKTRAFAAAHELGLPTAVVYF  179

Query  643  NAHKEPAA  666
            NA KEPA+
Sbjct  180  NAQKEPAS  187



>gb|ABK25607.1| unknown [Picea sitchensis]
Length=172

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 121/172 (70%), Gaps = 8/172 (5%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R V+PLVVGRVIGDV+DMFVP+VD+AV Y  + + +G ++KPS +A  PRV IGG D   
Sbjct  3    RFVEPLVVGRVIGDVLDMFVPSVDLAVTYASRQVNNGCELKPSALALLPRVDIGGEDLRN  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVMTDPDAPSPS+P +RE + WIVTDIP  T   + G+E V Y  P+PT+GIHR+I 
Sbjct  63   FYTLVMTDPDAPSPSDPTLREYLQWIVTDIPATTS-ASFGRELVSYESPRPTIGIHRFIF  121

Query  517  VLFQQKKVLGE--LQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q   +G   + PP  SR NF TR FA    L  PVA VYFNA KE A 
Sbjct  122  VLFKQ---MGRQTVYPP-GSRLNFNTRNFALSNSLGLPVAAVYFNAQKEAAG  169



>gb|ACN54547.1| mother of FT and TFL1-like protein [Physcomitrella patens]
Length=192

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 121/188 (64%), Gaps = 20/188 (11%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS--T  333
            R++DPLVVG+VIGDV+D FVP+VDMA++Y  + +T+G  + PS  A  P +H+   S   
Sbjct  3    RSIDPLVVGKVIGDVIDTFVPSVDMAIHYSTRQVTNGCQMMPSATAQAPEIHLSDKSGGN  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNT--HDITK---------------GKE  462
              YTL+M DPDAPSPSEP +RE +HWIVTDIPGN+   ++T                G+E
Sbjct  63   NLYTLIMIDPDAPSPSEPTLREWLHWIVTDIPGNSGGSEMTSGFPRLNELIAPSKSCGRE  122

Query  463  AVPYMGPKPTVGIHRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYF  642
             VPYMGP+P VGIHRYI VLF+Q      + PP T R+NF TR FA    L  PVA  Y 
Sbjct  123  LVPYMGPRPPVGIHRYIFVLFRQPLTPFHITPP-TVRSNFNTRYFAAQCGLGLPVAATYL  181

Query  643  NAHKEPAA  666
            NA KEP +
Sbjct  182  NAQKEPGS  189



>ref|NP_001236597.1| brother of FT and TFL1 protein [Glycine max]
 gb|ABS57463.1| brother of FT and TFL1 protein [Glycine max]
 gb|ACU00125.1| terminal flowering 1-like protein 3 [Glycine max]
 gb|ACU15487.1| unknown [Glycine max]
 gb|KHN31520.1| CEN-like protein 1 [Glycine soja]
Length=172

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 124/170 (73%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R ++PLVVGRVIG+VVD+F P+V M V Y  K + +G ++ PS +  +PRV IGGD  + 
Sbjct  3    RLMEPLVVGRVIGEVVDIFSPSVKMNVTYSTKQVANGHELMPSTIMAKPRVEIGGDDMRT  62

Query  340  -YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS+PC+RE +HW+VTDIPG T D++ GKE V Y  PKP +GIHRY+ 
Sbjct  63   AYTLIMTDPDAPSPSDPCLREHLHWMVTDIPGTT-DVSFGKEIVGYESPKPVIGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +LF+Q+     ++PP +SR++F TR F+    L  PVA VYFNA +E AA
Sbjct  122  ILFKQRG-RQTVRPP-SSRDHFNTRRFSEENGLGLPVAAVYFNAQRETAA  169



>ref|XP_002528731.1| phosphatidylethanolamine-binding protein, putative [Ricinus communis]
 gb|EEF33643.1| phosphatidylethanolamine-binding protein, putative [Ricinus communis]
Length=173

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 124/170 (73%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R V+ LVVGRVIGDVVD F P ++M++ YG + + +G ++ PS+VA +P+V + GGD   
Sbjct  3    RAVESLVVGRVIGDVVDSFTPMLNMSISYGNRRVFNGYELHPSLVALKPKVEVQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HW+VTDIPG T D T G+E V Y  P+PT+GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTT-DATFGREVVTYEIPRPTIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLFQQK+    + PP +SR+NF TR FA   +L  PVA +YFNA +E AA
Sbjct  122  VLFQQKR-RQTINPP-SSRDNFSTRDFAVGNDLGLPVAAIYFNAQRETAA  169



>gb|AEH59567.1| flowering locus T/Terminal flower1-like protein [Picea abies]
Length=172

 Score =   184 bits (467),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 120/172 (70%), Gaps = 8/172 (5%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R V+PLVVGRVIGDV+DMFVP+VD+AV Y  + + +G ++KPS +   PRV IGG D   
Sbjct  3    RFVEPLVVGRVIGDVLDMFVPSVDLAVTYASRQVNNGCELKPSAITLLPRVDIGGEDLRN  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVMTDPDAPSPS+P +RE + WIVTDIP  T   + G+E V Y  P+PT+GIHR+I 
Sbjct  63   FYTLVMTDPDAPSPSDPTLREYLQWIVTDIPATTS-ASFGRELVSYESPRPTIGIHRFIF  121

Query  517  VLFQQKKVLGE--LQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q   +G   + PP  SR NF TR FA    L  PVA VYFNA KE A 
Sbjct  122  VLFKQ---MGRQTVYPP-GSRLNFNTRNFALSNSLGLPVAAVYFNAQKEAAG  169



>gb|ADC32542.1| terminal flower 1-like protein [Leavenworthia crassa]
Length=177

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 123/173 (71%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R  DPL+VGRVIGDV+D F PT+ M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MRSRVADPLIVGRVIGDVLDFFTPTIKMHVTYNKKQVSNGHELFPSSVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HWIVT+IPG T D+T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMVDPDVPGPSDPFLKEHLHWIVTNIPGTT-DVTFGKEVVSYDLPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    L P +TSR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFRQKQRCVIL-PNITSRDHFNTRKFATEYDLGLPVAAVFFNAQRETAA  174



>ref|XP_007027716.1| Centroradialis [Theobroma cacao]
 gb|EOY08218.1| Centroradialis [Theobroma cacao]
Length=172

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PLVVGRVIGDV+D F+P++ M V +  K + +G +  PS VA +PRV I GGD   
Sbjct  3    RAAEPLVVGRVIGDVLDSFIPSITMTVTFNNKRVFNGHEFYPSTVATKPRVEIEGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTT-DATFGREVVSYEIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      P  +SR+NF TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQKRRQMITSP--SSRDNFSTRGFAAENDLGLPVAAVYFNAQRETAA  169



>gb|KDP42735.1| hypothetical protein JCGZ_23675 [Jatropha curcas]
 gb|AID51387.1| terminal flower 1b [Jatropha curcas]
 gb|AID51393.1| terminal flower 1b [Jatropha curcas]
Length=173

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = +1

Query  166  VDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQ-FY  342
            VDPL+V RVIGDV+D+F PT+ M+V Y  + + +G ++ PS +A +P+V + GD  + F+
Sbjct  5    VDPLIVERVIGDVLDLFTPTIKMSVAYTDRKVCNGHELYPSTIASKPKVAVEGDDMRSFF  64

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPD P PS+P +RE +HWIV+DIPG T D T GKE V Y  P+P +GIHR++ VL
Sbjct  65   TLVMTDPDVPGPSDPYLREHLHWIVSDIPGTT-DATFGKEIVSYEIPRPNIGIHRFVFVL  123

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+QKK   ++Q P  SR+NF TR FA   EL  PVA VYFNA +E AA
Sbjct  124  FKQKK-RSQIQHPPWSRDNFNTRNFAAENELGLPVAAVYFNAQRETAA  170



>ref|XP_004515713.1| PREDICTED: CEN-like protein 1-like [Cicer arietinum]
Length=172

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 122/170 (72%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R+++PL +GRVIG+VVD+F P+V M V Y  K + +G ++ PS+V ++PRV IGGD  + 
Sbjct  3    RSLEPLSMGRVIGEVVDIFNPSVRMNVTYSTKQVANGHELLPSIVMNKPRVEIGGDDLRT  62

Query  340  -YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS+P +RE +HW+VTDIPG T D++ GKE V Y  PKP +GIHRY+ 
Sbjct  63   AYTLIMTDPDAPSPSDPYLREHLHWMVTDIPGTT-DVSFGKEIVEYENPKPVIGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +LF+Q+       P  T R+NF TR+F+    L  PVA VYFNA +E AA
Sbjct  122  ILFKQRGRQTVRSP--TFRDNFNTRSFSQQNSLGLPVAAVYFNAQRETAA  169



>ref|XP_009766168.1| PREDICTED: protein TERMINAL FLOWER 1-like [Nicotiana sylvestris]
Length=172

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 121/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            RNV+PLVVGRV+GDV+D F PTV M V Y  K + +G ++ PS V  RPRV + GGD   
Sbjct  3    RNVEPLVVGRVVGDVLDSFSPTVKMTVTYNNKQVCNGQELFPSAVTIRPRVEVQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLV+TDPD P PS+P +RE VHWIVTDIPG T D T GKE V Y  P+P +GIHR++ 
Sbjct  63   FFTLVITDPDVPGPSDPYLREHVHWIVTDIPGTT-DATFGKELVSYEIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q K    + PP TSR++F TR FA+  +L  PVA V+FNA +E AA
Sbjct  122  VLFKQ-KCRQSVSPP-TSRDHFNTRNFANVNDLGPPVAAVFFNAQRETAA  169



>gb|EYU27885.1| hypothetical protein MIMGU_mgv1a022275mg [Erythranthe guttata]
Length=168

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD-  327
            M R  +DPLVVG+VIGDV+DMFVP  ++AV+YG + I +GS+VKPS  A RP+V I G  
Sbjct  1    MPRAALDPLVVGKVIGDVLDMFVPAAELAVHYGGEEIGNGSEVKPSSAAQRPKVQIKGAI  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
            S  +YTLVM DPDAPSP EP +RE +HW+V DIP  + D T+GKE + YMGPKP  G+HR
Sbjct  61   SPSYYTLVMVDPDAPSPGEPTLREWLHWLVIDIPEGS-DATEGKEIMEYMGPKPPAGVHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHK  654
            Y+  +FQQ  ++  ++     R  F TR FA   +L  P A +YF +HK
Sbjct  120  YVFAVFQQHGLMETVKRKPVERQLFDTRQFARENDLGLPAAALYFKSHK  168



>ref|XP_006341132.1| PREDICTED: CEN-like protein 2-like isoform X2 [Solanum tuberosum]
Length=172

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 121/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R+++PL+VGRVIGDV+D F PT+ M++ Y  K + +G ++ PS V+ RP+V + GGD   
Sbjct  3    RSLEPLIVGRVIGDVIDSFNPTIKMSITYNNKLVCNGHELFPSAVSSRPKVEVQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+  +RE +HWI+TDIPG T D T GKE V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDTYLREHLHWIITDIPGTT-DATFGKELVSYDIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK      QP  TSR++F TR FA   +L+ PVA V+FNA +E AA
Sbjct  122  VLFKQKSRSSVSQP--TSRDHFNTRNFAQENDLEQPVAAVFFNAQRETAA  169



>ref|XP_007025824.1| Phosphatidylethanolamine-binding protein, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOY28446.1| Phosphatidylethanolamine-binding protein, putative isoform 2, 
partial [Theobroma cacao]
Length=165

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 113/163 (69%), Gaps = 5/163 (3%)
 Frame = +1

Query  184  GRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--STQFYTLVMT  357
            GRVIGDV+D+F P  ++ V+Y  K + +G D+KPS  AD+P V I     S+  YTLVM 
Sbjct  1    GRVIGDVLDIFTPAAELTVHYSTKQVHNGCDIKPSSAADKPHVRILSPVVSSSLYTLVMV  60

Query  358  DPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLFQQKK  537
            DPDAP+PSEP +RE +HWIV DIP   HD TKGKE VPYMGP+P  GIHRYILVLF+Q++
Sbjct  61   DPDAPTPSEPRLREWLHWIVVDIP-EGHDATKGKEMVPYMGPQPPTGIHRYILVLFKQER  119

Query  538  VL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
               G  Q P  +R NF TR FA    L  PVA VYFN+ KEPA
Sbjct  120  ATEGGCQLP-DARANFSTRQFAAQNSLGLPVAAVYFNSQKEPA  161



>ref|XP_006341131.1| PREDICTED: CEN-like protein 2-like isoform X1 [Solanum tuberosum]
Length=172

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 121/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R+++PL+VGRVIGDV+D F PT+ M++ Y  K + +G ++ PS V+ RP+V + GGD   
Sbjct  3    RSLEPLIVGRVIGDVIDSFNPTIKMSITYNNKLVCNGHELFPSAVSSRPKVEVQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+  +RE +HWI+TDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDTYLREHLHWIITDIPGTT-DATFGRELVSYDIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK      QP  TSR++F TR FA   +L+ PVA V+FNA +E AA
Sbjct  122  VLFKQKSRSSVSQP--TSRDHFNTRNFAQENDLEQPVAAVFFNAQRETAA  169



>ref|XP_010049502.1| PREDICTED: protein TERMINAL FLOWER 1-like [Eucalyptus grandis]
 ref|XP_010049507.1| PREDICTED: protein TERMINAL FLOWER 1-like [Eucalyptus grandis]
 gb|KCW89194.1| hypothetical protein EUGRSUZ_A01505 [Eucalyptus grandis]
Length=172

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R ++PL VGRVIGDV+D F  ++ M+V Y  K + +G ++ PS VA RPRV I GGD   
Sbjct  3    RALEPLTVGRVIGDVIDPFTASIRMSVKYNGKQVNNGHELYPSSVAARPRVEIHGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPDAP PS+P +RE +HWIVT+IPG T D T G+E + Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDAPGPSDPYLREHLHWIVTNIPGTT-DATFGREVMSYEIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +LF+QK+     QP  +SR+ F TR FA   +LD PVA VYFNA +E AA
Sbjct  122  ILFRQKRRQQISQP--SSRDCFSTRNFAAENDLDLPVAAVYFNAQRETAA  169



>emb|CDO99645.1| unnamed protein product [Coffea canephora]
Length=177

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 118/176 (67%), Gaps = 10/176 (6%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD---S  330
            R V+PLVVGRVIGDV+DMFVP  ++ V YG K + +G ++KPS  A +P V + G    +
Sbjct  3    RPVEPLVVGRVIGDVLDMFVPAAELIVQYGSKQVGNGCEIKPSHSAHKPAVRVNGSRDRA  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
               +TLVM DPDAPSPS+P  RE +HWIV +IP    D ++GKE V Y GP+P  GIHRY
Sbjct  63   ASLFTLVMVDPDAPSPSDPTFREWLHWIVVNIP-EGGDASEGKELVAYQGPQPPAGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVT---SRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            +  LF+Q+   G ++ P T    R+NF TR FA H EL  PVA VYFN+ KEPA +
Sbjct  122  VFALFKQR---GRMEKPKTLPEPRHNFTTRQFASHNELGLPVAAVYFNSQKEPAGN  174



>emb|CDP15403.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R+ +PLVVGRVIGDV++ F P++ M V Y  K + +G ++ PS V  RPRV I GGD   
Sbjct  3    RSAEPLVVGRVIGDVLEYFTPSIKMTVIYNNKQVCNGHELFPSAVVSRPRVEILGGDMRN  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HW+VTDIPG T D+T GKE V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWVVTDIPGTT-DVTFGKELVSYEIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      PP  SR+ F TR FA   +L  PVA V+FNA +E AA
Sbjct  122  VLFKQKRRQTVNPPP--SRDQFNTRNFATENDLGEPVAAVFFNAQRETAA  169



>gb|ABW24962.1| terminal flower 1b [Gossypium arboreum]
 gb|ABW24969.1| terminal flower 1b [Gossypium arboreum]
Length=172

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R V+PL+VGRVIGDV+D F+P++ M+V +  K + +G +  PS V  +PRV + GGD   
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMSVTFNNKQVFNGHEFYPSTVVTKPRVEVVGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYENPKPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      P   SR+NF TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQKRRQIIKSP--CSRDNFNTRRFAFENDLGLPVAAVYFNAQRETAA  169



>gb|AGX25250.1| MCN1 [Musa AAB Group]
 gb|AGX25255.1| MCN1 [Musa AAB Group]
Length=175

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHI-GG  324
            M R + DPL VGRVIG+V+D F P+V M V Y   K + +G ++ PS V  +PRV + GG
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVCNGHELFPSAVVSKPRVEVQGG  60

Query  325  DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIH  504
            +   F+TLVMTDPDAP PS+P +RE VHW+VTDIPG T D + GKE V Y  P+P++GIH
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTT-DASFGKEVVSYESPRPSIGIH  119

Query  505  RYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            R++ VLF+QK+       P+ SR+ F TR FA   +LD PVA VYFNA +E AA
Sbjct  120  RFVFVLFKQKRGQSVAAAPL-SRDRFSTRGFAQENDLDLPVAAVYFNAQRETAA  172



>ref|XP_003563887.1| PREDICTED: protein MOTHER of FT and TF 1-like [Brachypodium distachyon]
Length=178

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  148  MMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD  327
            M VR  +DPL +G+VIG+VVD FVPT+ ++V +G K +T+G ++KPS+    P V IGG 
Sbjct  1    MAVR--LDPLELGKVIGEVVDRFVPTMVLSVRFGTKVLTNGCEIKPSVAVAAPAVQIGGG  58

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
                +TLVM DPDAPSPSEP MRE +HW+V +IPG   D ++GKE VPYM P+P +GIHR
Sbjct  59   VGDLFTLVMIDPDAPSPSEPSMREWLHWLVVNIPGGA-DPSQGKEVVPYMSPRPALGIHR  117

Query  508  YILVLFQQKK-----VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            Y+LV+FQQ+        GE  P V  R  F TR FA    L  PVA +YFNA KEPA+
Sbjct  118  YVLVVFQQRAPAPAVAPGEEAPGV--RAGFRTREFAKEHGLGLPVAAMYFNAQKEPAS  173



>ref|XP_009592311.1| PREDICTED: protein SELF-PRUNING-like isoform X2 [Nicotiana tomentosiformis]
Length=172

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R+++PL+VGRV+GDV+D F P V M + Y  K + +G +  PS+V  RP+V + GGD   
Sbjct  3    RSLEPLIVGRVVGDVLDSFSPIVKMTITYNNKLVCNGHEFFPSIVTSRPKVEVQGGDLRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGRELVSYEIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q++    + PP TSR+NF TR FA   +L  PVA V+FNA +E AA
Sbjct  122  VLFKQRR-RQSVSPP-TSRDNFNTRNFAEENDLSQPVAAVFFNAQRETAA  169



>gb|ABY62770.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R V+PL+VGRVIGDV+D F+P++ M+V +  K + +G +  PS V  +PRV + GGD   
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMSVTFNNKQVFNGHEFYPSTVVTKPRVEVVGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYENPKPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      P   SR+NF TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQKRRQIIKSP--CSRDNFNTRRFASENDLGLPVAAVYFNAQRETAA  169



>gb|AEO72025.1| TFL1-like protein [Spiraea cantoniensis]
Length=172

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 120/170 (71%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PLVVGRVIGDV+D F+PT  M V +  + + +G ++ PS V  +PRV I GGD   
Sbjct  3    RMSEPLVVGRVIGDVLDFFIPTTKMTVTFSNRLVRNGHELLPSAVTVKPRVEIQGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+EAV Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREAVSYEKPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +L++Q++    + PP +SR++FC R FA   +L  PVA VYFNA +E AA
Sbjct  122  ILYKQQR-RQSINPP-SSRDHFCARTFAAENDLGLPVAAVYFNAQRETAA  169



>gb|ABW24964.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R V+PL+VGRVIGDV+D F+P++ M V +  K + +G +  PS V  +PRV + GGD   
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMLVTFNNKQVFNGHEFYPSTVVTKPRVEVAGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYENPKPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      P   SR+NF TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQKRRQIIKSP--CSRDNFNTRRFASENDLGLPVAAVYFNAQRETAA  169



>gb|KDO75687.1| hypothetical protein CISIN_1g030480mg [Citrus sinensis]
Length=174

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 116/170 (68%), Gaps = 8/170 (5%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD---S  330
            R+++PLVVGRVIGDVVDMF P  +M V+YG K + +G ++KPS  AD+P V I      S
Sbjct  3    RSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPAS  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
            +  YTLVM DPDAPSPSEP  RE +HWIV DIP  + D T  KE V YMGP+P  GIHRY
Sbjct  63   SNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGS-DAT--KELVAYMGPQPPTGIHRY  119

Query  511  ILVLFQQK-KVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
            +  LF QK KV+   +PP  +R+NF TR FA    L  PVA VYFN+ KE
Sbjct  120  VFALFNQKGKVMAGCRPP-DARSNFSTRRFAADNGLQPPVAAVYFNSQKE  168



>ref|XP_009592303.1| PREDICTED: protein SELF-PRUNING-like isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R+++PL+VGRV+GDV+D F P V M + Y  K + +G +  PS+V  RP+V + GGD   
Sbjct  3    RSLEPLIVGRVVGDVLDSFSPIVKMTITYNNKLVCNGHEFFPSIVTSRPKVEVQGGDLRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T     G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFVGRELVSYEIPRPNIGIHRFVF  122

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q++    + PP TSR+NF TR FA   +L  PVA V+FNA +E AA
Sbjct  123  VLFKQRR-RQSVSPP-TSRDNFNTRNFAEENDLSQPVAAVFFNAQRETAA  170



>gb|AGX25240.1| MCN1 [Musa acuminata AAA Group]
 gb|AGX25245.1| MCN1 [Musa acuminata AAA Group]
Length=175

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHI-GG  324
            M R + DPL VGRVIG+V+D F P+V M V Y   K + +G ++ PS V  +PRV + GG
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVCNGHELFPSAVVSKPRVEVQGG  60

Query  325  DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIH  504
            +   F+TLVMTDPDAP PS+P +RE VHW+VTDIPG T D + GKE V Y  P+P++GIH
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTT-DASFGKEVVSYESPRPSIGIH  119

Query  505  RYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            R++ VLF+QK+       P  SR+ F TR FA   +LD PVA VYFNA +E AA
Sbjct  120  RFVFVLFKQKRRQSVAAAP-PSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAA  172



>gb|ADW82821.1| flowering time locus T-like protein 1 [Hordeum vulgare]
 gb|ADW82822.1| flowering time locus T-like protein 1 [Hordeum vulgare]
 gb|ADW82823.1| flowering time locus T-like protein 1 [Hordeum vulgare]
Length=174

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G +A+++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRAVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGQPVAAVYFNCQREAGSG  171



>ref|XP_009411957.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=175

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHI-GG  324
            M R + DPL VGRVIG+V+D F P+V M V Y   K + +G ++ PS V  +PRV + GG
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVYNGHELFPSAVVSKPRVEVQGG  60

Query  325  DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIH  504
            +   F+TLVMTDPDAP PS+P +RE VHW+VTDIPG T D + GKE V Y  P+P++GIH
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTT-DASFGKEVVSYESPRPSIGIH  119

Query  505  RYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            R++ VLF+QK+       P  SR+ F TR FA   +LD PVA VYFNA +E AA
Sbjct  120  RFVFVLFKQKRRQSVAAAP-PSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAA  172



>gb|ADW82819.1| flowering time locus T-like protein 1 [Hordeum vulgare]
Length=172

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G +A+++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRAVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGQPVAAVYFNCQREAGSG  171



>gb|AAZ38709.1| FT-like protein [Hordeum vulgare subsp. vulgare]
 gb|ABI55200.1| FT [Hordeum vulgare subsp. vulgare]
 gb|ABI55199.1| FT [Hordeum vulgare subsp. spontaneum]
 gb|ABI55201.1| FT [Hordeum vulgare]
 gb|ABI55202.1| FT [Hordeum vulgare]
 gb|ABI55203.1| FT [Hordeum vulgare subsp. vulgare]
 gb|ABJ97441.1| FT [Hordeum vulgare]
 gb|ABK91684.1| vrn-H3 late flowering allele [Hordeum vulgare subsp. vulgare]
 gb|ABL11232.1| FT-like protein [Hordeum vulgare subsp. vulgare]
 gb|ABV59387.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59388.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59390.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59391.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59392.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59393.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59394.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59395.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ABV59396.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
 gb|ACA29355.1| flowering locus T1 [Hordeum vulgare subsp. vulgare]
 gb|ACA29356.1| flowering locus T1 [Hordeum vulgare subsp. vulgare]
Length=177

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G +A+++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRAVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGQPVAAVYFNCQREAGSG  171



>ref|NP_001106264.1| ZCN11 protein [Zea mays]
 gb|ABW96234.1| ZCN11 [Zea mays]
 gb|ABX11013.1| ZCN11 [Zea mays]
 gb|AFW77067.1| ZCN11 isoform 1 [Zea mays]
 gb|AFW77068.1| ZCN11 isoform 2 [Zea mays]
Length=180

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 4/172 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +VDPLVVGRVIGDVVD+FVPTV ++  +G K +T+G ++KPS+ A  P V I G +   +
Sbjct  4    HVDPLVVGRVIGDVVDLFVPTVAVSARFGAKDLTNGCEIKPSVAAAAPAVLIAGRANDLF  63

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TLVMTDPDAPSPSEP MREL+HW+V +IPG       G+  VPY+GP+P VGIHRY+LV+
Sbjct  64   TLVMTDPDAPSPSEPTMRELLHWLVVNIPGGADASQGGETVVPYVGPRPPVGIHRYVLVV  123

Query  523  FQQKKVLG---ELQPPV-TSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +QQK  +     L P    +R  F  RAFA   +L  PVA ++FNA KE A+
Sbjct  124  YQQKARVTAPPSLAPATEATRARFSNRAFADRHDLGLPVAAMFFNAQKETAS  175



>ref|XP_003635936.1| CEN-like protein [Medicago truncatula]
 gb|KEH17361.1| terminal flower 1 [Medicago truncatula]
Length=172

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R ++PL VGRVIG+VVD+F P+V M V Y  K + +G ++ PS+V ++PRV IGG D   
Sbjct  3    RPLEPLSVGRVIGEVVDIFNPSVRMNVTYSTKQVANGHELMPSIVMNKPRVDIGGEDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS+P +RE +HW+VTDIPG T D++ G E V Y  PKP +GIHRY+ 
Sbjct  63   AYTLIMTDPDAPSPSDPHLREHLHWMVTDIPGTT-DVSFGNEIVEYENPKPVIGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +LF+Q+       P  +SR+NF TR F+    L  PVA VYFNA +E AA
Sbjct  122  ILFKQRGRQTVRSP--SSRDNFNTRRFSQENNLGLPVAAVYFNAQRETAA  169



>gb|ABV59389.1| flowering locus T 1 [Hordeum vulgare subsp. vulgare]
Length=177

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G +A+++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRAVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  P+A VYFN  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGQPIAAVYFNCQREAGSG  171



>gb|ABW24968.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R V+PL+VGRVIGDV+D F+P++ M+V +  K + +G +  PS V  +PRV + GGD   
Sbjct  3    REVEPLMVGRVIGDVMDSFIPSIKMSVTFNNKQVFNGHEFYPSTVVTKPRVEVVGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYENPKPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      P   SR+NF TR F    +L  PVA VYFNA +E AA
Sbjct  122  VLFKQKRRQIIKSP--CSRDNFNTRRFVSENDLGLPVAAVYFNAQRETAA  169



>ref|XP_009614479.1| PREDICTED: protein TERMINAL FLOWER 1-like [Nicotiana tomentosiformis]
Length=173

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            RNV+PLVVGRV+GDV+D F P V M V Y  K + +G ++ PS V  RPRV + GGD   
Sbjct  3    RNVEPLVVGRVVGDVLDSFSPKVKMTVTYNNKQVCNGQELFPSAVTIRPRVEVQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T GKE V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGKELVSYEIPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q K    + P   SR++F TR FA+  +L  PVA V+FNA +E AA
Sbjct  122  VLFKQ-KCRQSVSPHDVSRDHFNTRNFANVNDLGPPVAAVFFNAQRETAA  170



>ref|XP_004308107.1| PREDICTED: CEN-like protein 1-like [Fragaria vesca subsp. vesca]
 dbj|BAP18902.1| terminal flower 1 [Fragaria x ananassa]
Length=175

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 5/172 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP--KAITSGSDVKPSMVADRPRVHIGG-DS  330
            R ++ L +GRV+G+VVDMF P+V M V Y    K +++G ++ PS++A +PRV IGG D 
Sbjct  3    RIMETLTLGRVVGEVVDMFTPSVKMNVVYSSCNKQVSNGHEIMPSVIAAKPRVDIGGEDM  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
               YTL+MTDPD PSPS+PC+RE +HW+VTDIPG T D++ G+E V Y  PKP VGIHRY
Sbjct  63   RAAYTLIMTDPDYPSPSDPCLREHLHWMVTDIPGTT-DVSFGREVVEYETPKPVVGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            + +LFQQ +    ++ P  SR+NF TR F+    L  PVA VYFNA +E AA
Sbjct  122  VFLLFQQTRGRQTVRVPA-SRDNFNTRKFSQENSLGLPVAAVYFNAQRETAA  172



>gb|ADW82818.1| flowering time locus T-like protein 1 [Hordeum vulgare]
 gb|ADW82820.1| flowering time locus T-like protein 1 [Hordeum vulgare]
Length=167

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G +A+++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRAVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
            ++LVLFQQ        P    R NF TR FA    L  PVA VYFN  +E
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGQPVAAVYFNCQRE  167



>gb|AID67177.1| MFT2-like protein, partial [Picea abies]
Length=158

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGXEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSP  624
            + V F+Q+  +  +  P   R+NF TRAFA    L  P
Sbjct  122  VFVAFRQQDPMVMMMAPQV-RHNFSTRAFAAQYGLGLP  158



>ref|XP_006430226.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
 gb|ABY91242.1| CTRSTFL-like protein [Citrus trifoliata]
 gb|ESR43466.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
Length=173

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL VGRVIGDV++ F P++ M+V Y  K + +G ++ PS V  +PRV I GGD
Sbjct  1    MAARMLEPLAVGRVIGDVIESFTPSIKMSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGRELVSYEIPRPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+Q +    + PP +SR++F TRAFA   +L  PVA VYFNA +E AA
Sbjct  120  FVFVLFKQTR-RQTVNPP-SSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAA  170



>gb|AID67173.1| MFT2-like protein, partial [Picea abies]
 gb|AID67174.1| MFT2-like protein, partial [Picea abies]
 gb|AID67175.1| MFT2-like protein, partial [Picea abies]
 gb|AID67176.1| MFT2-like protein, partial [Picea abies]
 gb|AID67178.1| MFT2-like protein, partial [Picea abies]
 gb|AID67179.1| MFT2-like protein, partial [Picea abies]
 gb|AID67180.1| MFT2-like protein, partial [Picea abies]
 gb|AID67181.1| MFT2-like protein, partial [Picea abies]
 gb|AID67183.1| MFT2-like protein, partial [Picea abies]
 gb|AID67185.1| MFT2-like protein, partial [Picea abies]
 gb|AID67186.1| MFT2-like protein, partial [Picea abies]
 gb|AID67187.1| MFT2-like protein, partial [Picea abies]
 gb|AID67189.1| MFT2-like protein, partial [Picea abies]
 gb|AID67190.1| MFT2-like protein, partial [Picea abies]
 gb|AID67191.1| MFT2-like protein, partial [Picea abies]
 gb|AID67192.1| MFT2-like protein, partial [Picea abies]
 gb|AID67193.1| MFT2-like protein, partial [Picea abies]
 gb|AID67194.1| MFT2-like protein, partial [Picea abies]
 gb|AID67197.1| MFT2-like protein, partial [Picea abies]
 gb|AID67198.1| MFT2-like protein, partial [Picea abies]
 gb|AID67199.1| MFT2-like protein, partial [Picea abies]
 gb|AID67200.1| MFT2-like protein, partial [Picea abies]
 gb|AID67201.1| MFT2-like protein, partial [Picea abies]
 gb|AID67202.1| MFT2-like protein, partial [Picea abies]
 gb|AID67203.1| MFT2-like protein, partial [Picea abies]
 gb|AID67204.1| MFT2-like protein, partial [Picea abies]
 gb|AID67205.1| MFT2-like protein, partial [Picea abies]
 gb|AID67206.1| MFT2-like protein, partial [Picea abies]
 gb|AID67207.1| MFT2-like protein, partial [Picea abies]
 gb|AID67208.1| MFT2-like protein, partial [Picea abies]
 gb|AID67209.1| MFT2-like protein, partial [Picea abies]
 gb|AID67211.1| MFT2-like protein, partial [Picea abies]
 gb|AID67212.1| MFT2-like protein, partial [Picea abies]
 gb|AID67213.1| MFT2-like protein, partial [Picea abies]
 gb|AID67214.1| MFT2-like protein, partial [Picea abies]
 gb|AID67215.1| MFT2-like protein, partial [Picea abies]
 gb|AID67216.1| MFT2-like protein, partial [Picea abies]
 gb|AID67217.1| MFT2-like protein, partial [Picea abies]
 gb|AID67218.1| MFT2-like protein, partial [Picea abies]
 gb|AID67219.1| MFT2-like protein, partial [Picea abies]
 gb|AID67221.1| MFT2-like protein, partial [Picea abies]
 gb|AID67222.1| MFT2-like protein, partial [Picea abies]
 gb|AID67223.1| MFT2-like protein, partial [Picea abies]
 gb|AID67224.1| MFT2-like protein, partial [Picea abies]
 gb|AID67225.1| MFT2-like protein, partial [Picea abies]
 gb|AID67226.1| MFT2-like protein, partial [Picea abies]
 gb|AID67227.1| MFT2-like protein, partial [Picea abies]
 gb|AID67228.1| MFT2-like protein, partial [Picea abies]
 gb|AID67230.1| MFT2-like protein, partial [Picea abies]
 gb|AID67231.1| MFT2-like protein, partial [Picea abies]
 gb|AID67232.1| MFT2-like protein, partial [Picea abies]
 gb|AID67234.1| MFT2-like protein, partial [Picea abies]
 gb|AID67235.1| MFT2-like protein, partial [Picea abies]
 gb|AID67236.1| MFT2-like protein, partial [Picea abies]
 gb|AID67238.1| MFT2-like protein, partial [Picea abies]
 gb|AID67239.1| MFT2-like protein, partial [Picea abies]
 gb|AID67240.1| MFT2-like protein, partial [Picea abies]
 gb|AID67242.1| MFT2-like protein, partial [Picea abies]
 gb|AID67245.1| MFT2-like protein, partial [Picea abies]
 gb|AID67246.1| MFT2-like protein, partial [Picea abies]
 gb|AID67247.1| MFT2-like protein, partial [Picea abies]
 gb|AID67248.1| MFT2-like protein, partial [Picea abies]
 gb|AID67249.1| MFT2-like protein, partial [Picea abies]
 gb|AID67250.1| MFT2-like protein, partial [Picea abies]
 gb|AID67251.1| MFT2-like protein, partial [Picea abies]
 gb|AID67252.1| MFT2-like protein, partial [Picea abies]
 gb|AID67253.1| MFT2-like protein, partial [Picea abies]
 gb|AID67255.1| MFT2-like protein, partial [Picea abies]
 gb|AID67256.1| MFT2-like protein, partial [Picea abies]
 gb|AID67257.1| MFT2-like protein, partial [Picea abies]
 gb|AID67258.1| MFT2-like protein, partial [Picea abies]
 gb|AID67259.1| MFT2-like protein, partial [Picea abies]
 gb|AID67260.1| MFT2-like protein, partial [Picea abies]
 gb|AID67261.1| MFT2-like protein, partial [Picea abies]
 gb|AID67262.1| MFT2-like protein, partial [Picea abies]
Length=158

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSP  624
            + V F+Q+  +  +  P   R+NF TRAFA    L  P
Sbjct  122  VFVAFRQQDPMVMMMAPQV-RHNFSTRAFAAQYGLGLP  158



>ref|XP_006398842.1| hypothetical protein EUTSA_v10015708mg [Eutrema salsugineum]
 gb|ESQ40295.1| hypothetical protein EUTSA_v10015708mg [Eutrema salsugineum]
Length=177

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL+VGRV+GDV+D F PT+ M+V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGSRVIEPLIVGRVVGDVLDFFTPTIKMSVSYNKKQVSNGHELFPSTVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P  +E +HWIVT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFQKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFKQKQ-RRVIFPNILSRDHFNTRKFAIEYDLGLPVAAVFFNAQRETAA  174



>gb|AFK31069.1| Hd3a, partial [Oryza sativa Japonica Group]
 gb|AFK31074.1| Hd3a, partial [Oryza sativa Japonica Group]
 gb|AFK31076.1| Hd3a, partial [Oryza sativa Japonica Group]
 gb|AFK31090.1| Hd3a, partial [Oryza sativa Japonica Group]
 gb|AFK31128.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31148.1| Hd3a, partial [Oryza rufipogon]
Length=179

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R+ DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RDRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF TR FA    L SPVATVYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFSTRNFAELYNLGSPVATVYFNCQREAGSG  173



>gb|AFK31127.1| Hd3a, partial [Oryza rufipogon]
Length=179

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R+ DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RDRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF TR FA    L SPVATVYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFSTRNFAELYNLGSPVATVYFNCQREAGSG  173



>gb|AID67184.1| MFT2-like protein, partial [Picea abies]
 gb|AID67188.1| MFT2-like protein, partial [Picea abies]
 gb|AID67195.1| MFT2-like protein, partial [Picea abies]
 gb|AID67233.1| MFT2-like protein, partial [Picea abies]
 gb|AID67241.1| MFT2-like protein, partial [Picea abies]
Length=155

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLEL  615
            + V F+Q+  +  +  P   R+NF TRAFA    L
Sbjct  122  VFVAFRQQDPMVMMMAPQV-RHNFSTRAFAAQYGL  155



>ref|XP_007025825.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 3, partial [Theobroma cacao]
 gb|EOY28447.1| PEBP (phosphatidylethanolamine-binding protein) family protein 
isoform 3, partial [Theobroma cacao]
Length=157

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 113/168 (67%), Gaps = 16/168 (10%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQFY  342
            +V+PLVVGRVIGDV+D+F P  ++ V+Y  K + +G D+KPS  AD+P            
Sbjct  1    SVEPLVVGRVIGDVLDIFTPAAELTVHYSTKQVHNGCDIKPSSAADKPH-----------  49

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
              VM DPDAP+PSEP +RE +HWIV DIP   HD TKGKE VPYMGP+P  GIHRYILVL
Sbjct  50   --VMVDPDAPTPSEPRLREWLHWIVVDIP-EGHDATKGKEMVPYMGPQPPTGIHRYILVL  106

Query  523  FQQKKVL-GELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            F+Q++   G  Q P  +R NF TR FA    L  PVA VYFN+ KEPA
Sbjct  107  FKQERATEGGCQLP-DARANFSTRQFAAQNSLGLPVAAVYFNSQKEPA  153



>gb|AID67182.1| MFT2-like protein, partial [Picea abies]
Length=152

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 5/150 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFA  600
            + V F+Q+  +  +  P   R+NF TRAFA
Sbjct  122  VFVAFRQQDPMVMMMAP-QVRHNFSTRAFA  150



>gb|AIJ02002.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02003.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02004.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02006.1| FT/TFL1-like 2 [Pinus sylvestris]
 gb|AIJ02007.1| FT/TFL1-like 2 [Pinus sylvestris]
Length=173

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQ-FYT  345
            +PLV+GRVIGDVVDMF+P+V++ V YG + + +G ++KPS ++  PRV +GGD  +  YT
Sbjct  6    EPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSPPRVDVGGDDLRTCYT  65

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPDAPSPS+P +RE +HWIVTDIP  T   T G+E + Y  P+PT+GIHRY+ +LF
Sbjct  66   LVMTDPDAPSPSDPTLREYLHWIVTDIPATTA-ATFGRELMRYEAPRPTIGIHRYVFILF  124

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            +Q  +  E   P  SR NF TR FA    L  PVA VY+NA KE A
Sbjct  125  KQ--MARETVYPPQSRINFSTRDFAEINGLGLPVAAVYYNAQKETA  168



>ref|XP_006365770.1| PREDICTED: CEN-like protein 1-like [Solanum tuberosum]
Length=175

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAV-YYGPKAITSGSDVKPSMVADRPRVHIGG-  324
            M  R+++PLVV RVIG+VVD F P+V M V Y G K + +G ++ P ++A +PRV IGG 
Sbjct  1    MSCRDIEPLVVARVIGEVVDSFNPSVKMNVIYNGSKQVFNGHELMPLVIASKPRVEIGGE  60

Query  325  DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIH  504
            D    YTL+MTDPD P PS+P +RE +HWIVTDIPG+T D + G+E V Y  PKP +GIH
Sbjct  61   DMRSAYTLIMTDPDVPGPSDPYLREHLHWIVTDIPGST-DASFGREIVSYDSPKPVIGIH  119

Query  505  RYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            RY+ VL++Q +    ++PPVT R++F TR FA    L SPVA VYFNA +E AA
Sbjct  120  RYVFVLYKQNRGRQTVKPPVT-RDHFNTRKFAAENGLGSPVAAVYFNAQRETAA  172



>ref|XP_009374732.1| PREDICTED: protein TERMINAL FLOWER 1-like [Pyrus x bretschneideri]
 dbj|BAD10963.1| TFL1-like protein [Pyrus communis]
 dbj|BAJ33557.1| terminal flower 1 [Pyrus pyrifolia var. culta]
 dbj|BAK74838.1| terminal flowering 1 [Pyrus pyrifolia]
Length=172

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = +1

Query  154  VRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDS  330
            ++R  +PLVVGRVIGDV+D F  T  M+V Y  K + +G ++ PS+V  +PRV I GGD 
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGDM  60

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
              F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR+
Sbjct  61   RSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYEMPKPNIGIHRF  119

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            + VLF+Q +      P  +SR++F TR+FA   +L  PVA VYFNA +E AA
Sbjct  120  VFVLFKQNRRQSINTP--SSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAA  169



>gb|AID67210.1| MFT2-like protein, partial [Picea abies]
 gb|AID67243.1| MFT2-like protein, partial [Picea abies]
Length=157

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLEL  615
            + V F+Q+  +  +  P   R+NF TRAFA    L
Sbjct  122  VFVAFRQQDPMVMMMAPQV-RHNFSTRAFAAQYGL  155



>ref|XP_010101582.1| hypothetical protein L484_015411 [Morus notabilis]
 gb|EXB88721.1| hypothetical protein L484_015411 [Morus notabilis]
Length=169

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 4/167 (2%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQFYT  345
            +PLV+GRVIGDV+D F PT  M+V Y  K + +G ++ PS V  +PRV I GGD   F+T
Sbjct  3    EPLVIGRVIGDVLDSFTPTTKMSVSYNKKQVCNGHELFPSAVTTKPRVEIQGGDMRCFFT  62

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            L+MTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR++ VLF
Sbjct  63   LIMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYEMPKPNIGIHRFVFVLF  121

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +QK     + PP +SR++F TR FA   +L  PVA VYFNA +E AA
Sbjct  122  KQKS-RQSVNPP-SSRDHFNTRNFAAENDLGLPVAAVYFNAQRETAA  166



>gb|AID67196.1| MFT2-like protein, partial [Picea abies]
Length=156

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLEL  615
            + V F+Q+  +  +  P   R+NF TRAFA    L
Sbjct  122  VFVAFRQQDPMVMMMAPQV-RHNFSTRAFAAQYGL  155



>gb|AGN29206.1| TFL1 [Cardamine flexuosa]
Length=177

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R V+PL+VGRV+GDV+D F+PT  M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGTRVVEPLIVGRVVGDVLDYFIPTTKMHVSYNKKQVSNGHELFPSSVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HWIVT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            Y+ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  YVFVLFKQKQ-RRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  174



>gb|AFK31124.1| Hd3a, partial [Oryza rufipogon]
Length=179

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R+ DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RDRDPLVVGRVMGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF TR FA    L SPVATVYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFSTRNFAELYNLGSPVATVYFNCQREAGSG  173



>ref|NP_001280887.1| protein TERMINAL FLOWER 1-like [Malus domestica]
 dbj|BAD06418.1| TFL1-like protein [Malus domestica]
 dbj|BAD10961.1| TFL1-like protein [Malus domestica]
 gb|ABF84011.1| terminal flower 1 [Malus domestica]
 dbj|BAG31955.1| TFL1 like protein [Malus domestica]
Length=172

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = +1

Query  154  VRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDS  330
            ++R  +PLVVGRVIGDV+D F  T  M+V Y  K + +G ++ PS+V  +PRV I GGD 
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGDM  60

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
              F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR+
Sbjct  61   RSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYEMPKPNIGIHRF  119

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            + VLF+Q +      P  +SR++F TR+FA   +L  PVA VYFNA +E AA
Sbjct  120  VFVLFKQNQRQSINTP--SSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAA  169



>gb|ABW24966.1| terminal flower 1b [Gossypium raimondii]
Length=172

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R V+PL+ GRVIGDV+D F+P++ M V +  K + +G +  PS V  +PRV + GGD   
Sbjct  3    REVEPLMGGRVIGDVMDSFIPSIKMLVTFNNKQVFNGHEFYPSTVVTKPRVEVAGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYENPKPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      P   SR+NF TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQKRRQIIKSP--CSRDNFNTRRFASENDLGLPVAAVYFNAQRETAA  169



>ref|XP_006587343.1| PREDICTED: CEN-like protein 1-like isoform X2 [Glycine max]
Length=173

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M R    PLVVGRVIG+VVD+F P+V M V Y  K + +G ++ PS +  +PRV IGGD 
Sbjct  1    MSRLMEQPLVVGRVIGEVVDIFSPSVRMNVTYSTKQVANGHELMPSTIMAKPRVEIGGDD  60

Query  331  TQF-YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             +  YTL+MTDPDAPSPS+P +RE +HW VTDIPG T D++ GKE V Y  PKP +GIHR
Sbjct  61   MRTAYTLIMTDPDAPSPSDPHLREHLHWTVTDIPGTT-DVSFGKEIVGYESPKPVIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            Y+ +LF+Q+     ++PP +SR++F TR F+    L  PVA VYFNA +E AA
Sbjct  120  YVFILFKQRG-RQTVRPP-SSRDHFNTRRFSEENGLGLPVAVVYFNAQRETAA  170



>ref|XP_009384535.1| PREDICTED: CEN-like protein 1 [Musa acuminata subsp. malaccensis]
Length=173

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 119/171 (70%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            R +DPL VGRVIGDV+D F P+V + V YGP K + +G +  PS V  +PRV IGGD  +
Sbjct  3    RMLDPLTVGRVIGDVLDSFNPSVKLEVVYGPNKRVYNGHEFMPSAVCAKPRVEIGGDDMR  62

Query  337  -FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             FYTL++TDPDAPSPS+P +RE +HWIVTDIPG T +++ G+E V Y  PKP +GIHRY+
Sbjct  63   SFYTLILTDPDAPSPSDPHLREHLHWIVTDIPGTT-NVSFGREIVGYEAPKPFIGIHRYV  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VLF+QK       P   SR++F TR F+    L  PVA VYFNA +E AA
Sbjct  122  FVLFKQKGRQTVYAP--ASRDHFSTRDFSEENGLGLPVAAVYFNAQRETAA  170



>ref|XP_004228449.1| PREDICTED: CEN-like protein 1 [Solanum lycopersicum]
Length=175

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGG-  324
            M  R+++PL+V RVIG+VVD F P+V M V Y G K + +G ++ P ++A +PRV IGG 
Sbjct  1    MSCRDIEPLIVARVIGEVVDSFNPSVKMNVIYNGTKQVFNGHELMPLVIASKPRVEIGGE  60

Query  325  DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIH  504
            D    YTL+MTDPD P PS+P +RE +HWIVTDIPG+T D++ GKE V Y  PKP +GIH
Sbjct  61   DMRSAYTLIMTDPDVPGPSDPYLREHLHWIVTDIPGST-DVSFGKEIVSYESPKPVIGIH  119

Query  505  RYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            RY+ +L++Q +    ++PPVT R++F  R FA    L SPVA VYFNA +E AA
Sbjct  120  RYVFILYKQNRGRQTVKPPVT-RDHFNARKFAVENGLGSPVAAVYFNAQRETAA  172



>ref|XP_008788083.1| PREDICTED: protein SELF-PRUNING-like [Phoenix dactylifera]
Length=173

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 119/171 (70%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYG-PKAITSGSDVKPSMVADRPRVHI-GGDST  333
            R ++PL+VGRVIG+V+D F P+V M V Y   K + +G +  PS V  +PRV + GGD  
Sbjct  3    RALEPLIVGRVIGEVLDSFNPSVKMVVAYNFNKVVCNGHEFYPSAVTSKPRVEVQGGDMR  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D + G+E V Y  P+P+VGIHR++
Sbjct  63   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DASFGREVVIYESPRPSVGIHRFV  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VLF+QK+   E+  P  SR+NF TR FA   +L  PVA VYFNA +E AA
Sbjct  122  FVLFKQKR--REVVTPPASRDNFSTRRFAEENDLGLPVAAVYFNAQRETAA  170



>gb|AFK31163.1| Hd3a, partial [Oryza rufipogon]
Length=179

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKGFAELYNLGSPVAAVYFNCQRETGSG  173



>ref|NP_001267935.1| MFT-like protein [Vitis vinifera]
 gb|ABI99469.1| MFT-like protein [Vitis vinifera]
Length=175

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 111/167 (66%), Gaps = 3/167 (2%)
 Frame = +1

Query  163  NVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGD--STQ  336
            +++ LVVG+VIGDVV+MF P  +  V+YG + + +G  + PS   D+P+V I G   S+ 
Sbjct  4    SLESLVVGKVIGDVVNMFTPAAEFTVHYGSRQVANGRMIPPSAAVDKPKVQIHGHRLSSN  63

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTLVM DPDAPSPSEP +RE +HWIV DIP    D T+G+E VPYMGP+P  GIHRYI 
Sbjct  64   LYTLVMVDPDAPSPSEPTLREWLHWIVVDIPEGC-DATQGREVVPYMGPQPPTGIHRYIF  122

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
             LF+QK        P  +R+NF TR FA    L  PVA VYFN+ KE
Sbjct  123  TLFKQKAAAMSGTLPPETRSNFSTRQFAAGNGLGPPVALVYFNSQKE  169



>gb|AAW23034.1| flowering locus T [Triticum aestivum]
 gb|ABK32205.1| VRN3 [Triticum aestivum]
 gb|ABK32206.1| VRN3 [Triticum monococcum subsp. aegilopoides]
 gb|ABK32207.1| VRN3 [Triticum turgidum]
 gb|ABK32208.1| VRN3 [Triticum aestivum]
 gb|AHB86975.1| PEBP [Oncidium hybrid cultivar]
 gb|AHB86976.1| PEBP [Cymbidium hybrid cultivar]
Length=177

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G + +++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRTVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGPPVAAVYFNCQREAGSG  171



>dbj|BAI49900.1| FT-like protein [Phyllostachys meyeri]
Length=178

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 114/174 (66%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-D  327
            MV  + DPLV GRV+GDV+D FV T D+ V YGP+ I++G ++KPSMV  +PR+ +GG D
Sbjct  1    MVGGDRDPLVAGRVVGDVLDPFVRTTDLRVSYGPRTISNGCELKPSMVVHQPRLEVGGND  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               FYTLVM DPDAPSPSEP +RE +HW+VTDIPG T     G+E V Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSEPNLREYLHWLVTDIPGTT-GAAFGQEVVCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++ VLFQQ        P    R NF TR FA    L  P A VYFN  +E  + 
Sbjct  120  FVFVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGQPAAAVYFNCQREAGSG  171



>gb|ADO64261.1| KSN [Rosa chinensis var. spontanea]
Length=172

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PLVVGRVIGDV+D F P   M V Y  K + +G ++ PS V  +PRV I GGD   
Sbjct  3    RISEPLVVGRVIGDVLDYFTPNTKMIVTYSTKLVFNGHELFPSAVTAKPRVEIQGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P ++E +HWIVTDIPG T D+T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTT-DVTFGREMVSYEMPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+    + PP +SR++F TR+FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQKR-RQSVNPP-SSRDHFNTRSFAAENDLGLPVAAVYFNAQRETAA  169



>gb|AEO72023.1| TFL1-like protein [Prunus yedoensis]
Length=172

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 119/170 (70%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PLVVGRVIGDV+D F PT  M+V Y  K + +G ++ PS V  +PRV I GGD   
Sbjct  3    RTSEPLVVGRVIGDVLDCFTPTTKMSVTYNTKLVCNGYELYPSAVTTKPRVEIQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TL+MTDPD P+PS+P +RE +HWIVTDIPG T D T G+E + Y  P+P +GIHR++ 
Sbjct  63   FFTLIMTDPDVPAPSDPYLREHLHWIVTDIPGTT-DATFGREVMSYEMPRPDIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+    + PP +SR++F  R+FA   +L  PVA VYFN  +E AA
Sbjct  122  VLFKQKR-RQSVNPP-SSRDHFSARSFAAENDLGLPVAAVYFNCQRETAA  169



>gb|ABI34864.1| FT [Aegilops tauschii]
 dbj|BAG12867.1| putative kinase inhibitor [Triticum aestivum]
 gb|EMT15643.1| hypothetical protein F775_05442 [Aegilops tauschii]
Length=177

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D F+ T ++ V +G + +++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFIRTTNLRVTFGNRTVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGPPVAAVYFNCQREAGSG  171



>ref|XP_006353340.1| PREDICTED: CEN-like protein 1-like [Solanum tuberosum]
Length=175

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 122/175 (70%), Gaps = 5/175 (3%)
 Frame = +1

Query  148  MMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGG  324
            M  R   +PL VGRVIG+VVD F P+V M V Y G K +++G ++ P++VA +PRV IGG
Sbjct  1    MSSRGTCEPLAVGRVIGEVVDSFSPSVKMKVIYNGSKQVSNGHEIMPAVVATQPRVEIGG  60

Query  325  -DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGI  501
             D    YTL+MTDPDAPSPS+P +RE +HWIVTDIPG T DI+ G+E V Y  PKP +GI
Sbjct  61   EDMRSAYTLIMTDPDAPSPSDPYLREHLHWIVTDIPGTT-DISFGREIVCYETPKPVIGI  119

Query  502  HRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            HRY+ +L++Q+       P  ++R+ F TR+F+    L SPVA VYFNA +E AA
Sbjct  120  HRYVFLLYKQRGRQTVKAP--STRDQFNTRSFSAENGLGSPVAAVYFNAQRETAA  172



>gb|AFK31070.1| Hd3a, partial [Oryza sativa Japonica Group]
Length=179

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R+ DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RDRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVATVYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFSTKNFAELYNLGSPVATVYFNCQREAGSG  173



>ref|NP_001173006.1| Os02g0531600 [Oryza sativa Japonica Group]
 dbj|BAD28412.1| putative Cen-like protein [Oryza sativa Japonica Group]
 gb|EAY86144.1| hypothetical protein OsI_07517 [Oryza sativa Indica Group]
 gb|EAZ23305.1| hypothetical protein OsJ_07001 [Oryza sativa Japonica Group]
 dbj|BAH01422.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91735.1| Os02g0531600 [Oryza sativa Japonica Group]
Length=173

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 118/171 (69%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHI-GGDST  333
            R ++PL+VG+VIG+V+D F PTV M   YG  K + +G +  PS VA +PRV + GGD  
Sbjct  3    RVLEPLIVGKVIGEVLDNFNPTVKMTATYGANKQVFNGHEFFPSAVAGKPRVEVQGGDLR  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D + G+E V Y  P+P +GIHR+I
Sbjct  63   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DASFGREVVSYESPRPNIGIHRFI  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            LVLF+QK+      PP  SR+ F TR FA   +L  PVA VYFNA +E AA
Sbjct  122  LVLFRQKRRQAVSPPP--SRDRFSTRQFAEDNDLGLPVAAVYFNAQRETAA  170



>dbj|BAD10966.1| TFL1-like protein [Eriobotrya japonica]
 gb|ADB92194.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R ++PLVVGRVIGDV+D F  T  M+V Y  K + +G ++ PS+V  +PRV I GGD   
Sbjct  3    RALEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYEMPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q +      P  +SR++F TR+FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQNRRQSINTP--SSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAA  169



>gb|ACL27223.1| fasciculate [Capsicum frutescens]
Length=175

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHI-GG  324
            M  +  +PLV+GRVIG+VVD F P+V M+V Y   K + +G ++ PS V  +PRV + GG
Sbjct  1    MASKMCEPLVIGRVIGEVVDYFCPSVKMSVIYNSNKHVYNGHELFPSSVTTKPRVEVNGG  60

Query  325  DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIH  504
            D   F+TL+M DPD P PS+P +RE +HWIVTDIPG T D + G+E V Y  P+PT+GIH
Sbjct  61   DLRSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTT-DCSFGREVVGYEMPRPTIGIH  119

Query  505  RYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            R++ +LFQQKK       P+ SR+ FCTR F+   EL SPVA V+FN  +E AA
Sbjct  120  RFVFLLFQQKKRQTISNAPL-SRDRFCTRKFSEENELGSPVAAVFFNCQRETAA  172



>ref|XP_009130785.1| PREDICTED: protein TERMINAL FLOWER 1 [Brassica rapa]
Length=177

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 120/170 (71%), Gaps = 3/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R ++PL++GRV+GDV+D F PT+ M V Y    +++G ++ PS V+ +PRV I GGD   
Sbjct  7    RVIEPLIMGRVVGDVLDFFTPTIKMNVSYNKNQVSNGHELLPSSVSSKPRVEIHGGDLRS  66

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVM DPD P PS+P ++E +HWIVT+IPG T D T GKE V Y  P+P++GIHR++ 
Sbjct  67   FFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHRFVF  125

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+    + P + SR+NF TR FA   +L  PVA V+FNA +E AA
Sbjct  126  VLFKQKQ-RRVIFPNIPSRDNFNTRKFAIEYDLGLPVAAVFFNAQRETAA  174



>dbj|BAK08043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 117/168 (70%), Gaps = 4/168 (2%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQ-FYT  345
            DPLVVGRV+GDV+D FV T ++ V +G +A+++G ++KPSMVA +PRV +GG+  + FYT
Sbjct  5    DPLVVGRVVGDVLDPFVRTTNLRVTFGNRAVSNGCELKPSMVAQQPRVEVGGNEMRTFYT  64

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR++LVLF
Sbjct  65   LVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHRFVLVLF  123

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            QQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  124  QQLGRQTVYAP--GWRQNFNTRDFAELYNLGQPVAAVYFNCQREAGSG  169



>dbj|BAO03055.1| Hd3a [Oryza rufipogon]
Length=179

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRESGSG  173



>dbj|BAI49901.1| FT-like protein [Phyllostachys meyeri]
Length=178

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 116/174 (67%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            MV  + DPLVVGRV+GDV+D FV T ++ V YGP+  ++G ++KPSMV  +PRV +GG+ 
Sbjct  1    MVGGDRDPLVVGRVVGDVIDPFVRTTNLRVSYGPRTTSNGCELKPSMVVHQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPSEP +RE +HW+VTDIPG T     G+E V Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSEPNLREYLHWLVTDIPGTT-GAAFGQEVVCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++ VLFQQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVFVLFQQLGRRTVHAP--GRRENFNTRDFAALYNLGQPVAAVYFNCQREAGSG  171



>gb|AHX00603.1| TFL1a [Lupinus angustifolius]
 gb|AHX00604.1| TFL1a [Lupinus angustifolius]
Length=173

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M R + +PL+VGRVIGDV+D F  ++ M V Y  K + +G ++ PS V ++PRV I G D
Sbjct  1    MARISSEPLIVGRVIGDVLDSFTTSMKMTVSYNNKQVFNGHELFPSTVTNKPRVEIDGAD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVMTDPD P PS+P MRE +HWIVTDIPG T D T GKE V Y  PKP +GIHR
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYMREHLHWIVTDIPGTT-DATFGKELVNYEIPKPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+     QP  +SR++F T  FA   +L  PVA VYFNA +E AA
Sbjct  120  FVFVLFKQKRRQCVTQP--SSRDHFNTMNFASENDLGLPVAAVYFNAQRETAA  170



>ref|NP_001289244.1| protein TERMINAL FLOWER 1-like [Pyrus x bretschneideri]
 dbj|BAD10968.1| TFL1-like protein [Pyrus pyrifolia]
 dbj|BAD10969.1| TFL1-like protein [Pyrus communis]
 dbj|BAK74839.1| terminal flowering 1 [Pyrus pyrifolia]
 dbj|BAI99732.4| terminal flower1 [Pyrus pyrifolia var. culta]
 gb|AGW22130.1| terminal flower 1 protein [Pyrus x bretschneideri]
Length=172

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 4/167 (2%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQFYT  345
            +PLVVGRVIGDV+D F PT  M+V Y  K + +G ++ PS+V  +PRV I GG+   F+T
Sbjct  6    EPLVVGRVIGDVLDSFTPTTHMSVTYNTKLVCNGLELFPSVVTAKPRVEIQGGELRSFFT  65

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPD P PS+P +RE +HWIVTDIPG T D   G+EA+ Y  P+P +GIHR++ VLF
Sbjct  66   LVMTDPDCPGPSDPYLREHLHWIVTDIPGTT-DAAFGREALSYEMPRPNIGIHRFVFVLF  124

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +QK+    + PP +SR+ F TR+FA   +L  PVA VYFNA +E AA
Sbjct  125  KQKR-RQSINPP-SSRDCFSTRSFAAENDLGLPVAAVYFNAQREGAA  169



>ref|NP_001280770.1| CEN-like protein 1 [Malus domestica]
 gb|AGX15186.1| BFTb [Malus domestica]
Length=173

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            R  +PL VGRVIG+VVD+F P+V + V Y P K + +G ++ PS++A++PRV IGGD  +
Sbjct  3    RTTEPLTVGRVIGEVVDIFTPSVKLNVVYNPNKQVANGHELMPSVIAEKPRVDIGGDDMR  62

Query  337  F-YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
              YTL+MTDPD P PS+P ++E +HW+VTDIPG T D++ GKE V Y  PKP VGIHRY+
Sbjct  63   IAYTLIMTDPDYPGPSDPYLKEHLHWMVTDIPGTT-DVSFGKETVEYETPKPVVGIHRYV  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             +LF+Q+       P   SR+NF TR F+    L  PVA VYFNA +E AA
Sbjct  122  FLLFKQRGRQTVRAP--ASRDNFNTRKFSQENGLGLPVAAVYFNAQRETAA  170



>gb|ABY91243.1| CTRSTFL-like protein [Citrus trifoliata]
Length=173

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 120/173 (69%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL VGRVIGDV++ F P++  +V Y  K + +G ++ PS V  +PRV I GGD
Sbjct  1    MAARMLEPLAVGRVIGDVIESFTPSIKKSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGRELVSYEIPRPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+Q +    + PP +SR++F TRAFA   +L  PVA VYFNA +E AA
Sbjct  120  FVFVLFKQTR-RQTVNPP-SSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAA  170



>ref|XP_004234370.1| PREDICTED: CEN-like protein 1 [Solanum lycopersicum]
Length=175

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 123/175 (70%), Gaps = 5/175 (3%)
 Frame = +1

Query  148  MMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYY-GPKAITSGSDVKPSMVADRPRVHIGG  324
            M  R   +PL VGRVIG+VVD F P+V M V Y G K +++G ++ P++VA +PRV IGG
Sbjct  1    MSSRSTCEPLAVGRVIGEVVDSFSPSVKMKVIYNGRKQVSNGHEIMPAVVATQPRVEIGG  60

Query  325  -DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGI  501
             D    YTL+MTDPDAPSPS+P +RE +HWIVTDIPG T DI+ G+E V Y  PKP +GI
Sbjct  61   EDMRSAYTLIMTDPDAPSPSDPYLREHLHWIVTDIPGTT-DISFGREIVCYETPKPVIGI  119

Query  502  HRYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            HRY+ +L++Q+     ++ P T R+ F TR+F+    L SPVA VYFNA +E AA
Sbjct  120  HRYVFLLYKQRG-RQTVRAPAT-RDQFNTRSFSAENGLGSPVAAVYFNAQRETAA  172



>gb|ABR23052.1| terminal flower-like protein [Picea abies]
 gb|ADE77648.1| unknown [Picea sitchensis]
Length=173

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQ-  336
            R  +PLV+GRVIGDVVDMF+P+V++ V YG + + +G ++KPS ++  PRV +GGD  + 
Sbjct  3    RFREPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSAPRVDVGGDDLRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             +TLVMTDPDAPSPS+P +RE +HWIVTDIP  T   + G+E + Y  P+PT+GIHRY+ 
Sbjct  63   CFTLVMTDPDAPSPSDPTLREYLHWIVTDIPATTA-ASFGRELMRYEAPRPTIGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
             LF+Q  +  E   P  SR NF TR FA    L  PVA VY+NA KE A
Sbjct  122  TLFKQ--MARETVYPPQSRVNFSTRDFAEMNGLGLPVAAVYYNAQKETA  168



>gb|AID67220.1| MFT2-like protein, partial [Picea abies]
 gb|AID67237.1| MFT2-like protein, partial [Picea abies]
Length=158

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 111/158 (70%), Gaps = 5/158 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSP  624
            + V F+Q+  +  +  P   R+NF TRAF     L  P
Sbjct  122  VFVAFRQQDPMVMMMAPQV-RHNFSTRAFXAQYGLGLP  158



>gb|KDP22308.1| hypothetical protein JCGZ_26139 [Jatropha curcas]
 gb|AID51388.1| terminal flower 1c [Jatropha curcas]
 gb|AID51394.1| terminal flower 1c [Jatropha curcas]
Length=175

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 120/168 (71%), Gaps = 5/168 (3%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHIGG-DSTQFY  342
             PL VGR+IG+VVD F P+V M+V Y P + + +G ++ PS++A +PRV IGG D    Y
Sbjct  8    QPLTVGRIIGEVVDAFTPSVKMSVTYNPNRQVANGHELMPSVIAAKPRVEIGGQDLRTSY  67

Query  343  TLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVL  522
            TL+MTDPDAPSPS+P +RE +HW+VTDIPG T D++ GKE V Y  PKP VGIHRY+ +L
Sbjct  68   TLIMTDPDAPSPSDPHLREHIHWMVTDIPGTT-DVSFGKEIVSYESPKPVVGIHRYVFLL  126

Query  523  FQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            F+Q+     ++PP+ SR+ F TR FA    L  PVA VYFNA +E AA
Sbjct  127  FKQRG-RQTVRPPI-SRDYFNTRRFAEENGLGLPVAAVYFNAQRETAA  172



>dbj|BAI49899.1| FT-like protein [Phyllostachys meyeri]
Length=178

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 114/174 (66%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-D  327
            MV  + DPLVVGRV+GDV+D FV T ++ V YGP+ I++G ++KPSMV  +PR+ +GG D
Sbjct  1    MVGGDRDPLVVGRVVGDVLDPFVRTTNLRVSYGPRTISNGCELKPSMVVHQPRIEVGGND  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               FYTLVM DPDAPSPSEP  RE +HW+VTDIPG T     G+E V Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSEPNFREYLHWLVTDIPGTT-GAALGQEVVCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++ VLFQQ        P    R NF TR F     L  PVA VYFN  +E  + 
Sbjct  120  FVFVLFQQLGRQTVYAP--GWRQNFNTRDFXELYNLGQPVAAVYFNCQREAGSG  171



>gb|AEO72027.1| TFL1-like protein [Fragaria vesca]
Length=172

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PL VGRVIGDV+D F PT  M V Y  K + +G ++ PS V  +PRV I GGD   
Sbjct  3    RMSEPLAVGRVIGDVLDSFTPTTKMIVSYNSKLVCNGHELFPSAVTAKPRVEIQGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P ++E +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTT-DATFGREVVSYEMPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF QK+    + PP +SR++F TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFMQKR-RQSMNPP-SSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAA  169



>gb|AGX25242.1| MCN3 [Musa acuminata AAA Group]
 gb|AGX25247.1| MCN3 [Musa acuminata AAA Group]
Length=174

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYG-PKAITSGSDVKPSMVADRPRVHIGGDSTQ  336
            + + PL VGRVIGDV+D FVP + + V YG  K + +G ++ PS V  RPRV IGGD  +
Sbjct  3    KTLGPLAVGRVIGDVLDSFVPGMKLEVAYGHNKQVYNGHELMPSAVCARPRVEIGGDDMR  62

Query  337  -FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             FYTLV+TDPDAPSPS+P  RE +HWIVTDIPG T + + G+E V Y  PKP++GIHRY+
Sbjct  63   SFYTLVLTDPDAPSPSDPHSREHLHWIVTDIPGTT-NASFGREIVSYEAPKPSIGIHRYV  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VLF+QK       PP  SR++F TR+F+    L  PVA VYFNA +E AA
Sbjct  122  FVLFKQKGRRTVCVPPA-SRDHFNTRSFSEESGLGLPVAAVYFNAQRETAA  171



>gb|AIU44253.1| TFL1 [Oncidium hybrid cultivar]
Length=173

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 122/171 (71%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYG-PKAITSGSDVKPSMVADRPRVHI-GGDST  333
            R ++PLVVGRVIG+V+++F P+V M V Y   K + +G ++ PS++ D PRV + GGD  
Sbjct  3    RAIEPLVVGRVIGEVLELFNPSVKMKVTYNCNKHVYNGHELYPSVILDMPRVEVQGGDLR  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             F+TL+MTDPD P PS+P +RE VHWIVTDIPG T D + G+E VPY  P+P +GIHR++
Sbjct  63   SFFTLIMTDPDVPGPSDPYLREHVHWIVTDIPGTT-DASFGREVVPYESPRPRIGIHRFV  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VLF QK+ L  + PP+ SR+ F TR FA   +L  PV+ VYFNA +E AA
Sbjct  122  FVLFMQKRRL-TVGPPI-SRDRFNTRGFAEEHDLGLPVSAVYFNAQRETAA  170



>gb|AFK31116.1| Hd3a, partial [Oryza nivara]
Length=179

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R+ DPLVVGRV+GDV+D FV + ++ V YG KA+++G ++KPSMV  +PRV +GG D   
Sbjct  6    RDRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKAVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQREAGSG  173



>gb|AFK31129.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31130.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31135.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31137.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31138.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31139.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31140.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31141.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31143.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31154.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31155.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31156.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31157.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31158.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31159.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31160.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31161.1| Hd3a, partial [Oryza rufipogon]
Length=179

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRETGSG  173



>gb|AFK32780.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R ++PLVVGRVIGDV+D F  T  M+V Y  K + +G +V PS+V  +PRV I GGD   
Sbjct  3    RALEPLVVGRVIGDVLDSFTATTKMSVTYNTKLVCNGLEVFPSVVTAKPRVEIQGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FLTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYEMPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q +      P  +SR++F TR+FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFKQNRRQSINTP--SSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAA  169



>ref|XP_010089842.1| hypothetical protein L484_022359 [Morus notabilis]
 gb|EXB38458.1| hypothetical protein L484_022359 [Morus notabilis]
Length=174

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M +   DPLV+GRVIGDVVD F P++ ++V Y  K + +G ++ PS V  +P+V + GGD
Sbjct  1    MAKHMSDPLVLGRVIGDVVDPFSPSLRISVTYSNKKVYNGHELLPSSVTTKPKVEVHGGD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D++ G+E V Y  P+P +GIHR
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DVSFGREVVSYEMPRPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            ++L+LF+QK+      PP  SR  F TR+FA   EL  PVA V+FNA +E A
Sbjct  120  FVLLLFKQKRRQTVAAPP-PSRERFSTRSFAQENELGLPVAAVFFNAQRETA  170



>dbj|BAG72295.1| Hd3a [Oryza rufipogon]
 dbj|BAG72296.1| Hd3a [Oryza rufipogon]
 dbj|BAG72297.1| Hd3a [Oryza rufipogon]
 dbj|BAG72299.1| Hd3a [Oryza rufipogon]
 dbj|BAG72300.1| Hd3a [Oryza rufipogon]
 dbj|BAO02923.1| Hd3a [Oryza rufipogon]
 dbj|BAO02988.1| Hd3a [Oryza rufipogon]
 dbj|BAO02989.1| Hd3a [Oryza rufipogon]
Length=179

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRETGSG  173



>ref|NP_001276314.1| uncharacterized protein LOC100783608 [Glycine max]
 gb|ACU00126.1| terminal flowering 1-like protein 4 [Glycine max]
Length=173

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = +1

Query  172  PLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF-YTL  348
            PLVVGRVIG+VVD+F P+V M V Y  K + +G ++ PS +  +PRV IGGD  +  YTL
Sbjct  8    PLVVGRVIGEVVDIFSPSVRMNVTYSTKQVANGHELMPSTIMAKPRVEIGGDDMRTAYTL  67

Query  349  VMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLFQ  528
            +MTDPDAPSPS+P +RE +HW VTDIPG T D++ GKE V Y  PKP +GIHRY+ +LF+
Sbjct  68   IMTDPDAPSPSDPHLREHLHWTVTDIPGTT-DVSFGKEIVGYESPKPVIGIHRYVFILFK  126

Query  529  QKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            Q+     ++PP +SR++F TR F+    L  PVA VYFNA +E AA
Sbjct  127  QRG-RQTVRPP-SSRDHFNTRRFSEENGLGLPVAVVYFNAQRETAA  170



>gb|ABQ85553.1| flowering locus T-like/terminal flower1-like protein [Picea abies]
Length=173

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQ-  336
            R  +PLV+GRVIGDVVDMF+P+V++ V YG + + +G ++KPS ++  PRV +GGD  + 
Sbjct  3    RFREPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSAPRVDVGGDDLRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             +TL+MTDPDAPSPS+P +RE +HWIVTDIP  T   + G+E + Y  P+PT+GIHRY+ 
Sbjct  63   CFTLIMTDPDAPSPSDPTLREYLHWIVTDIPATTA-ASFGRELMRYEAPRPTIGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
             LF+Q  +  E   P  SR NF TR FA    L  PVA VY+NA KE A
Sbjct  122  TLFKQ--MARETVYPPQSRVNFSTRDFAEMNGLGLPVAAVYYNAQKETA  168



>gb|AFK31134.1| Hd3a, partial [Oryza rufipogon]
Length=179

 Score =   177 bits (449),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMIDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRETGSG  173



>ref|XP_006289547.1| hypothetical protein CARUB_v10003093mg [Capsella rubella]
 gb|EOA22445.1| hypothetical protein CARUB_v10003093mg [Capsella rubella]
Length=178

 Score =   177 bits (449),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL+VGRV+GDV+D F PT  M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  5    MGARVIEPLIVGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSFVSSKPRVEIHGGD  64

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HW+VT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  65   LRSFFTLVMIDPDVPGPSDPFLKEHLHWLVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  123

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  124  FVFVLFKQKQ-RRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  175



>gb|AID67229.1| MFT2-like protein, partial [Picea abies]
 gb|AID67254.1| MFT2-like protein, partial [Picea abies]
Length=149

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG---DS  330
            R+VDPLVVG V+GDV+D+FV   DM V+YGPK +T+G ++KPS    RP + I G   D 
Sbjct  3    RSVDPLVVGNVVGDVIDIFVRAADMTVHYGPKQVTNGCEIKPSATVHRPNLQIAGRHFDD  62

Query  331  TQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRY  510
             + +TLVMTDPDAPSPSEP MRE +HWIVTDIPG   D ++G+E VPYMGP+P +GIHRY
Sbjct  63   NKLFTLVMTDPDAPSPSEPNMREWLHWIVTDIPGAA-DASQGREIVPYMGPRPPIGIHRY  121

Query  511  ILVLFQQKKVLGELQPPVTSRNNFCTRAF  597
            + V F+Q+  +  +  P   R+NF TRAF
Sbjct  122  VFVAFRQQDPMVMMMAP-QVRHNFSTRAF  149



>ref|XP_002873117.1| hypothetical protein ARALYDRAFT_487163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABY79195.1| At5g03840-like protein [Arabidopsis lyrata]
 gb|EFH49376.1| hypothetical protein ARALYDRAFT_487163 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL++GRV+GDV+D F PT+ M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGTRVIEPLIMGRVVGDVLDFFTPTIKMNVSYNKKQVSNGHELFPSSVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HWIVT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFKQKQ-RRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  174



>gb|ADP95116.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95117.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95118.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95119.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95120.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95121.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95122.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95123.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95124.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95125.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95126.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95127.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95128.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95129.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95130.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95131.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95132.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95133.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95134.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95135.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95136.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95137.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95138.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95139.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95140.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95141.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95142.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95143.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95144.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95145.1| flowering locus T-like protein [Picea sitchensis]
 gb|ADP95146.1| flowering locus T-like protein [Picea sitchensis]
Length=193

 Score =   177 bits (450),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQ-FYT  345
            +PLV+GRVIGDVVDMF+P+V++ V YG + + +G ++KPS ++  PRV +GGD  +  +T
Sbjct  26   EPLVLGRVIGDVVDMFMPSVNLTVAYGSRQVNNGCEIKPSAISSAPRVDVGGDDLRTCFT  85

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVMTDPDAPSPS+P +RE +HWIVTDIP  T   + G+E + Y  P+PT+GIHRY+  LF
Sbjct  86   LVMTDPDAPSPSDPTLREYLHWIVTDIPATTA-ASFGRELMRYEAPRPTIGIHRYVFTLF  144

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPA  663
            +Q  +  E   P  SR NF TR FA    L  PVA VY+NA KE A
Sbjct  145  KQ--MARETVYPPQSRVNFSTRDFAEMNGLGLPVAAVYYNAQKETA  188



>ref|XP_009792306.1| PREDICTED: CEN-like protein 2 [Nicotiana sylvestris]
Length=172

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R+++PL+VGRV+GDV+D F P + M + Y  K + +G ++ PS+V  RP+V + GGD   
Sbjct  3    RSLEPLIVGRVVGDVLDSFSPIMKMTISYNNKLVCNGHELLPSVVTARPKVEVQGGDLRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGRELVSYEIPMPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+      P  TSR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  122  VLFKQKRRQSVSSP--TSRDHFNTRNFAEENDLGQPVAAVFFNAQRETAA  169



>ref|XP_010490878.1| PREDICTED: protein TERMINAL FLOWER 1-like [Camelina sativa]
Length=177

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL+VGRV+GDV+D F PT  M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGTRVIEPLIVGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIYGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HW+VT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWLVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFKQKQ-RRVIFPSIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  174



>dbj|BAO03056.1| Hd3a [Oryza rufipogon]
Length=179

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLV+GRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVIGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRETGSG  173



>ref|NP_001267006.1| protein TERMINAL FLOWER 1-like [Fragaria vesca]
 gb|ADO64258.1| TFL1-like protein [Fragaria vesca]
 gb|AEP23097.1| terminal flower 1 [Fragaria vesca]
 dbj|BAO93909.1| terminal flower 1 [Fragaria x ananassa]
Length=172

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PL VGRVIGDV+D F PT  M V Y  K + +G ++ PS V  +PRV I GGD   
Sbjct  3    RMSEPLAVGRVIGDVLDSFTPTTKMIVSYNSKLVCNGHELFPSAVTAKPRVEIQGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P ++E +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTT-DATFGREVVSYEMPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF QK+    + PP +SR++F TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFMQKR-RQSVNPP-SSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAA  169



>ref|XP_006481791.1| PREDICTED: protein TERMINAL FLOWER 1 isoform X1 [Citrus sinensis]
Length=173

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 120/173 (69%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL VG VIGDV++ F P++ M+V Y  K + +G ++ PS V  +PRV I GGD
Sbjct  1    MAARMLEPLAVGGVIGDVIESFTPSIKMSVTYNNKQVCNGHELFPSTVVSKPRVEIQGGD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGRELVSYEIPRPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+Q +    + PP +SR++F TRAFA   +L  PVA VYFNA +E AA
Sbjct  120  FVFVLFKQTR-RQTVNPP-SSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAA  170



>gb|ADL62862.1| terminal flower 1 [Prunus armeniaca]
Length=172

 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PLVVGRVIGDV+D F PT  M+V Y  + + +G ++ PS V  +PRV I GGD   
Sbjct  3    RMSEPLVVGRVIGDVLDCFTPTTKMSVTYNTRLVCNGYELYPSAVTTKPRVEIQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TL+MTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIH ++ 
Sbjct  63   FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYEMPRPNIGIHTFVC  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+QK+    + PP +SR++F  R+FA   +LD PVA VYFN  +E AA
Sbjct  122  VLFKQKR-RQSVNPP-SSRDHFSARSFAAENDLDLPVAAVYFNCQRETAA  169



>ref|XP_010543489.1| PREDICTED: protein TERMINAL FLOWER 1 [Tarenaya hassleriana]
Length=199

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 120/179 (67%), Gaps = 4/179 (2%)
 Frame = +1

Query  139  ISKMMVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI  318
            +  M   R ++PL+VGRVIGDV+D F P++ M V Y  K + +G ++ PS ++  PRVHI
Sbjct  19   MENMGGSRAIEPLIVGRVIGDVLDFFTPSIKMTVSYSKKQVCNGHELLPSSLSSAPRVHI  78

Query  319  -GGDSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTV  495
             G D   F+TLVM DPD P PS+P +RE +HWIVT+IPG T D T GKE V Y  P+P++
Sbjct  79   HGADLRSFFTLVMVDPDVPGPSDPYLREHLHWIVTNIPGTT-DATFGKEVVSYEVPRPSI  137

Query  496  GIHRYILVLFQQKK--VLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            GIHRY+ VLF+Q++  V+      V SR++F TR F    +L  PVA VYFNA +E AA
Sbjct  138  GIHRYVFVLFKQRQRHVVTSTTNSVPSRDHFNTRRFVAEHDLGLPVAAVYFNAQRETAA  196



>ref|NP_001066172.1| Os12g0152000 [Oryza sativa Japonica Group]
 gb|AAD42896.1|AF159883_1 Cen-like protein FDR1 [Oryza sativa]
 gb|ABA95827.1| CENTRORADIALIS, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29191.1| Os12g0152000 [Oryza sativa Japonica Group]
 gb|EAY82277.1| hypothetical protein OsI_37487 [Oryza sativa Indica Group]
 gb|EAZ19669.1| hypothetical protein OsJ_35245 [Oryza sativa Japonica Group]
Length=173

 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 118/171 (69%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHI-GGDST  333
            R+V+PLVVGRVIG+V+D F P   M V Y   K + +G +  PS V  +PRV + GGD  
Sbjct  3    RSVEPLVVGRVIGEVIDSFNPCTKMIVTYNSNKLVFNGHEFYPSAVVSKPRVEVQGGDMR  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D + G+E + Y  PKP++GIHR++
Sbjct  63   SFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DASFGREIISYESPKPSIGIHRFV  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VLF+QK+    + P  +SR++F TR FA   EL  PVA VYFNA +E AA
Sbjct  122  FVLFKQKRRQAVVVP--SSRDHFNTRQFAEENELGLPVAAVYFNAQRETAA  170



>ref|XP_006655810.1| PREDICTED: protein HEADING DATE 3A-like [Oryza brachyantha]
Length=177

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 113/168 (67%), Gaps = 4/168 (2%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQFYT  345
            DPLVVGRV+GDV+D F  T  + V YG + +++G ++KPSMV  +PRV +GG D   FYT
Sbjct  7    DPLVVGRVVGDVLDQFTRTTSLRVSYGGRTVSNGCELKPSMVTQQPRVEVGGTDMRTFYT  66

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVM DPDAP+PS+P +RE +HW+VTDIPG+T   T G+E + Y  P+PT+GIHR +LVLF
Sbjct  67   LVMVDPDAPNPSDPSLREYLHWLVTDIPGST-GATFGQEVMCYESPRPTMGIHRMVLVLF  125

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            QQ        P    R NF TR FA    L SPVA VYFN  +E  + 
Sbjct  126  QQLGRQTVYAP--GWRQNFSTRDFAELYNLGSPVAAVYFNCQREAGSG  171



>gb|ABY79180.1| At5g03840 [Arabidopsis thaliana]
Length=174

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL++GRV+GDV+D F PT  M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGTRVIEPLIIGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HWIVT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFRQKQ-RRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  174



>gb|AEZ63950.1| FLOWERING LOCUS T2 [Dimocarpus longan]
 gb|AHF27443.1| flowering locus T-like 1 [Dimocarpus longan]
Length=174

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQ-  336
            RN DPL VGRVIGDV+D F  ++ +++ Y  +AI +G ++KPS   ++PRV IGGD  + 
Sbjct  3    RNRDPLAVGRVIGDVLDPFTRSISLSISYNNRAINNGYELKPSQTVNQPRVDIGGDDLRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIP  T   T G+EAV Y  P+PTVGIHR++ 
Sbjct  63   FYTLVMVDPDAPSPSDPTLREYLHWLVTDIPATTG-ATFGQEAVSYESPRPTVGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKE  657
            VLF+Q+       P    R NF T+ FA    L SPVA VYFN  +E
Sbjct  122  VLFRQQGRQTVNAP--GWRQNFKTKDFAELYNLGSPVAAVYFNCQRE  166



>dbj|BAJ22383.1| terminal flower 1b [Vigna unguiculata]
Length=172

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDSTQF  339
            R ++PL VGRVIG+VVD+F P+V M V Y  K + +G ++ PS V  +PRV IGGD  + 
Sbjct  3    RVMEPLSVGRVIGEVVDIFSPSVRMNVTYSTKEVANGHELMPSTVMAKPRVEIGGDDMRT  62

Query  340  -YTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
             YTL+MTDPDAPSPS+P +RE +HW+VTDIPG T D++ GKE + Y  PKP +GIHRY+ 
Sbjct  63   AYTLIMTDPDAPSPSDPYLREHLHWMVTDIPGTT-DVSFGKEIMGYESPKPVIGIHRYVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            +LF+Q+       P  +SR+ F TR F+    L  PVA VYFNA +E AA
Sbjct  122  ILFKQRGRQTVRAP--SSRDRFNTRRFSEENGLGLPVAAVYFNAQRETAA  169



>ref|XP_010423657.1| PREDICTED: protein TERMINAL FLOWER 1 [Camelina sativa]
Length=177

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL+VGRV+GDV+D F PT  M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGTRVIEPLIVGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIYGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HW+VT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWLVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFKQKQ-RRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  174



>gb|AHB86977.1| PEBP [Hygrochilus japonicus]
Length=177

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G + +++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRTVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T     G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GAPFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGPPVAAVYFNCQREAGSG  171



>gb|AFA42328.1| TFL1-like protein [Fragaria x ananassa]
 gb|AFA52237.1| TFL1-like protein [Fragaria x ananassa]
Length=172

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PL VGRVIGDV+D F PT  M V Y  K + +G ++ PS V  +PRV I GGD   
Sbjct  3    RMSEPLAVGRVIGDVLDSFTPTTKMIVTYNTKLVCNGHELFPSAVTAKPRVEIQGGDMRS  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TLVMTDPD P PS+P ++E +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTT-DATFGREVVSYEMPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF QK+    + PP +SR++F TR FA   +L  PVA VYFNA +E AA
Sbjct  122  VLFMQKR-RQSVNPP-SSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAA  169



>dbj|BAO02982.1| Hd3a [Oryza rufipogon]
 dbj|BAO02985.1| Hd3a [Oryza rufipogon]
Length=179

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAP+PS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPNPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRESGSG  173



>ref|XP_008241250.1| PREDICTED: CEN-like protein 2 [Prunus mume]
 dbj|BAJ14521.1| TFL1-like protein [Prunus mume]
 gb|AEO72021.1| TFL1-like protein [Prunus mume]
Length=172

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 118/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGDSTQ  336
            R  +PLVVGRVIGDV+D F PT  M+V Y  + + +G ++ PS V  +PRV I GGD   
Sbjct  3    RMSEPLVVGRVIGDVLDCFTPTTKMSVTYNTRLVCNGYELYPSAVTTKPRVEIQGGDMRT  62

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            F+TL+MTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR++ 
Sbjct  63   FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGREVVSYEMPRPNIGIHRFVF  121

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            VLF+Q++    + PP +SR++F  R+FA   +L  PVA VYFN  +E AA
Sbjct  122  VLFKQRR-RQSVNPP-SSRDHFSARSFAAENDLGLPVAAVYFNCQRETAA  169



>gb|AAM27947.1|AF466807_1 terminal flower 1 [Arabidopsis thaliana]
 gb|ABY79191.1| At5g03840 [Arabidopsis thaliana]
Length=177

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL++GRV+GDV+D F PT  M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGTRVIEPLIIGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HWIVT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFRQKQ-RRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  174



>gb|ADF30920.1| Dt1 [Glycine max]
 gb|ADF30923.1| Dt1 [Glycine max]
 gb|ADF30935.1| Dt1 [Glycine max]
 gb|ADF30942.1| Dt1 [Glycine max]
 gb|ADF31035.1| Dt1 [Glycine max]
 gb|ADF31036.1| Dt1 [Glycine max]
 gb|ADF31042.1| Dt1 [Glycine max]
 gb|ADF31044.1| Dt1 [Glycine max]
 gb|ADF31048.1| Dt1 [Glycine max]
 gb|ADF31049.1| Dt1 [Glycine max]
 gb|ADF31061.1| Dt1 [Glycine max]
 gb|ADF31072.1| Dt1 [Glycine max]
 gb|ADF31075.1| Dt1 [Glycine max]
 gb|ADF31080.1| Dt1 [Glycine max]
 gb|ADF31084.1| Dt1 [Glycine max]
 gb|ADF31091.1| Dt1 [Glycine max]
 gb|ADF31097.1| Dt1 [Glycine max]
 gb|ADF31099.1| Dt1 [Glycine max]
 gb|ADF31122.1| Dt1 [Glycine max]
 gb|ADF31143.1| Dt1 [Glycine max]
 gb|ADF31145.1| Dt1 [Glycine max]
 gb|ADF31155.1| Dt1 [Glycine max]
 gb|ADF31160.1| Dt1 [Glycine max]
 gb|ADF31162.1| Dt1 [Glycine max]
 gb|ADF31190.1| Dt1 [Glycine max]
Length=173

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 119/173 (69%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M +  ++PL+VGRVIG+V+D F  +  M V Y  K + +G ++ PS V  +P+V I GGD
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYNKKQVYNGHELFPSTVNTKPKVEIEGGD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + F+TL+MTDPD P PS+P +RE +HWIVTDIPG T D T GKE V Y  PKP +GIHR
Sbjct  61   MSSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGKELVSYEVPKPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+   +   P TSR++F TR FA   +L  PVA VYFNA +E AA
Sbjct  120  FVFVLFKQKR--RQCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAA  170



>ref|NP_001275848.1| terminal flower [Citrus sinensis]
 gb|AAR04683.1| terminal flower [Citrus sinensis]
 gb|AAR04684.1| terminal flower [Citrus sinensis]
Length=173

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 120/173 (69%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL VG VIGDV++ F P++ M+V Y  K + +G ++ PS V  +PRV I GGD
Sbjct  1    MAARMLEPLAVGGVIGDVIESFTPSIKMSVTYDNKQVCNGHELFPSTVVSKPRVEIQGGD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  P+P +GIHR
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTT-DATFGRELVSYEIPRPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+Q +    + PP +SR++F TRAFA   +L  PVA VYFNA +E AA
Sbjct  120  FVFVLFKQTR-RQTVNPP-SSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAA  170



>dbj|BAH37010.1| terminal flower1-like protein [Raphanus sativus]
Length=177

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL++GRV+GDV+D F PT+ M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGARVIEPLIMGRVVGDVLDFFTPTIKMNVSYNKKQVSNGHELLPSSVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P  +E +HWIVT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFQKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFKQKQ-RRVIFPNIPSRDHFNTRKFAIEYDLGLPVAAVFFNAQRETAA  174



>gb|AGS32268.1| TFL1-1 [Litchi chinensis]
Length=173

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R  DPLVVGRVIGDV++ F P++ M+V +  K + +G +  PS V ++P+V I G D
Sbjct  1    MDSRMQDPLVVGRVIGDVLEAFTPSIRMSVTFNNKQVCNGHEFFPSAVTNKPKVLIQGAD  60

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVMTDPD P PS+P +RE +HWIV+DIPG T D T GKE V Y  PKP +GIHR
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTT-DATFGKEVVGYEIPKPNIGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+      PP  SR+ F T+AFA   +L  PVA VYFNA +E AA
Sbjct  120  FVFVLFKQKRRQTISAPP--SRDQFSTKAFAADNDLGLPVAAVYFNAQRETAA  170



>gb|AAM27952.1|AF466812_1 terminal flower 1 [Arabidopsis thaliana]
 gb|ABY79192.1| At5g03840 [Arabidopsis thaliana]
Length=177

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL++GRV+GDV+D F PT  M V Y  K +++G ++ PS V+ +PRV I GGD
Sbjct  4    MGTRVIEPLIIGRVVGDVLDFFTPTTKMNVSYNKKQVSNGHELFPSSVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HWIVT+IPG T D T GKE V Y  P+P++GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTT-DATFGKEVVSYELPRPSIGIHR  122

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+    + P + SR++F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFRQKQ-RRVIFPNIPSRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAA  174



>dbj|BAH30240.1| FT-like protein [Oryza rufipogon]
Length=178

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +1

Query  169  DPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQFYT  345
            DPLVVGR++GDV+D FV   +++V YG + +++G ++KPSMV  +PRV +GG D   FYT
Sbjct  8    DPLVVGRIVGDVLDPFVRITNLSVSYGARIVSNGCELKPSMVTQQPRVVVGGNDMRTFYT  67

Query  346  LVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYILVLF  525
            LVM DPDAPSPS P +RE +HW+VTDIPG T  IT G+E + Y  P+PT+GIHR + VLF
Sbjct  68   LVMVDPDAPSPSNPNLREYLHWLVTDIPGTT-GITFGQEVMCYESPRPTMGIHRLVFVLF  126

Query  526  QQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            QQ        P    R NF TR FA    L SPVATVYFN  +E  + 
Sbjct  127  QQLGRQTVYAP--GWRQNFSTRNFAELYNLGSPVATVYFNCQREAGSG  172



>gb|AFK31132.1| Hd3a, partial [Oryza rufipogon]
 gb|AFK31145.1| Hd3a, partial [Oryza rufipogon]
Length=179

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAP+PS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPNPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRETGSG  173



>gb|AGX25254.1| MCN5 [Musa AAB Group]
 gb|AGX25259.1| MCN5 [Musa AAB Group]
Length=173

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 5/171 (3%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGP-KAITSGSDVKPSMVADRPRVHI-GGDST  333
            R +DPLVVGRVIG+V+D F P+V M V Y   K + +G ++ PS VA +PRV + GGD  
Sbjct  3    RLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVASKPRVEVQGGDMR  62

Query  334  QFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYI  513
             F+TLVMTDPDAP PS+P +RE +HWIVTDIPG T D + G+E V Y  P+P +GIHR++
Sbjct  63   SFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTT-DASFGREMVSYESPRPNIGIHRFV  121

Query  514  LVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
             VLF+Q++    + PP +SR+ F TR FA   +L  PVA V+FN+ +E AA
Sbjct  122  FVLFKQQRRQA-VSPP-SSRDYFSTRRFAEENDLGLPVAAVFFNSQRETAA  170



>gb|AGE45850.1| phosphatidylethanolamine-binding protein [Phalaenopsis hybrid 
cultivar]
Length=177

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G + +++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRTVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVL QQ        P    R NF TR FA    L  PVA VYFN  +E  + 
Sbjct  120  FVLVLLQQLGRQTVYAP--GWRQNFNTRDFAELYNLGPPVAAVYFNCQREAGSG  171



>gb|ACA25439.1| flowering locus T [Triticum aestivum]
Length=177

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGGDS  330
            M  R+ DPLVVGRV+GDV+D FV T ++ V +G + +++G ++KPSMVA +PRV +GG+ 
Sbjct  1    MAGRDRDPLVVGRVVGDVLDPFVRTTNLRVTFGNRTVSNGCELKPSMVAQQPRVEVGGNE  60

Query  331  TQ-FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
             + FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR
Sbjct  61   MRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTT-GASFGQEVMCYESPRPTMGIHR  119

Query  508  YILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            ++LVLFQQ        P    R NF TR FA    L  PVA VY N  +E  + 
Sbjct  120  FVLVLFQQLGRQTVYAP--GWRQNFNTRDFAELYNLGPPVAAVYLNCQREAGSG  171



>dbj|BAH30250.1| FT-like protein [Oryza rufipogon]
 dbj|BAO02991.1| Hd3a [Oryza rufipogon]
Length=179

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            RN DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RNRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAP+PS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPNPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQRETGSG  173



>dbj|BAM73643.1| terminal flower1 homologue [Ipomoea nil]
Length=175

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 120/174 (69%), Gaps = 4/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPT-VDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GG  324
            M  R ++PL++GRV+G+VVD F PT + + V Y  K +++G +  PS +  RPRV I GG
Sbjct  1    MSSRALEPLILGRVVGEVVDPFTPTSIRIVVTYNNKLVSNGHEFFPSALTSRPRVEIHGG  60

Query  325  DSTQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIH  504
            D   F+TLVMTDPD P PS+P +RE +HWIVTDIPG T D T G+E V Y  PKP +GIH
Sbjct  61   DLRTFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTT-DATFGRELVSYESPKPNIGIH  119

Query  505  RYILVLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            R++ +LF+Q + L  + PP+ SR++F TR FA    L  PVA V+FNA +E AA
Sbjct  120  RFVFILFKQTRRLSVVTPPL-SRDHFNTRRFAADNGLGLPVAAVFFNAQRETAA  172



>emb|CDY14173.1| BnaC02g02900D [Brassica napus]
 emb|CDY04899.1| BnaAnng00810D [Brassica napus]
Length=179

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = +1

Query  151  MVRRNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHI-GGD  327
            M  R ++PL+VGRV+G+V+D F  T++M V Y  K + +G ++ PS V+ +PRV I GGD
Sbjct  4    MGSRVIEPLIVGRVVGEVLDFFTQTIEMNVSYNKKQVCNGHELFPSFVSSKPRVEIHGGD  63

Query  328  STQFYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHR  507
               F+TLVM DPD P PS+P ++E +HWIVT+IPG T D T GKE V Y  P+P +GIHR
Sbjct  64   LRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTT-DATFGKEVVSYEFPRPNIGIHR  122

Query  508  YILVLFQQKKV-LGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAA  666
            ++ VLF+QK+  + ++ P + SR+ F TR FA   +L  PVA V+FNA +E AA
Sbjct  123  FVFVLFKQKQRHVIDISPNIPSRDKFNTRKFAIEHDLGLPVAAVFFNAQRETAA  176



>gb|AFK31118.1| Hd3a, partial [Oryza nivara]
Length=179

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +1

Query  160  RNVDPLVVGRVIGDVVDMFVPTVDMAVYYGPKAITSGSDVKPSMVADRPRVHIGG-DSTQ  336
            R+ DPLVVGRV+GDV+D FV + ++ V YG K +++G ++KPSMV  +PRV +GG D   
Sbjct  6    RDRDPLVVGRVVGDVLDAFVQSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRT  65

Query  337  FYTLVMTDPDAPSPSEPCMRELVHWIVTDIPGNTHDITKGKEAVPYMGPKPTVGIHRYIL  516
            FYTLVM DPDAPSPS+P +RE +HW+VTDIPG T   + G+E + Y  P+PT+GIHR + 
Sbjct  66   FYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTA-ASFGQEVMCYESPRPTMGIHRLVF  124

Query  517  VLFQQKKVLGELQPPVTSRNNFCTRAFAHHLELDSPVATVYFNAHKEPAAS  669
            VLFQQ        P    R NF T+ FA    L SPVA VYFN  +E  + 
Sbjct  125  VLFQQLGRQTVYAP--GWRQNFNTKDFAELYNLGSPVAAVYFNCQREAGSG  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1795021438176