BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77842_g1_i1 len=326 path=[1:0-325]

Length=326
                                                                      Score     E

gb|AAB07724.1|  Pn47p                                                   140   3e-37   Ipomoea nil [qian niu]
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           105   1e-24   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              105   2e-24   
ref|XP_007208931.1|  hypothetical protein PRUPE_ppb012141mg             102   2e-24   
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like           103   5e-24   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              102   1e-23   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           101   3e-23   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           100   5e-23   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like           100   1e-22   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           100   1e-22   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             100   1e-22   
gb|KHN18919.1|  Phospholipase A1-IIgamma                              99.8    2e-22   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like         99.8    2e-22   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg          99.4    2e-22   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like         98.6    5e-22   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like            98.6    5e-22   
gb|EPS70940.1|  hypothetical protein M569_03817                       97.1    1e-21   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like            97.4    1e-21   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g           97.1    2e-21   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma              97.1    2e-21   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like            96.7    2e-21   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like         97.1    2e-21   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like         95.9    4e-21   
emb|CBI30665.3|  unnamed protein product                              95.1    6e-21   
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like         95.1    7e-21   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1   95.1    8e-21   Vitis vinifera
gb|KDP21073.1|  hypothetical protein JCGZ_21544                       94.7    1e-20   
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2    93.6    2e-20   
emb|CDO96758.1|  unnamed protein product                              94.0    2e-20   
ref|XP_010108435.1|  Phospholipase A1-IIgamma                         94.0    2e-20   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma              94.4    2e-20   
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like         94.0    2e-20   
emb|CBI21954.3|  unnamed protein product                              93.6    2e-20   
emb|CDO96757.1|  unnamed protein product                              93.2    3e-20   
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1    93.6    3e-20   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                         93.6    4e-20   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like         93.2    5e-20   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like         92.8    5e-20   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like         92.8    5e-20   
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...  92.4    7e-20   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like         92.4    7e-20   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g           92.0    1e-19   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like         92.0    1e-19   
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like         91.7    1e-19   
emb|CDY10187.1|  BnaC05g04300D                                        91.7    1e-19   
ref|XP_004289499.1|  PREDICTED: phospholipase A1-IIgamma-like         91.3    1e-19   
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like         91.3    1e-19   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like         91.7    1e-19   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like         91.3    2e-19   
gb|AFK35349.1|  unknown                                               90.1    2e-19   
ref|NP_172115.1|  phospholipase A1-IIalpha                            91.7    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                 91.3    2e-19   
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like         90.9    2e-19   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma              92.0    2e-19   
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg           90.9    2e-19   
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like         91.3    3e-19   
gb|KHN08451.1|  Phospholipase A1-IIgamma                              90.9    3e-19   
ref|XP_002892328.1|  predicted protein                                90.1    3e-19   
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                   90.9    3e-19   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like         90.9    4e-19   
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like         90.5    4e-19   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like         90.9    4e-19   
gb|AAM61647.1|  lipase-like protein                                   90.5    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg           90.1    7e-19   
gb|KDO40783.1|  hypothetical protein CISIN_1g046292mg                 87.4    9e-19   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...  89.7    9e-19   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g           89.4    1e-18   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha              89.7    1e-18   
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like            89.4    1e-18   
ref|XP_008369474.1|  PREDICTED: phospholipase A1-II 2-like            87.0    1e-18   
ref|XP_003593747.1|  Lipase                                           88.6    2e-18   
emb|CDY57813.1|  BnaA10g28020D                                        89.4    2e-18   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like         88.6    3e-18   
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like         88.6    3e-18   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                     88.6    3e-18   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like         88.2    3e-18   
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg           87.8    4e-18   
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...  87.8    4e-18   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  87.8    4e-18   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  87.8    4e-18   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                  87.8    4e-18   
gb|KDO38625.1|  hypothetical protein CISIN_1g0208022mg                86.7    4e-18   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma              88.2    4e-18   
gb|EPS68357.1|  hypothetical protein M569_06414                       85.5    5e-18   
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like         87.4    5e-18   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  87.8    7e-18   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like         87.0    7e-18   
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...  87.8    7e-18   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  86.3    1e-17   
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg              86.3    1e-17   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein        86.7    1e-17   
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like            86.3    1e-17   
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha              86.7    1e-17   
gb|AFK39140.1|  unknown                                               84.0    2e-17   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like         85.9    2e-17   
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg           86.3    2e-17   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  85.9    2e-17   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like            85.9    2e-17   
emb|CDX76515.1|  BnaA08g08850D                                        85.5    3e-17   
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like         85.5    3e-17   
emb|CDX86530.1|  BnaC08g01730D                                        85.5    3e-17   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like         85.1    3e-17   
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like         85.1    4e-17   
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma              85.5    4e-17   
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg           85.1    4e-17   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                 84.7    5e-17   
emb|CDP11819.1|  unnamed protein product                              84.3    7e-17   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like         84.3    7e-17   
emb|CDY34061.1|  BnaC03g62710D                                        84.0    9e-17   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                  84.3    1e-16   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like         84.0    1e-16   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like         83.6    1e-16   
gb|AFK47098.1|  unknown                                               83.6    1e-16   
ref|XP_003608122.1|  Lipase                                           83.6    1e-16   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like         84.0    1e-16   
emb|CDX99456.1|  BnaC01g10960D                                        83.6    1e-16   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like         83.2    2e-16   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like         83.2    2e-16   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like         83.2    2e-16   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like         83.6    2e-16   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like            83.2    2e-16   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma              82.8    3e-16   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                 82.4    4e-16   
ref|XP_002525129.1|  triacylglycerol lipase, putative                 82.4    4e-16   Ricinus communis
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  82.0    4e-16   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like         82.0    6e-16   
ref|XP_009137120.1|  PREDICTED: phospholipase A1-IIgamma-like         81.3    6e-16   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  81.6    7e-16   
gb|ABQ95989.1|  phospholipase A1                                      81.3    1e-15   Capsicum annuum
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg           81.6    1e-15   
ref|XP_003608120.1|  Lipase                                           81.3    1e-15   
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like         80.5    1e-15   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like         80.9    1e-15   
ref|XP_006428508.1|  hypothetical protein CICLE_v10013478mg           76.6    2e-15   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like         80.5    2e-15   
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like         80.5    2e-15   
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g           80.5    2e-15   
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like            80.5    2e-15   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    2e-15   
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    2e-15   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    2e-15   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma              80.5    3e-15   
ref|XP_002522552.1|  triacylglycerol lipase, putative                 80.1    3e-15   Ricinus communis
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like         80.1    3e-15   
gb|KDP21072.1|  hypothetical protein JCGZ_21543                       80.1    3e-15   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like         80.1    4e-15   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  80.1    4e-15   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like            79.3    6e-15   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg              79.0    7e-15   
ref|XP_007025428.1|  Alpha/beta-Hydrolases superfamily protein        78.6    7e-15   
ref|XP_007025427.1|  Alpha/beta-Hydrolases superfamily protein        78.6    8e-15   
ref|XP_002867985.1|  lipase class 3 family protein                    79.0    9e-15   
emb|CDY01554.1|  BnaC07g35440D                                        79.0    1e-14   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like         78.2    1e-14   
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                77.8    1e-14   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg           78.2    2e-14   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like         77.4    2e-14   
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like         77.0    3e-14   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like         77.0    3e-14   
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  77.0    3e-14   
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like         77.0    3e-14   
ref|XP_010446304.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  75.5    5e-14   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like         76.6    5e-14   
gb|EMS52156.1|  Phospholipase A1-II 2                                 76.3    5e-14   
ref|NP_193590.1|  phospholipase A1-IIgamma                            76.3    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525127.1|  triacylglycerol lipase, putative                 75.9    8e-14   Ricinus communis
gb|KDP21071.1|  hypothetical protein JCGZ_21542                       75.9    8e-14   
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like            75.1    1e-13   
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg           75.1    2e-13   
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g           74.7    2e-13   
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like          74.7    3e-13   
gb|KCW74059.1|  hypothetical protein EUGRSUZ_E02687                   74.3    3e-13   
emb|CDY23963.1|  BnaC03g17280D                                        74.7    3e-13   
emb|CDX84801.1|  BnaA03g14290D                                        74.7    3e-13   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like         74.7    3e-13   
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like         74.3    3e-13   
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like            74.3    4e-13   
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                 73.2    8e-13   
ref|XP_002305750.2|  lipase class 3 family protein                    73.2    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like            73.2    8e-13   
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like            73.2    1e-12   
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta        72.8    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EEC71192.1|  hypothetical protein OsI_03092                        70.1    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002316835.2|  lipase class 3 family protein                    72.8    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like         72.4    1e-12   
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein        72.4    1e-12   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like            72.4    2e-12   
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg           72.4    2e-12   
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta               72.4    2e-12   
ref|NP_001168256.1|  hypothetical protein                             72.0    2e-12   Zea mays [maize]
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1            72.0    2e-12   
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like          72.0    2e-12   
ref|XP_002522554.1|  triacylglycerol lipase, putative                 72.0    2e-12   Ricinus communis
emb|CDY10774.1|  BnaA05g11620D                                        71.6    2e-12   
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640        72.0    3e-12   Sorghum bicolor [broomcorn]
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like          72.0    3e-12   
gb|EMT15520.1|  Feruloyl esterase A                                   72.0    4e-12   
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like          71.2    4e-12   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma              71.2    5e-12   
dbj|BAJ85084.1|  predicted protein                                    70.9    7e-12   
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2           70.5    7e-12   Oryza sativa Indica Group [Indian rice]
gb|EAY75192.1|  hypothetical protein OsI_03084                        70.5    9e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g           70.1    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like         70.1    1e-11   
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg           70.1    1e-11   
emb|CDY24728.1|  BnaC04g13330D                                        69.3    2e-11   
gb|ABK96341.1|  unknown                                               68.9    2e-11   Populus trichocarpa x Populus deltoides
ref|XP_001754450.1|  predicted protein                                68.9    3e-11   
gb|EAZ12914.1|  hypothetical protein OsJ_02837                        68.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043730.2|  Os01g0651200                                     68.2    4e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD68802.1|  lipase-like protein                                  68.2    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420        68.2    6e-11   Sorghum bicolor [broomcorn]
gb|ABK24664.1|  unknown                                               67.8    7e-11   Picea sitchensis
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like         67.0    2e-10   
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4           66.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55096.1|  hypothetical protein OsJ_02844                        65.9    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  67.0    2e-10   
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                   66.2    2e-10   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                 66.2    2e-10   
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like            65.9    2e-10   
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                  65.9    3e-10   
gb|EMT11182.1|  hypothetical protein F775_27795                       65.9    4e-10   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.5    6e-10   
ref|XP_002981063.1|  hypothetical protein SELMODRAFT_113737           65.1    6e-10   
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  65.1    7e-10   
gb|EMS63790.1|  Phospholipase A1-II 7                                 65.1    8e-10   
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  64.7    1e-09   
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630        64.3    1e-09   Sorghum bicolor [broomcorn]
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg           64.7    1e-09   
gb|KDP46901.1|  hypothetical protein JCGZ_24110                       63.9    1e-09   
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g           64.3    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  64.3    1e-09   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like            63.9    2e-09   
gb|EMT21704.1|  Putative lipase                                       63.9    2e-09   
gb|ABR16123.1|  unknown                                               64.3    2e-09   Picea sitchensis
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680        63.9    2e-09   Sorghum bicolor [broomcorn]
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                 63.5    2e-09   
emb|CDM85400.1|  unnamed protein product                              63.5    2e-09   
dbj|BAJ95995.1|  predicted protein                                    63.5    2e-09   
gb|EMS50697.1|  Phospholipase A1-II 1                                 63.2    2e-09   
dbj|BAJ96485.1|  predicted protein                                    63.2    2e-09   
ref|XP_010486696.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  63.5    2e-09   
gb|EMT15519.1|  Lipase                                                63.2    3e-09   
ref|XP_010486704.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  63.5    3e-09   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like            63.2    3e-09   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  63.5    3e-09   
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  63.5    3e-09   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  63.2    3e-09   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  63.2    3e-09   
emb|CDM83551.1|  unnamed protein product                              62.8    3e-09   
ref|XP_010486640.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  63.2    4e-09   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  63.2    4e-09   
ref|XP_010486634.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  62.8    4e-09   
gb|EMS63185.1|  Phospholipase A1-II 1                                 63.2    5e-09   
gb|ABR18391.1|  unknown                                               62.4    5e-09   Picea sitchensis
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg              62.4    5e-09   
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810        62.4    6e-09   Sorghum bicolor [broomcorn]
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  62.4    7e-09   
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  62.8    8e-09   
ref|NP_563772.1|  phospholipase A1-Igamma1                            62.0    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982537.1|  hypothetical protein SELMODRAFT_445229           61.6    9e-09   
ref|NP_849603.1|  phospholipase A1-Igamma1                            62.0    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  62.0    9e-09   
ref|XP_002892359.1|  lipase class 3 family protein                    62.0    1e-08   
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6           61.6    1e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CBI39158.3|  unnamed protein product                              61.2    1e-08   
gb|EMT05578.1|  hypothetical protein F775_13080                       61.2    1e-08   
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  61.2    1e-08   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...  61.2    1e-08   
gb|ACG40994.1|  triacylglycerol lipase                                59.3    1e-08   Zea mays [maize]
gb|KHN11563.1|  Phospholipase A(1) DAD1, chloroplastic                60.8    1e-08   
gb|AFW83434.1|  hypothetical protein ZEAMMB73_348788                  59.3    1e-08   
ref|XP_003533563.2|  PREDICTED: phospholipase A(1) DAD1, chloropl...  60.8    2e-08   
ref|XP_002268142.1|  PREDICTED: galactolipase DONGLE, chloroplastic   61.2    2e-08   Vitis vinifera
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940        61.2    2e-08   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  60.8    2e-08   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  60.8    2e-08   
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like            60.8    2e-08   
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                  60.5    2e-08   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  60.8    2e-08   
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor   60.5    2e-08   
ref|XP_002520983.1|  triacylglycerol lipase, putative                 60.5    3e-08   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  60.5    3e-08   
gb|EEE64775.1|  hypothetical protein OsJ_19631                        60.1    3e-08   
emb|CAN74039.1|  hypothetical protein VITISV_012945                   60.5    3e-08   
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like            60.1    3e-08   
gb|KDP38020.1|  hypothetical protein JCGZ_04663                       60.5    3e-08   
gb|KDP46905.1|  hypothetical protein JCGZ_24114                       60.1    4e-08   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg           60.1    4e-08   
ref|XP_007139644.1|  hypothetical protein PHAVU_008G047100g           59.7    4e-08   
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  59.7    4e-08   
ref|XP_002893614.1|  lipase class 3 family protein                    60.1    5e-08   
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like            59.7    5e-08   
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202            59.7    5e-08   
gb|KDP46903.1|  hypothetical protein JCGZ_24112                       59.3    5e-08   
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.7    5e-08   
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.7    6e-08   
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  59.7    6e-08   
ref|XP_002321113.2|  hypothetical protein POPTR_0014s14860g           59.3    6e-08   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                   59.7    6e-08   
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  59.3    6e-08   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.7    6e-08   
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1     60.1    6e-08   
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170        59.7    7e-08   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.3    7e-08   
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.3    7e-08   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.3    7e-08   
emb|CDM86668.1|  unnamed protein product                              59.3    7e-08   
gb|EMS68153.1|  Phospholipase A1-II 7                                 58.9    7e-08   
dbj|BAJ99811.1|  predicted protein                                    59.3    8e-08   
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470        58.9    8e-08   
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g           59.3    8e-08   
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.3    8e-08   
emb|CBI17935.3|  unnamed protein product                              58.9    8e-08   
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  59.3    9e-08   
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410        59.3    9e-08   
gb|EEE55092.1|  hypothetical protein OsJ_02840                        58.9    9e-08   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...  58.9    9e-08   
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...  58.9    9e-08   
ref|XP_011000043.1|  PREDICTED: galactolipase DONGLE, chloroplastic   58.9    9e-08   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1           58.5    1e-07   
gb|EAY75191.1|  hypothetical protein OsI_03083                        58.5    1e-07   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  58.9    1e-07   
ref|NP_001152663.1|  triacylglycerol lipase precursor                 58.5    1e-07   
ref|XP_003551711.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  58.5    1e-07   
ref|NP_174326.1|  DAD1-like acylhydrolase                             58.9    1e-07   
gb|KHN40550.1|  Phospholipase A(1) DAD1, chloroplastic                58.2    1e-07   
gb|ABK23399.1|  unknown                                               58.5    1e-07   
ref|XP_008382954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  58.5    1e-07   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  58.5    1e-07   
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  58.5    1e-07   
gb|EAY99121.1|  hypothetical protein OsI_21080                        58.2    2e-07   
emb|CDP14642.1|  unnamed protein product                              58.2    2e-07   
ref|NP_001043734.1|  Os01g0651800                                     58.2    2e-07   
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg           58.2    2e-07   
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...  58.2    2e-07   
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  58.2    2e-07   
gb|EMS48809.1|  Phospholipase A1-II 6                                 58.2    2e-07   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg           58.2    2e-07   
ref|XP_002522551.1|  hypothetical protein RCOM_1014260                53.9    2e-07   
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  58.2    2e-07   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  57.8    2e-07   
ref|XP_007014120.1|  Alpha/beta-Hydrolases superfamily protein        57.4    3e-07   
emb|CDY02287.1|  BnaA09g26150D                                        57.8    3e-07   
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like         57.4    3e-07   
ref|XP_009115161.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  57.8    3e-07   
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                  57.4    3e-07   
emb|CDY09593.1|  BnaC05g23260D                                        57.8    3e-07   
gb|KCW73103.1|  hypothetical protein EUGRSUZ_E01548                   57.4    3e-07   
ref|XP_006415481.1|  hypothetical protein EUTSA_v10007346mg           57.8    3e-07   
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  57.8    3e-07   
ref|XP_010058502.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  57.4    3e-07   
gb|KFK44851.1|  hypothetical protein AALP_AA1G310600                  57.4    3e-07   
ref|XP_006364696.1|  PREDICTED: galactolipase DONGLE, chloroplast...  57.8    3e-07   
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  57.4    3e-07   
ref|XP_006304825.1|  hypothetical protein CARUB_v10012471mg           57.4    3e-07   
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein        57.4    4e-07   
emb|CDY54880.1|  BnaA10g27930D                                        57.0    4e-07   
ref|XP_002301637.2|  hypothetical protein POPTR_0002s23240g           57.0    4e-07   
gb|KHN18833.1|  Phospholipase A1-Igamma2, chloroplastic               57.0    4e-07   
emb|CDX77597.1|  BnaA07g07350D                                        57.0    4e-07   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                 57.0    4e-07   
ref|XP_009383384.1|  PREDICTED: galactolipase DONGLE, chloroplast...  57.0    4e-07   
ref|XP_004492931.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  57.0    4e-07   
gb|ACJ76846.1|  chloroplast lipase protein                            57.0    4e-07   
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like            56.6    5e-07   
ref|XP_006647618.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...  56.6    5e-07   
ref|XP_011042808.1|  PREDICTED: galactolipase DONGLE, chloroplast...  57.0    5e-07   
emb|CDY10228.1|  BnaC05g04710D                                        57.0    5e-07   
ref|XP_003624312.1|  Lipase                                           57.0    5e-07   
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  57.0    5e-07   
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  57.0    5e-07   
ref|XP_009102705.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  57.0    5e-07   
ref|XP_002879267.1|  lipase class 3 family protein                    57.0    5e-07   
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262            57.0    5e-07   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                       56.6    6e-07   
ref|XP_009798317.1|  PREDICTED: galactolipase DONGLE, chloroplastic   56.6    6e-07   
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g           56.6    7e-07   
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  56.2    7e-07   
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                  56.6    7e-07   
ref|XP_009589831.1|  PREDICTED: galactolipase DONGLE, chloroplast...  56.2    7e-07   
ref|XP_011025479.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  56.2    8e-07   
ref|NP_001149813.1|  triacylglycerol lipase                           55.8    8e-07   
ref|XP_010087133.1|  Phospholipase A1-Igamma1                         56.2    8e-07   
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like            55.8    9e-07   
sp|Q948R1.1|PLA11_ARATH  RecName: Full=Phospholipase A(1) DAD1, c...  56.2    9e-07   
ref|XP_010245971.1|  PREDICTED: LOW QUALITY PROTEIN: galactolipas...  56.2    9e-07   
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like            55.8    9e-07   
ref|NP_850148.1|  phospholipase A1-Igamma2                            55.8    1e-06   
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like            55.8    1e-06   
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like         55.8    1e-06   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  55.8    1e-06   
ref|NP_565701.1|  phospholipase A1-Igamma2                            55.8    1e-06   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  55.8    1e-06   
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  55.8    1e-06   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  55.8    1e-06   
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.8    1e-06   
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg           55.8    1e-06   
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.8    1e-06   
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  55.8    1e-06   
gb|KHN11562.1|  Phospholipase A(1) DAD1, chloroplastic                55.1    1e-06   
ref|XP_010499568.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.5    1e-06   
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1     55.5    1e-06   
ref|XP_002298419.2|  hypothetical protein POPTR_0001s27040g           55.5    1e-06   
ref|XP_010460828.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.5    1e-06   
ref|NP_001047607.1|  Os02g0653900                                     55.5    2e-06   
emb|CAC39051.1|  lipase-like protein                                  55.5    2e-06   
ref|XP_010478423.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.5    2e-06   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                 55.1    2e-06   
ref|XP_006489506.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  55.1    2e-06   
ref|XP_003551710.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  55.1    2e-06   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.5    2e-06   
dbj|BAJ85518.1|  predicted protein                                    55.1    2e-06   
ref|XP_006853091.1|  hypothetical protein AMTR_s00038p00115130        52.8    2e-06   
gb|EYU40369.1|  hypothetical protein MIMGU_mgv1a018694mg              54.7    2e-06   
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.1    2e-06   
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  55.1    2e-06   
ref|XP_003533565.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  54.7    2e-06   
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  55.1    2e-06   
ref|XP_006304384.1|  hypothetical protein CARUB_v10010888mg           54.7    2e-06   
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  55.1    2e-06   
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  54.7    2e-06   
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg           55.1    2e-06   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                       54.7    2e-06   
gb|KGN44761.1|  hypothetical protein Csa_7G378500                     54.7    3e-06   
emb|CDP21091.1|  unnamed protein product                              54.7    3e-06   
ref|XP_006827274.1|  hypothetical protein AMTR_s00010p00263480        54.7    3e-06   
ref|XP_011047360.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  54.7    3e-06   
ref|XP_001781080.1|  predicted protein                                54.3    3e-06   
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  54.7    3e-06   
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  54.7    3e-06   
ref|XP_009403651.1|  PREDICTED: galactolipase DONGLE, chloroplast...  54.7    3e-06   
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  54.7    3e-06   
ref|XP_007024952.1|  Alpha/beta-Hydrolases superfamily protein        54.7    3e-06   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  54.7    3e-06   
emb|CDY09664.1|  BnaC07g33970D                                        54.3    3e-06   
ref|XP_006445433.1|  hypothetical protein CICLE_v10020217mg           54.3    3e-06   
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  54.3    3e-06   
ref|XP_002441042.1|  hypothetical protein SORBIDRAFT_09g019276        54.3    3e-06   
gb|KGN46517.1|  hypothetical protein Csa_6G106200                     53.9    3e-06   
ref|XP_006364888.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  54.3    3e-06   
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg           54.3    3e-06   
ref|XP_002531054.1|  triacylglycerol lipase, putative                 54.3    3e-06   
ref|XP_011073877.1|  PREDICTED: galactolipase DONGLE, chloroplastic   54.3    4e-06   
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like            54.3    4e-06   
emb|CDM86669.1|  unnamed protein product                              54.3    4e-06   
ref|XP_004140625.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  53.9    4e-06   
ref|XP_002314049.2|  hypothetical protein POPTR_0009s06300g           54.3    4e-06   
ref|XP_009792730.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  54.3    4e-06   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  54.3    4e-06   
ref|XP_010941432.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  54.3    4e-06   
gb|EPS66180.1|  hypothetical protein M569_08597                       53.9    4e-06   
ref|XP_009368221.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...  54.3    4e-06   
ref|XP_004168164.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  53.9    4e-06   
ref|NP_001055438.1|  Os05g0390000                                     54.3    4e-06   
ref|XP_009407578.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  53.9    4e-06   
gb|AFW75599.1|  hypothetical protein ZEAMMB73_741719                  54.7    4e-06   
ref|XP_006837391.1|  hypothetical protein AMTR_s00111p00133140        53.9    4e-06   
gb|EEC79153.1|  hypothetical protein OsI_19824                        54.3    4e-06   
ref|XP_007139124.1|  hypothetical protein PHAVU_008G003400g           53.9    4e-06   
ref|XP_010314737.1|  PREDICTED: phospholipase A1-Ialpha2, chlorop...  53.9    4e-06   
ref|XP_010414253.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  53.9    5e-06   
ref|XP_010475298.1|  PREDICTED: galactolipase DONGLE, chloroplast...  53.9    5e-06   
gb|KCW74063.1|  hypothetical protein EUGRSUZ_E02691                   53.5    5e-06   
ref|XP_009362274.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  53.9    5e-06   
ref|XP_010414254.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  53.9    5e-06   
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  53.9    5e-06   
ref|XP_010457679.1|  PREDICTED: galactolipase DONGLE, chloroplastic   53.9    5e-06   
ref|XP_007223991.1|  hypothetical protein PRUPE_ppa014790mg           53.9    5e-06   
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400        53.9    5e-06   
ref|XP_008222660.1|  PREDICTED: galactolipase DONGLE, chloroplastic   53.9    5e-06   
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  53.9    5e-06   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg           53.9    5e-06   
ref|XP_010692044.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  53.5    6e-06   
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  53.9    6e-06   
ref|NP_001151242.1|  triacylglycerol lipase                           53.5    6e-06   
emb|CDX90495.1|  BnaA03g42860D                                        53.5    6e-06   
ref|XP_002972970.1|  hypothetical protein SELMODRAFT_97883            53.1    6e-06   
dbj|BAC23081.1|  DAD1                                                 53.5    6e-06   
gb|ABP35955.1|  phospholipase A1                                      53.5    6e-06   
emb|CDX74688.1|  BnaA05g04340D                                        53.5    6e-06   
ref|XP_009143069.1|  PREDICTED: phospholipase A(1) DAD1, chloropl...  53.5    6e-06   
emb|CDY48263.1|  BnaC04g05220D                                        53.5    6e-06   
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  53.9    6e-06   
ref|XP_009605461.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  53.5    6e-06   
ref|XP_009136810.1|  PREDICTED: phospholipase A1-Ibeta2, chloropl...  53.5    6e-06   
ref|XP_002880139.1|  defective IN anther DEHISCENCE1                  53.5    7e-06   
ref|XP_009401159.1|  PREDICTED: galactolipase DONGLE, chloroplast...  53.1    7e-06   
gb|KDO85502.1|  hypothetical protein CISIN_1g035710mg                 53.1    7e-06   
emb|CDX97819.1|  BnaC04g41200D                                        53.5    8e-06   
dbj|BAJ88767.1|  predicted protein                                    53.5    8e-06   
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like            53.1    8e-06   
ref|XP_008783953.1|  PREDICTED: galactolipase DONGLE, chloroplast...  53.1    8e-06   
gb|EMT04701.1|  Lipase                                                53.1    8e-06   
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  53.1    8e-06   
ref|XP_009119115.1|  PREDICTED: galactolipase DONGLE, chloroplastic   53.1    8e-06   
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  53.1    8e-06   
emb|CDY29665.1|  BnaA04g17620D                                        53.1    8e-06   
ref|XP_009387098.1|  PREDICTED: galactolipase DONGLE, chloroplast...  53.1    9e-06   
ref|XP_006576920.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  52.8    9e-06   



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA+RWK LSGSDNW+GLL+PLDSDLRRYLIHY  M+ P+ ++ I +  SKN+GLPRYAR
Sbjct  3    GIAKRWKVLSGSDNWEGLLEPLDSDLRRYLIHYGTMVSPATDSFINEAASKNVGLPRYAR  62

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
            RNLLAN GLVKGNPFKYEVTKY
Sbjct  63   RNLLANCGLVKGNPFKYEVTKY  84



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   105 bits (263),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAM---ICPSFETLITQPFSKNIGLPRY  254
            IAERW+ L+G +NW+GLLDPLD DLRRYLIHY  M   IC SF + I    SKN+G  RY
Sbjct  32   IAERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSEIA---SKNLGTNRY  88

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            +++N     GL K NPFKYEVTKY
Sbjct  89   SKKNFFKRVGLDKNNPFKYEVTKY  112



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   105 bits (262),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAM---ICPSFETLITQPFSKNIGLPRY  254
            +AERW+ L+G +NW+GLLDPLD DLRRYLIHY  M   IC SF + I    SKN+G  RY
Sbjct  32   VAERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSEIA---SKNLGTNRY  88

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            +++N     GL K NPFKYEVTKY
Sbjct  89   SKKNFFKRVGLDKNNPFKYEVTKY  112



>ref|XP_007208931.1| hypothetical protein PRUPE_ppb012141mg [Prunus persica]
 gb|EMJ10130.1| hypothetical protein PRUPE_ppb012141mg [Prunus persica]
Length=185

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQP--FSKNIGL  245
            M   IA RW+ LSG D W+GLLDPLD +LRRY+IHY           I +P   SKNIGL
Sbjct  1    MGSLIAARWRVLSGEDEWEGLLDPLDINLRRYIIHYGERAGAIGYGFIDKPTSISKNIGL  60

Query  246  PRYARRNLLANTGLVKGNPFKYEVTKY  326
            PRYA+RNL +  GL  GNP+KYEV KY
Sbjct  61   PRYAKRNLFSKVGLETGNPYKYEVKKY  87



>ref|XP_008238422.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=390

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQP--FSKNIGLPR  251
            G  A RW+ LSG D W+GLLDPLD DLRRY+IHY           I +P   SKNIGLPR
Sbjct  2    GSFAARWRVLSGEDEWEGLLDPLDIDLRRYIIHYGERAGAIGYGFIDKPTSISKNIGLPR  61

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+RNL +  GL  GNP+KYEV KY
Sbjct  62   YAKRNLFSKVGLETGNPYKYEVKKY  86



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IAERW+ LSG+++W+GLLDPLD+DLRRY+IHY  M   + +   T   SK  G  RY+
Sbjct  39   GNIAERWRFLSGNNSWEGLLDPLDNDLRRYIIHYGGMAQATRDAFNTNKISKYAGSCRYS  98

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            ++NLL+  G+   NPFKYEVTKY
Sbjct  99   KKNLLSQVGIEMSNPFKYEVTKY  121



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G I +RW+ L+G +NWK LLDPLD DLRR +IHY  M   +++T IT+  SK  G  R
Sbjct  1    MMGSIDKRWRLLNGQENWKNLLDPLDIDLRRNIIHYGEMAQATYDTFITEKASKFAGSSR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YAR +  +  GLVK NPFKY+VTK+
Sbjct  61   YARADFFSKVGLVKTNPFKYQVTKF  85



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IAERW+ LSG++NW+GLLDPLD+DLRRYLIHY  M+    +       SK  G  RY+++
Sbjct  8    IAERWRVLSGNNNWEGLLDPLDNDLRRYLIHYGEMVQAIRDAFNNDETSKYAGCSRYSKK  67

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL +  G+   NPFKYEVTKY
Sbjct  68   NLFSKVGIEISNPFKYEVTKY  88



>ref|XP_004301748.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA RWKALSG D W+GLL+PLD DLRRY+IHY          ++ +P SKN  LPRYA
Sbjct  2    GSIATRWKALSGQDEWEGLLNPLDIDLRRYIIHYGER--AGAIAVVNEPKSKNYRLPRYA  59

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            + NL +N GL  GNP+KY V KY
Sbjct  60   KENLFSNMGLESGNPYKYMVNKY  82



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++WK LSG  NW+GLLDPLD DLRRY+IHY  M   +++   T+  SK  G  RYAR+
Sbjct  45   IAKKWKHLSGEHNWEGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKTSKYAGSSRYARK  104

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            N  +  GL K NPFKY VTK+
Sbjct  105  NFFSKVGLEKANPFKYNVTKF  125



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA  IA++W++LSG +NW+GLLDPLD DLRRY+IHY  M   +++T  T+  SK  G   
Sbjct  19   MANSIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEMAQAAYDTFNTEKASKYAGDSI  78

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+++  +  GL KGNP+KY VTK+
Sbjct  79   YAKKDFFSKVGLDKGNPYKYNVTKF  103



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA++W+ LSG D+WKGL+DPLD DLRRY+IHY  M   +++   T+  SK  G  R
Sbjct  1    MNSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+++  +  GLV GNPF Y VTK+
Sbjct  61   YAKKSFFSKVGLVNGNPFTYSVTKF  85



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA++W+ LSG D+WKGL+DPLD DLRRY+IHY  M   +++   T+  SK  G  R
Sbjct  28   MNSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSR  87

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+++  +  GLV GNPF Y VTK+
Sbjct  88   YAKKSFFSKVGLVNGNPFTYSVTKF  112



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++W+ LSG +NW+GLLDPLD DLRRY+IHY  M   +++   T+  SK  G  RYAR+
Sbjct  7    IAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRYARK  66

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            N  +  GL KGN FKY VTK+
Sbjct  67   NFFSRVGLEKGNAFKYNVTKF  87



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA  IA++W++LSG +NW+GLLDPLD DLRRY+IHY  +   +++T  T+  SK  G   
Sbjct  19   MADSIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKYAGDSI  78

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+++  +  GL KGNP+KY VTK+
Sbjct  79   YAKKDFFSKVGLDKGNPYKYNVTKF  103



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G I ERW+ LSG+ NW+GLLDPLD+DLRRYLI Y  M   + +   T   SK  G  RY+
Sbjct  43   GNITERWRILSGNSNWEGLLDPLDNDLRRYLIRYGEMTQAARDAFNTNKISKYAGTCRYS  102

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            ++N  + TG+   NPFKYEVTKY
Sbjct  103  KKNFFSRTGIEISNPFKYEVTKY  125



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            I +RWK+LSG  NW+ LLDPLD DL++Y+IHY AM   +++   + P S+N G   +++ 
Sbjct  8    IPQRWKSLSGDGNWRSLLDPLDVDLQQYIIHYGAMAQATYDNFNSDPVSRNAGCNIHSKS  67

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            N+ ++ GL KGNPFKY VTKY
Sbjct  68   NMFSSVGLDKGNPFKYRVTKY  88



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M    AERW+ LSG++NW+GLLDPLD+DLRRYLI Y  M   + +   T   SK  G  R
Sbjct  43   MGNITAERWRLLSGNNNWEGLLDPLDNDLRRYLIRYGEMAQAARDAFNTNKMSKYAGSCR  102

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+++NL + TG+   NPFKYEVTKY
Sbjct  103  YSKKNLFSRTGIEISNPFKYEVTKY  127



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA++W+ LSG  +WKGL++PLD DLRRY+IHY  M   +++  I++  SK  G  R
Sbjct  29   MDSSIAKKWRELSGQSHWKGLMEPLDIDLRRYIIHYGEMAQAAYDAFISEKVSKYAGCSR  88

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+RN  +  GL+ GN F Y VTK+
Sbjct  89   YAKRNFFSKVGLMNGNAFTYSVTKF  113



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++WK LSG + W GLLDPL+ DLRRY+IHY  M   +++   ++  SK  G  RYAR+
Sbjct  36   IAKKWKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARK  95

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            N  +  GL KGNPFKY VTK+
Sbjct  96   NFFSKVGLEKGNPFKYNVTKF  116



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IAERW+ LSG+++W+GLL+PLD DLRRYLIHY  M   + +   T   SK  G  RY+
Sbjct  28   GNIAERWRFLSGNNSWEGLLNPLDDDLRRYLIHYGEMAQATRDAFNTNKLSKYAGSCRYS  87

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            ++NLL+  G+   NPF YEVTKY
Sbjct  88   KKNLLSRAGIEMPNPFNYEVTKY  110



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++WK LSG + W GLLDPL+ DLRRY+IHY  M   +++   ++  SK  G  RYAR+
Sbjct  36   IAKKWKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARK  95

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            N  +  GL KGNPFKY VTK+
Sbjct  96   NFFSKVGLEKGNPFKYNVTKF  116



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA+RW+ L+G + WK LLDPLD DLRR +IHY  M   +++  IT+  SK  G  RYA
Sbjct  2    GSIAKRWRLLNGQEMWKNLLDPLDIDLRRSIIHYGEMAQATYDAFITEKVSKFAGSSRYA  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +R+  +  GLV  NP+KY VTK+
Sbjct  62   KRDFFSKVGLVNANPYKYNVTKF  84



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++W+ LSG +NW+GLLDPLD DLRRY+IHY  M   +++T  ++  S+  G  RYA++
Sbjct  4    IAKKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAKK  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  G+  GNPFKY VTKY
Sbjct  64   DFFSKVGIDIGNPFKYYVTKY  84



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M GGIA+RW+ LSG +NW  LL PLDSDL+RYL+HY  M   + +       SK IG  +
Sbjct  1    MIGGIAQRWRLLSGHNNWTNLLKPLDSDLQRYLLHYGGMAQATNDAFDFDILSKYIGYSK  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            ++R++L    GLVKGNPF+Y+  KY
Sbjct  61   FSRKHLFERCGLVKGNPFRYKAVKY  85



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++W+ LSG +NW+GLLDPLD DLRRY+IHY  M   +++T  ++  S+  G  RYA++
Sbjct  19   IAKKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAKK  78

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  G+  GNPFKY VTKY
Sbjct  79   DFFSKVGIDIGNPFKYYVTKY  99



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            +AG IA+RWK LSG +NWK LL+PLD DLRR++IHY  M   +++   +Q  SK  G   
Sbjct  2    VAGSIAKRWKHLSGENNWKNLLEPLDIDLRRFIIHYGEMAQATYDAFNSQKASKFAGSSL  61

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+    +  GL KGNP+KY VTK+
Sbjct  62   YAKNGFFSKVGLDKGNPYKYTVTKF  86



>ref|XP_010557126.1| PREDICTED: phospholipase A1-IIbeta isoform X2 [Tarenaya hassleriana]
Length=327

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RWK LSG   WKGLLDPLD+DLRRY++HY  M   +++   +   SK  G   
Sbjct  1    MRGDIARRWKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            +++  L A TG +KGNP++Y+VTK+
Sbjct  61   FSKTELFARTGFLKGNPYRYKVTKF  85



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RWK LSG+ +W GLLDPLD DLRRY+IHY  M   ++++   +  S+  G   YA++
Sbjct  4    IAKRWKVLSGNYDWDGLLDPLDYDLRRYIIHYGEMAQATYDSFNAEKASRYAGSCLYAKK  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L A  GL  GNPFKY VTKY
Sbjct  64   DLFAKVGLQNGNPFKYRVTKY  84



>ref|XP_010108435.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19463.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=394

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLD-PLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            G IAE+WK  SG ++WKGLLD PLD+D RRY+IHY        +  I +  SKN G  RY
Sbjct  2    GSIAEKWKVFSGENDWKGLLDHPLDNDFRRYIIHYGERNEALGDAFIAEEKSKNYGRSRY  61

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            A+R+  +  GL KGNP+KYEVT +
Sbjct  62   AKRDFFSKVGLEKGNPYKYEVTNF  85



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++W+ LSG +NW+GLLDPLD DLRRY+IHY  M   +++   T+  SK  G  RYAR+
Sbjct  36   IAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRYARK  95

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +   L KGN FKY VTK+
Sbjct  96   SFFSRVCLEKGNAFKYNVTKF  116



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RW+ LSG D+WK LLDPLD DLR+Y+IHY  M   +++T   +P SK  G   
Sbjct  1    MIRSIAKRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSI  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+RRNL +  GL K NP+ Y  TKY
Sbjct  61   YSRRNLFSQVGLAKPNPYTYTPTKY  85



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RW+ LSG D+WK LLDPLD DLR+Y+IHY  M   +++T   +P SK  G   
Sbjct  1    MIRSIAKRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSI  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+RRNL +  GL K NP+ Y  TKY
Sbjct  61   YSRRNLFSQVGLAKPNPYTYTPTKY  85



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            I +RW+ LSG++NW GLLDPLD DLR+Y+IHY  M   ++++   +  S+  G   YA++
Sbjct  4    IDKRWEVLSGNNNWDGLLDPLDYDLRQYIIHYGEMAQATYDSFNAEKASRYAGSCLYAKK  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L A  GL  GNPFKY VTKY
Sbjct  64   DLFAKVGLQNGNPFKYRVTKY  84



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RWK LSG   WKGLLDPLD+DLRRY++HY  M   +++   +   SK  G   
Sbjct  1    MRGDIARRWKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            +++  L A TG +KGNP++Y+VTK+
Sbjct  61   FSKTELFARTGFLKGNPYRYKVTKF  85



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IAE+WK LSG  NW+GLLDPL+ DLRRY+IH   M   +++    +  SK  G  RY 
Sbjct  33   GSIAEKWKYLSGEKNWEGLLDPLNIDLRRYIIHNGEMAQATYDAFNGEKASKYAGSSRYG  92

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            R++L A   L  GNPFKY VTK+
Sbjct  93   RKDLFAKVSLENGNPFKYSVTKF  115



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            I +RWK LSG +NW+GLLDPLD DLR+Y+IHY  M   +++   T+  SK  G  RYAR+
Sbjct  41   IVKRWKKLSGENNWEGLLDPLDIDLRKYIIHYGEMAQATYDAFNTERASKFAGSSRYARK  100

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  GL K N F+Y VTK+
Sbjct  101  SFFSRVGLEKANAFRYNVTKF  121



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RW+ LSG DNWK LLDPLD DLR+Y++HY  M   ++++  +   SK  G   
Sbjct  1    MIGNIATRWRLLSGEDNWKNLLDPLDIDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSH  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            ++R+NL +  GL   NP+KY +TK+
Sbjct  61   FSRKNLFSRVGLAIANPYKYNITKF  85



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            I  +W+ LSG +NW+GLLDPLD DLRR +IHY  M   +++   T+  S+  G  RYA+R
Sbjct  17   IPRKWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKR  76

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  GL KGNPFKY VTK+
Sbjct  77   DFFSKVGLDKGNPFKYSVTKF  97



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            + G IA+RW+ LSG +NW+GLLDPLD DLR+Y+IHY        +    +  SK +G  R
Sbjct  10   LMGSIAQRWRELSGENNWEGLLDPLDKDLRKYIIHYGERTQAVMDAFNGEKASKWVGFSR  69

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+  +  +  GL  GNP+KY+VTK+
Sbjct  70   YSTEDFFSKVGLEMGNPYKYKVTKF  94



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MAG IA +W+ LSG  NWKGLLDPLD DLR Y+IHY  +   +++   ++  SK  G  R
Sbjct  1    MAGNIARKWRDLSGRSNWKGLLDPLDIDLRPYIIHYGQLAQATYDAFNSEKTSKYAGNSR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +++  +  GL  GNPF+Y+V K+
Sbjct  61   YPKKDFFSKVGLENGNPFRYDVKKF  85



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA +W+ LSG  NWKGLLDPLD DLRRY+IHY  +   +++   ++  S   G  RY+
Sbjct  2    GSIARKWRELSGRSNWKGLLDPLDIDLRRYIIHYGQLAQATYDGFNSEKASNLAGNSRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +R      GL  GNPFKY VTK+
Sbjct  62   KREFFGKVGLENGNPFKYLVTKF  84



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            I  RW+ LSG +NW+GLLDPLD DLRR +IHY  M   +++   T+  S+  G  RYA+R
Sbjct  17   IPRRWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKR  76

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  GL  GNPFKY VTK+
Sbjct  77   DFFSKVGLDNGNPFKYSVTKF  97



>ref|XP_004301746.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=392

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +3

Query  87   AERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRN  266
            A  WK LSG + W+GLLDPLD +LRRY+IHY      S  T++T+  SKN GLPRYA+ +
Sbjct  5    ATNWKDLSGENEWEGLLDPLDINLRRYIIHYGER-SGSIATVVTEQKSKNYGLPRYAKGH  63

Query  267  LLANTGLVKGNPFKYEVTKY  326
            L    GL  GNP+KY V  Y
Sbjct  64   LFQKVGLENGNPYKYVVKNY  83



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M GGIA+RWK LSG + WKGLLDPLD DLRRY+IHY  M    ++       S   G   
Sbjct  1    MLGGIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  + A TG +K NPF+Y VTKY
Sbjct  61   YSKSQIFARTGYLKANPFRYNVTKY  85



>ref|XP_004289499.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=348

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G   +RW+ LSG ++W+GLL PLD DLRRY+IHY      S + +IT+  SKN G PRYA
Sbjct  2    GSTTKRWRQLSGENDWEGLLHPLDIDLRRYIIHYGERTGASRDAVITERKSKNYGQPRYA  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            + +  +  GL  GNP+KY V +Y
Sbjct  62   KGHFFSKVGLEIGNPYKYVVKRY  84



>ref|XP_009333706.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=378

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA RW+ L G  +W+GLLDPLD DLRR ++HY   +    ++ I+ P SKN GLPRY + 
Sbjct  4    IATRWRLLGGETDWEGLLDPLDIDLRRCILHYGERVAAIGDSFISDPRSKNCGLPRYTKT  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L +  GL   NP+KY V KY
Sbjct  64   HLFSKVGLENSNPYKYTVNKY  84



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA +W+ LSG  NWKGLLDPLD+DLRRY+IHY  +   +++   T+  SK  G  RYA  
Sbjct  4    IARKWRDLSGQSNWKGLLDPLDTDLRRYIIHYGQLAQAAYDAFNTEKASKCAGNSRYAMS  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  GL  GN FKY VTK+
Sbjct  64   DFFSKVGLENGNCFKYVVTKF  84



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW  LSG +NW+GL+DPL+ DLRRY+IHY  M   S++   +   SKN G  RY++ 
Sbjct  12   IAKRWMLLSGKNNWEGLMDPLNYDLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSKN  71

Query  264  NLLANTGLVKG-NPFKYEVTKY  326
            NL    GL K  NPFKY VTKY
Sbjct  72   NLFTKVGLDKDHNPFKYRVTKY  93



>gb|AFK35349.1| unknown [Lotus japonicus]
Length=246

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA +W+ LSG D+W  LLDPLD DLR+Y+IHY      +++T  T+  SKN G  RY + 
Sbjct  38   IASKWQQLSGQDDWNNLLDPLDIDLRQYIIHYGERAQATYDTFNTEKASKNAGNTRYGKD  97

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +   L +GNPFKY VTK+
Sbjct  98   DFFSKVSLEQGNPFKYSVTKF  118



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M  GI +RWK LSG + WKGLLDPLD DLRRY+IHY  M    ++       S+  G   
Sbjct  1    MVEGIPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  LLA TG +K NPF+Y+VTKY
Sbjct  61   YSKNRLLARTGFLKANPFRYKVTKY  85



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW  LSG +NW+GL+DPLD +LRRY+IHY  M   S++   +   SKN G  RY+R 
Sbjct  20   IAKRWMLLSGKNNWEGLMDPLDYNLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSRN  79

Query  264  NLLANTGLVK--GNPFKYEVTKY  326
            N     GL K   NPFKY VTKY
Sbjct  80   NFFTKVGLDKDHNNPFKYRVTKY  102



>ref|XP_008238420.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=379

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
             IA RW+ LSG   W+GLL PLD DLRRY+IHY        +  I +P SKN GLPRYA+
Sbjct  3    AIARRWRLLSGETEWEGLLYPLDIDLRRYIIHYGERASAIADAFIDEPKSKNSGLPRYAK  62

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
            RNL +  GL   +P+KY V  Y
Sbjct  63   RNLFSKVGLESYSPYKYVVKTY  84



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RW+ LSG DNWK LLDPLD DLR+Y++HY  M   ++++  +   SK  G   
Sbjct  82   MIGNIATRWRLLSGEDNWKSLLDPLDVDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSH  141

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            ++R+NL +  GL   NP+KY +TK+
Sbjct  142  FSRKNLFSRVGLSIANPYKYNITKF  166



>ref|XP_007208858.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
 gb|EMJ10057.1| hypothetical protein PRUPE_ppa025833mg [Prunus persica]
Length=379

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
             IA RW+ LSG   W+GLL PLD DLRRY+IHY        +  I +P SKN GLPRYA+
Sbjct  3    AIARRWRLLSGQTEWEGLLYPLDIDLRRYIIHYGERASAIADAFIDEPKSKNSGLPRYAK  62

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
            RNL +  GL   +P+KY V  Y
Sbjct  63   RNLFSKVGLESYSPYKYVVKTY  84



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RWK L+G   W+GLLDPLD DLRRYLIHY  M    ++       S+  G   
Sbjct  1    MLNDIAKRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+++ L A TG +K NPF+YEVTKY
Sbjct  61   YSKKQLFARTGFIKANPFRYEVTKY  85



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA++W+ LSG D+WKGL+DPLD DLRRY+I Y  M   +++   T+  SK  G  R
Sbjct  1    MNSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+++  +   LV GNP+ Y VTK+
Sbjct  61   YAKKSFFSKVALVNGNPYTYSVTKF  85



>ref|XP_002892328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68587.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M  GI +RWK LSG + W+GLLDPLD DLRRY+IHY  M    ++       SK  G   
Sbjct  1    MVEGIPKRWKVLSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSKYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  L A TG +K NPF+Y VTKY
Sbjct  61   YSKNQLFARTGFLKANPFRYNVTKY  85



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            +  +A++W+ LSG D+W+ LLDPL+ DLRRY++HY  M   +++  I +  SK  G  RY
Sbjct  18   SNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRY  77

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            ARR+  +  GL  GNP+KY VTK+
Sbjct  78   ARRDFFSKVGLELGNPYKYSVTKF  101



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA++W+ LSG D+WKGL+DPLD DLRRY+I Y  M   +++   T+  SK  G  R
Sbjct  26   MNSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCR  85

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+++  +   LV GNP+ Y VTK+
Sbjct  86   YAKKSFFSKVALVNGNPYTYSVTKF  110



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RWK L+G   W+GLLDPLD DLRRYLIHY  M    ++       S+  G   
Sbjct  1    MLDDIAKRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+++ L A TG +K NPF+YEVTKY
Sbjct  61   YSKKQLFARTGFIKANPFRYEVTKY  85



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            +  +A++W+ LSG D+W+ LLDPL+ DLRRY++HY  M   +++  I +  SK  G  RY
Sbjct  58   SNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRY  117

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            ARR+  +  GL  GNP+KY VTK+
Sbjct  118  ARRDFFSKVGLELGNPYKYSVTKF  141



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M  GI +RWK LSG + WKGLLDPLD DLRRY+IHY  M    ++       S+  G   
Sbjct  1    MVEGIPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  L A TG +K NPF+Y+VTKY
Sbjct  61   YSKNRLFARTGFLKANPFRYKVTKY  85



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M  GIA+RWK LSG + W+GLLDPLD DLRRY+IHY  M    ++       S+  G   
Sbjct  1    MLEGIAKRWKELSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+++ + A TG +K NPF+Y VTKY
Sbjct  61   YSKKQIFARTGYLKANPFRYNVTKY  85



>gb|KDO40783.1| hypothetical protein CISIN_1g046292mg [Citrus sinensis]
Length=191

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+ WK LSG++NW GLL+PL+ +LRRY+IHY   +   +++   +  SK  G PRYA  
Sbjct  6    IADNWKELSGNNNWDGLLNPLNINLRRYIIHYGERVQAIYDSFNGEITSKMYGFPRYAPE  65

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            N  +N  L  GNP+KY VT Y
Sbjct  66   NFFSNVALQNGNPYKYIVTDY  86



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 48/84 (57%), Positives = 56/84 (67%), Gaps = 9/84 (11%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAM---ICPSFETLITQPFSKNIGLPRY  254
            IAERW+ LSG +NW+GLLDPLD DLRRYLIHY  M   IC SF     +  SK  G  RY
Sbjct  32   IAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFN---NEKVSKYRGTSRY  88

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            +++NL    GL K NP  YE+TKY
Sbjct  89   SKKNLFTRVGLDK-NP--YEITKY  109



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            I  +W+ LSG  NW+G+LDPLD DLR+Y++HY  +   +++   ++  S + G  RYA+R
Sbjct  6    IGRKWRDLSGRSNWEGMLDPLDIDLRQYILHYGQLAQATYDAFNSEKLSMHAGNCRYAKR  65

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  GL  GNPFKYEVT++
Sbjct  66   DFFSKVGLEHGNPFKYEVTEF  86



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG + WKGLLDPLD DLRRY+IHY  M    ++       S   G   
Sbjct  39   MLGAIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCY  98

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  + A TG +K NPF+Y VTKY
Sbjct  99   YSKSQIFARTGYLKANPFRYNVTKY  123



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IAERW+ LSG +NW+GLLDPLD DLRRYLIHY  M    +++   +  SK  G  RY+++
Sbjct  32   IAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAIYDSFNNEKVSKYRGTSRYSKK  91

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL +    KYE+TKY
Sbjct  92   NLFTRVGLHRN---KYEITKY  109



>ref|XP_008369474.1| PREDICTED: phospholipase A1-II 2-like [Malus domestica]
Length=197

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA RW+ L G  +W+GLLDPLD DLRR ++H    +    ++ I+ P SKN GLPRY   
Sbjct  4    IATRWRLLGGETDWEGLLDPLDIDLRRCILHXGERVAAIGDSFISDPRSKNCGLPRYTXT  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L +  GL   NP+KY V KY
Sbjct  64   HLFSKVGLENSNPYKYTVNKY  84



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            +  IA +W+ LSG ++W GLLDPLD DLRRY+IHY  M   +++   T+  SK  G  RY
Sbjct  17   SSSIANKWQQLSGENHWIGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRY  76

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            A+ +  +   L  GNPFKY VTK+
Sbjct  77   AKNDFFSKVFLENGNPFKYSVTKF  100



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG + WKGLLDPLD DLRRY+IHY  M    ++       S   G   
Sbjct  144  MLGAIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCY  203

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  + A TG +K NPF+Y VTKY
Sbjct  204  YSKSQIFARTGYLKANPFRYNVTKY  228



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA +W+ LSG +NW GLL PLD DLRRY+IHY  M   +++   T+  SK  G  RYA+ 
Sbjct  23   IANKWRQLSGENNWNGLLYPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRYAKN  82

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +   L  GNPFKY VTKY
Sbjct  83   DFFSKVYLENGNPFKYNVTKY  103



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+ WK LSG +NW GLL PLD DLRRY+IHY  M   +++T  +   SK  G   Y+++
Sbjct  25   IAKEWKELSGENNWDGLLSPLDMDLRRYVIHYGEMSQSTYDTFNSSKLSKYGGSSIYSKK  84

Query  264  NLLANTGLVKGN--PFKYEVTKY  326
            +  +  GLVKGN  P+KY VTKY
Sbjct  85   DFFSKVGLVKGNNDPYKYRVTKY  107



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            +G     WK L GSDNWKGLL+PL  DLRRYLIHY  M   +++T  T+  SK  G  RY
Sbjct  43   SGKSENNWKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRY  102

Query  255  ARRNLLANTGLVKGN--PFKYEVTKY  326
            ++++  A  GL KG   P+KY VTK+
Sbjct  103  SKQDFFAKIGLEKGKTGPYKYRVTKF  128



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +3

Query  96   WKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRNLLA  275
            WK L GSDNWKGLL+PL  DLRRYLIHY  M   +++T  T+  SK  G  RY++++  A
Sbjct  44   WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQDFFA  103

Query  276  NTGLVKGN--PFKYEVTKY  326
              GL KG   P+KY VTK+
Sbjct  104  KIGLEKGKTGPYKYRVTKF  122



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M  GI +RWK LSG + W+GLL+PLD DLRRY+IHY  M    ++       S+  G   
Sbjct  1    MLEGIPKRWKELSGVNKWQGLLEPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSRYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++R + A TG +K NPF+Y VTKY
Sbjct  61   YSKRQIFARTGFLKANPFRYNVTKY  85



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 56/84 (67%), Gaps = 9/84 (11%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAM---ICPSFETLITQPFSKNIGLPRY  254
            IAERW+ LSG +NW+GLLDPLD DLRRYLIHY  M   IC SF     +  SK  G  RY
Sbjct  32   IAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFN---NEKVSKYRGTSRY  88

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            +++NL    GL K NP  YE+TKY
Sbjct  89   SKKNLFTRVGLDK-NP--YEITKY  109



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL+PLD DLR+YLI Y  +   +++T IT+  SKN G  RY+  
Sbjct  4    MAEKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYSLE  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY VTK+
Sbjct  64   NLFTRVGL---DPLKYRVTKF  81



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL+PLD DLR+YLI Y  +   +++T IT+  SKN G  RY+  
Sbjct  4    MAEKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYSLE  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY VTK+
Sbjct  64   NLFTRVGL---DPLKYRVTKF  81



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M  GI +RWK LSG + W+GLLDPLD DLRRY+IHY  M    ++       SK  G   
Sbjct  1    MLEGIPKRWKELSGLNKWQGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSKYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+++ + A TG +K NPF+Y VTKY
Sbjct  61   YSKKQVFARTGYLKANPFRYNVTKY  85



>gb|KDO38625.1| hypothetical protein CISIN_1g0208022mg, partial [Citrus sinensis]
Length=288

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA+ WK LSGS+NW GLL PL+ +LRRY+IHY      ++++   +  SK  G PRYA 
Sbjct  5    GIADNWKELSGSNNWDGLLKPLNINLRRYIIHYGERAQANYDSFNDETISKMYGFPRYAP  64

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
             +   +  L  GNP+KY VT Y
Sbjct  65   EDFFYHVALHNGNPYKYTVTNY  86



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +3

Query  96   WKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRNLLA  275
            WK L GSDNWKGLL+PL  DLRRYLIHY  M   +++T  T+  SK  G  RY++++  A
Sbjct  50   WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKVSKFAGSSRYSKQDFFA  109

Query  276  NTGLVKGN--PFKYEVTKY  326
              GL KG   P+KY VTK+
Sbjct  110  KIGLGKGKTGPYKYRVTKF  128



>gb|EPS68357.1| hypothetical protein M569_06414, partial [Genlisea aurea]
Length=191

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +3

Query  87   AERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRN  266
            A RWK L+G D W+GLLDPLD DLRR++IHY      +++   ++  SK  G  RY +R+
Sbjct  1    ASRWKILNGQDRWEGLLDPLDPDLRRWIIHYGERAQATYDAFNSEKASKYAGSCRYLKRD  60

Query  267  LLANTGLVKGNPFKYEVTKY  326
              +  GL  GNP++Y VT+Y
Sbjct  61   FFSRAGLEVGNPYRYRVTRY  80



>ref|XP_008345355.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=407

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA RW+ L G  +W+GLLDPLD DLRR ++H    +    ++ I+ P SKN GLPRY   
Sbjct  33   IATRWRLLGGETDWEGLLDPLDIDLRRCILHXGERVAAIGDSFISDPRSKNCGLPRYTXT  92

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L +  GL   NP+KY V KY
Sbjct  93   HLFSKVGLENSNPYKYTVNKY  113



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA  IA RW+ L+G DNWK LLDPLD DLRR +IHY      +++T  ++  S   G  R
Sbjct  1    MADSIATRWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++ N  +   L KGNP+KY +TK+
Sbjct  61   YSKANFFSGLFLEKGNPYKYNITKF  85



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL+PLD DLR+YLI Y  +   +++T IT+  SKN G  RY+  
Sbjct  4    MAEKWEQLSGKNNWEGLLNPLDLDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY VTK+
Sbjct  64   NLFTRVGL---DPLKYRVTKF  81



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA  IA RW+ L+G DNWK LLDPLD DLRR +IHY      +++T  ++  S   G  R
Sbjct  1    MADSIATRWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++ N  +   L KGNP+KY +TK+
Sbjct  61   YSKANFFSGLFLEKGNPYKYNITKF  85



>ref|XP_004505133.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Cicer arietinum]
Length=364

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA +W+ LSG   WKGLLDPL  DLR+YL+HY  +   +++   ++  SK  G   Y+
Sbjct  2    GSIARKWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +++L +   L KGNPFKY +TK+
Sbjct  62   KKDLFSKVNLEKGNPFKYSITKF  84



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A+RW+ LSG   W+ LL+PLD+D++ YL+HY  M   +++T   Q  S+  G  RYAR 
Sbjct  5    VAKRWRELSGQHGWRNLLNPLDADMQTYLLHYGGMAQVTYDTFNKQQMSRYAGSSRYARN  64

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL   TG  KG+P++Y+  KY
Sbjct  65   NLFHATGSAKGSPYRYDAVKY  85



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RWK LSG ++W  LLDPLD DLRRY+IHY  M   +++    +  SK  G   
Sbjct  18   MGSSIAKRWKPLSGQNHWGELLDPLDIDLRRYIIHYGEMAQATYDAFNNEKASKFAGSSL  77

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y + +  +   L KGNP++Y+VTK+
Sbjct  78   YGKEDFFSKVNLEKGNPYRYQVTKF  102



>ref|XP_010686472.1| PREDICTED: phospholipase A1-II 1-like [Beta vulgaris subsp. vulgaris]
Length=411

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA++W+ L G ++W+G LDPLD DLRR +IHY  M   +++T I + +SK+ G  R+ 
Sbjct  35   GYIADKWELLMGRNHWEGQLDPLDIDLRRNIIHYGEMAQATYDTFIREKYSKHAGASRFN  94

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            + N  A  GL  G+P+KY VTK+
Sbjct  95   KNNFFAKLGLELGHPYKYCVTKF  117



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RWK L+G   W+GLLDPLD DLRR LIHY  M    ++       S+  G   
Sbjct  1    MLDDIAKRWKELNGQKKWQGLLDPLDPDLRRCLIHYGEMSQVGYDAFNWDRKSRYAGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+++ L A TG +K NPF+YEVTKY
Sbjct  61   YSKKQLFARTGFLKANPFRYEVTKY  85



>gb|AFK39140.1| unknown [Medicago truncatula]
Length=196

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA  W+ LSG   WKGLL+PL  DLRRYL+HY      +++    +  SK  G  RY+
Sbjct  2    GSIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +++  +   L KGNPFKY VTKY
Sbjct  62   KKDFFSKVYLEKGNPFKYSVTKY  84



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG DNW+GLL+PLD DLRRY+I Y  +   +++T IT+  SK  G  RY+  
Sbjct  4    MAEKWEQLSGKDNWEGLLNPLDLDLRRYIIQYGELAQATYDTFITEKASKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY VTK+
Sbjct  64   NLFTGVGL---DPLKYRVTKF  81



>ref|XP_006428645.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
 ref|XP_006480462.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|ESR41885.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
Length=410

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+ WK LSG++NW GLL+PL+ +LRRY+IHY   +   +++   +  SK  G PRYA  
Sbjct  6    IADNWKELSGNNNWDGLLNPLNINLRRYIIHYGERVQAIYDSFNGETTSKMYGFPRYAPE  65

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +N  L  GNP+KY VT Y
Sbjct  66   DFFSNVALQNGNPYKYIVTNY  86



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA +W+ LSG   WKGLLDPL  DLR+YL+HY  +   +++   ++  SK  G   Y+
Sbjct  2    GSIARKWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +++L +   L KGNPFKY +TK+
Sbjct  62   KKDLFSKVNLEKGNPFKYSITKF  84



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA+RWK LSG  NW+GLLDPLD DLRRY+IHY  M   +++T  ++  SK  G  RYA
Sbjct  19   GSIAKRWKLLSGKSNWEGLLDPLDLDLRRYVIHYGTMAQATYDTFNSENASKFAGSSRYA  78

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            + +L +N G+ KGNPFKY VTKY
Sbjct  79   KNDLFSNVGMDKGNPFKYRVTKY  101



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA+RW+ LSG ++WKGLL PLD DLR+YLIHY  M    ++T      SK  G   Y+R
Sbjct  33   GIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIYSR  92

Query  261  RNLLANTGLVKGNPF-KYEVTKY  326
            ++  A  GL K +P+ KY+VTK+
Sbjct  93   KDFFAKVGLEKAHPYTKYKVTKF  115



>ref|XP_009110999.1| PREDICTED: phospholipase A1-IIalpha-like [Brassica rapa]
 emb|CDY15570.1| BnaA08g28540D [Brassica napus]
Length=408

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   I +RWK LSG + WKGLLDPLDSDLRRYLIHY  M    ++       S+  G   
Sbjct  1    MLEDIPKRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  + A TG +K NP +Y VTKY
Sbjct  61   YSKSQIHARTGYLKANPIRYNVTKY  85



>emb|CDX86530.1| BnaC08g01730D [Brassica napus]
Length=408

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   I +RWK LSG + WKGLLDPLDSDLRRYLIHY  M    ++       S+  G   
Sbjct  1    MLEDIPKRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCY  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++  + A TG +K NP +Y VTKY
Sbjct  61   YSKSQIHARTGYLKANPIRYNVTKY  85



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL+PLD DLR+Y+I Y  +   +++T IT+  SK  G  RY+  
Sbjct  4    MAEKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY VTK+
Sbjct  64   NLFTKVGL---DPLKYRVTKF  81



>ref|XP_006491814.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
Length=407

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA+ WK LSGS++W GLL PL+ +LRRY+IHY      ++++   +  SK  G PRYA 
Sbjct  5    GIADNWKELSGSNHWDGLLKPLNINLRRYIIHYGETAQANYDSFNDETISKMYGFPRYAP  64

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
             +   +  L  GNP+KY VT Y
Sbjct  65   EDFFYHVALHNGNPYKYTVTNY  86



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA+RW+ LSG ++WKGLL PLD DLR+YLIHY  M    ++T      SK  G   Y+R
Sbjct  33   GIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIYSR  92

Query  261  RNLLANTGLVKGNPF-KYEVTKY  326
            ++  A  GL K +P+ KY+VTK+
Sbjct  93   KDFFAKVGLEKAHPYTKYKVTKF  115



>ref|XP_006428509.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
 gb|ESR41749.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
Length=407

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA+ WK LSGS++W GLL PL+ +LRRY+IHY      ++++   +  SK  G PRYA 
Sbjct  5    GIADNWKELSGSNHWDGLLKPLNINLRRYIIHYGETAQANYDSFNDETISKMYGFPRYAP  64

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
             +   +  L  GNP+KY VT Y
Sbjct  65   EDFFYHVALHNGNPYKYTVTNY  86



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RW+ L G D+WKGLLDPLD DLRR L+ Y  M    ++  I Q  S+  G P 
Sbjct  1    MTGSIAKRWRVLQGKDSWKGLLDPLDVDLRRSLVLYGEMAQAVYDGFIRQKKSRFAGAPL  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YAR N+L    L +G    Y VTK+
Sbjct  61   YARSNILQKVALSQGQERLYRVTKF  85



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   I  RW+ LSG DNWK LLDPLD DLRRY+IHY      +++T   +  SK  G   
Sbjct  1    MLKDIPRRWRLLSGQDNWKNLLDPLDIDLRRYIIHYGERAQATYDTFDHEKASKYAGSSL  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y    L  + GL K NPFKY+V KY
Sbjct  61   YKPDVLFKSVGLCKRNPFKYKVVKY  85



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLLDPLD DLR+Y+I Y  +   +++T I +  SK  G  RY+  
Sbjct  4    MAEKWEQLSGKNNWEGLLDPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY+VTKY
Sbjct  64   NLFTRAGL---DPLKYKVTKY  81



>emb|CDY34061.1| BnaC03g62710D [Brassica napus]
Length=402

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA+RW+ LSG ++WKGLL PLD DLR+YLIHY  M    ++T      S+  G   Y+R
Sbjct  33   GIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSEFAGSSIYSR  92

Query  261  RNLLANTGLVKGNPF-KYEVTKY  326
            ++  A  GL K +P+ KY+VTK+
Sbjct  93   KDFFAKVGLEKAHPYTKYKVTKF  115



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA++W+ LSG ++WKG+L PLD DLR+Y++HY  M    ++T  T   SK  G   Y+R+
Sbjct  17   IAKKWRDLSGQNHWKGMLHPLDQDLRQYIVHYGEMAQAGYDTFNTNTESKFAGASIYSRK  76

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A  GL K NP+ KY+VTK+
Sbjct  77   DFFAKVGLEKANPYTKYKVTKF  98



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL PLD DLR+Y+IHY  +   +++T IT+  SK  G  RY+  
Sbjct  1    MAEKWEELSGKNNWEGLLHPLDVDLRKYIIHYGELAQATYDTFITERASKYAGASRYSME  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY VTK+
Sbjct  61   NLFTKVGL---DPNKYRVTKF  78



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +AE+W+ LSG + W+GLL+PLD DLRRY+I Y  +   +++T I++  SK  G  RY+
Sbjct  2    GSMAEKWEELSGKNKWEGLLNPLDVDLRRYIIQYGELAHVTYDTFISEKASKYAGASRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
              NL +  GL   +P KY VTKY
Sbjct  62   MENLFSKAGL---DPTKYRVTKY  81



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA  W+ LSG   WKGLL+PL  DLRRYL+HY      +++    +  SK  G  RY+
Sbjct  2    GSIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +++  +   L KGNPFKY VTKY
Sbjct  62   KKDFFSKVYLEKGNPFKYSVTKY  84



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA  W+ LSG   WKGLL+PL  DLRRYL+HY      +++    +  SK  G  RY+
Sbjct  2    GSIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +++  +   L KGNPFKY VTKY
Sbjct  62   KKDFFSKVYLEKGNPFKYSVTKY  84



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            +  IA+RW+ LSG  +W GLL+PLD DLR+Y++HY  M+  +++T  +   S+  G   Y
Sbjct  38   SASIAQRWRDLSGQSHWNGLLEPLDLDLRQYIVHYGEMVQAAYDTFNSCTESQYAGSSIY  97

Query  255  ARRNLLANTGLVKGNPF-KYEVTKY  326
            +R++  +  G+V GNP+ KY+VTK+
Sbjct  98   SRQDFFSKVGIVNGNPYCKYQVTKF  122



>emb|CDX99456.1| BnaC01g10960D [Brassica napus]
Length=402

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ LSG ++WKGLL PLD DLR+Y+IHY  M    ++T      SK  G   Y+R+
Sbjct  35   IAKRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRK  94

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A  GL K +P+ KY+VTK+
Sbjct  95   DFFAKVGLEKAHPYTKYKVTKF  116



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA RWK L+G +NWK LLDPLD DLRR +I Y      +++T  ++  S   G  R
Sbjct  1    MLQSIATRWKLLNGQNNWKNLLDPLDVDLRRNIIQYGERAQATYDTFNSEKASMFAGSSR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y++ N  +  GL K NP+KY VTK+
Sbjct  61   YSKANFFSKLGLEKANPYKYNVTKF  85



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G  AE+W+ LSG +NW GLL+PLD DLR+Y+IHY  +   +++TLI +  SK  G  RY+
Sbjct  2    GSTAEKWEELSGKNNWDGLLNPLDVDLRKYIIHYGELAHATYDTLIMERASKYAGASRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
              N     GL   +P KY VTK+
Sbjct  62   MENFFTKVGL---DPNKYRVTKF  81



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL+PLD DLR+Y+I Y      +++T I+   SK  G  RY+  
Sbjct  1    MAEKWEELSGKNNWEGLLNPLDVDLRKYIIQYGEKAEVTYDTFISDKVSKYAGASRYSME  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL +N GL   +P KY VTKY
Sbjct  61   NLFSNVGL---DPSKYRVTKY  78



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ LSG ++WKGLL PLD DLR+Y+IHY  M    ++T      SK  G   Y+R+
Sbjct  35   IAKRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRK  94

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A  GL K +P+ KY+VTK+
Sbjct  95   DFFAKVGLEKAHPYTKYKVTKF  116



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IAE+W+ LSG +NWKGLL+PLD +LR+Y+I Y  +   +++T I+   SK  G  RY++ 
Sbjct  4    IAEKWEELSGKENWKGLLNPLDVNLRKYIIQYGELAQATYDTFISDRASKYAGSSRYSKE  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL A  GL   +P  Y VTKY
Sbjct  64   NLFAKVGL---DPEMYHVTKY  81



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            A GIA+RWK LSG++ W+GLLDPLD DLRRY+IHY  M   +++T  ++  SK  G  RY
Sbjct  25   AVGIAKRWKLLSGTNQWEGLLDPLDLDLRRYIIHYGEMAQAAYDTFNSEKASKYAGSSRY  84

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            A+ NL +  G+ + NPFKY VTKY
Sbjct  85   AKENLFSKVGIEQANPFKYRVTKY  108



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG + W+GLL+PLD DLR+Y+I Y  +   +++T I+   SK  G  RY+  
Sbjct  4    MAEKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL +N GL   +P KY VTKY
Sbjct  64   NLFSNVGL---DPSKYRVTKY  81



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +3

Query  72   MAGG-IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLP  248
            M+GG IA RW+ LSG   W+GLL+PLD+DLR+YLIHY  +   +++  I Q +S+  G  
Sbjct  1    MSGGNIARRWRQLSGQQKWQGLLEPLDNDLRQYLIHYGDLAQATYDNFIMQKYSQFAGDN  60

Query  249  RYARRNLLANTGL-VKGNPFKYEVTKY  326
            R++ +NL +  GL ++ N F Y+  KY
Sbjct  61   RFSMKNLFSRVGLGMRNNQFVYKPVKY  87



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   I   W+ LSG  NWKGLL PLD DLR+Y+IHY  M   +++T  +   SK  G   
Sbjct  1    MLRSIGRGWRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSI  60

Query  252  YARRNLLANTGLVKGNPF-KYEVTKY  326
            Y+R++  +  GL K NP+ KY+VTK+
Sbjct  61   YSRQDFFSKVGLEKNNPYSKYQVTKF  86



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA   AE+W+ LSG +NW GLL+PLD DLR+Y+IHY  +   +++T I++  SK  G  R
Sbjct  1    MACIFAEKWEELSGKNNWDGLLNPLDLDLRKYIIHYGELAQATYDTFISERASKYAGASR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+  N     GL   +P KY VTKY
Sbjct  61   YSMENFFTKVGL---DPKKYCVTKY  82



>ref|XP_009137120.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=349

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ L+G ++WKG+L PLD DLR Y+IHY  M    ++T      SK  G   Y+R+
Sbjct  33   IAKRWRDLNGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRK  92

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A  GL K +P+ KY+VTK+
Sbjct  93   DFFAKVGLEKAHPYTKYKVTKF  114



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   I   W+ LSG  NWKGLL PLD DLR+Y+IHY  M   +++T  +   SK  G   
Sbjct  1    MLRSIGRGWRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSI  60

Query  252  YARRNLLANTGLVKGNPF-KYEVTKY  326
            Y+R++  +  GL K NP+ KY+VTK+
Sbjct  61   YSRQDFFSKVGLEKNNPYSKYQVTKF  86



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +AE+W+ LSG +NW+GLL+PLD DLR+Y+I Y  +   +++T I++  SK  G  RY+
Sbjct  2    GSMAEKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
              N     GL   +P KY VTK+
Sbjct  62   MENFFTKVGL---DPSKYHVTKF  81



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ LSG ++WKG+L PLD DLR+Y+IHY  M    ++T      SK  G   Y+R+
Sbjct  36   IAKRWRELSGQNHWKGMLHPLDQDLRQYIIHYGEMAQAGYDTFNINTESKFAGASIYSRK  95

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  +  GL K +P+ KY+VTK+
Sbjct  96   DFFSKVGLEKAHPYTKYKVTKF  117



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA+ W+ LSG   WKGLL+PL  DLR+YL+HY      +++    +  SK  G  RY+
Sbjct  11   GSIAKTWRELSGKSKWKGLLEPLHIDLRKYLLHYGQFAQATYDAFNFEKASKYAGNCRYS  70

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            +++  +   L +GNP+KY VTKY
Sbjct  71   KKDFFSKVYLEEGNPYKYSVTKY  93



>ref|XP_008238421.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=376

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ LSG   W+GLL+PLD DLRRY++HY      + +  I +  S N GLPRYA+R
Sbjct  4    IAKRWRRLSGETEWEGLLNPLDLDLRRYILHYGERTAATADAFIDETKSDNCGLPRYAKR  63

Query  264  NLLANTGLVKGNP  302
             L +  GL   NP
Sbjct  64   YLFSKVGLENSNP  76



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG DNW+ LL+PLD DLR+Y+I Y  +   +++T IT+  SK  G  RY+  
Sbjct  4    MAEKWEQLSGKDNWEALLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    G    +P KY VTK+
Sbjct  64   NLFTGVG---HDPLKYRVTKF  81



>ref|XP_006428508.1| hypothetical protein CICLE_v10013478mg [Citrus clementina]
 gb|ESR41748.1| hypothetical protein CICLE_v10013478mg [Citrus clementina]
Length=97

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GI   WK LSG++NW GLL+P + +LRRY+IHY   +  + ++   +  SK    P Y  
Sbjct  5    GIVANWKKLSGNNNWDGLLNPFNINLRRYIIHYGERVQVNNDSFNGETMSKMYEFPHYTP  64

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
                +N  L  GNP+KY VT Y
Sbjct  65   EGFFSNVALRNGNPYKYIVTNY  86



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL PLD DLR+Y+I Y  +   +++T IT+  SK  G  RY+  
Sbjct  1    MAEKWEELSGKNNWEGLLHPLDIDLRKYIIQYGELAQATYDTFITERASKYAGASRYSME  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P KY VTK+
Sbjct  61   NLFTKVGL---DPNKYRVTKF  78



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A++W+ LSG +NW+GLL+PLD DLR+Y+I Y  +     +T IT+  SK  G  RY+
Sbjct  2    GSMADKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQAINDTFITEKASKYAGASRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
              NL    GL   +P KY VTKY
Sbjct  62   MENLFTKVGL---DPTKYRVTKY  81



>ref|XP_006374296.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
 gb|ERP52093.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
Length=412

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLL-DPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
             GIA+ WKA SG +NW GLL  P+++D RRYLIHY   +    +       S +  L RY
Sbjct  2    AGIADHWKAFSGFNNWDGLLVHPINTDFRRYLIHYGERVGAIGDGFNNVKASNSFALSRY  61

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
                L ++ GL  GNPFKY+VTKY
Sbjct  62   PPEELFSHVGLQNGNPFKYQVTKY  85



>ref|XP_011005460.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=412

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLL-DPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            GIA+ WKA SG +NW GLL  P+++D RRYLIHY   +    +       S +  L RY 
Sbjct  3    GIADHWKAFSGFNNWDGLLIHPINTDFRRYLIHYGERVGAIGDGFNNVKASNSFALSRYP  62

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
               L ++ GL  GNPFKY+VTKY
Sbjct  63   PEELFSHVGLQNGNPFKYQVTKY  85



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL+PLD DLR+Y+I Y      +++T I++  SK  G  RY+  
Sbjct  4    MAEKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGEKAEVTYDTFISETASKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL A  GL   +P KY VTK+
Sbjct  64   NLFAKVGL---DPSKYRVTKF  81



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  90   ERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRNL  269
            + WK LSG +NW+GLLDPLD +LRR +I Y  M   S++T  +   SK  G  RY +++ 
Sbjct  11   KNWKNLSGQNNWEGLLDPLDINLRRSIIRYGEMAQASYDTFNSTNISKYAGSSRYTKKDF  70

Query  270  LANTGLVKGNPFKYEVTKY  326
                GL  G P+KY VTK+
Sbjct  71   FTKVGLAMGKPYKYRVTKF  89



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AE+W+ LSG +NW+GLL+PLD DLR+Y+I Y  +   +++T I +  SK  G  RY+  
Sbjct  4    MAEKWEHLSGKNNWEGLLNPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P  Y+VTKY
Sbjct  64   NLFTRAGL---DPLNYKVTKY  81



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            +A   A+RW+ LSG ++WKG+L PLD DLR Y+IHY  M    ++T      SK  G   
Sbjct  31   VAKEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASI  90

Query  252  YARRNLLANTGLVKGNPF-KYEVTKY  326
            Y+R++  A  GL K +P+ KY+VTK+
Sbjct  91   YSRKDFFAKVGLEKAHPYTKYKVTKF  116



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+ WK LSG +NWKGLLDP+D +LRRYLI+Y A      ++      S    L RY   
Sbjct  4    IAKNWKVLSGENNWKGLLDPIDDNLRRYLINYGAFTRAPADSFNDVKVSDGFALCRYPPE  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
             L    GL  GNPFKY VT Y
Sbjct  64   VLFTRVGLQSGNPFKYLVTDY  84



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A++W+ LSG + W+GLL+PLD DLR+Y+I Y  +   +++T IT+  SK  G  RY+  
Sbjct  4    MADKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAHVTYDTFITEKASKYAGASRYSME  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL +  GL   +P KY VTKY
Sbjct  64   NLFSKAGL---DPSKYRVTKY  81



>gb|KDP21072.1| hypothetical protein JCGZ_21543 [Jatropha curcas]
Length=407

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA  WK LSG +NW GLLDP+D +LR YLI+Y  +   +   L     S    L RY  
Sbjct  3    GIASNWKVLSGENNWDGLLDPIDDNLRHYLINYGFLTAAAPAALNGVKKSPGYALSRYPP  62

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
             N  +  G+ KGNPFKY+VT +
Sbjct  63   ENYFSEVGIEKGNPFKYQVTDF  84



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            +A   A+RW+ LSG ++WKG+L PLD DLR Y+IHY  M    ++T      SK  G   
Sbjct  31   VAKEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASI  90

Query  252  YARRNLLANTGLVKGNPF-KYEVTKY  326
            Y+R++  A  GL K +P+ KY+VTK+
Sbjct  91   YSRKDFFAKVGLEKAHPYTKYKVTKF  116



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            +A   A+RW+ LSG ++WKG+L PLD DLR Y+IHY  M    ++T      SK  G   
Sbjct  31   VAKEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASI  90

Query  252  YARRNLLANTGLVKGNPF-KYEVTKY  326
            Y+R++  A  GL K +P+ KY+VTK+
Sbjct  91   YSRKDFFAKVGLEKAHPYTKYKVTKF  116



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IAE W+ LSG +NWKGLL+PLD +LR+Y+I Y  +   +++T I++  SK  G  RY++ 
Sbjct  4    IAENWEQLSGKENWKGLLNPLDFNLRKYIIQYGELAQATYDTFISERASKYAGSSRYSKE  63

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL    GL   +P  Y +TKY
Sbjct  64   NLFKRVGL---DPEMYHITKY  81



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA +WK LSG++NW+GLLDPLD DLR+Y+IHY  M   +++T  ++  SK  G  RY++ 
Sbjct  26   IARKWKLLSGANNWQGLLDPLDLDLRKYIIHYGQMSQATYDTFNSEKASKYAGSSRYSKD  85

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NLL+  G+ K NPFKY VTKY
Sbjct  86   NLLSKVGVDKANPFKYRVTKY  106



>ref|XP_007025428.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28050.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=381

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA  IA RW+ LSG  NWKGLL PLD DLRRY+IHY      + +       SK+ GL  
Sbjct  1    MASFIASRWRELSGEKNWKGLLHPLDLDLRRYIIHYLQRAGAAGDIFNDNRASKSFGLSL  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y      +  GL  GNP+KY VT +
Sbjct  61   YPPDEYFSRAGLEIGNPYKYRVTNF  85



>ref|XP_007025427.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28049.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=382

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA  IA RW+ LSG  NW+GLL PLD DLRRY+IHY      + +    +  SK+ GL  
Sbjct  1    MASSIASRWRELSGEKNWEGLLHPLDLDLRRYIIHYLQRAGAAGDLFNNKKASKSYGLSL  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y      +  GL  GNP+KY VT +
Sbjct  61   YPPDEYFSRAGLEIGNPYKYRVTNF  85



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
             A+RW+ LSG ++WKG+L PLD DLR Y+IHY  M    ++T      S+  G   Y+R+
Sbjct  18   FAKRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTDSQFAGASIYSRK  77

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A  GL K +P+ KY+VTK+
Sbjct  78   DFFAKVGLEKAHPYTKYKVTKF  99



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ LSG ++W G+L PLD DLR Y+IHY  M    ++T      SK  G   Y+R+
Sbjct  33   IAKRWRDLSGQNHWNGMLQPLDQDLREYVIHYGEMAQAGYDTFNINTESKFAGASIYSRK  92

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A  GL K +P+ KY+VT++
Sbjct  93   DFFAKVGLEKAHPYTKYKVTRF  114



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +AE+W+ L G +NW GLL+PL  DLR+Y+IHY  +   +++T I +  SK  G  RY+
Sbjct  2    GSMAEKWEELGGKNNWNGLLNPLAVDLRKYIIHYGELAQATYDTFIMERASKYAGASRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
              N     GL   +P KY VTK+
Sbjct  62   MENFFTKVGL---DPNKYRVTKF  81



>gb|KHG20660.1| Phospholipase A1-IIgamma -like protein [Gossypium arboreum]
Length=383

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            +  IA RW+ LSG +NW+GLLDPLD + RRYLIHY      + +       SK   L  Y
Sbjct  3    SSAIASRWRELSGENNWEGLLDPLDLEFRRYLIHYLQRAAAASDAFNGTKASKGYALSLY  62

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
                  A  GL KGNP++Y+VT +
Sbjct  63   PPDEYFARVGLEKGNPYRYKVTNF  86



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
             A+RWK LSG ++WKG+L PLD DLR Y+IHY  M    ++T      SK  G   YAR+
Sbjct  40   FAKRWKDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYARK  99

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A   L K +P+ KY+VTK+
Sbjct  100  DFFAKVCLEKAHPYTKYKVTKF  121



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            MA   A++W+ LSG +NW GLL+PLD DLR+Y+I Y  +   +++T I++  SK  G  R
Sbjct  1    MACIFADKWEELSGKNNWDGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y+  N     GL   +P KY VTKY
Sbjct  61   YSMENFFTKVGL---DPKKYCVTKY  82



>ref|XP_003528483.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31004.1| Phospholipase A1-IIgamma [Glycine soja]
Length=366

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA +W+ LSG  NW+GLLD LD DLRRY++HY  +   +++      F+   G  RY   
Sbjct  4    IARKWRDLSGQSNWQGLLDSLDIDLRRYILHYGQLAQATYDA-----FNSENGNCRYPMS  58

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +  +  GL  GNPFKY VTK+
Sbjct  59   DFFSKVGLENGNPFKYVVTKF  79



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
             G+AE+W+ LSG  NW GL+ PL  DLR+Y+I Y  +   +++T IT+  SK  G  RY+
Sbjct  2    AGMAEKWEELSGKSNWDGLVHPLAVDLRKYIIQYGELAQATYDTFITERASKYAGASRYS  61

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
              N     GL   +P KY VTK+
Sbjct  62   NENFFTKVGL---DPNKYGVTKF  81



>ref|XP_006469038.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-IIbeta-like 
[Citrus sinensis]
Length=395

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G I E+W+ LSG+DNWK LLDPLD DLRRY+IHY      +++       SK  G  +
Sbjct  1    MIGSIKEKWRVLSGNDNWKDLLDPLDIDLRRYIIHYGERAQXTYDAFNRGKASKYAGDSQ  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            + R+N  +  G  KGNPFKYEVTK+
Sbjct  61   FGRKNFFSRVGXYKGNPFKYEVTKF  85



>ref|XP_011005461.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLD-PLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            IA+ WK  SG+ NW+GLLD P+++D RRYLIHY   +    +       S +  L RY  
Sbjct  4    IADNWKDFSGAQNWEGLLDHPINTDFRRYLIHYGERVEAIGDAFNYVKASDSYALSRYPP  63

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
              L  N  L  GNPFKY+VTKY
Sbjct  64   EELFMNVNLQNGNPFKYQVTKY  85



>ref|XP_010446304.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010446311.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=309

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            +A   A+ W+ LSG ++WKG L PLD DLR Y+IHY  M    ++T      SK  G   
Sbjct  31   VAKEFAKSWRDLSGLNHWKGTLQPLDQDLREYIIHYGEMGQAGYDTFNINTESKFAGASI  90

Query  252  YARRNLLANTGLVKGNPF-KYEVTKY  326
            Y+R++  A  GL K +P+ KY+VTK+
Sbjct  91   YSRKDFFAKVGLEKAHPYTKYKVTKF  116



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG +NWK LLDPLD+DLR Y+IHY  M   ++++  TQ  SK  G   
Sbjct  1    MVGSIAKRWKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKASKYAGCSL  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+        L KGNPFKY VTK+
Sbjct  61   YAKDEFFNRVHLEKGNPFKYRVTKF  85



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AERW+ L GSD+W  LLDPLD DLRR LI+Y  MI  ++E  I +  S N G+ RY R 
Sbjct  1    MAERWRELHGSDHWDSLLDPLDVDLRRCLINYGEMIMATYEAFIAERRSPNAGMCRYRRA  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L     +   +P  Y VT+Y
Sbjct  61   DLFRRVEV--SHPGWYAVTRY  79



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
             A+RW+ LSG ++WKG+L PLD DLR Y+IHY  M    ++T      S+  G   Y+R+
Sbjct  19   FAKRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESQFAGASIYSRK  78

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  A  GL   +P+ KY+VTK+
Sbjct  79   DFFAKVGLEIAHPYTKYKVTKF  100



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RWK LSG   W+GLLDPLD DLRRYLIHY  M   +++T I +  SK  G  RY+ +
Sbjct  6    IAKRWKLLSGQQKWEGLLDPLDLDLRRYLIHYGEMAQATYDTFIMEKVSKYAGDSRYSMK  65

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            NL +  GLV  NPF Y+  KY
Sbjct  66   NLFSEVGLVLNNPFVYQPVKY  86



>gb|KDP21071.1| hypothetical protein JCGZ_21542 [Jatropha curcas]
Length=407

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            GIA  WK LSG +NW GLLDP+D +LR YLI+   +   +   L     S    L RY  
Sbjct  3    GIASNWKVLSGENNWDGLLDPIDDNLRHYLINNGFLTAAAPAALNDVKQSPGYALSRYPP  62

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
             N  +  G+ +GNPFKY+VT +
Sbjct  63   ENYFSEAGIEQGNPFKYQVTDF  84



>ref|XP_006646154.1| PREDICTED: phospholipase A1-II 2-like [Oryza brachyantha]
Length=361

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A RW+ L GS +W GLLDPLD DLRR LI Y  MI  ++E+ I +P S N G+ RY R 
Sbjct  6    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYESFIGEPRSPNAGMCRYRRA  65

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L     +   +P  Y  T+Y
Sbjct  66   DLFRRVDV--SHPGWYAATRY  84



>ref|XP_007210039.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
 gb|EMJ11238.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
Length=376

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ LSG   W+GLL+PLD DLRRY++HY        +  I +  S N GLPRYA+R
Sbjct  4    IAKRWRLLSGETEWEGLLNPLDLDLRRYILHYGERAAAIADAFIDETKSDNCGLPRYAKR  63

Query  264  NLLANTGLVKGNP  302
             L +  GL   NP
Sbjct  64   YLFSKVGLENSNP  76



>ref|XP_006374295.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
 gb|ERP52092.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
Length=412

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLD-PLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            IA+ WK  SG+ NW+GLLD P+++D RRYLIHY   +    +       S +  L R+  
Sbjct  19   IADNWKDFSGAKNWEGLLDHPINTDFRRYLIHYGERVGAIGDAFNYVKASDSYALSRHPP  78

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
              L  N  L  GNPFKY+VTKY
Sbjct  79   EELFMNVNLQNGNPFKYQVTKY  100



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG+  WK LLDPLD DLRRY++HY  M    + T  +   SK +G   
Sbjct  1    MVGDIAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTKY
Sbjct  61   YTKEELFARTGYLKANPFRYEVTKY  85



>gb|KCW74059.1| hypothetical protein EUGRSUZ_E02687 [Eucalyptus grandis]
Length=384

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M GG +  W  LSG  NWK +LDPLD DLR YLIHY   +    +    Q  S   G+P 
Sbjct  1    MGGGSSRPWTELSGETNWKDMLDPLDEDLRMYLIHYGERVQAIGDAYNGQEESAGYGMPL  60

Query  252  YARRNLLANTGL-VKGNPFKYEVTKY  326
            Y    L +  GL    N F+YEVT+Y
Sbjct  61   YPMDKLFSEVGLETDNNKFRYEVTRY  86



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG   WK LLDPLD DLRRY++HY  M    + T  +   SK +G   
Sbjct  1    MVGDIAKRWKQLSGDSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTKY
Sbjct  61   YTKEELFARTGYLKANPFRYEVTKY  85



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG+  WK LLDPLD DLRRY++HY  M    + T  +   SK +G   
Sbjct  1    MVGDIAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTKY
Sbjct  61   YTKEELFARTGYLKANPFRYEVTKY  85



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            + +RW+ LSG ++WK  L+PLD +LR+Y+IHY  M   +++T      SK  G   Y+R+
Sbjct  27   LGKRWRDLSGRNHWKDALEPLDLELRQYIIHYGEMAQATYDTFNANTKSKYAGSSIYSRQ  86

Query  264  NLLANTGLVKGNPF-KYEVTKY  326
            +  +  GL KG+P+ KY+VTK+
Sbjct  87   DFFSKVGLEKGHPYCKYQVTKF  108



>ref|XP_011047741.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLD-PLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            +A+ WK  SG+ NW+GLLD P+++D RRYLIHY   +    +       S +  L RY  
Sbjct  4    MADNWKDFSGAKNWEGLLDHPINTDFRRYLIHYGERVGAIGDAFNYVKASDSYALSRYPP  63

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
                 N  L  GNPFKY+VTKY
Sbjct  64   EEFFMNVNLQNGNPFKYQVTKY  85



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
            G+A RW+ L GSD+W GLLDPLD+DLRR LI Y  M   + E  I +  S N G+ RY R
Sbjct  6    GMASRWRELHGSDSWAGLLDPLDADLRRSLITYGEMAMATHEAFIGERRSPNAGMCRYRR  65

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
             +L     +   +P  Y VT+Y
Sbjct  66   ADLFRRVEV--SHPGWYAVTRY  85



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   I ERW+ LSG +NWK LLDPLD DLRRYLIHY      +++T  ++  SK  G  R
Sbjct  1    MFKQIPERWRELSGQNNWKNLLDPLDLDLRRYLIHYGERASATYDTFNSEVKSKYAGDSR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y  +NL +N GL   NPF+Y  TKY
Sbjct  61   YGLKNLFSNVGLSIANPFEYTATKY  85



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+ WK LSG +NWK LLDPLD+DLR Y+IHY  M   ++++  TQ  SK  G   
Sbjct  1    MVGSIAKGWKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKVSKYAGSSL  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+        L KGNPFKY VTK+
Sbjct  61   YAKDEFFNRVHLEKGNPFKYRVTKF  85



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            + G +A +WK L GS++W+GLLDPLD  LRR L+ Y  MI  ++E  I +  S N G+ R
Sbjct  3    VTGDMAAQWKELQGSNHWEGLLDPLDVGLRRCLVTYGEMIMATYEAFIGESRSPNAGMCR  62

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y R +L     +   +P  YE T+Y
Sbjct  63   YRRADLFQRVDV--SHPGWYEATRY  85



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A RW+ L GSD+W+GLLDPLD+ LRR LI Y  MI  ++E  I +  S N G+ RY R 
Sbjct  24   MAGRWRELQGSDHWEGLLDPLDAGLRRCLIAYGEMITATYEAFIGERRSPNAGMCRYRRA  83

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +LL    +   +P  Y  T+Y
Sbjct  84   DLLRRVDV--SHPGWYAATRY  102



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RWK LSGS  WK LLDPLD DLRRY++HY  M    +    +   SK +G   
Sbjct  1    MVGDIATRWKELSGSSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTKY
Sbjct  61   YTKEELFARTGYLKANPFRYEVTKY  85



>gb|EEC71192.1| hypothetical protein OsI_03092 [Oryza sativa Indica Group]
Length=139

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AERW+ L G D+WKGLLDPLD+DLRR +I Y  +   + +  I + +S + G  RY+R 
Sbjct  9    VAERWRELHGEDHWKGLLDPLDADLRRSVIGYGELAQATNDAFIREAWSPHAGACRYSRD  68

Query  264  NLLANTGLVKGNPFKYEVTK  323
              L      +G  FK EV +
Sbjct  69   RFLEKAQGKRGG-FKLEVDR  87



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            + G I +RWK LSG ++WK LLDPLD+DLRRY+IHY  M   ++++   Q  SK  G   
Sbjct  18   LVGSIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDSFNAQKASKYAGSSL  77

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+ +  +   L KGNPFKY VTK+
Sbjct  78   YAKDDFFSKVHLEKGNPFKYRVTKF  102



>ref|XP_010058981.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW74055.1| hypothetical protein EUGRSUZ_E02678 [Eucalyptus grandis]
Length=396

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKN-IGLP  248
            M GG +  W  LSG  NWK +LDPLD DLR YLIHY   +   ++    Q  S +  G+P
Sbjct  1    MGGGSSRPWTELSGETNWKDMLDPLDEDLRMYLIHYGERVQAIYDAYNGQKESGDGYGMP  60

Query  249  RYARRNLLANTGL-VKGNPFKYEVTKY  326
             Y    L +  GL    N F+YEVT+Y
Sbjct  61   LYPMDKLFSEVGLETDNNKFRYEVTRY  87



>ref|XP_007025431.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28053.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=383

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA RW+ LSG  NWK LL P+D DLRRY+IHY      + +       S+  G   
Sbjct  1    MDNSIATRWRDLSGEKNWKDLLHPVDPDLRRYVIHYGERAGAAGDLFNDTMASRGFGYCL  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y      +  GL  GNPF YEVT +
Sbjct  61   YPPDEFFSRAGLENGNPFMYEVTNF  85



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA-R  260
            +AE+W+ LSG +NW GLL+PLD DLR+Y+I Y  +    ++T IT+  SK  G  RY+  
Sbjct  1    MAEKWEELSGKNNWDGLLNPLDIDLRKYIIQYGELCQAIYDTFITETASKYAGASRYSME  60

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
            +      GL   +P KY VTKY
Sbjct  61   KPFFTRFGL---DPNKYRVTKY  79



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG+  WK LLDPLD DLRRY++HY  M    +    +   SK +G   
Sbjct  1    MVGDIAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTKY
Sbjct  61   YTKEELFARTGYLKANPFRYEVTKY  85



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG+  WK LLDPLD DLRRY++HY  M    +    +   SK +G   
Sbjct  1    MVGDIAKRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTK+
Sbjct  61   YTKEELFARTGYLKANPFRYEVTKF  85



>ref|NP_001168256.1| hypothetical protein [Zea mays]
 gb|ACN27606.1| unknown [Zea mays]
 gb|AFW82850.1| hypothetical protein ZEAMMB73_282385 [Zea mays]
Length=394

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA+RW+ L G  +WKGLL+PLD DLR+ +I Y  ++  + +    +P S ++GL +Y 
Sbjct  7    GSIAKRWRELQGEKSWKGLLEPLDMDLRKSIISYGELVAATGDGFNNEPHSPHVGLCKYG  66

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
              +LL  +G+   +   Y+VTK+
Sbjct  67   HDDLLTKSGVAAAS--HYKVTKF  87



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  87   AERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRN  266
            A+RW+ LSG ++WKG L PLD DLR Y+IHY       ++T      S+  G   Y+R++
Sbjct  20   AKRWRDLSGQNHWKGXLQPLDQDLREYIIHYGEXAQAGYDTFNINTESQFAGASIYSRKD  79

Query  267  LLANTGLVKGNPF-KYEVTKY  326
              A  GL   +P+ KY+VTK+
Sbjct  80   FFAKVGLEIAHPYTKYKVTKF  100



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RWK LSG+  WK LLDPLD DLRRY++HY  M    +    +   SK +G   
Sbjct  1    MVGDIANRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTK+
Sbjct  61   YTKEELFARTGYLKANPFRYEVTKF  85



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RWK LSG  +WK LLDPLD DLR Y+IHY  M   +++   TQ  SKN G   Y + 
Sbjct  28   IAKRWKHLSGEHHWKDLLDPLDIDLRHYIIHYGEMAQAAYDAFNTQKASKNAGSSLYTKE  87

Query  264  NLLANTGLVKGNPFKYEVTKY  326
               +  GL  GNP+KY+VTK+
Sbjct  88   AFFSKVGLENGNPYKYQVTKF  108



>emb|CDY10774.1| BnaA05g11620D [Brassica napus]
Length=368

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RWK LSG+  WK LLDPLD DLRRY++HY  M+   + T      SK +G   
Sbjct  1    MVEDIAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGHMVEVGYITFNCGRLSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTK+
Sbjct  61   YTKEELFARTGYLKDNPFRYEVTKF  85



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +3

Query  87   AERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRN  266
            A RW+ L GS++W+GLLDPLD +LRR LI Y  MI  ++E  I +  S N G+ RY R +
Sbjct  8    AGRWRELHGSNHWEGLLDPLDVNLRRCLITYGEMIMATYEAFIGESRSPNAGMCRYRRAD  67

Query  267  LLANTGLVKGNPFKYEVTKY  326
            L     + +  P  YE T+Y
Sbjct  68   LFRRVDVSR--PGWYEATRY  85



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RWK LSG+  WK LLDPLD DLRRY++HY  M    +    +   SK +G   
Sbjct  10   MVGDIANRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSC  69

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTK+
Sbjct  70   YTKEELFARTGYLKANPFRYEVTKF  94



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AERW+ L GSD+W GLL+PLD DLRR LI+Y  MI  ++E  I +  S N G+ RY R 
Sbjct  210  MAERWRELHGSDHWDGLLNPLDIDLRRCLINYGEMIMATYEAFIAERRSPNAGMCRYRRA  269

Query  264  NLL  272
            +L 
Sbjct  270  DLF  272



>ref|XP_009144598.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=408

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RWK LSG+  WK LLDPLD DLRRY++HY  M+   + T      SK +G   
Sbjct  1    MVEDIAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGHMVEVGYITFNCGRLSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTK+
Sbjct  61   YTKEELFARTGYLKDNPFRYEVTKF  85



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            + G I +RWK LSG ++WK LLDPLD+DLRRY+IHY  M   +++    Q  SK  G   
Sbjct  18   LVGSIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDGFNAQKASKYAGSSL  77

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YA+ +      L KGNPFKY VTK+
Sbjct  78   YAKDDFFTKVHLEKGNPFKYRVTKF  102



>dbj|BAJ85084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = +3

Query  75   AGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRY  254
            AG +A RW+ L GSD+WKGLLDPLD DLRR +I Y  +   + +    +  S + GL  Y
Sbjct  27   AGNMASRWRELHGSDSWKGLLDPLDVDLRRSIIAYGELASAAHDGFNLEKRSPHAGLCLY  86

Query  255  ARRNLLANTGLVKGNPFKYEVTKY  326
            +R  LL+ + +   +P  Y+VTK+
Sbjct  87   SRDRLLSASTVT--HPEYYKVTKF  108



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A RW+ L GS +W GLLDPLD DLRR LI Y  MI  ++E  I +  S N G+ RY R 
Sbjct  1    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRA  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L     +   +P  Y  T+Y
Sbjct  61   DLFRRVDV--SHPGWYAATRY  79



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A RW+ L GS +W GLLDPLD DLRR LI Y  MI  ++E  I +  S N G+ RY R 
Sbjct  1    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRA  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L     +   +P  Y  T+Y
Sbjct  61   DLFRRVDV--SHPGWYAATRY  79



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 6/89 (7%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHY---AAMICPSFETLITQPFSKN-I  239
            +   IA+RW+ LSG  +W GLL+PLD DLRR +I+Y   A  I  +F    T   S N  
Sbjct  8    VTASIADRWRELSGEKSWNGLLNPLDIDLRRSIINYGDRATAIGNAFNK--TSLRSANCC  65

Query  240  GLPRYARRNLLANTGLVKGNPFKYEVTKY  326
            G  RYA R+  + TG+   NP+KY+VT +
Sbjct  66   GFSRYAPRDFFSKTGIQTRNPYKYQVTDF  94



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 6/89 (7%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHY---AAMICPSFETLITQPFSKN-I  239
            +   IA+RW+ LS   +WKGLL+PLD DLRR +I+Y   A  I  +F    T   S N  
Sbjct  8    VTASIADRWRELSSEKSWKGLLNPLDIDLRRSIINYGDRATAIGNAFNN--TSLRSTNCC  65

Query  240  GLPRYARRNLLANTGLVKGNPFKYEVTKY  326
            G  RYA R+  + TG+   NP+KY+VT +
Sbjct  66   GFSRYAPRDFFSKTGIQTRNPYKYQVTDF  94



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+RWK LSG+  WK LLDPLD DLRRY++HY  M    +    +   SK +G   
Sbjct  1    MVGDIAKRWKELSGTSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YE TK+
Sbjct  61   YTKEELFARTGYLKANPFRYEATKF  85



>emb|CDY24728.1| BnaC04g13330D [Brassica napus]
Length=408

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M   IA+RWK LSG+  WK LLDPLD DLRRY++HY  M+   + T      SK +G   
Sbjct  1    MVEDIAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGHMVEVGYITFNYGRRSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y +  L A TG +K NPF+YEVTK+
Sbjct  61   YTKEELFARTGYLKDNPFRYEVTKF  85



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETL-ITQPFSKN-IGL  245
            +   IA+RW+ LSG ++W GLL+PLD DLRR +I+Y      +      T   S N  G 
Sbjct  8    VTASIADRWRELSGEESWNGLLNPLDIDLRRSIINYGDRATANGNAFNKTSLRSANCCGF  67

Query  246  PRYARRNLLANTGLVKGNPFKYEVTKY  326
             RYA R+  + TG+   NP+KY+VT +
Sbjct  68   SRYAPRDFFSKTGIQTRNPYKYQVTDF  94



>ref|XP_001754450.1| predicted protein [Physcomitrella patens]
 gb|EDQ80900.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A+RW+ + G+ +WKG+LDP+DSDLR  LI Y       ++    + +SK  G  RY R 
Sbjct  14   LAQRWRDIQGATDWKGMLDPIDSDLRAELIRYGEFAQACYDGFDGEVYSKYRGSCRYKRE  73

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            + L N GL       YEVTKY
Sbjct  74   DFLNNAGLANSG---YEVTKY  91



>gb|EAZ12914.1| hypothetical protein OsJ_02837 [Oryza sativa Japonica Group]
Length=373

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A RW+ L GS +W GLLDPLD DLRR LI Y  MI  ++E  I +  S N G+ RY   
Sbjct  1    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHA  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L     +   +P  Y  T+Y
Sbjct  61   DLFRRVDV--SHPGWYAATRY  79



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A RW+ L GS +W GLLDPLD DLRR LI Y  MI  ++E  I +  S N G+ RY   
Sbjct  6    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHA  65

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L     +   +P  Y  T+Y
Sbjct  66   DLFRRVDV--SHPGWYAATRY  84



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A RW+ L GS +W GLLDPLD DLRR LI Y  MI  ++E  I +  S N G+ RY   
Sbjct  1    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHA  60

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L     +   +P  Y  T+Y
Sbjct  61   DLFRRVDV--SHPGWYAATRY  79



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            +A GIA+RW+ L G ++WKGL+DPLD DLR+ +I Y  +   +++   T+  S + G   
Sbjct  9    IAAGIAKRWRELHGDNSWKGLMDPLDLDLRKTIISYGELAEATYDGFNTERRSPHAGACI  68

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y   +LLA++G+       YEVT++
Sbjct  69   YGYSDLLASSGVAAAG--HYEVTRF  91



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +3

Query  93   RWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRNLL  272
            +W+A+ GSDNW+GLL+PLD+DLR  ++ Y  +   +++   + P SK  G  RY +++  
Sbjct  10   KWRAVQGSDNWEGLLEPLDNDLREAILLYGDLTQATYDAFNSDPHSKFCGSSRYGKKDFF  69

Query  273  ANTGLVKG-NPFKYEVTKY  326
                L  G + + YEVT++
Sbjct  70   QKVSLATGDDEWNYEVTRF  88



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A RW+ L G +NW+ LLDPLD DLR  +IHY  M   +++T I   +SK  G  R++
Sbjct  36   GFVANRWELLMGENNWEDLLDPLDKDLRELIIHYGEMAQAAYDTFIRDKYSKYAGSSRFS  95

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            + N  A  GL  G+P+KY VTK+
Sbjct  96   KNNFFAKLGLELGHPYKYRVTKF  118



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
             +AERW+ L G D+WKGLLDPLD+DLRR +I Y  +   + +  I + +S + G  RY+R
Sbjct  8    AVAERWRELHGEDHWKGLLDPLDADLRRSVIGYGELAQATNDAFIREAWSPHAGACRYSR  67

Query  261  RNLLANTGLVKGNPFKYEVTKY  326
               L            YEVT +
Sbjct  68   DRFLEKAQASTQLAGLYEVTAF  89



>gb|EEE55096.1| hypothetical protein OsJ_02844 [Oryza sativa Japonica Group]
Length=301

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +AERW+ L G D+WKGLLDPLD+DLRR +I Y  +   + +  I + +S + G  RY+R 
Sbjct  9    VAERWRELHGEDHWKGLLDPLDADLRRSVIGYGELAQATNDAFIREAWSPHAGACRYSRD  68

Query  264  NLL  272
              L
Sbjct  69   RFL  71



>ref|XP_008802654.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 45/83 (54%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A+RW+ + G D+W GLLDP+D  LR  LI Y       ++    QPFS+  G  RY 
Sbjct  95   GRLADRWREIHGRDDWTGLLDPMDPLLRSELIRYGEFAQACYDAFDYQPFSRYCGSCRYN  154

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            RR   A+ G+   +   YEV  Y
Sbjct  155  RRQFFASLGMDAAD---YEVAHY  174



>gb|KCW74056.1| hypothetical protein EUGRSUZ_E02682 [Eucalyptus grandis]
Length=387

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 43/86 (50%), Gaps = 12/86 (14%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M GG +  W  LSG  NWK +LDPLD DLR YLIHY             +      G+P 
Sbjct  1    MGGGSSRPWTELSGETNWKDMLDPLDEDLRMYLIHYGE-----------RESGAGYGMPL  49

Query  252  YARRNLLANTGL-VKGNPFKYEVTKY  326
            Y    L +  GL    N F+YEVT+Y
Sbjct  50   YPMDKLFSKVGLETDNNKFRYEVTRY  75



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA+R + L+G DN KGL DPLD DLRR ++ Y  M   +++  IT+  S+  G  R
Sbjct  1    MLGDIAKRLRELNGRDNRKGLSDPLDIDLRRNILLYGEMAQATYDAFITEKKSRYAGDCR  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            YARR+              Y VTK+
Sbjct  61   YARRDFFDKVATSTDQQSLYRVTKF  85



>ref|XP_006646158.1| PREDICTED: phospholipase A1-II 4-like [Oryza brachyantha]
Length=367

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ L G D+WKGLLDPLD DLRR +I Y  +   + +  I + +S + G  RY+R 
Sbjct  9    IAKRWRELHGEDHWKGLLDPLDVDLRRSIIGYGELAQATNDAFIRETWSPHAGACRYSRD  68

Query  264  NLLANTGLVKGNPFKYEVTKY  326
              L            YEVT +
Sbjct  69   RFLEKAEASDQVAGLYEVTAF  89



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            M G IA RWK LSG+  WK LLDPLD DLRRY++HY  M    +    +   SK +G   
Sbjct  1    MLGDIATRWKELSGAGKWKNLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRQSKYVGDSC  60

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            +  + L A +G ++ NPF+YEVTK+
Sbjct  61   FTMKELFAQSGYLRANPFRYEVTKF  85



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A RW+ L G ++WKGLLDPLD  LR  +I Y  M+  +++   T+  S + G   Y 
Sbjct  39   GTVASRWRELHGENSWKGLLDPLDPHLRSSIISYGEMVQAAYDAFNTERRSPHCGACFYG  98

Query  258  RRNLLANTGLV-KGNPFKYEVTKY  326
              +LLA  G+   GN   YEVTK+
Sbjct  99   YEDLLAGVGVPHHGN--NYEVTKF  120



>ref|XP_010938535.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=524

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A+RW+ + G D+W GLLDP+D  LR  LI Y       ++     PFS+  G  RY+
Sbjct  96   GRLADRWREIHGRDHWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCRYS  155

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            RR   A+ G+   +   Y+VT Y
Sbjct  156  RRKFFASLGM---DTAGYDVTHY  175



>ref|XP_002981063.1| hypothetical protein SELMODRAFT_113737 [Selaginella moellendorffii]
 gb|EFJ17764.1| hypothetical protein SELMODRAFT_113737 [Selaginella moellendorffii]
Length=418

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  81   GIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYAR  260
             +A +W+++ G D+W+G+L+PLD DL + LI YA  I   +++L   P SK  GLPRYA+
Sbjct  2    ALAAKWRSVQGQDHWEGMLEPLDKDLCQELIRYAQFIQVVYDSLNKNPVSKANGLPRYAK  61

Query  261  RNLL  272
              L 
Sbjct  62   SELF  65



>ref|XP_008783171.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=520

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A+RW+ + GSD+W GLLDP+D  LR  LI Y       ++     PFS+  G  +Y RR
Sbjct  95   LADRWREIHGSDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCKYNRR  154

Query  264  NLLANTGLVKGNPFKYEVTKY  326
               A+ G+       YE+T+Y
Sbjct  155  KFFASLGMDSSG---YEITRY  172



>gb|EMS63790.1| Phospholipase A1-II 7 [Triticum urartu]
Length=515

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A RW+ L G ++WKGLLDPLD  LR  +I Y  M+  +++   T+  S + G   Y 
Sbjct  39   GTVASRWRELHGENSWKGLLDPLDPHLRSSIISYGEMVQAAYDAFNTERRSPHCGACFYG  98

Query  258  RRNLLANTGLV-KGNPFKYEVTKY  326
              +LLA  G+   GN   YEVTK+
Sbjct  99   YEDLLAGVGVPHHGN--NYEVTKF  120



>ref|XP_011042425.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Populus euphratica]
Length=435

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A+ W+ + G D+W GLLDP+D  LR  LI Y  M    ++     PFSK  G  R+ RR
Sbjct  90   LADVWREIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFIRR  149

Query  264  NLLANTGLVKGNPFKYEVTKY  326
              L + G+       YEVT+Y
Sbjct  150  RFLESLGMAHHG---YEVTRY  167



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA+RWK L+G + WKGL+DPLD DLRR +I+Y  +   ++  L  +  S+  G   + 
Sbjct  8    GNIAKRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFN  67

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            RR+ L+   +   NP  YE+TK+
Sbjct  68   RRDFLSRVDV--SNPNLYEITKF  88



>ref|XP_006307284.1| hypothetical protein CARUB_v10008898mg [Capsella rubella]
 gb|EOA40182.1| hypothetical protein CARUB_v10008898mg [Capsella rubella]
Length=508

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            + + W+ + G DNW GLLDP+D  LR  LI Y  M    ++     PFS+  G  R+ RR
Sbjct  81   LRDTWRKIQGEDNWAGLLDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRR  140

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L  + G++      YEV +Y
Sbjct  141  HLFESLGIIDSG---YEVARY  158



>gb|KDP46901.1| hypothetical protein JCGZ_24110 [Jatropha curcas]
Length=403

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            + G IA+RW+ LSG +NWKGLLDPLD DLR  +++Y        +    + +    G  R
Sbjct  8    VIGNIADRWRELSGENNWKGLLDPLDFDLRSSILNYGDRAVAIGDAYNNKKYEDLHGFSR  67

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            +    L    G+   N F Y VT +
Sbjct  68   FPPNELFTKVGVRARNEFDYNVTDF  92



>ref|XP_002306818.1| hypothetical protein POPTR_0005s24000g [Populus trichocarpa]
 gb|EEE93814.1| hypothetical protein POPTR_0005s24000g [Populus trichocarpa]
Length=513

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A+ W+ + G D+W GLLDP+D  LR  LI Y  M    ++     PFSK  G  R+ RR
Sbjct  90   LADVWREIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFIRR  149

Query  264  NLLANTGLVKGNPFKYEVTKY  326
              L + G+       YEVT+Y
Sbjct  150  RFLESLGMAHHG---YEVTRY  167



>ref|XP_011042424.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Populus euphratica]
Length=513

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A+ W+ + G D+W GLLDP+D  LR  LI Y  M    ++     PFSK  G  R+ RR
Sbjct  90   LADVWREIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFIRR  149

Query  264  NLLANTGLVKGNPFKYEVTKY  326
              L + G+       YEVT+Y
Sbjct  150  RFLESLGMAHHG---YEVTRY  167



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A RW+ L+G + WKGLLDPLD DLRR +I+Y  +   ++  L  +  S+  G   + 
Sbjct  8    GNVARRWRELNGVNYWKGLLDPLDIDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFN  67

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            RR+ L+   +   NP  YE+TK+
Sbjct  68   RRDFLSRVDV--SNPDLYEITKF  88



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = +3

Query  72   MAGGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPR  251
            + G +A RW+ L G ++WKGLLDPLD  LR  +I Y  M+  +++   T+  S + G   
Sbjct  36   IVGTVASRWRELHGENSWKGLLDPLDLHLRATIISYGEMVQATYDGFNTERRSPHCGACF  95

Query  252  YARRNLLANTGLVKGNPFKYEVTKY  326
            Y   +LLA  G V  +   Y+VTK+
Sbjct  96   YGHDDLLAGVG-VPHHANNYQVTKF  119



>gb|ABR16123.1| unknown [Picea sitchensis]
Length=554

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 3/77 (4%)
 Frame = +3

Query  96   WKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRNLLA  275
            W+ + G++NW+GLLDP+D  LR+ +I Y       ++     PFSK  G  +Y RR L  
Sbjct  114  WREIQGANNWEGLLDPMDGILRKEIIRYGEFAQACYDGFDFDPFSKYCGSCKYHRRELFQ  173

Query  276  NTGLVKGNPFKYEVTKY  326
              G+   + + YEVTKY
Sbjct  174  GVGM---SDYGYEVTKY  187



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 42/78 (54%), Gaps = 1/78 (1%)
 Frame = +3

Query  96   WKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRNLLA  275
            W  LSG DNW GLLDPLD+DLRR +I Y  +   + +  I  P S   G  RYA    L 
Sbjct  36   WAELSGRDNWDGLLDPLDADLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLH  95

Query  276  NTGLVKG-NPFKYEVTKY  326
             T    G +P  Y VT++
Sbjct  96   RTQAPGGSDPDAYAVTRF  113



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A+RWK L+G + WKGL+DPLD DLRR +I+Y  +   ++  L  +  S+  G   + 
Sbjct  8    GNVAKRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQATYTGLNRERRSRYAGSCLFN  67

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            RR+ L+   +   NP  YE+TK+
Sbjct  68   RRDFLSRVDV--SNPNLYEITKF  88



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            IA+RW+ +SGS+ W GLLDPLD D+RR +I Y  +   + +  IT P S   G  RY+  
Sbjct  20   IAQRWREISGSNQWSGLLDPLDIDVRREVIRYGELAQATSDAFITDPASPYAGACRYSPA  79

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +      +   +P  Y VT++
Sbjct  80   SFF--NKVQASDPGAYRVTRF  98



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G +A RW+ L G ++W GLLDPLD  LR  +I Y  M+  +++   T+  S + G   YA
Sbjct  39   GTVASRWRELHGENSWDGLLDPLDPHLRSSIISYGEMVQAAYDGFNTERRSPHCGACFYA  98

Query  258  RRNLLANTGLV-KGNPFKYEVTKY  326
              +LLA  G+   GN   Y+VTK+
Sbjct  99   YEDLLAGVGVPHHGN--NYQVTKF  120



>gb|EMS50697.1| Phospholipase A1-II 1 [Triticum urartu]
Length=352

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA +W+ L G+ +W GLLDP+D DLR ++I Y      +++    +  S  +G   Y+
Sbjct  24   GSIASQWRELHGARSWHGLLDPIDDDLRAFVIAYGEHAAAAYDGFNAERPSPRVGSCLYS  83

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            R NLLA  G+    P  Y VTK+
Sbjct  84   RANLLAACGV--SCPAHYTVTKF  104



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA RW+ L+G++ WKGLLDPLD DLR+ +I+Y  +   ++  L  +  S+  G   + 
Sbjct  8    GNIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFR  67

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            R++ L+   +   NP  YE+TK+
Sbjct  68   RKDFLSRVDV--SNPNLYEITKF  88



>ref|XP_010486696.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=445

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            + + W+ + G DNW GL+DP+D  LR  LI Y  M    ++     PFS+  G  R+ RR
Sbjct  83   LKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRR  142

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L  + G++      YEV +Y
Sbjct  143  HLFESLGILDSG---YEVARY  160



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA RW+ L+G++ WKGLLDPLD DLR+ +I+Y  +   ++  L  +  S+  G   + 
Sbjct  8    GNIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFR  67

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            R++ L+   +   NP  YE+TK+
Sbjct  68   RKDFLSRVDV--SNPNLYEITKF  88



>ref|XP_010486704.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=442

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            + + W+ + G DNW GL+DP+D  LR  LI Y  M    ++     PFS+  G  R+ RR
Sbjct  83   LKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRR  142

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L  + G++      YEV +Y
Sbjct  143  HLFESLGILDSG---YEVARY  160



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = +3

Query  96   WKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARRNLLA  275
            W  LSG DNW GLLDPLD+DLRR +I Y  +   + +  I+ P S + G  RYA    L 
Sbjct  29   WAELSGRDNWDGLLDPLDADLRRVVIRYGELAQATSDAFISDPASPHAGASRYAPGAFLR  88

Query  276  NTGLVKGNPFKYEVTKY  326
                    P  Y VT++
Sbjct  89   RAQAGADVPDLYRVTRF  105



>ref|XP_010475428.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Camelina 
sativa]
Length=511

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            + + W+ + G DNW GL+DP+D  LR  LI Y  M    ++     PFS+  G  R+ RR
Sbjct  83   LKDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRR  142

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L  + G++      YEV +Y
Sbjct  143  HLFESLGILDSG---YEVARY  160



>ref|XP_010927018.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=523

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            +A+RW+ + GSD+W GLLDP+D  LR  LI Y       ++     PFS+  G  +Y RR
Sbjct  98   LADRWREIHGSDDWAGLLDPMDPLLRSELIRYGEFAQACYDGFDYDPFSRYCGSCKYNRR  157

Query  264  NLLANTGLVKGNPFKYEVTKY  326
                + G+       YE+T+Y
Sbjct  158  KFFGSLGMDNAG---YEITRY  175



>ref|XP_010457831.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic isoform X2 
[Camelina sativa]
Length=469

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            + + W+ + G DNW GL+DP+D  LR  LI Y  M    ++     PFS+  G  R+ RR
Sbjct  41   LRDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRR  100

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L  + G++      YEV +Y
Sbjct  101  HLFESLGILDSG---YEVARY  118



>ref|XP_010457830.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic isoform X1 
[Camelina sativa]
Length=469

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = +3

Query  84   IAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYARR  263
            + + W+ + G DNW GL+DP+D  LR  LI Y  M    ++     PFS+  G  R+ RR
Sbjct  41   LRDTWRKIQGEDNWAGLMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRR  100

Query  264  NLLANTGLVKGNPFKYEVTKY  326
            +L  + G++      YEV +Y
Sbjct  101  HLFESLGILDSG---YEVARY  118



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  78   GGIAERWKALSGSDNWKGLLDPLDSDLRRYLIHYAAMICPSFETLITQPFSKNIGLPRYA  257
            G IA RW+ L+G++ WKGLLDPLD DLR+ +I+Y  +   ++  L  +  S+  G   + 
Sbjct  8    GNIARRWRELNGANYWKGLLDPLDIDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFR  67

Query  258  RRNLLANTGLVKGNPFKYEVTKY  326
            R++ L+   +   NP  YE+TK+
Sbjct  68   RKDFLSRVDV--SNPNLYEITKF  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 535914171072