BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77826_g1_i1 len=1945 path=[1:0-1944]

Length=1945
                                                                      Score     E

ref|XP_006365539.1|  PREDICTED: auxilin-related protein 1-like          430   3e-140   
ref|XP_004242043.1|  PREDICTED: putative tyrosine-protein phospha...    429   5e-140   
ref|XP_009769841.1|  PREDICTED: auxilin-related protein 1               426   1e-138   
ref|XP_009625909.1|  PREDICTED: auxilin-like protein 1                  423   2e-137   
ref|XP_011074824.1|  PREDICTED: uncharacterized protein LOC105159449    345   4e-107   
ref|XP_003527949.1|  PREDICTED: auxilin-related protein 1               294   1e-87    
gb|KHN46994.1|  Auxilin-related protein 1                               294   2e-87    
ref|XP_010534755.1|  PREDICTED: auxilin-related protein 1-like          290   2e-85    
gb|KHG12723.1|  hypothetical protein F383_18435                         290   2e-85    
ref|XP_008219590.1|  PREDICTED: auxilin-related protein 1 isoform X2    287   2e-84    
emb|CDP10975.1|  unnamed protein product                                284   1e-83    
ref|XP_011027469.1|  PREDICTED: auxilin-related protein 2               283   3e-83    
ref|XP_003522570.1|  PREDICTED: auxilin-related protein 1-like is...    283   4e-83    
ref|XP_004149430.1|  PREDICTED: auxilin-related protein 2-like          283   5e-83    
ref|XP_007137461.1|  hypothetical protein PHAVU_009G128700g             282   6e-83    
ref|XP_006578959.1|  PREDICTED: auxilin-related protein 1-like is...    281   1e-82    
ref|XP_010539667.1|  PREDICTED: auxilin-related protein 1 isoform X1    281   2e-82    
gb|KDP32818.1|  hypothetical protein JCGZ_12110                         275   1e-79    
ref|XP_002300968.2|  hypothetical protein POPTR_0002s07940g             273   1e-79    Populus trichocarpa [western balsam poplar]
emb|CDY00396.1|  BnaC07g14300D                                          273   2e-79    
ref|XP_008219589.1|  PREDICTED: auxilin-related protein 2 isoform X1    275   2e-79    
ref|XP_007019170.1|  Chaperone DnaJ-domain superfamily protein, p...    273   3e-79    
emb|CDY04660.1|  BnaC05g16980D                                          269   2e-78    
ref|XP_004290908.1|  PREDICTED: auxilin-related protein 1-like          271   3e-78    
gb|KFK44269.1|  hypothetical protein AALP_AA1G236200                    268   8e-78    
ref|XP_010095436.1|  hypothetical protein L484_013393                   267   5e-77    
ref|XP_009149684.1|  PREDICTED: auxilin-related protein 2 isoform X2    264   1e-76    
ref|XP_009149683.1|  PREDICTED: auxilin-related protein 1 isoform X1    261   2e-75    
ref|XP_004502523.1|  PREDICTED: auxilin-related protein 2-like is...    263   2e-75    
emb|CBI21587.3|  unnamed protein product                                249   2e-74    
ref|XP_006416279.1|  hypothetical protein EUTSA_v10007304mg             259   3e-74    
ref|XP_011089568.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-rela...    261   6e-73    
ref|XP_002890450.1|  heat shock protein binding protein                 255   7e-73    
ref|XP_010270274.1|  PREDICTED: auxilin-related protein 2-like          263   1e-72    
ref|XP_008466755.1|  PREDICTED: auxilin-related protein 2 isoform X2    251   2e-72    
emb|CDY01318.1|  BnaA07g10910D                                          254   2e-72    
gb|KEH35332.1|  DnaJ domain protein                                     254   2e-72    
gb|EPS68726.1|  hypothetical protein M569_06042                         241   4e-72    
gb|EYU36870.1|  hypothetical protein MIMGU_mgv1a001096mg                260   7e-72    
ref|XP_002307457.2|  hypothetical protein POPTR_0005s20410g             253   7e-72    Populus trichocarpa [western balsam poplar]
ref|XP_008466754.1|  PREDICTED: auxilin-related protein 2 isoform X1    249   1e-71    
ref|XP_009103287.1|  PREDICTED: auxilin-related protein 2-like          251   2e-71    
ref|NP_173585.1|  Chaperone DnaJ-domain superfamily protein             251   4e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010269037.1|  PREDICTED: auxilin-related protein 2               259   6e-71    
ref|XP_010914449.1|  PREDICTED: auxilin-related protein 2-like is...    255   5e-70    
emb|CDY08188.1|  BnaA06g15380D                                          246   6e-70    
ref|XP_003602665.1|  Auxilin-like protein                               252   7e-70    
ref|XP_004502522.1|  PREDICTED: auxilin-related protein 2-like is...    248   1e-69    
ref|XP_002275766.1|  PREDICTED: auxilin-related protein 2-like          254   2e-69    Vitis vinifera
ref|XP_004503905.1|  PREDICTED: auxilin-related protein 2-like          253   2e-69    
gb|KEH35623.1|  DnaJ domain protein                                     249   3e-69    
emb|CBI18977.3|  unnamed protein product                                239   4e-69    
gb|KEH20914.1|  auxilin-like protein                                    253   4e-69    
gb|EYU32507.1|  hypothetical protein MIMGU_mgv1a020422mg                233   5e-69    
ref|XP_008338677.1|  PREDICTED: auxilin-related protein 2 isoform X2    245   1e-68    
ref|XP_007159871.1|  hypothetical protein PHAVU_002G274800g             250   2e-68    
ref|XP_008800820.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-rela...    251   2e-68    
ref|XP_008338676.1|  PREDICTED: auxilin-related protein 2 isoform X1    244   3e-68    
ref|XP_010664177.1|  PREDICTED: auxilin-related protein 2               243   4e-68    
ref|XP_010931651.1|  PREDICTED: auxilin-related protein 2-like is...    250   4e-68    
ref|XP_010477407.1|  PREDICTED: auxilin-related protein 2-like          243   5e-68    
ref|XP_011013120.1|  PREDICTED: auxilin-related protein 1-like is...    250   6e-68    
ref|XP_011008205.1|  PREDICTED: auxilin-related protein 1-like          250   7e-68    
ref|XP_006664621.1|  PREDICTED: auxilin-related protein 1-like          248   8e-68    
ref|XP_008361516.1|  PREDICTED: auxilin-related protein 2-like is...    242   2e-67    
gb|EYU23866.1|  hypothetical protein MIMGU_mgv1a015354mg                229   2e-67    
ref|XP_006375591.1|  hypothetical protein POPTR_0014s17160g             248   2e-67    
ref|XP_008361515.1|  PREDICTED: auxilin-related protein 2-like is...    241   3e-67    
ref|XP_008807324.1|  PREDICTED: auxilin-related protein 2-like          247   4e-67    
ref|XP_011007017.1|  PREDICTED: auxilin-related protein 2-like is...    247   4e-67    
ref|XP_011007014.1|  PREDICTED: auxilin-related protein 2-like is...    247   4e-67    
ref|XP_011007015.1|  PREDICTED: auxilin-related protein 2-like is...    247   4e-67    
gb|EYU46089.1|  hypothetical protein MIMGU_mgv1a000900mg                247   5e-67    
ref|XP_010459888.1|  PREDICTED: auxilin-related protein 2-like          240   5e-67    
ref|XP_003630317.1|  Auxilin-like protein                               247   6e-67    
ref|XP_011007016.1|  PREDICTED: auxilin-related protein 2-like is...    247   7e-67    
ref|XP_010498622.1|  PREDICTED: auxilin-related protein 2-like          239   1e-66    
ref|XP_010524634.1|  PREDICTED: auxilin-related protein 2-like          246   1e-66    
ref|XP_007137764.1|  hypothetical protein PHAVU_009G153800g             245   2e-66    
ref|XP_011002448.1|  PREDICTED: auxilin-related protein 2-like          238   4e-66    
ref|XP_004968715.1|  PREDICTED: auxilin-related protein 1-like          243   9e-66    
gb|KCW62475.1|  hypothetical protein EUGRSUZ_H05116                     243   1e-65    
ref|XP_010025742.1|  PREDICTED: auxilin-related protein 2-like is...    243   1e-65    
ref|XP_010674406.1|  PREDICTED: auxilin-related protein 2-like          243   1e-65    
ref|XP_011012111.1|  PREDICTED: auxilin-related protein 2-like          236   2e-65    
ref|XP_010025743.1|  PREDICTED: auxilin-related protein 2-like is...    243   2e-65    
ref|XP_009418913.1|  PREDICTED: auxilin-related protein 1-like          241   4e-65    
ref|NP_001042996.1|  Os01g0355500                                       241   4e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674031.1|  PREDICTED: auxilin-related protein 1-like is...    241   4e-65    
ref|XP_006644158.1|  PREDICTED: auxilin-related protein 1-like          239   2e-64    
ref|XP_002457810.1|  hypothetical protein SORBIDRAFT_03g013900          239   2e-64    Sorghum bicolor [broomcorn]
ref|XP_006307189.1|  hypothetical protein CARUB_v10008781mg             232   4e-64    
ref|XP_006828838.1|  hypothetical protein AMTR_s00001p00148480          234   8e-63    
ref|XP_006344354.1|  PREDICTED: auxilin-related protein 1-like          234   2e-62    
ref|XP_008662610.1|  PREDICTED: auxilin-related protein 1-like          233   4e-62    
ref|XP_002443330.1|  hypothetical protein SORBIDRAFT_08g017590          233   4e-62    Sorghum bicolor [broomcorn]
gb|AGT16729.1|  auxilin-related protein                                 233   4e-62    
gb|KHF99207.1|  hypothetical protein F383_08933                         233   4e-62    
ref|XP_006386806.1|  hypothetical protein POPTR_0002s22300g             232   6e-62    
ref|XP_011080586.1|  PREDICTED: auxilin-related protein 2-like          232   8e-62    
ref|XP_004962813.1|  PREDICTED: auxilin-related protein 1-like          231   9e-62    
ref|XP_009393210.1|  PREDICTED: auxilin-related protein 2-like          231   1e-61    
emb|CDP04001.1|  unnamed protein product                                231   2e-61    
ref|XP_002524574.1|  auxilin, putative                                  231   2e-61    Ricinus communis
ref|XP_009799251.1|  PREDICTED: auxilin-related protein 2-like          231   2e-61    
ref|XP_008674361.1|  PREDICTED: auxilin-related protein 1-like          230   2e-61    
gb|KDP45177.1|  hypothetical protein JCGZ_15042                         230   3e-61    
ref|XP_002449945.1|  hypothetical protein SORBIDRAFT_05g026150          230   3e-61    Sorghum bicolor [broomcorn]
ref|XP_009373905.1|  PREDICTED: auxilin-related protein 2-like is...    225   3e-61    
ref|XP_009373906.1|  PREDICTED: auxilin-related protein 2-like is...    225   3e-61    
ref|XP_004246243.1|  PREDICTED: auxilin-related protein 2               230   4e-61    
ref|XP_002968053.1|  hypothetical protein SELMODRAFT_451301             228   5e-61    
ref|XP_002992586.1|  hypothetical protein SELMODRAFT_451303             228   5e-61    
gb|EPS64905.1|  hypothetical protein M569_09873                         229   6e-61    
ref|XP_007049495.1|  Chaperone DnaJ-domain superfamily protein, p...    229   7e-61    
ref|XP_006580346.1|  PREDICTED: auxilin-related protein 2-like is...    228   1e-60    
ref|XP_009587427.1|  PREDICTED: auxilin-related protein 2-like          228   1e-60    
ref|XP_009800690.1|  PREDICTED: auxilin-related protein 2-like          228   1e-60    
gb|KHN16939.1|  Auxilin-related protein 2                               227   2e-60    
ref|XP_009600153.1|  PREDICTED: auxilin-related protein 2-like          228   2e-60    
gb|AAL91223.1|  auxilin-like protein                                    220   2e-60    Arabidopsis thaliana [mouse-ear cress]
gb|KFK35296.1|  hypothetical protein AALP_AA5G266200                    220   5e-60    
ref|XP_006366804.1|  PREDICTED: auxilin-related protein 1-like          226   7e-60    
ref|XP_004242447.1|  PREDICTED: auxilin-related protein 2-like          226   8e-60    
ref|NP_193014.5|  auxilin-related protein 1                             226   8e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283093.1|  hypothetical protein CARUB_v10004108mg             225   9e-60    
ref|XP_010450239.1|  PREDICTED: auxilin-related protein 2 isoform X1    226   9e-60    
gb|EMS56462.1|  Auxilin-related protein 2                               223   9e-60    
ref|XP_010435356.1|  PREDICTED: auxilin-related protein 2-like is...    225   1e-59    
ref|XP_010451586.1|  PREDICTED: auxilin-related protein 1-like          224   1e-59    
gb|KHG12625.1|  hypothetical protein F383_17312                         223   1e-59    
ref|XP_003526879.1|  PREDICTED: auxilin-related protein 2-like          225   2e-59    
ref|XP_010440618.1|  PREDICTED: auxilin-related protein 2-like is...    225   2e-59    
ref|XP_010450240.1|  PREDICTED: auxilin-related protein 2 isoform X2    225   2e-59    
ref|XP_010542046.1|  PREDICTED: auxilin-related protein 2-like          225   2e-59    
ref|XP_008442142.1|  PREDICTED: auxilin-related protein 2-like          225   2e-59    
ref|XP_010440619.1|  PREDICTED: auxilin-related protein 2-like is...    224   2e-59    
dbj|BAJ93380.1|  predicted protein                                      221   2e-59    
ref|NP_193013.2|  auxilin-related protein 2                             224   2e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435339.1|  PREDICTED: auxilin-related protein 2-like is...    224   2e-59    
ref|XP_002863292.1|  hypothetical protein ARALYDRAFT_497125             224   2e-59    
ref|XP_010435338.1|  PREDICTED: auxilin-related protein 2-like is...    224   2e-59    
gb|ACG29251.1|  hypothetical protein                                    220   2e-59    Zea mays [maize]
ref|NP_001190708.1|  auxilin-related protein 2                          224   2e-59    
ref|XP_006286120.1|  hypothetical protein CARUB_v10007669mg             224   2e-59    
ref|XP_010435357.1|  PREDICTED: auxilin-related protein 2-like is...    224   3e-59    
gb|KHG03751.1|  hypothetical protein F383_26895                         224   3e-59    
gb|KGN54785.1|  hypothetical protein Csa_4G496260                       224   4e-59    
ref|XP_004146411.1|  PREDICTED: auxilin-related protein 1-like          224   4e-59    
ref|XP_006584657.1|  PREDICTED: auxilin-related protein 2-like is...    224   4e-59    
ref|XP_006415007.1|  hypothetical protein EUTSA_v10024361mg             223   6e-59    
gb|KFK35298.1|  hypothetical protein AALP_AA5G266400                    221   7e-59    
ref|XP_010532937.1|  PREDICTED: auxilin-related protein 2-like          222   1e-58    
ref|XP_009383742.1|  PREDICTED: auxilin-related protein 2-like          222   1e-58    
ref|XP_009364182.1|  PREDICTED: auxilin-related protein 2-like          223   1e-58    
gb|ACN33245.1|  unknown                                                 222   1e-58    Zea mays [maize]
ref|NP_001146349.1|  uncharacterized protein LOC100279927               222   1e-58    Zea mays [maize]
ref|XP_006447895.1|  hypothetical protein CICLE_v10014131mg             223   2e-58    
ref|XP_006469380.1|  PREDICTED: auxilin-related protein 2-like          222   2e-58    
gb|KDO51042.1|  hypothetical protein CISIN_1g002109mg                   222   2e-58    
ref|XP_006578776.1|  PREDICTED: auxilin-related protein 2-like is...    222   2e-58    
ref|NP_001066970.1|  Os12g0548200                                       222   2e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008365846.1|  PREDICTED: auxilin-related protein 1-like          222   2e-58    
gb|EEC69454.1|  hypothetical protein OsI_38641                          222   2e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_010027574.1|  PREDICTED: auxilin-related protein 2-like          221   2e-58    
dbj|BAJ97040.1|  predicted protein                                      221   2e-58    
ref|XP_004165963.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-rela...    222   2e-58    
ref|XP_009355852.1|  PREDICTED: auxilin-related protein 2-like          221   3e-58    
ref|XP_008394184.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-rela...    221   3e-58    
ref|XP_003575620.1|  PREDICTED: auxilin-related protein 2-like          221   4e-58    
ref|XP_004288492.1|  PREDICTED: auxilin-related protein 2-like          220   5e-58    
ref|XP_009108483.1|  PREDICTED: auxilin-related protein 2-like is...    220   6e-58    
ref|XP_010093098.1|  hypothetical protein L484_007907                   220   6e-58    
emb|CDX76445.1|  BnaA08g09550D                                          219   7e-58    
gb|EEC68581.1|  hypothetical protein OsI_36921                          220   7e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_006663095.1|  PREDICTED: auxilin-related protein 2-like          220   7e-58    
emb|CDY31429.1|  BnaC03g63950D                                          219   7e-58    
ref|XP_009108484.1|  PREDICTED: auxilin-related protein 2-like is...    219   8e-58    
gb|ABA95242.1|  expressed protein                                       219   9e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979900.1|  PREDICTED: auxilin-related protein 2-like          219   1e-57    
ref|XP_006578777.1|  PREDICTED: auxilin-related protein 2-like is...    219   1e-57    
ref|XP_007213691.1|  hypothetical protein PRUPE_ppa000822mg             219   1e-57    
ref|XP_010440616.1|  PREDICTED: auxilin-related protein 2-like is...    219   1e-57    
ref|XP_008227521.1|  PREDICTED: auxilin-related protein 1-like          219   2e-57    
ref|XP_003577264.1|  PREDICTED: auxilin-related protein 1-like          217   5e-57    
ref|XP_010055974.1|  PREDICTED: auxilin-related protein 2 isoform X2    211   4e-56    
ref|NP_001190709.1|  auxilin-related protein 1                          214   5e-56    
ref|XP_010055973.1|  PREDICTED: auxilin-related protein 2 isoform X1    212   5e-56    
ref|XP_002863218.1|  hypothetical protein ARALYDRAFT_333056             213   1e-55    
ref|XP_006878529.1|  hypothetical protein AMTR_s00011p00222440          213   2e-55    
ref|XP_002321224.1|  auxilin-related family protein                     212   4e-55    Populus trichocarpa [western balsam poplar]
gb|KHN11110.1|  Auxilin-related protein 1                               206   5e-55    
ref|XP_002992806.1|  hypothetical protein SELMODRAFT_448911             211   7e-55    
emb|CAB40994.1|  auxilin-like protein                                   210   1e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383175.1|  trichohyalin-related family protein                211   8e-54    
gb|EMT09705.1|  UBA domain-containing protein 7                         207   9e-54    
gb|KHN36088.1|  Auxilin-related protein 2                               207   1e-53    
ref|XP_007156969.1|  hypothetical protein PHAVU_002G032500g             209   2e-53    
ref|XP_010471928.1|  PREDICTED: auxilin-related protein 2-like          199   2e-53    
emb|CDP01994.1|  unnamed protein product                                209   3e-53    
gb|KCW54137.1|  hypothetical protein EUGRSUZ_I00114                     203   4e-53    
ref|XP_002987499.1|  hypothetical protein SELMODRAFT_447002             206   5e-53    
gb|KDO70977.1|  hypothetical protein CISIN_1g003023mg                   205   5e-53    
gb|KDO70975.1|  hypothetical protein CISIN_1g003023mg                   205   5e-53    
gb|KDO70976.1|  hypothetical protein CISIN_1g003023mg                   205   5e-53    
gb|KHN41951.1|  Auxilin-related protein 2                               208   5e-53    
ref|XP_003537600.2|  PREDICTED: auxilin-like protein 1-like             208   5e-53    
gb|KCW60593.1|  hypothetical protein EUGRSUZ_H03319                     207   1e-52    
ref|XP_011074560.1|  PREDICTED: auxilin-like protein 1                  207   1e-52    
gb|KDO51043.1|  hypothetical protein CISIN_1g002109mg                   205   1e-52    
ref|XP_006472829.1|  PREDICTED: auxilin-related protein 1-like is...    201   1e-52    
ref|XP_006573573.1|  PREDICTED: auxilin-like protein 1-like isofo...    207   1e-52    
ref|XP_006415005.1|  hypothetical protein EUTSA_v10024354mg             204   1e-52    
ref|XP_011015131.1|  PREDICTED: auxilin-like protein 1 isoform X3       207   1e-52    
ref|XP_011011933.1|  PREDICTED: auxilin-like protein 1 isoform X1       207   1e-52    
ref|XP_002981984.1|  hypothetical protein SELMODRAFT_445035             206   1e-52    
ref|XP_010024161.1|  PREDICTED: trichohyalin                            207   2e-52    
ref|XP_007017583.1|  Auxin-like 1 protein                               206   2e-52    
ref|XP_011011937.1|  PREDICTED: auxilin-like protein 1 isoform X3       207   2e-52    
ref|XP_011011935.1|  PREDICTED: auxilin-like protein 1 isoform X2       207   2e-52    
ref|XP_011015129.1|  PREDICTED: auxilin-like protein 1 isoform X1       207   2e-52    
ref|XP_006472830.1|  PREDICTED: auxilin-related protein 1-like is...    200   2e-52    
ref|XP_011015130.1|  PREDICTED: auxilin-like protein 1 isoform X2       207   2e-52    
ref|XP_006434263.1|  hypothetical protein CICLE_v10000812mg             200   2e-52    
ref|XP_006434262.1|  hypothetical protein CICLE_v10000812mg             200   2e-52    
ref|XP_011015132.1|  PREDICTED: auxilin-like protein 1 isoform X4       206   2e-52    
ref|XP_003519893.2|  PREDICTED: auxilin-like protein 1-like             206   2e-52    
ref|XP_006340644.1|  PREDICTED: auxilin-like protein 1-like             206   2e-52    
ref|XP_010316381.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-like...    206   3e-52    
ref|XP_002994190.1|  hypothetical protein SELMODRAFT_432122             205   3e-52    
ref|XP_010649121.1|  PREDICTED: auxilin-like protein 1 isoform X2       206   3e-52    
ref|XP_002266275.1|  PREDICTED: auxilin-like protein 1 isoform X1       206   3e-52    Vitis vinifera
ref|XP_003547978.2|  PREDICTED: auxilin-like protein 1-like             206   3e-52    
ref|XP_004143520.1|  PREDICTED: uncharacterized protein LOC101221934    205   4e-52    
ref|XP_010428815.1|  PREDICTED: uncharacterized protein LOC104713...    194   4e-52    
ref|XP_010649122.1|  PREDICTED: auxilin-like protein 1 isoform X3       206   4e-52    
ref|XP_006472831.1|  PREDICTED: auxilin-related protein 1-like is...    199   4e-52    
ref|XP_008440740.1|  PREDICTED: auxilin-like protein 1 isoform X2       205   4e-52    
ref|XP_008440739.1|  PREDICTED: auxilin-like protein 1 isoform X1       205   4e-52    
ref|XP_006472832.1|  PREDICTED: auxilin-related protein 1-like is...    199   4e-52    
ref|XP_004168397.1|  PREDICTED: uncharacterized LOC101221934            205   4e-52    
ref|XP_007156064.1|  hypothetical protein PHAVU_003G255200g             205   5e-52    
ref|XP_006466828.1|  PREDICTED: auxilin-like protein 1-like isofo...    205   5e-52    
ref|XP_009410973.1|  PREDICTED: auxilin-like protein 1 isoform X2       205   5e-52    
ref|XP_007156063.1|  hypothetical protein PHAVU_003G255200g             205   5e-52    
ref|XP_008440741.1|  PREDICTED: auxilin-like protein 1 isoform X3       205   5e-52    
ref|XP_008440742.1|  PREDICTED: auxilin-like protein 1 isoform X4       205   5e-52    
gb|KGN48846.1|  hypothetical protein Csa_6G502820                       205   5e-52    
ref|XP_006466827.1|  PREDICTED: auxilin-like protein 1-like isofo...    205   5e-52    
ref|XP_006425641.1|  hypothetical protein CICLE_v10024708mg             205   5e-52    
ref|XP_008338072.1|  PREDICTED: auxilin-like protein 1                  205   5e-52    
gb|KHG23303.1|  hypothetical protein F383_08440                         205   5e-52    
emb|CAN79639.1|  hypothetical protein VITISV_014476                     193   6e-52    Vitis vinifera
ref|XP_009410971.1|  PREDICTED: auxilin-like protein 1 isoform X1       204   7e-52    
ref|XP_009620462.1|  PREDICTED: auxilin-like protein 1                  204   8e-52    
gb|KCW67872.1|  hypothetical protein EUGRSUZ_F01588                     197   1e-51    
ref|XP_009371626.1|  PREDICTED: auxilin-like protein 1                  204   1e-51    
ref|XP_009347600.1|  PREDICTED: auxilin-like protein 1                  204   1e-51    
ref|XP_010682626.1|  PREDICTED: auxilin-related protein 1-like is...    204   1e-51    
ref|XP_002310250.2|  hypothetical protein POPTR_0007s13120g             204   1e-51    Populus trichocarpa [western balsam poplar]
ref|XP_010682627.1|  PREDICTED: auxilin-like protein 1 isoform X2       203   1e-51    
gb|KHN44933.1|  Auxilin-related protein 1                               191   1e-51    
ref|XP_008675312.1|  PREDICTED: myosin-2 heavy chain-like isoform X2    203   2e-51    
ref|XP_011025827.1|  PREDICTED: auxilin-like protein 1 isoform X1       203   2e-51    
ref|XP_008800707.1|  PREDICTED: trichohyalin-like                       203   2e-51    
ref|XP_011025828.1|  PREDICTED: auxilin-like protein 1 isoform X2       203   2e-51    
ref|XP_011100975.1|  PREDICTED: auxilin-like protein 1                  202   3e-51    
gb|EEE53373.1|  hypothetical protein OsJ_36414                          203   3e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004154847.1|  PREDICTED: uncharacterized LOC101221326            203   3e-51    
gb|KHG04409.1|  hypothetical protein F383_28478                         202   3e-51    
gb|ADE76679.1|  unknown                                                 183   3e-51    
ref|XP_010924289.1|  PREDICTED: auxilin-like protein 1 isoform X2       202   3e-51    
ref|XP_008466543.1|  PREDICTED: auxilin-like protein 1                  202   3e-51    
gb|KDP43186.1|  hypothetical protein JCGZ_22738                         202   3e-51    
ref|XP_004147855.1|  PREDICTED: uncharacterized protein LOC101221326    202   4e-51    
ref|XP_002458205.1|  hypothetical protein SORBIDRAFT_03g028900          202   4e-51    Sorghum bicolor [broomcorn]
ref|XP_007046879.1|  Chaperone DnaJ-domain superfamily protein, p...    202   5e-51    
ref|XP_010230973.1|  PREDICTED: auxilin-like protein 1                  202   6e-51    
ref|XP_009759958.1|  PREDICTED: auxilin-like protein 1                  202   7e-51    
ref|XP_003516401.2|  PREDICTED: auxilin-like protein 1-like             193   8e-51    
ref|XP_008675311.1|  PREDICTED: myosin-2 heavy chain-like isoform X1    201   8e-51    
ref|XP_009402553.1|  PREDICTED: auxilin-like protein 1 isoform X1       201   9e-51    
gb|EMS53814.1|  Auxilin-related protein 2                               201   1e-50    
ref|XP_009402578.1|  PREDICTED: trichohyalin-like isoform X4            200   1e-50    
ref|XP_004509282.1|  PREDICTED: LOW QUALITY PROTEIN: axoneme-asso...    201   1e-50    
ref|XP_009392412.1|  PREDICTED: auxilin-like protein 1 isoform X2       200   3e-50    
ref|XP_009392411.1|  PREDICTED: auxilin-like protein 1 isoform X1       200   3e-50    
gb|EEC79751.1|  hypothetical protein OsI_21128                          195   3e-50    
ref|NP_001056423.1|  Os05g0579900                                       196   3e-50    
ref|XP_008650060.1|  PREDICTED: uncharacterized protein LOC103630...    199   5e-50    
ref|XP_009759091.1|  PREDICTED: auxilin-like protein 1                  199   5e-50    
ref|XP_004961113.1|  PREDICTED: dentin sialophosphoprotein-like i...    199   5e-50    
gb|EYU32773.1|  hypothetical protein MIMGU_mgv1a001943mg                196   5e-50    
ref|XP_004961112.1|  PREDICTED: dentin sialophosphoprotein-like i...    199   5e-50    
gb|AFW79311.1|  hypothetical protein ZEAMMB73_299591                    199   5e-50    
gb|KFK30274.1|  hypothetical protein AALP_AA7G240000                    195   5e-50    
ref|XP_010926074.1|  PREDICTED: auxilin-related protein 2-like          199   6e-50    
ref|XP_010060969.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-like...    199   8e-50    
emb|CDP07491.1|  unnamed protein product                                198   9e-50    
ref|XP_006646132.1|  PREDICTED: putative protein tag-278-like           198   1e-49    
ref|XP_009614947.1|  PREDICTED: auxilin-like protein 1                  198   1e-49    
ref|NP_001043659.2|  Os01g0634300                                       198   1e-49    
ref|XP_006341961.1|  PREDICTED: auxilin-like protein 1-like             198   2e-49    
ref|NP_195370.5|  chaperone DnaJ-domain containing protein              197   2e-49    
ref|XP_010924288.1|  PREDICTED: auxilin-like protein 1 isoform X1       197   2e-49    
gb|AAD39596.1|AC007858_10  10A19I.11                                    197   2e-49    
ref|XP_002440311.1|  hypothetical protein SORBIDRAFT_09g029580          197   2e-49    
ref|XP_010924291.1|  PREDICTED: auxilin-like protein 1 isoform X3       197   2e-49    
ref|XP_011083660.1|  PREDICTED: auxilin-like protein 1                  197   2e-49    
ref|XP_010254781.1|  PREDICTED: auxilin-like protein 1                  197   3e-49    
ref|XP_004969262.1|  PREDICTED: uncharacterized protein LOC101770...    197   3e-49    
ref|XP_004969261.1|  PREDICTED: uncharacterized protein LOC101770...    197   3e-49    
gb|EEE64816.1|  hypothetical protein OsJ_19672                          197   3e-49    
ref|XP_008366724.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-rela...    178   3e-49    
ref|XP_008797531.1|  PREDICTED: LOW QUALITY PROTEIN: auxilin-like...    196   3e-49    
ref|XP_010906335.1|  PREDICTED: auxilin-like protein 1                  196   4e-49    
ref|XP_006654840.1|  PREDICTED: auxilin-like protein 1-like             196   4e-49    
ref|XP_010437341.1|  PREDICTED: auxilin-like protein 1                  196   5e-49    
emb|CDX87523.1|  BnaA07g33500D                                          184   6e-49    
ref|XP_010548861.1|  PREDICTED: auxilin-like protein 1                  196   6e-49    
ref|XP_004287878.1|  PREDICTED: uncharacterized protein LOC101295164    196   6e-49    
dbj|BAH56783.1|  AT1G21660                                              177   7e-49    
ref|XP_002281287.2|  PREDICTED: auxilin-like protein 1                  195   1e-48    
ref|XP_010446784.1|  PREDICTED: trichohyalin-like                       195   1e-48    
ref|XP_010432170.1|  PREDICTED: auxilin-like protein 1                  195   1e-48    
ref|XP_006283005.1|  hypothetical protein CARUB_v10003992mg             195   1e-48    
ref|XP_006283004.1|  hypothetical protein CARUB_v10003992mg             194   2e-48    
ref|XP_010232064.1|  PREDICTED: uncharacterized protein LOC100831...    194   2e-48    
ref|XP_010232063.1|  PREDICTED: uncharacterized protein LOC100831...    194   2e-48    
ref|XP_010320397.1|  PREDICTED: auxilin-like protein 1                  194   2e-48    
gb|KDO70978.1|  hypothetical protein CISIN_1g003023mg                   191   2e-48    
ref|XP_006411994.1|  hypothetical protein EUTSA_v10024218mg             194   3e-48    
ref|XP_002521556.1|  auxilin, putative                                  194   3e-48    
gb|KDP38530.1|  hypothetical protein JCGZ_04455                         193   4e-48    
ref|XP_007226264.1|  hypothetical protein PRUPE_ppa018551mg             193   4e-48    
ref|XP_008784924.1|  PREDICTED: auxilin-like protein 1 isoform X1       193   5e-48    
gb|AGT17351.1|  hypothetical protein SHCRBa_078_K12_F_230               193   5e-48    
ref|XP_010102067.1|  Auxilin-related protein 2                          193   6e-48    
gb|AGV54163.1|  auxilin-like protein                                    184   6e-48    
ref|XP_009144043.1|  PREDICTED: trichohyalin                            192   7e-48    
emb|CDX75581.1|  BnaA01g01210D                                          192   7e-48    
emb|CDX69230.1|  BnaC01g02230D                                          192   8e-48    
gb|EYU24094.1|  hypothetical protein MIMGU_mgv1a000502mg                191   9e-48    
gb|EMT32757.1|  UBA domain-containing protein 7                         192   1e-47    
emb|CAA07520.1|  auxilin-like protein                                   184   1e-47    
ref|XP_006290550.1|  hypothetical protein CARUB_v10016633mg             191   1e-47    
ref|XP_003520123.2|  PREDICTED: auxilin-like protein 1-like             192   1e-47    
gb|EEC71146.1|  hypothetical protein OsI_02974                          180   1e-47    
ref|XP_011007458.1|  PREDICTED: auxilin-like protein 1 isoform X4       192   1e-47    
ref|XP_008784925.1|  PREDICTED: auxilin-like protein 1 isoform X2       191   1e-47    
ref|XP_011007456.1|  PREDICTED: auxilin-like protein 1 isoform X2       192   1e-47    
ref|XP_011007455.1|  PREDICTED: auxilin-like protein 1 isoform X1       191   2e-47    
gb|EPS69786.1|  hypothetical protein M569_04977                         179   2e-47    
ref|XP_010428813.1|  PREDICTED: uncharacterized protein LOC104713...    181   4e-47    
gb|EYU45185.1|  hypothetical protein MIMGU_mgv1a0003261mg               189   7e-47    
ref|XP_010526765.1|  PREDICTED: auxilin-like protein 1                  188   1e-46    
ref|XP_002887586.1|  hypothetical protein ARALYDRAFT_316462             189   1e-46    
ref|XP_010677552.1|  PREDICTED: auxilin-related protein 1               182   1e-46    
ref|XP_010536345.1|  PREDICTED: auxilin-like protein 1                  188   2e-46    
gb|KEH20423.1|  chaperone DnaJ-domain protein, putative                 188   2e-46    
ref|NP_177666.1|  auxin-like 1 protein                                  187   3e-46    
sp|Q9FWS1.2|AUL1_ARATH  RecName: Full=Auxilin-like protein 1            187   3e-46    
ref|XP_002510415.1|  auxilin, putative                                  187   4e-46    
gb|AAG13076.1|AC023754_14  Unknown protein - partial protein            187   4e-46    
ref|XP_002306880.2|  hypothetical protein POPTR_0005s25090g             187   4e-46    
ref|XP_006301070.1|  hypothetical protein CARUB_v10021463mg             168   8e-46    
ref|XP_004499173.1|  PREDICTED: myosin-9-like isoform X1                186   9e-46    
ref|XP_004499174.1|  PREDICTED: myosin-9-like isoform X2                186   1e-45    
ref|XP_007203207.1|  hypothetical protein PRUPE_ppa000194mg             186   1e-45    
gb|AFW79312.1|  hypothetical protein ZEAMMB73_299591                    186   1e-45    
ref|XP_008650059.1|  PREDICTED: uncharacterized protein LOC103630...    186   1e-45    
ref|XP_004499175.1|  PREDICTED: myosin-9-like isoform X3                186   1e-45    
ref|XP_004291859.1|  PREDICTED: uncharacterized protein LOC101294040    186   1e-45    
ref|XP_008365018.1|  PREDICTED: auxilin-like protein 1                  183   1e-45    
gb|KEH40170.1|  auxilin-like protein                                    185   1e-45    
ref|XP_007160737.1|  hypothetical protein PHAVU_001G012900g             185   1e-45    
ref|XP_004961111.1|  PREDICTED: dentin sialophosphoprotein-like i...    185   1e-45    
ref|XP_004961110.1|  PREDICTED: dentin sialophosphoprotein-like i...    185   2e-45    
ref|XP_006300584.1|  hypothetical protein CARUB_v10019660mg             185   2e-45    
emb|CDX88363.1|  BnaC06g38070D                                          172   2e-45    
ref|XP_007160736.1|  hypothetical protein PHAVU_001G012900g             184   2e-45    
ref|XP_010681803.1|  PREDICTED: auxilin-like protein 1                  185   2e-45    
ref|XP_006390322.1|  hypothetical protein EUTSA_v10018007mg             184   3e-45    
ref|XP_006390321.1|  hypothetical protein EUTSA_v10018007mg             184   3e-45    
ref|XP_008388160.1|  PREDICTED: auxilin-like protein 1                  184   4e-45    
ref|XP_009336096.1|  PREDICTED: auxilin-like protein 1 isoform X2       184   4e-45    
ref|XP_009336091.1|  PREDICTED: auxilin-like protein 1 isoform X1       184   4e-45    
dbj|BAB90730.1|  auxilin-like protein                                   184   5e-45    
ref|XP_009365071.1|  PREDICTED: auxilin-like protein 1                  184   5e-45    
ref|XP_008377459.1|  PREDICTED: auxilin-like protein 1                  184   7e-45    
emb|CDY45424.1|  BnaA07g32040D                                          183   8e-45    
gb|EEE55043.1|  hypothetical protein OsJ_02730                          183   9e-45    
ref|XP_010263615.1|  PREDICTED: auxilin-like protein 1                  183   9e-45    
ref|XP_006599370.1|  PREDICTED: auxilin-like protein 1-like             165   1e-44    
ref|XP_010474346.1|  PREDICTED: auxilin-like protein 1                  182   2e-44    
emb|CAB40995.1|  auxilin-like protein                                   180   2e-44    
ref|XP_009106400.1|  PREDICTED: auxilin-related protein 1-like          164   3e-44    
ref|XP_009106187.1|  PREDICTED: auxilin-like protein 1 isoform X2       181   3e-44    
ref|XP_009106186.1|  PREDICTED: auxilin-like protein 1 isoform X1       181   3e-44    
ref|XP_006473532.1|  PREDICTED: auxilin-like protein 1-like isofo...    181   4e-44    
ref|XP_006473531.1|  PREDICTED: auxilin-like protein 1-like isofo...    181   4e-44    
emb|CDX73162.1|  BnaC06g36100D                                          181   4e-44    
ref|XP_010428546.1|  PREDICTED: auxilin-like protein 1 isoform X1       181   6e-44    
ref|XP_010428547.1|  PREDICTED: auxilin-like protein 1 isoform X2       181   6e-44    
ref|XP_006435029.1|  hypothetical protein CICLE_v100000381mg            180   6e-44    
ref|XP_006435030.1|  hypothetical protein CICLE_v100000381mg            180   6e-44    
ref|XP_010416406.1|  PREDICTED: auxilin-like protein 1 isoform X1       180   9e-44    
ref|XP_010416407.1|  PREDICTED: auxilin-like protein 1 isoform X2       180   9e-44    
ref|XP_008220904.1|  PREDICTED: auxilin-like protein 1                  180   1e-43    
gb|KFK41967.1|  hypothetical protein AALP_AA2G195100                    180   1e-43    
gb|KFK41966.1|  hypothetical protein AALP_AA2G195100                    179   1e-43    
ref|XP_008241709.1|  PREDICTED: auxilin-like protein 1                  179   1e-43    
ref|XP_010416675.1|  PREDICTED: uncharacterized protein LOC104702...    172   2e-43    
gb|KFK42131.1|  hypothetical protein AALP_AA2G215200                    167   2e-43    
ref|XP_011028869.1|  PREDICTED: auxilin-like protein 1 isoform X1       179   2e-43    
ref|XP_011028870.1|  PREDICTED: auxilin-like protein 1 isoform X2       179   2e-43    
ref|XP_010416677.1|  PREDICTED: uncharacterized protein LOC104702...    169   1e-42    
gb|AAG12690.1|AC025814_14  unknown protein, 3' partial; 5120-134        176   1e-42    
gb|KEH20422.1|  chaperone DnaJ-domain protein, putative                 175   2e-42    
tpg|DAA58430.1|  TPA: hypothetical protein ZEAMMB73_270678              169   2e-40    
ref|XP_006829050.1|  hypothetical protein AMTR_s00001p00256830          152   2e-39    
ref|XP_010539668.1|  PREDICTED: auxilin-related protein 1 isoform X2    158   2e-38    
ref|XP_002867010.1|  hypothetical protein ARALYDRAFT_328116             158   6e-37    
emb|CAB16841.1|  trichohyalin like protein                              150   3e-34    
ref|XP_003523847.2|  PREDICTED: J domain-containing protein requi...    147   5e-34    
tpg|DAA55294.1|  TPA: hypothetical protein ZEAMMB73_932315              145   2e-33    
ref|XP_003527699.1|  PREDICTED: J domain-containing protein requi...    145   2e-33    
ref|XP_006836350.1|  hypothetical protein AMTR_s00092p00101020          139   1e-31    
gb|KEH35333.1|  DnaJ domain protein                                     136   4e-31    
gb|KEH35334.1|  DnaJ domain protein                                     136   5e-31    
ref|XP_002468333.1|  hypothetical protein SORBIDRAFT_01g043940          137   5e-31    
ref|XP_006383589.1|  hypothetical protein POPTR_0005s20410g             137   5e-31    
ref|XP_007136577.1|  hypothetical protein PHAVU_009G056700g             138   7e-31    
ref|XP_007136578.1|  hypothetical protein PHAVU_009G056700g             138   7e-31    
ref|XP_002977932.1|  hypothetical protein SELMODRAFT_451314             138   8e-31    
ref|XP_006468265.1|  PREDICTED: putative tyrosine-protein phospha...    135   1e-30    
gb|ACU20506.1|  unknown                                                 125   1e-30    
ref|XP_006448961.1|  hypothetical protein CICLE_v10015036mg             135   1e-30    
ref|XP_004501035.1|  PREDICTED: uncharacterized protein LOC101509...    137   2e-30    
ref|XP_004501036.1|  PREDICTED: uncharacterized protein LOC101509...    137   2e-30    
ref|XP_006448962.1|  hypothetical protein CICLE_v10015036mg             135   2e-30    
ref|XP_002986959.1|  hypothetical protein SELMODRAFT_451308             137   2e-30    
ref|XP_009411024.1|  PREDICTED: J domain-containing protein requi...    137   2e-30    
gb|EYU45121.1|  hypothetical protein MIMGU_mgv1a008359mg                133   2e-30    
ref|XP_010909769.1|  PREDICTED: J domain-containing protein requi...    137   3e-30    
ref|XP_010909768.1|  PREDICTED: J domain-containing protein requi...    136   3e-30    
ref|XP_006649566.1|  PREDICTED: J domain-containing protein requi...    135   5e-30    
gb|EMS53454.1|  Auxilin-related protein 2                               133   1e-29    
ref|XP_002316725.1|  hypothetical protein POPTR_0011s02550g             123   2e-29    
ref|NP_001145320.1|  hypothetical protein                               133   2e-29    
ref|XP_008658453.1|  PREDICTED: hypothetical protein isoform X2         133   2e-29    
ref|XP_008658452.1|  PREDICTED: hypothetical protein isoform X1         133   2e-29    
ref|NP_001049277.1|  Os03g0198300                                       133   2e-29    
ref|XP_010254923.1|  PREDICTED: J domain-containing protein requi...    133   2e-29    
gb|EPS68870.1|  hypothetical protein M569_05898                         124   4e-29    
ref|XP_010664661.1|  PREDICTED: J domain-containing protein requi...    133   4e-29    
ref|XP_004985333.1|  PREDICTED: J domain-containing protein requi...    132   4e-29    
ref|XP_010254922.1|  PREDICTED: J domain-containing protein requi...    133   4e-29    
ref|XP_002281702.1|  PREDICTED: J domain-containing protein requi...    133   4e-29    
ref|XP_006375081.1|  hypothetical protein POPTR_0014s04210g             133   4e-29    
ref|XP_007225147.1|  hypothetical protein PRUPE_ppa002474mg             132   5e-29    
ref|XP_011031582.1|  PREDICTED: J domain-containing protein requi...    132   5e-29    
gb|EMT06632.1|  UBA domain-containing protein 7                         132   7e-29    
ref|XP_006434949.1|  hypothetical protein CICLE_v10000407mg             132   7e-29    
ref|XP_006434950.1|  hypothetical protein CICLE_v10000407mg             132   8e-29    
ref|XP_006473468.1|  PREDICTED: J domain-containing protein requi...    132   8e-29    
dbj|BAJ98047.1|  predicted protein                                      132   9e-29    
ref|XP_011083721.1|  PREDICTED: J domain-containing protein requi...    132   9e-29    
ref|XP_011083722.1|  PREDICTED: J domain-containing protein requi...    132   9e-29    
ref|XP_010914450.1|  PREDICTED: auxilin-related protein 2-like is...    132   1e-28    
ref|XP_008220772.1|  PREDICTED: J domain-containing protein requi...    132   1e-28    
ref|XP_006468266.1|  PREDICTED: putative tyrosine-protein phospha...    129   1e-28    
dbj|BAJ92217.1|  predicted protein                                      131   1e-28    
ref|XP_003558580.1|  PREDICTED: J domain-containing protein requi...    130   1e-28    
ref|XP_006448963.1|  hypothetical protein CICLE_v10015036mg             129   2e-28    
ref|XP_011010575.1|  PREDICTED: uncharacterized protein LOC105115398    129   2e-28    
ref|XP_006856110.1|  hypothetical protein AMTR_s00059p00139560          131   2e-28    
ref|XP_008377318.1|  PREDICTED: J domain-containing protein requi...    130   2e-28    
ref|XP_008444679.1|  PREDICTED: uncharacterized protein LOC103487941    128   3e-28    
gb|KEH36141.1|  heat shock protein-binding protein, putative            130   4e-28    
gb|KEH36142.1|  heat shock protein-binding protein, putative            130   4e-28    
gb|EAY73969.1|  hypothetical protein OsI_01853                          122   5e-28    
ref|XP_004147814.1|  PREDICTED: uncharacterized protein LOC101211029    130   5e-28    
emb|CDY45410.1|  BnaA07g31900D                                          129   6e-28    
ref|XP_009106168.1|  PREDICTED: J domain-containing protein requi...    129   6e-28    
ref|XP_004154905.1|  PREDICTED: uncharacterized protein LOC101230998    129   6e-28    
ref|XP_008377465.1|  PREDICTED: J domain-containing protein requi...    121   9e-28    
ref|XP_002532979.1|  conserved hypothetical protein                     126   1e-27    
gb|KDP38012.1|  hypothetical protein JCGZ_04655                         126   1e-27    
emb|CDX73142.1|  BnaC06g35900D                                          127   1e-27    
ref|XP_009364681.1|  PREDICTED: J domain-containing protein requi...    128   1e-27    
ref|XP_004293220.1|  PREDICTED: uncharacterized protein LOC101310580    128   2e-27    
ref|XP_003630318.1|  Auxilin-like protein                               129   2e-27    
ref|XP_009599410.1|  PREDICTED: J domain-containing protein requi...    128   2e-27    
gb|ABF94473.1|  expressed protein                                       127   2e-27    
ref|XP_006367308.1|  PREDICTED: J domain-containing protein requi...    127   2e-27    
ref|XP_010931652.1|  PREDICTED: auxilin-related protein 1-like is...    128   2e-27    
gb|KHG04397.1|  hypothetical protein F383_28829                         127   2e-27    
ref|XP_008466603.1|  PREDICTED: J domain-containing protein requi...    127   3e-27    
ref|XP_010060923.1|  PREDICTED: J domain-containing protein requi...    127   3e-27    



>ref|XP_006365539.1| PREDICTED: auxilin-related protein 1-like [Solanum tuberosum]
Length=487

 Score =   430 bits (1106),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 263/501 (52%), Positives = 321/501 (64%), Gaps = 41/501 (8%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRG-NSIPLANLKAKSKPSSGFPNDSGQKSSHNS-----DPY--DL  1646
             MDEFGVLVERYGVK +G  S P+ANLKAK+  S+GFP++ G  S  N+     DP+  DL
Sbjct  1     MDEFGVLVERYGVKVQGGKSTPMANLKAKNNSSNGFPSNLGFNSGQNTGYSSGDPFANDL  60

Query  1645  DGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNL  1466
             DG+FRS KTS   NYD++DIFGG F +S     QQ++VD+++   GS++   NN  + N+
Sbjct  61    DGIFRS-KTS--PNYDDNDIFGGVFANSKQ---QQNNVDIESVLGGSSSGYNNNYASKNV  114

Query  1465  RDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEKSAR  1286
              D+FD FG+ PK SDS+DDLFGNLG KS GLKK       +SDDLIPGFG  S+   S +
Sbjct  115   NDDFDLFGTEPKRSDSIDDLFGNLGLKSDGLKKDPAGKRSESDDLIPGFGDFSSPSYSKK  174

Query  1285  TSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETNP---SIDEL  1115
             +        +S K SS+  DDPF VFES+    N SSWP S+  E    +NP   SIDEL
Sbjct  175   SDPRSPQQSNSSKSSSSSPDDPFLVFESSTSEANASSWPFSESSEHHIGSNPVTSSIDEL  234

Query  1114  EDFVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKW  935
             EDF + +  S +  + H   +  S       A +   N           N     TK K 
Sbjct  235   EDFANFKVRSDTTERPHVPKKAYSVKNPVDRAQEKSKNVRV------TINKPSNTTKPKS  288

Query  934   TSHGTQSTG----------------KSKSPLKNFVddfssslfgdlgssfDEFHEVEGES  803
              + G  S G                K+ SP+KN VDD          S    F EVE ES
Sbjct  289   AAEGHMSAGFIKKGRPEEKKSSLSKKNVSPVKNLVDDLMFFGDSAPSSEA--FQEVEDES  346

Query  802   VERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGN  623
              ERR ARL HH +T+ERMA+ALAEK QRDLQ+Q EQ+EK RLA+ L+ +IKRWA GKEGN
Sbjct  347   EERRNARLKHHLKTQERMAKALAEKTQRDLQSQNEQEEKHRLADTLNYDIKRWATGKEGN  406

Query  622   LRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYI  443
             LRALLSSLQ+VLWPECGWQ VSLTDLITS SVKK+YHKATLCVHPDKVQQK A++R+KYI
Sbjct  407   LRALLSSLQHVLWPECGWQPVSLTDLITSISVKKIYHKATLCVHPDKVQQKGATVRQKYI  466

Query  442   AEKVFDILKEAFGKFNAEELR  380
             AEKVFD+LKEA+ KFN+EELR
Sbjct  467   AEKVFDLLKEAWNKFNSEELR  487



>ref|XP_004242043.1| PREDICTED: putative tyrosine-protein phosphatase auxilin [Solanum 
lycopersicum]
 ref|XP_010322938.1| PREDICTED: putative tyrosine-protein phosphatase auxilin [Solanum 
lycopersicum]
Length=487

 Score =   429 bits (1104),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 269/501 (54%), Positives = 330/501 (66%), Gaps = 41/501 (8%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRG-NSIPLANLKAKSKPSSGFPNDSGQKSSHNS-----DPY--DL  1646
             MDEFGVLVERYGVK +G  S P+ANLKAK+  S+GFP++ G  S  N+     DP+  DL
Sbjct  1     MDEFGVLVERYGVKVQGGKSTPMANLKAKNNSSNGFPSNLGFNSGQNTGYSSGDPFADDL  60

Query  1645  DGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNL  1466
             DG+FRS KTS   NYD++DIFGG F +S     QQ++VD+++   GS++ N NN  + N+
Sbjct  61    DGIFRS-KTS--PNYDDNDIFGGVFANSKQ---QQNNVDIESVLGGSSSGNNNNYASKNV  114

Query  1465  RDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEKSAR  1286
              D+FD FG+ PK SDS+DD+FGNLG KS  LKK    N  + DDLIPGFG  S+   S +
Sbjct  115   NDDFDLFGTEPKRSDSIDDIFGNLGLKSDSLKKDPAVNRSEGDDLIPGFGDFSSPSYSKK  174

Query  1285  TSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETNP---SIDEL  1115
             +        +S K SS+  DDPF VFES+    N SSWP S+  E+   +NP   SIDEL
Sbjct  175   SDPRSPQQSNSSKSSSSSPDDPFLVFESSTSEANASSWPFSESSEQHRGSNPVTSSIDEL  234

Query  1114  EDFVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKW  935
             E+F + +  S +  + H V +K+S+VK   S  D     S +       N     TK K 
Sbjct  235   ENFANFKVRSDTTERPH-VPKKDSSVK---SPVDRAQEKSKNVRV--TINKPSNTTKPKS  288

Query  934   TSHGTQSTG----------------KSKSPLKNFVddfssslfgdlgssfDEFHEVEGES  803
              + G  S G                K+ SP+KNFVDD          S    F EVE ES
Sbjct  289   AAEGHMSAGFHKKGMPEEKKSSLSKKNASPVKNFVDDLMFFGDSAPSSEA--FQEVEDES  346

Query  802   VERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGN  623
              ERR ARL HH +T+ERMA+ALAEK QRDLQ+Q EQ+EK RLA+ L+ +IKRWA GKEGN
Sbjct  347   EERRNARLKHHLKTQERMAKALAEKTQRDLQSQNEQEEKHRLADTLNYDIKRWATGKEGN  406

Query  622   LRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYI  443
             LRALLSSLQ+VLWPECGWQ VSLTDLITSTSVKKVYHKATLCVHPDKVQQK A++R+KYI
Sbjct  407   LRALLSSLQHVLWPECGWQPVSLTDLITSTSVKKVYHKATLCVHPDKVQQKGATVRQKYI  466

Query  442   AEKVFDILKEAFGKFNAEELR  380
             AEKVFD+LKEA+ KFN EELR
Sbjct  467   AEKVFDLLKEAWNKFNTEELR  487



>ref|XP_009769841.1| PREDICTED: auxilin-related protein 1 [Nicotiana sylvestris]
Length=486

 Score =   426 bits (1095),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 265/495 (54%), Positives = 321/495 (65%), Gaps = 30/495 (6%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRG-NSIPLANLKA-KSKPSSGFPND----SGQKSSHNSDPY--DL  1646
             MDEFGVLVERYGVK +G  S P+ANLKA K+  ++GFP++    SGQ S ++SDP+  DL
Sbjct  1     MDEFGVLVERYGVKVQGGKSTPMANLKANKTNSTNGFPSNLGFNSGQNSGYSSDPFANDL  60

Query  1645  DGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNL  1466
             DG+FRS  +   QNYDN+DIFGG F +S     QQ++VD+++   GS + N NN   +N 
Sbjct  61    DGIFRSKSS---QNYDNNDIFGGVFANSK----QQNNVDIESVLGGSNSNNNNNYGGNNS  113

Query  1465  RDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEKSAR  1286
              D+FD FG+APK SDS+DDLFGNLG KS G KK       +SDDLIPGFG  S+     +
Sbjct  114   YDDFDLFGTAPKKSDSIDDLFGNLGLKSDGPKKDHAGKRSESDDLIPGFGDFSSPSYGKK  173

Query  1285  TSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEK---LAETNPSIDEL  1115
                      +S K SS+  DDPF VF+S+    N SSWP S+  E    ++    SIDEL
Sbjct  174   LETKGSQQSNSSKSSSSSPDDPFLVFKSSTREANASSWPFSESSEHHPGISTVTSSIDEL  233

Query  1114  EDFVSGRGTSTSQGQQH----------YVSRKESNVKKTHSAGDILSNTSTDHMFDGLFN  965
             EDF + +  S    Q H           V R +   K      +  S T+T         
Sbjct  234   EDFANFKVRSNVTEQSHDTKKDAYVKKPVERAQEKSKSVRVTINKPSKTTTPKSAAKGHV  293

Query  964   NNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRA  785
             +     K K     + S  K+ SP+KNFVDD          S    F EVEGES ERRRA
Sbjct  294   SADFHEKGKPEEKKSSSIRKNVSPVKNFVDDLMFFGDSAPSSEV--FQEVEGESKERRRA  351

Query  784   RLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLS  605
             RL HH +T+ERMA+ALAEK QRDLQ+Q EQ+EK RLAE LD +IKRWA GKEGNLRALLS
Sbjct  352   RLKHHMKTQERMAKALAEKTQRDLQSQNEQEEKHRLAEMLDYDIKRWATGKEGNLRALLS  411

Query  604   SLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFD  425
             SLQ+VLWPECGWQ VSLTDLITSTSVKKVYH+ATLCVHPDKVQQK A++ +KYIAEKVFD
Sbjct  412   SLQHVLWPECGWQPVSLTDLITSTSVKKVYHRATLCVHPDKVQQKGATVPQKYIAEKVFD  471

Query  424   ILKEAFGKFNAEELR  380
             +LKEA+ KFN EELR
Sbjct  472   LLKEAWNKFNTEELR  486



>ref|XP_009625909.1| PREDICTED: auxilin-like protein 1 [Nicotiana tomentosiformis]
Length=490

 Score =   423 bits (1087),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 265/504 (53%), Positives = 326/504 (65%), Gaps = 44/504 (9%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRG-NSIPLANLKA-KSKPSSGFPND----SGQKSSHNSDPYD---  1649
             MDEFGVLVERYGVK +G  S P+ANLKA K+  ++GFP++    SGQ S ++SDP+D   
Sbjct  1     MDEFGVLVERYGVKVQGGKSTPMANLKANKTNFTNGFPSNLGFNSGQNSGYSSDPFDESF  60

Query  1648  ---LDGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrn  1478
                LDG+FRS  +   QNYDN+DIFGG F +S     QQ++VD+++   GS + N NN  
Sbjct  61    PNDLDGIFRSKSS---QNYDNNDIFGGVFANSK----QQNNVDIESVLGGSNSNNNNNYG  113

Query  1477  nsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSE  1298
              +N  D+FD FG+APK SDS+DDLFGNLG KS G KK       +SDDLIPGFG  S+  
Sbjct  114   GNNSYDDFDLFGTAPKRSDSIDDLFGNLGLKSDGPKKDHTGKRSESDDLIPGFGDFSSPS  173

Query  1297  KSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEK---LAETNPS  1127
                +         +S K SS+  DDPF VFES+    N ++WP S+  E    ++    S
Sbjct  174   YGKKLETKGSQQSNSSKSSSSSPDDPFLVFESSTREANAATWPFSESSEHHPGISTVTSS  233

Query  1126  IDELEDFVSGRGTSTSQGQQH------YVSR-------KESNVKKT--HSAGDILSNTST  992
             IDELEDF + +  S    + H      YV +       K  NV+ T    +      ++ 
Sbjct  234   IDELEDFANFKVRSNITERSHDTKRDTYVKKPVDRAQEKSKNVRVTINKPSKTTTPKSAA  293

Query  991   DHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVE  812
                    F+  G   + K     + S  K+ SP+KNFVDD          S    F EVE
Sbjct  294   KGHVSADFHEKGKPEEKK-----SSSIRKNVSPVKNFVDDLMFFGDSAPSSEV--FQEVE  346

Query  811   GESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGK  632
             GES ERRRARL HH +T+ERMA+ALAEK QRDLQ+Q EQ+EK RLAE LD +IKRWA GK
Sbjct  347   GESEERRRARLKHHMKTQERMAKALAEKTQRDLQSQNEQEEKHRLAEMLDYDIKRWATGK  406

Query  631   EGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLRE  452
             EGNLRALLSSLQ+VLWPECGWQ VSLTDLITSTSVKKVYH+ATLCVHPDKVQQK A++R+
Sbjct  407   EGNLRALLSSLQHVLWPECGWQPVSLTDLITSTSVKKVYHRATLCVHPDKVQQKGATVRQ  466

Query  451   KYIAEKVFDILKEAFGKFNAEELR  380
             KYIAEKVFD+LKEA+ KFN EELR
Sbjct  467   KYIAEKVFDLLKEAWNKFNTEELR  490



>ref|XP_011074824.1| PREDICTED: uncharacterized protein LOC105159449 [Sesamum indicum]
Length=500

 Score =   345 bits (885),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 244/516 (47%), Positives = 301/516 (58%), Gaps = 58/516 (11%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPY-----DLDGV  1637
             MDEFGVLVE  G ++ G S P+A  K+K KP S F   S   +S   D Y     +LDG+
Sbjct  1     MDEFGVLVESIGFRAHGKSAPMA--KSKPKPKSHFTAHSTVSTSSFDDSYSLPVDELDGI  58

Query  1636  FRSG----KTSGQQN-YDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnns  1472
             FRS     KT   QN + + DIFGG  PSSN    Q   VDL++ F  S N+  ++ N +
Sbjct  59    FRSNVNISKTQQSQNSFGDDDIFGGPVPSSN----QYGGVDLESVFSSSINRKNSSSNLN  114

Query  1471  NLR----DEF-DFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHS  1307
             +      D F D  GS  K  D VDDLFGN G  S G  +     +   DD IPGFG  S
Sbjct  115   SWNSGGFDAFDDLLGSKSKQKDPVDDLFGNFGVSSSGKHEKKGAGL---DDFIPGFGGVS  171

Query  1306  NS--EKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEK---LA  1142
              S  E  +           +   SST ADDPF VFES+   Q+ +SWP + P ++     
Sbjct  172   PSKTEGYSEIKIPPAPKGSTSNSSSTVADDPFLVFESSVS-QSDASWPFAGPSDQNIGKG  230

Query  1141  ETNPSIDELEDFVSGRGTSTSQGQQHYVSRKESNVKKTHSAG----DIL-----------  1007
                 SID+ +DF+ G    T  G +  V R E+      +AG    D +           
Sbjct  231   SVQSSIDDFDDFIMG---GTRSGPKVGV-RTEAKQPSPGTAGFENNDYIDAIFGGSNGVR  286

Query  1006  -------SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgd  848
                    S+ S D +FD +F+   G    + +S    ST K+ S     V +  SSLFGD
Sbjct  287   QKNNARPSSLSQDSLFDDIFHEERGPDVKQTSSRSAFSTKKASSGTN--VRNDFSSLFGD  344

Query  847   lgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEA  668
             + +S  EFHE+EGE  ERRRARLN H R   RM  A+AEKNQRD Q+Q EQ+EK R+AE 
Sbjct  345   VATSSGEFHEIEGEPEERRRARLNRHMRMNARMREAVAEKNQRDHQSQLEQEEKRRIAET  404

Query  667   LDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHP  488
             LD +IKRWAAGKEGNLRALLSSLQ VLWPECGW+ VSLTD+ITS SVKKVY KA LCVHP
Sbjct  405   LDNDIKRWAAGKEGNLRALLSSLQQVLWPECGWRPVSLTDMITSESVKKVYKKANLCVHP  464

Query  487   DKVQQKRASLREKYIAEKVFDILKEAFGKFNAEELR  380
             DKVQQK A+L++KYIAEKVFD+LKEA+ KF+AEELR
Sbjct  465   DKVQQKGATLQQKYIAEKVFDLLKEAWNKFSAEELR  500



>ref|XP_003527949.1| PREDICTED: auxilin-related protein 1 [Glycine max]
Length=516

 Score =   294 bits (753),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 208/547 (38%), Positives = 278/547 (51%), Gaps = 106/547 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK-------AKSKPSSGFPNDSGQKSSHNSDPYDLD  1643
             MDEFGVL E++G+K +G S P+A  K       ++++P+  FP +     SH +  +D D
Sbjct  1     MDEFGVLTEKFGLKPQGKSAPMARAKRPPNVADSQTRPNPKFPLNGS--PSHQNSTFDFD  58

Query  1642  -GVFRSGKTSGQ-QNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsN  1469
              GVF +  T  + Q +D  DIFGG   S+ ++       D D+ F GS      +     
Sbjct  59    YGVFSNSNTDNKTQRFD--DIFGGNAKSNGAS------FDYDSIFAGSNTPVSTSSYVD-  109

Query  1468  LRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS---DDLIPGFGFHSNSE  1298
                  D FG     S  VDDL      K GGL   A      S   DDLIPGFG  +N  
Sbjct  110   -----DIFGGIHGKSVGVDDLLD----KIGGLNTNAKSPNAKSPAFDDLIPGFGVSNNGV  160

Query  1297  KSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETNPS---  1127
                  S +      +   S    DDPF +FE+     +  S+   D LE++++ N S   
Sbjct  161   GMNNPSVTPNKPAAAAAASH---DDPFLIFETASSSPSSESF--LDALEQISKLNNSKGT  215

Query  1126  ------------------------IDELEDFVSGRGTSTSQGQQHYVSRKESNVKKTHSA  1019
                                     IDELEDF  G       G Q   S +++NVK   + 
Sbjct  216   KGGSPSLKSPPKPMSKVNSLSVSTIDELEDFAMG-------GTQTNASSRKANVKAAETK  268

Query  1018  GDILSNTSTDHMFDGLFNNNGGGTKD--KWTSHGTQSTG--KSKSP---------LKN--  884
              ++ +  +          N   G  D   + S G++S+   KS++P         +KN  
Sbjct  269   QNLAARMNNGKRVPAAKVNQANGVDDLESFFSMGSRSSSVPKSRTPTMDRMYDNQMKNKG  328

Query  883   --------------------FVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTR  764
                                  +           GS   EF EVEGE+ ERR+ARL  H R
Sbjct  329   KPEVSPRVPSRSSANVNKSPVMTSLDDLSLMFGGSPSSEFQEVEGETEERRKARLGRHQR  388

Query  763   TRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLW  584
              +ER  +A+ + NQRDLQT+ EQ+E+ ++A+  D +IKRWAAGKEGN+RALLS+LQYVLW
Sbjct  389   AQERALKAVNDMNQRDLQTKMEQEERRKIADTADVQIKRWAAGKEGNMRALLSTLQYVLW  448

Query  583   PECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFG  404
             PECGWQ VSLTD+ITS++VKKVY KA LC+HPDKVQQK A+L +KY AEKVFDILKEA+ 
Sbjct  449   PECGWQPVSLTDMITSSAVKKVYRKANLCIHPDKVQQKGATLEQKYTAEKVFDILKEAYT  508

Query  403   KFNAEEL  383
             KFNAEEL
Sbjct  509   KFNAEEL  515



>gb|KHN46994.1| Auxilin-related protein 1 [Glycine soja]
Length=516

 Score =   294 bits (753),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 208/547 (38%), Positives = 278/547 (51%), Gaps = 106/547 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK-------AKSKPSSGFPNDSGQKSSHNSDPYDLD  1643
             MDEFGVL E++G+K +G S P+A  K       ++++P+  FP +     SH +  +D D
Sbjct  1     MDEFGVLTEKFGLKPQGKSAPMARAKRPPNVADSQTRPNPKFPLNGS--PSHQNSTFDFD  58

Query  1642  -GVFRSGKTSGQ-QNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsN  1469
              GVF +  T  + Q +D  DIFGG   S+ ++       D D+ F GS      +     
Sbjct  59    YGVFSNSNTDNKTQRFD--DIFGGNAKSNGAS------FDYDSIFAGSNTPVSTSSYVD-  109

Query  1468  LRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS---DDLIPGFGFHSNSE  1298
                  D FG     S  VDDL      K GGL   A      S   DDLIPGFG  +N  
Sbjct  110   -----DIFGGIHGKSVGVDDLLD----KIGGLNTNAKSPNAKSPAFDDLIPGFGVSNNGV  160

Query  1297  KSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETNPS---  1127
                  S +      +   S    DDPF +FE+     +  S+   D LE++++ N S   
Sbjct  161   GMNNPSVTPNKPAAAAAASH---DDPFFIFETASSSPSSESF--LDALEQISKLNNSKGT  215

Query  1126  ------------------------IDELEDFVSGRGTSTSQGQQHYVSRKESNVKKTHSA  1019
                                     IDELEDF  G       G Q   S +++NVK   + 
Sbjct  216   KGGSPSLKSPPKPMSKVNSLSVSTIDELEDFAMG-------GTQTNASSRKANVKAAETK  268

Query  1018  GDILSNTSTDHMFDGLFNNNGGGTKD--KWTSHGTQSTG--KSKSP---------LKN--  884
              ++ +  +          N   G  D   + S G++S+   KS++P         +KN  
Sbjct  269   QNLAARMNNGKRVPAAKVNQANGVDDLESFFSMGSRSSSVPKSRTPTMDRMYDNQMKNKG  328

Query  883   --------------------FVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTR  764
                                  +           GS   EF EVEGE+ ERR+ARL  H R
Sbjct  329   KPEVSPRVPSRSSANVNKSPVMTSLDDLSLMFGGSPSSEFQEVEGETEERRKARLGRHQR  388

Query  763   TRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLW  584
              +ER  +A+ + NQRDLQT+ EQ+E+ ++A+  D +IKRWAAGKEGN+RALLS+LQYVLW
Sbjct  389   AQERALKAVNDMNQRDLQTKMEQEERRKIADTADVQIKRWAAGKEGNMRALLSTLQYVLW  448

Query  583   PECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFG  404
             PECGWQ VSLTD+ITS++VKKVY KA LC+HPDKVQQK A+L +KY AEKVFDILKEA+ 
Sbjct  449   PECGWQPVSLTDMITSSAVKKVYRKANLCIHPDKVQQKGATLEQKYTAEKVFDILKEAYT  508

Query  403   KFNAEEL  383
             KFNAEEL
Sbjct  509   KFNAEEL  515



>ref|XP_010534755.1| PREDICTED: auxilin-related protein 1-like [Tarenaya hassleriana]
Length=557

 Score =   290 bits (742),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 233/581 (40%), Positives = 292/581 (50%), Gaps = 133/581 (23%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK------------------AKSKPSSGFPNDSGQK  1676
             MDEFGVL ERYG+K +G S P+++ K                    +KP+S   + S   
Sbjct  1     MDEFGVLTERYGLKPQGKSAPMSSSKRSVNPNNAQSWHFGSSAGVDAKPTSYASDRSWNT  60

Query  1675  SSHNSDPYDLDGVF-------RSGKTSGQQNYDNSDIFGG--QFPSSNS-----------  1556
              S +   +D D +F       R G  SG   +D+   FGG  +  S+ S           
Sbjct  61    GSGDRSLFDGDDIFFKSSSIDRKGMDSG--GFDDLGYFGGLNKLSSNKSGNSESSFGGDG  118

Query  1555  ------------TTAQQSHVDLDTFFKGSTnqngnnrnnsNLRDEFDFFGSAPKPSDSVD  1412
                         TT+     D+D  F G T    +   +S+  D F  F S+ K + SVD
Sbjct  119   LMFSNLGNLGTKTTSSMDSYDVDDIFGGMTRSKSSPTVDSD--DVFGSFSSSAKQNGSVD  176

Query  1411  DLFGNL---GFKSGGLKKTAV----QNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHS  1253
             DL G+    G KS    + +     +N  D D+LIPGFG   N++ S+ T+ S  S    
Sbjct  177   DLLGDFSQFGTKSKSWNQNSSSDVGKNAADFDELIPGFG--GNAQSSSGTAKSTSS----  230

Query  1252  YKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAE------TNPS------------  1127
                     DDPF V ES+    + SS    DPLE+ A       T PS            
Sbjct  231   -------VDDPFVVLESSSASGHSSSGVFVDPLEEFANSFSSKGTKPSNSSQTSTKLRPP  283

Query  1126  ---------------IDELEDFVSGRGTSTSQGQQHYVSRKES---NVKKTHSAGDIL--  1007
                            IDELE+F  GR   TS   Q+    KE+     KK  +  D L  
Sbjct  284   PKPAQKVYEVKSSSSIDELEEFAMGRVQHTSSASQNASKYKEAEDVGTKKKQTRVDDLDS  343

Query  1006  -------------SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfs  866
                          S  +T+      FN        K TS G  S  K   P  N VDDFS
Sbjct  344   FFSSGSRSSSVPKSRATTETFSKPAFNAT------KKTSSGVPSGVKKPVPPANLVDDFS  397

Query  865   sslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEK  686
             S    D      EF ++ GES ERR+AR +   RT+ R+A+A+A+ N RD QTQ EQ+E+
Sbjct  398   SLFGADPLFG--EFEDIPGESEERRKARWDRERRTKNRVAQAVADMNHRDHQTQLEQEER  455

Query  685   SRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKA  506
             SR+AE +D EIKRWAAGKEGN+RALLSSLQ VLWPECGW+AVSLTDLITSTSVKKVY KA
Sbjct  456   SRIAETIDAEIKRWAAGKEGNMRALLSSLQIVLWPECGWEAVSLTDLITSTSVKKVYRKA  515

Query  505   TLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             TL VHPDKVQQK A+L++KYIAEKVFDILKEA+ KFN EEL
Sbjct  516   TLYVHPDKVQQKGATLKQKYIAEKVFDILKEAWNKFNKEEL  556



>gb|KHG12723.1| hypothetical protein F383_18435 [Gossypium arboreum]
Length=558

 Score =   290 bits (741),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 222/570 (39%), Positives = 288/570 (51%), Gaps = 110/570 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSS-------GFPNDSGQ---------KSS  1670
             MDEFGVL ERYG+K +G S+P++  K  +  ++       GF  DSG          K S
Sbjct  1     MDEFGVLTERYGLKPQGKSVPMSQAKRSTATAAATATTDWGFGFDSGSNRNPMSFSSKFS  60

Query  1669  HNSDPYD---LDGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVD----------  1529
              NS P +   LD      K + + ++   D FGG     N+TT Q +  +          
Sbjct  61    RNSGPSNGSLLDDHDFFPKPNSRNSFGLGDDFGG---FQNATTKQSNTSNNNSSSNGSSF  117

Query  1528  --------------------LDTFFKGSTnqngnnrnnsNLRDEFDFFGSAPKPSDSVDD  1409
                                 +D  F G       N +     D+F  F S+ K   S  D
Sbjct  118   DLASMLLNSGSKSSSANSYVVDDLFGGMPVSQNANND-----DDFGSFVSSTKQKGSASD  172

Query  1408  LFGNLGFKSGGLKKTA-------VQNVHDSDDLIPGFGFHSNS--EKSARTSHSQQSSVH  1256
             L G+    +  LK ++       V N    DDLIPGFG  S S    + +T+ S +SS  
Sbjct  173   LLGDFSGVAAKLKSSSRSGSWDSVNNEAGVDDLIPGFGASSPSVNRTNVKTTKSTRSSEE  232

Query  1255  -------SYKQSSTFADDP------FSVFE---STPPVQNVSSWPSSDPLEKLAETNPS-  1127
                     +     F++ P      FSV      T P  + ++  S  P  K A+ +   
Sbjct  233   PFVVLDSDFGSEYNFSETPMDPLGEFSVLNRSGGTKPRGSSNASQSFRPPPKPAQVSKEE  292

Query  1126  ---------IDELEDFVSGRG---TSTSQGQQHYVSRKESN----------VKKTHSAGD  1013
                      IDELEDF  GR    +S S+  +    + +SN          V    ++  
Sbjct  293   KAKSSGASLIDELEDFAMGRAHNKSSRSKEAEDATKKTQSNGEDDLESFFGVSSRSNSAP  352

Query  1012  ILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssf  833
              +  T+ D +FD   +N     + + TS G  ST K  SP+         S      S  
Sbjct  353   KMRATTLDPIFDKNMHN-----RQQKTSAGAPSTAKKASPVTMMNGMDDLSFIFGAASMS  407

Query  832   DEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEI  653
              EF EV GES ERRRARL  H RT++R+ARA+A+ NQRD Q+Q EQ+E+ R+AEA+D EI
Sbjct  408   GEFEEVAGESEERRRARLGRHQRTQDRVARAVADMNQRDRQSQNEQEERHRIAEAMDFEI  467

Query  652   KRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQ  473
             KRWAAGKEGN+RALLSS+Q VLWPECGW+ VSLTDLITS SVKKVY KATLCVHPDKVQQ
Sbjct  468   KRWAAGKEGNMRALLSSMQQVLWPECGWEPVSLTDLITSGSVKKVYRKATLCVHPDKVQQ  527

Query  472   KRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             K A+L +KYIAEKVFDILKEA+ KFN EEL
Sbjct  528   KGATLEQKYIAEKVFDILKEAWNKFNKEEL  557



>ref|XP_008219590.1| PREDICTED: auxilin-related protein 1 isoform X2 [Prunus mume]
Length=550

 Score =   287 bits (734),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 234/564 (41%), Positives = 301/564 (53%), Gaps = 106/564 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQ---KSSHNSDP--------  1655
             MDEFGVL E+YG+K +G S P+A   A  +P+S   ND+      +  NS+P        
Sbjct  1     MDEFGVLTEQYGLKPQGKSAPMA---ASKRPTSA--NDTQAWNFVADSNSNPKTSSYSSR  55

Query  1654  -------------YDL-DGVFRSGKTSGQQNY----DNSDIFGGQFPSSNSTTAQQSHVD  1529
                          +D  DG+F+SG     +++    D  DIFGG       T   +   +
Sbjct  56    SPPPNSNSDYASFFDAQDGLFQSGSNDKTRSFGGLDDYDDIFGGPV---KPTKHSEGSFN  112

Query  1528  LDTFFKGSTnqngnnrnnsNLRDEF-------------------DFFGS---APKPSDSV  1415
              D+ F GS  ++ +     +  D F                   D FGS   APK S +V
Sbjct  113   FDSLFSGSNAKSSSFNGYEDAYDVFGGMPGLKSPGSGKSNAKGDDIFGSFASAPKQSATV  172

Query  1414  DDLFGNLGFKSGGLKKTAVQNVH----------------DSDDLIPGFG--FHSNSEKSA  1289
             DDL G+L   SG  +K    NV                 D DDLIPGFG    SN+   A
Sbjct  173   DDLLGDL---SGIRQKLQTLNVKNDKNVNRSAKVGKNGGDFDDLIPGFGGSAPSNNGTYA  229

Query  1288  RTSHSQQSSVHSYKQS-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN-----PS  1127
             + +H QQS+VHS K + S+  DDPF V ES     +  ++ SSD   +L +        S
Sbjct  230   QENHRQQSTVHSTKSNFSSSLDDPFVVLESVSTSTSTPAYDSSDIFSELEQIKRSSGVSS  289

Query  1126  IDELEDFVSGRGTSTSQGQQHYVSRKE---SNVKKTHSAGDIL----SNT---------S  995
             IDELE+F  G   + + G+ ++ S ++   S  ++  S+ D L    SN+         +
Sbjct  290   IDELEEFAKGTVQNNATGRTNFHSHEDVETSATRRGRSSEDDLMGFRSNSVPRSWAAPAT  349

Query  994   TDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEV  815
              D +FD   NN GG  + + TS GT S+ K  S      DD  S           E  EV
Sbjct  350   LDPVFDAPTNNRGG-PRPQGTS-GTSSSMKKSSSATGIFDDLFSMNGASPAFVEFE--EV  405

Query  814   EGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAG  635
             EGES ERR+ARL  H R  ER  +A+A+ NQRD +TQQEQDEK R+AE L+ +IK W+ G
Sbjct  406   EGESEERRKARLGRHQRAHERALQAVADMNQRDRKTQQEQDEKRRIAETLNIKIKSWSYG  465

Query  634   KEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLR  455
             KEGN+RALLSSLQ VLWPE GW+ VSLTDLITS SVKKVY KATLC+HPDKVQQK ASL 
Sbjct  466   KEGNMRALLSSLQSVLWPESGWEPVSLTDLITSGSVKKVYRKATLCIHPDKVQQKGASLE  525

Query  454   EKYIAEKVFDILKEAFGKFNAEEL  383
             +KY AEKVFDILKEA+ KFN EEL
Sbjct  526   QKYTAEKVFDILKEAWNKFNKEEL  549



>emb|CDP10975.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   284 bits (727),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 216/551 (39%), Positives = 278/551 (50%), Gaps = 108/551 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPS----SGFPNDSGQKSSH-----NSDPY-  1652
             MDEFGVLVE  G KS+ NS P+A+LK+K K +     GFP+ S   +S      N+D + 
Sbjct  1     MDEFGVLVESIGFKSQRNSAPMAHLKSKPKTNLSVNDGFPDISSANASRSSFYDNNDYFV  60

Query  1651  -DLDGVFRSGK-----TSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqng  1490
              DLDG+F+S +     +   QN+ +         S  ++  Q+  +D D+ F    + + 
Sbjct  61    DDLDGIFQSNRNNYSSSKKSQNFFDGGDDIFDGGSFLNSKPQKGIIDFDSVFDLKNSNSK  120

Query  1489  nnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFH  1310
             ++ N        D   S P+  D++DD FGNL  K GG +K +       DDLIPGF   
Sbjct  121   SSSNFHGD----DLLTSGPRKGDALDDFFGNL--KKGGEEKGS-----QYDDLIPGFEGT  169

Query  1309  SNSE-------KSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLE  1151
             S S        + A      Q S     +SS+ ADDPF VFES+   +N SSWP SD LE
Sbjct  170   SPSRSNDPGNTRMASKPKVSQPSSGYSSKSSSAADDPFLVFESSRSEENTSSWPFSDLLE  229

Query  1150  KLA---ETNPSIDELEDFV-----------------------------------SGRGTS  1085
             + A       S+DE E F                                    SGR  +
Sbjct  230   QTAGKSSVESSLDEFEKFARGMPPGDAHDKPSGKAVRNIKISLKKKEDKARDNASGRDVN  289

Query  1084  TSQGQQHYVSR----------KESNVKKTHSAG------DILSNTS------TDHMFDGL  971
             T     H   R          K +N KK  S G      D LSN +       D   D L
Sbjct  290   TDAKVVHEKRRGKEKDRADKDKVTNGKK-ESVGINIFGVDTLSNVNGPRSQLKDPDLDAL  348

Query  970   FNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERR  791
             FN        + +  G+  T K    L +  +               EF E+EGE+VERR
Sbjct  349   FNEKREPEVKETSIQGSSRTSKDFDGLSSLFEGP-------------EFQEIEGETVERR  395

Query  790   RARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRAL  611
               RLN H + +ERM +AL EK QRDL+ Q EQ+E+ RLA+ LD +IKRW+AGKE NLRAL
Sbjct  396   SRRLNQHIKIQERMFKALEEKTQRDLEAQYEQEERHRLADCLDNDIKRWSAGKENNLRAL  455

Query  610   LSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKV  431
             LSSLQ VLWPE GWQ VSL DLITS SV KVY KA++C HPDKVQQ+  +L++KYIAEKV
Sbjct  456   LSSLQDVLWPESGWQPVSLADLITSVSVIKVYKKASMCFHPDKVQQRGCNLQQKYIAEKV  515

Query  430   FDILKEAFGKF  398
             FD+LKEA   F
Sbjct  516   FDVLKEARSNF  526



>ref|XP_011027469.1| PREDICTED: auxilin-related protein 2 [Populus euphratica]
Length=533

 Score =   283 bits (725),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 218/558 (39%), Positives = 286/558 (51%), Gaps = 111/558 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK----------AKSKPSSGFPNDSGQKSSHNSDPY  1652
             MDEFGVL ER+G+K +G S P+A  +          A S P +   +     +SH+ +  
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMAASRGSNNTQIPNFASSNPKTSSYSSKSTYNSHSFNGS  60

Query  1651  DLDGVFRSGKTSGQQNY-DNSDIFGG------------------QFPSSNSTTAQQSHVD  1529
              +D        S  QN+ D+ DIFGG                   FPS+ +++A+ S   
Sbjct  61    FMDDHETLRSNSKSQNFGDDFDIFGGFQKNSKQTSTGFGFDYDSLFPSTKNSSAKSSF--  118

Query  1528  LDTFFKGSTnqngnnrnnsNLRDEFDFFGS----APKPSDSVDDLFGNLGFKSGGLKKTA  1361
              D  F G    +    NN++  D F  F S    A K    VDDL G  G K   LK  +
Sbjct  119   YDDIFGGLNVSSSTVNNNNDDDDIFGAFTSYSSKAAKQRAPVDDLLGGFGTK---LKPPS  175

Query  1360  VQNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNV  1181
                    DDLIPGFG        +R S S++ ++ +   + T  +DPF V E T     +
Sbjct  176   RNGSVGYDDLIPGFG--------SRKSSSKEENIRTTTPAFTSTEDPFVVLEQTSTKTKL  227

Query  1180  SSWPSSDPLEKLAETNPS-----------------------------------IDELEDF  1106
             S+    DPLE+  + N S                                   IDELEDF
Sbjct  228   ST----DPLEEFGKFNHSGRAESTVLSNRSPPLRPPPKPGQVLKTGKSSDVSAIDELEDF  283

Query  1105  VSGRGTSTSQGQQHYVSRKESNVKKTHSAGDIL------SNTST---------DHMFDGL  971
               GR     Q   H  S      +   SA D+       S +S+         D +FD  
Sbjct  284   AMGR----MQTNAHSGSNGRHAREVKESADDLELFFGRGSRSSSVPKSRPEVPDPLFDAK  339

Query  970   FNNNGGGTKDKWTSH--GTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVE  797
              N  G   K ++ +    T S G  K+  KN + D SS     + S   EF EV+GES E
Sbjct  340   INAKG---KPEFPTKKSSTSSPGIRKTSAKNVIGDLSSIFGDAMLSG--EFEEVDGESEE  394

Query  796   RRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLR  617
             RRRAR + H RTR+R+ +A+A+ NQRD QT  EQ+E+ R+A+ +D +IK WAAGKEGN+R
Sbjct  395   RRRARWDRHQRTRDRIEQAVADMNQRDRQTLHEQEERRRIADKMDVQIKHWAAGKEGNMR  454

Query  616   ALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAE  437
             ALLSSLQYVLWP+C W+ V+LTDLITSTSVKKVY KATLCVHPDKVQQK A++++KYIAE
Sbjct  455   ALLSSLQYVLWPDCDWEPVALTDLITSTSVKKVYRKATLCVHPDKVQQKGATIQQKYIAE  514

Query  436   KVFDILKEAFGKFNAEEL  383
             KVFD LKEA+ KF+ EEL
Sbjct  515   KVFDTLKEAWNKFSKEEL  532



>ref|XP_003522570.1| PREDICTED: auxilin-related protein 1-like isoform X1 [Glycine 
max]
 gb|KHN44306.1| Auxilin-related protein 1 [Glycine soja]
Length=517

 Score =   283 bits (723),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 203/550 (37%), Positives = 276/550 (50%), Gaps = 111/550 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK-------AKSKPSSGFPNDSGQKSSHNSDPYDLD  1643
             MDEFGVL ER+G+K +G S P+A  K       ++++P+S  P +     SH +  +D D
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMARAKRPPNVADSQTRPNSKSPLNGS--PSHQNSTFDFD  58

Query  1642  -GVFRSGKTSGQQNYDN--SDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnns  1472
              G F S   S   N      DIFG    S+ ++       D D+ F GS      +    
Sbjct  59    YGFFSSSNNSNTDNKTQRFDDIFGVDAKSNGAS------FDYDSIFSGSNKPVSASSYVD  112

Query  1471  NLRDEFDFFGSAPKPSDSVDDLFGNLG-----FKSGGLKKTAVQNVHDSDDLIPGFGFHS  1307
                   D FG   + S  VDDL   +G      KS   K  A       D LIPGFG  +
Sbjct  113   ------DIFGGMHEKSVGVDDLLDKIGGLNTNAKSPNTKTPAF------DYLIPGFGVSN  160

Query  1306  NSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETNPS  1127
             N         ++QS   +   ++   DDPF +FE+     +  S+ ++  LE+++ +N S
Sbjct  161   NG-----VEMNKQSVTPNKPAAAASQDDPFLIFETASSSASSESFLNA--LEQISRSNNS  213

Query  1126  ---------------------------IDELEDFVSGRGTSTSQGQQHYVSRKESNVKKT  1028
                                        IDELEDF  G       G Q   S +++NV   
Sbjct  214   KGTKGGSPSLKSPPKPMSKVNRPSVSTIDELEDFAMG-------GAQTNASSRKANVNAA  266

Query  1027  HSAGDILSNTSTDHMFDGLFNNNGGGTKD--KWTSHGTQSTG--KSKSP---------LK  887
              +  ++ +  +          N   G  D   + S G++S+   KS++P         +K
Sbjct  267   ETKQNLAARMNNGKRVPAARVNQANGVDDLESFFSMGSRSSSVPKSRTPTMDHMYDNQMK  326

Query  886   N----------------------FVddfssslfgdlgssfDEFHEVEGESVERRRARLNH  773
             N                       +           GS   EF EVEGE+ ERR+ARL  
Sbjct  327   NKERPEVSPRVPSRSSASVNKSPVMTSLDDLSLMFGGSPSSEFQEVEGETEERRKARLGR  386

Query  772   HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
             H R +ER  +A+ + NQRDLQT+ EQ+E+ ++A+  D +IKRWAAGKEGN+RALLS+LQY
Sbjct  387   HQRAQERALKAVNDMNQRDLQTKMEQEERRKIADTADVQIKRWAAGKEGNMRALLSTLQY  446

Query  592   VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
             VLWPECGWQ VSLTD+ITS++VKKVY KA LC+HPDKVQQK A+L +KY AEKVFDILKE
Sbjct  447   VLWPECGWQPVSLTDMITSSAVKKVYRKANLCIHPDKVQQKGATLEQKYTAEKVFDILKE  506

Query  412   AFGKFNAEEL  383
             A+ KFNAEEL
Sbjct  507   AYTKFNAEEL  516



>ref|XP_004149430.1| PREDICTED: auxilin-related protein 2-like [Cucumis sativus]
 ref|XP_004160715.1| PREDICTED: auxilin-related protein 2-like [Cucumis sativus]
Length=541

 Score =   283 bits (724),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 224/560 (40%), Positives = 277/560 (49%), Gaps = 106/560 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA-----------------NLKAKSKPSSGFPNDSGQKS  1673
             MDEFGVL ER+G+K +G S P+A                  L  KS   SGF + S QK+
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMAASKQPASSNTFHSGFNSGLNGKSSFDSGFVDVSFQKN  60

Query  1672  SHNSDPYDLDGVFRS---------GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDT  1520
             +       +D +F S            S   ++D   IF G         ++ S    D 
Sbjct  61    TKPDSYAGVDDIFGSLTQSTKHLRNSASSPSSFDYDSIFFG---------SKNSDPSYDD  111

Query  1519  FFKGSTnqngnnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGF-------KSGGLKKTA  1361
              F G      +        D    F  +   +  VDDLFG+          K  GLK TA
Sbjct  112   VFSGIPGFKSSVTAKK--EDPVRSFSPSLNQTSQVDDLFGDFSSNVVKPTPKPNGLK-TA  168

Query  1360  VQNVHDSDDLIPGFGFHSNS---EKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPV  1190
               N    D+LI GFG  SNS     S + + +QQS+ HS K + + A DPF   ES    
Sbjct  169   PNNGAPFDELISGFG-ASNSPIDRASMQDNLTQQSTSHS-KSTFSSARDPFIELESASVP  226

Query  1189  QNVSSWPSSDPLEKLAETN---------------------------PSIDELEDFVSGRG  1091
              N SS    DPLE++ + N                             IDELEDF  G+ 
Sbjct  227   SNNSSEAFPDPLEEMTKFNNKFDSSHNSSPPFRVPPVPKPVKSSSSSPIDELEDFAKGKV  286

Query  1090  TSTSQGQQHYVSRKES-NVKKTHSAG--------DILS---------------NTSTDHM  983
              + S+G     +R  + N K  H+AG        D+ S                T+ D +
Sbjct  287   RNNSEGNVDASTRTTNRNGKDVHTAGLNHQKTVDDLDSFFNVGPRSKSAPRSRTTTPDPL  346

Query  982   FDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGES  803
             FD +   N      K     T S  K  S   NFVDD         G     F EV+GES
Sbjct  347   FD-VPKYNKPPEIPKPAPSATFSHIKKSSSAVNFVDDLFFGDSPSFG----HFEEVDGES  401

Query  802   VERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGN  623
              ERRRARL    RT ER ARA+A+ NQRD QTQ EQ+EK R+AE+LD +IKRW+AGKEGN
Sbjct  402   EERRRARLGRLQRTEERAARAVADLNQRDFQTQHEQEEKRRIAESLDVDIKRWSAGKEGN  461

Query  622   LRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYI  443
             +RALLSSLQYVLW  CGW+ VSLTD+ITSTSVKKVY KA LC+HPDKVQQK AS+ +KY 
Sbjct  462   MRALLSSLQYVLWSGCGWEPVSLTDIITSTSVKKVYRKAVLCIHPDKVQQKGASIEQKYT  521

Query  442   AEKVFDILKEAFGKFNAEEL  383
             AEKVFDILKEA+ KF+ EEL
Sbjct  522   AEKVFDILKEAWNKFSKEEL  541



>ref|XP_007137461.1| hypothetical protein PHAVU_009G128700g [Phaseolus vulgaris]
 gb|ESW09455.1| hypothetical protein PHAVU_009G128700g [Phaseolus vulgaris]
Length=511

 Score =   282 bits (721),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 206/531 (39%), Positives = 269/531 (51%), Gaps = 79/531 (15%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKP----SSGFPNDSGQ---KSSHNSDPYDLD  1643
             MDEFGVL ER+G+K +G S P+A    K  P    S   PN         S  S P D +
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMARASTKRPPIVADSQTRPNSKSTLNGSPSPQSSPLDFN  60

Query  1642  ---GVFRSGKTSGQ-QNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnn  1475
                GVF S     + Q++DN  IFGG   S+ ++       D D+ F GS      +   
Sbjct  61    FDYGVFSSSSGDNKTQHFDN--IFGGNAKSNGAS------FDYDSIFAGSNKPVSTSSYV  112

Query  1474  sNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEK  1295
                    D FG     S  VDDL   +G  +        +  H SDDLIPGFG  +N   
Sbjct  113   D------DIFGGMHAKSVGVDDLLDKIGGLNTNTNSPNSKTPH-SDDLIPGFGVFNNG--  163

Query  1294  SARTSHSQQSSVHSYKQSSTFADDPFSVF----------------ESTPPVQNVSSWPSS  1163
                     + SV   K ++   DDPF +F                E    + N      S
Sbjct  164   ----VEMNKPSVTPNKPAAVSHDDPFLIFETVSSSASSESFLDSLEQITKLNNSKGSKGS  219

Query  1162  DPLEKLAETNP----------SIDELEDFVSG--RGTSTSQGQQHYVSRKESNVKKTHSA  1019
              P+ K     P          SIDE E F  G  R  ++S+    +  + + N+    + 
Sbjct  220   SPILKSHPPKPMSKVKKSNLSSIDEFESFAMGGARTNASSRNANVHAPQTKQNLSAKINN  279

Query  1018  G----DILSNTSTD-HMFDGLFN--NNGGGTKDKWTSHGTQSTGK--------SKSPLKN  884
             G    D+  + S D    + +F+  +         T+   ++ GK        S SP   
Sbjct  280   GKRVPDVKVSQSNDVDDLESIFSMGSRSSSAPKSRTTTTMKNKGKPEVSPRVPSGSPASV  339

Query  883   F----VddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRD  716
                  V  F        GS   EF EVEGE+ ERR+ARL  H R +ER  +A+A+ NQRD
Sbjct  340   MKPPAVSSFDDLSLIFGGSPSSEFQEVEGETEERRKARLGRHQRAQERALKAVADMNQRD  399

Query  715   LQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITS  536
             +QT+ EQ+E+ R+A++ D +IKRW+AGKEGN+RALLSSLQYVLWPECGWQ VSLTD+ITS
Sbjct  400   IQTKMEQEERRRIADSADIQIKRWSAGKEGNMRALLSSLQYVLWPECGWQPVSLTDMITS  459

Query  535   TSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
              +VKKVY KATL +HPDKVQQK A+L +KYIAEKVFDILKE++ KFNAEEL
Sbjct  460   AAVKKVYRKATLYIHPDKVQQKGATLEQKYIAEKVFDILKESWTKFNAEEL  510



>ref|XP_006578959.1| PREDICTED: auxilin-related protein 1-like isoform X2 [Glycine 
max]
Length=521

 Score =   281 bits (720),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 206/552 (37%), Positives = 275/552 (50%), Gaps = 111/552 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK-------AKSKPSSGFPNDSGQKSSHNSDPYDLD  1643
             MDEFGVL ER+G+K +G S P+A  K       ++++P+S  P +     SH +  +D D
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMARAKRPPNVADSQTRPNSKSPLNGS--PSHQNSTFDFD  58

Query  1642  -GVFRSGKTSGQQNYDN--SDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnns  1472
              G F S   S   N      DIFG    S+ ++       D D+ F GS      +    
Sbjct  59    YGFFSSSNNSNTDNKTQRFDDIFGVDAKSNGAS------FDYDSIFSGSNKPVSASSYVD  112

Query  1471  NLRDEFDFFGSAPKPSDSVDDLFGNLG-----FKSGGLKKTAVQNVHDSDDLIPGFGFHS  1307
                   D FG   + S  VDDL   +G      KS   K  A       D LIPGFG  +
Sbjct  113   ------DIFGGMHEKSVGVDDLLDKIGGLNTNAKSPNTKTPAF------DYLIPGFGVSN  160

Query  1306  NSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSW---------------  1172
             N         ++QS   +   ++   DDPF +FE+     +  S+               
Sbjct  161   NG-----VEMNKQSVTPNKPAAAASQDDPFLIFETASSSASSESFLNALEQISRSNNSKG  215

Query  1171  -----PS----SDPLEKL--AETNPS---IDELEDFVSGRGTSTSQGQQHYVSRKESNVK  1034
                  PS      P+ K+  A   PS   IDELEDF  G       G Q   S +++NV 
Sbjct  216   TKGGSPSLKSPPKPMSKVLGAVNRPSVSTIDELEDFAMG-------GAQTNASSRKANVN  268

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKD--KWTSHGTQSTG--KSKSP---------  893
                +  ++ +  +          N   G  D   + S G++S+   KS++P         
Sbjct  269   AAETKQNLAARMNNGKRVPAARVNQANGVDDLESFFSMGSRSSSVPKSRTPTMDHMYDNQ  328

Query  892   LKN----------------------FVddfssslfgdlgssfDEFHEVEGESVERRRARL  779
             +KN                       +           GS   EF EVEGE+ ERR+ARL
Sbjct  329   MKNKERPEVSPRVPSRSSASVNKSPVMTSLDDLSLMFGGSPSSEFQEVEGETEERRKARL  388

Query  778   NHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSL  599
               H R +ER  +A+ + NQRDLQT+ EQ+E+ ++A+  D +IKRWAAGKEGN+RALLS+L
Sbjct  389   GRHQRAQERALKAVNDMNQRDLQTKMEQEERRKIADTADVQIKRWAAGKEGNMRALLSTL  448

Query  598   QYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDIL  419
             QYVLWPECGWQ VSLTD+ITS++VKKVY KA LC+HPDKVQQK A+L +KY AEKVFDIL
Sbjct  449   QYVLWPECGWQPVSLTDMITSSAVKKVYRKANLCIHPDKVQQKGATLEQKYTAEKVFDIL  508

Query  418   KEAFGKFNAEEL  383
             KEA+ KFNAEEL
Sbjct  509   KEAYTKFNAEEL  520



>ref|XP_010539667.1| PREDICTED: auxilin-related protein 1 isoform X1 [Tarenaya hassleriana]
Length=545

 Score =   281 bits (720),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 227/571 (40%), Positives = 285/571 (50%), Gaps = 125/571 (22%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSG---------------FPND-SGQKSS  1670
             MDEFGVL ERYG+K +G S P+A  K  + P++G               + +D S    S
Sbjct  1     MDEFGVLTERYGLKPQGKSAPMAAAKRSANPNNGQSWHFGSNINTKPTSYSSDRSKNADS  60

Query  1669  HNSDPYDLDGVFRSGKTSGQQN-----YDNSDIFGGQFPSSNSTTAQQSHVDLDTFFK--  1511
              N+  +D D +F   K   + +     +D+   FGG   SSN++   +     D  F   
Sbjct  61    GNASLFDGDDIFSKSKPVHRVDMNSGGFDDFGAFGGLNKSSNTSGNSKPSFGDDLMFPNV  120

Query  1510  GSTnqngnnrnnsNLRDEFD---------------FFGSAPKPSD---SVDDLFGNL---  1394
             G++        N    D FD                FGS   P+    SVDDL G+    
Sbjct  121   GNSGAKNATSINGYGDDIFDGTMKSKISPSVDKDDIFGSFSSPAKQNGSVDDLLGDFSQF  180

Query  1393  GFKSGGLKKTAVQNVH----DSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD  1226
             G KS    + +  N+     D D+LIPGFG      +SA  S           +S+T  D
Sbjct  181   GTKSKSWNQNSSGNLAKDAADFDELIPGFG------ESAPPSSGTA-------KSTTAVD  227

Query  1225  DPFSVFESTPPVQNVSSWPSSDPLEKLA------ETNPS---------------------  1127
             DPF V EST    + SS    DPLE  A       T PS                     
Sbjct  228   DPFVVLESTSASGHSSSGVFVDPLEDFAFSVSSNGTKPSNSSQTSTKLRPPPKPAQKVNE  287

Query  1126  --------IDELEDFVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDIL------------  1007
                     ID LE+F  GR     +    Y   ++   KK  ++ D L            
Sbjct  288   VKSSGMSSIDALEEFAMGR-----ERPNKYNEAEDVRTKKQQTSVDDLDFFSSSVSRSSS  342

Query  1006  ---SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgss  836
                S  +TD     +FN        K TS+G QS+ K   P  N VDDFSS    D    
Sbjct  343   APKSRATTDIFSKPVFNA-------KKTSNGVQSSAKKPVPPANLVDDFSSVFGADPLFG  395

Query  835   fDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEE  656
               EF ++ GES ERR AR +   RT+ R+A+A+A+ N RD QTQ EQ+E+SR+AE ++ E
Sbjct  396   --EFEDIPGESEERRNARWDRERRTKNRVAQAVADMNHRDRQTQLEQEERSRIAETINAE  453

Query  655   IKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQ  476
             IKRWAAGKEGN+RALLSSLQ VLWPECGWQ VSLTDLITST+VKKVY KATL VHPDKVQ
Sbjct  454   IKRWAAGKEGNMRALLSSLQIVLWPECGWQPVSLTDLITSTAVKKVYRKATLYVHPDKVQ  513

Query  475   QKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             QK A+L +KYIAEKVFDILKEA+ KFN EEL
Sbjct  514   QKGATLEQKYIAEKVFDILKEAWNKFNKEEL  544



>gb|KDP32818.1| hypothetical protein JCGZ_12110 [Jatropha curcas]
Length=557

 Score =   275 bits (702),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 231/588 (39%), Positives = 291/588 (49%), Gaps = 147/588 (25%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPY----------  1652
             MDEFGVL ER+G+K +G S P+A+ K   +P+S    ++ Q  +  S+P           
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSK---RPNS---TNNTQIRNFASNPGLNPKSSSKSS  54

Query  1651  ------------DLDGVFRSGKTSGQQNYD--NSDIFGGQFPSSNSTT--AQQSHVDLDT  1520
                         D + +F   KT   QNY   + DIFGG   +S  TT     S  D D+
Sbjct  55    YNSNSFNGSFLDDNESLFSGKKT---QNYGGLDDDIFGGFEKNSRQTTNNGNGSSFDYDS  111

Query  1519  FFKGSTnqngnnrnnsNLR--------------DEFDFFGSAPKPSDSVDDLFGNLGFKS  1382
              F  S   +  +  + ++               D F  FGS  K S  +DDLFGN G KS
Sbjct  112   IFSNSNYSSAKSSFDGDILGGLNLNSSNSTSSDDIFGSFGSKSKQSAPIDDLFGNFGAKS  171

Query  1381  GGLKKTAVQNVHDS-DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFE  1205
                 KT  QN+    DDLIPGFG  ++S K   T  +        K + T  DDPF V E
Sbjct  172   ----KTQNQNISAGFDDLIPGFGSSNSSNKGEHTGMN--------KSTFTLTDDPFVVLE  219

Query  1204  STPPVQNVSSWPSSDPLEKL-------------------------------------AET  1136
             ST      S    +DPLE+                                      A  
Sbjct  220   STSTATKSSF---TDPLEEFNKLSHSRSTKSTGSSNFSPSLKPPPKPGQVLKSEKVKASD  276

Query  1135  NPSIDELEDFVSGRGTSTSQGQQ--HYV-------SRKESNVKKTH---------SAGDI  1010
               SIDELEDF  GR  + + G+   HY        + K S  K+           SA DI
Sbjct  277   VSSIDELEDFAMGRVRNNAGGRSDVHYAKEVRDGQTAKASKYKEAEDAAKKNQQKSADDI  336

Query  1009  LS---------------NTSTDHMFDGLFNNNGGGT----KDKWTSHGTQSTGKSKSPLK  887
              S                 + D +FD   N  G       K  + S G +    + + + 
Sbjct  337   ESFFSMGSRSTSAPKSRTATLDPLFDAKSNGRGEPVVTQKKSSFASSGIRKASSTTNIID  396

Query  886   NFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQT  707
             +F+   +S              EVEGES ERRRARL  H RT++R+A+A+A+ NQRDLQT
Sbjct  397   DFMFGDASLFGEF--------EEVEGESEERRRARLGRHQRTQDRVAKAVADMNQRDLQT  448

Query  706   QQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSV  527
             Q EQ+E+ R+A+ +D  IKRWAAGKEGN+RALLSSLQYVLWPECGW+ VSLTDLITS+SV
Sbjct  449   QHEQEERRRIADNVDAHIKRWAAGKEGNMRALLSSLQYVLWPECGWEPVSLTDLITSSSV  508

Query  526   KKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             KKVY KATL VHPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  509   KKVYRKATLYVHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  556



>ref|XP_002300968.2| hypothetical protein POPTR_0002s07940g [Populus trichocarpa]
 gb|EEE80241.2| hypothetical protein POPTR_0002s07940g [Populus trichocarpa]
Length=532

 Score =   273 bits (699),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 212/554 (38%), Positives = 283/554 (51%), Gaps = 104/554 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKP-----SSGFPNDSGQKSSHNSDPYDLDGV  1637
             MDEFGVL ER+G+K +G S P+A  +  +       +S  P  S   S    + +  +G 
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMAASRGSNNTQIPNFASSNPKTSPYSSKSTYNSHSFNGS  60

Query  1636  FRSG-----KTSGQQNY-DNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnn  1475
             F          S  QN+ D+ DIFGG F  ++  T+     D D+ F  + N N  +   
Sbjct  61    FMDDHETLRSNSKSQNFGDDFDIFGG-FQKNSKQTSTGFGFDYDSVFSSTKNSNAKSSFY  119

Query  1474  sNL-------------RDEFDFFGS-------APKPSDSVDDLFGNLGFKSGGLKKTAVQ  1355
              ++              D  D FG+       A K    VDDL G  G K   LK  +  
Sbjct  120   DDIFGGLNVSSSTVNNNDNDDIFGAFTSSSSKAAKQRAPVDDLLGGFGTK---LKPPSRN  176

Query  1354  NVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSS  1175
                  DDLIPGFG        +  S S++ ++ +   + T  +DPF V E T     +S+
Sbjct  177   GSVGYDDLIPGFG--------SSKSSSKEENIRTTTPAFTSTEDPFVVLEQTSTKTKLST  228

Query  1174  WPSSDPLEKLAETNPS-----------------------------------IDELEDFVS  1100
                 DPLE+  + N S                                   IDELEDF  
Sbjct  229   ----DPLEEFGKFNHSGRAESTVLSNRSLPLRPPPKPGQVLKTGKSSDVFAIDELEDFAM  284

Query  1099  GRGTSTSQGQQHYVSRKESNVKKTHSAGDIL----SNTST---------DHMFDGLFNNN  959
              R  + +    +   R    VK++    ++     S +S+         D +FD   N  
Sbjct  285   VRMQTNAHSGSN--GRHAREVKESADDLELFFGRGSRSSSVPKSRHEVPDPLFDAKINAK  342

Query  958   GGGTKDKWTSH--GTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRA  785
             G   K ++ +    T S G  K+  KN + D SS     + S   EF EV+GES ERRRA
Sbjct  343   G---KPEFPTKKSSTSSPGIRKTSAKNVIGDLSSIFGDAMLSG--EFEEVDGESEERRRA  397

Query  784   RLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLS  605
             R + H RTR+RM +A+A+ NQRD QT  EQ+E+ R+A+ +D +IK WAAGKEGNLRALLS
Sbjct  398   RWDRHQRTRDRMEQAVADMNQRDRQTLHEQEERRRIADKMDVQIKHWAAGKEGNLRALLS  457

Query  604   SLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFD  425
             SLQYVLWP+C W+ VSLTDLITSTSVKKVY KATLCVHPDKVQQK A++++K+IAEKVFD
Sbjct  458   SLQYVLWPDCDWEPVSLTDLITSTSVKKVYRKATLCVHPDKVQQKGATIQQKFIAEKVFD  517

Query  424   ILKEAFGKFNAEEL  383
              LKEA+ KF+ EEL
Sbjct  518   TLKEAWNKFSKEEL  531



>emb|CDY00396.1| BnaC07g14300D [Brassica napus]
Length=524

 Score =   273 bits (697),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 210/542 (39%), Positives = 287/542 (53%), Gaps = 88/542 (16%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSG---QKSSHNSDPYDL--DGV  1637
             MDEFGVL ERYG+K +G S P+A  K     +  + N  G   + +S++S+   +  D +
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMAASKRPPNNAPSWKNLGGVNPKSTSYSSNKVSVNDDDI  60

Query  1636  F-------RSGKTSGQQNYDNSDIFGGQF--PSSNSTTAQQSHVDLDTFFKGSTnqngnn  1484
             F       R+G +SG   +D+ D+FGG    P + S++     +   T F   T+ + ++
Sbjct  61    FFTSSSTNRNGSSSG--GFDDFDVFGGGLNKPDTKSSSLNDDDLMFSTNFGMKTSSSSSS  118

Query  1483  rnnsNLRDEFDFFGSAPKPSDSV--DDLFGNLGFKSGGLKKTAVQNVHDS-DDLIPGFGF  1313
              +     D  D FG+ P  + SV  DD+FG     + G+      +  +  D+LIPGFG 
Sbjct  119   SSAQGFAD-VDLFGAVPVSNSSVGNDDIFGAFSQDAAGVDDLLGGSGKNGFDELIPGFG-  176

Query  1312  HSNSEKSARTSHSQQSSVHSYKQSSTFAD-DPFSVFESTPPVQNVSSWPSSDPLEKLAET  1136
                         S Q++      SS FAD DPF V EST    + SS    DPL+  A +
Sbjct  177   -----------GSSQTTSSKTTASSNFADADPFVVLESTTSAPHSSSGLFVDPLDVFAAS  225

Query  1135  ------NPS---------------------------IDELEDFVSGRGTSTSQGQQHYVS  1055
                    PS                           IDELEDF  G  TST+  +    S
Sbjct  226   VTSQGKKPSQSSSTKLKPPPKPTPKVDRVKSSGLSSIDELEDFAMG-STSTTMRRSASAS  284

Query  1054  RKESNVKKTHSAGDILSNTSTDHMFDGLFN---NNGGGTKDKWTSHGTQ-----------  917
                S  ++   AG        D + D  F+    +    K + T+  T+           
Sbjct  285   DTASKFREAEDAGTKTKQFGVDDL-DSFFSAGHRSSSVPKSRATTEATRKQAAVNVPKKT  343

Query  916   ----STGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERM  749
                 S+ K   P  N VDDFS+   GD      EF E+ GES ERR+AR +   RT+ R+
Sbjct  344   PNGVSSAKKPPPPANLVDDFSALFGGDPIFR--EFEEIPGESDERRKARWDREQRTKSRV  401

Query  748   ARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGW  569
             A+A+A+ N RD Q++ EQ+ ++R++E++D EI+RWA GKEGN+RALLSSLQ VLWP CGW
Sbjct  402   AQAVADMNSRDHQSRIEQEHRTRISESVDAEIRRWATGKEGNMRALLSSLQIVLWPGCGW  461

Query  568   QAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAE  389
             +AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L +K+IAEKVFDILKEA+ KFN E
Sbjct  462   EAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKFIAEKVFDILKEAWNKFNKE  521

Query  388   EL  383
             EL
Sbjct  522   EL  523



>ref|XP_008219589.1| PREDICTED: auxilin-related protein 2 isoform X1 [Prunus mume]
Length=585

 Score =   275 bits (702),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 234/599 (39%), Positives = 302/599 (50%), Gaps = 141/599 (24%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQ---KSSHNSDP--------  1655
             MDEFGVL E+YG+K +G S P+A   A  +P+S   ND+      +  NS+P        
Sbjct  1     MDEFGVLTEQYGLKPQGKSAPMA---ASKRPTSA--NDTQAWNFVADSNSNPKTSSYSSR  55

Query  1654  -------------YDL-DGVFRSGKTSGQQNY----DNSDIFGGQFPSSNSTTAQQSHVD  1529
                          +D  DG+F+SG     +++    D  DIFGG       T   +   +
Sbjct  56    SPPPNSNSDYASFFDAQDGLFQSGSNDKTRSFGGLDDYDDIFGGPV---KPTKHSEGSFN  112

Query  1528  LDTFFKGSTnqngnnrnnsNLRDEF-------------------DFFGS---APKPSDSV  1415
              D+ F GS  ++ +     +  D F                   D FGS   APK S +V
Sbjct  113   FDSLFSGSNAKSSSFNGYEDAYDVFGGMPGLKSPGSGKSNAKGDDIFGSFASAPKQSATV  172

Query  1414  DDLFGNLGFKSGGLKKTAVQNVH----------------DSDDLIPGFG--FHSNSEKSA  1289
             DDL G+L   SG  +K    NV                 D DDLIPGFG    SN+   A
Sbjct  173   DDLLGDL---SGIRQKLQTLNVKNDKNVNRSAKVGKNGGDFDDLIPGFGGSAPSNNGTYA  229

Query  1288  RTSHSQQSSVHSYKQS-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN-------  1133
             + +H QQS+VHS K + S+  DDPF V ES     +  ++ SSD   +L + +       
Sbjct  230   QENHRQQSTVHSTKSNFSSSLDDPFVVLESVSTSTSTPAYDSSDIFSELEQISKFSNSAG  289

Query  1132  ---------------------------------PSIDELEDFVSGRGTSTSQGQQHYVSR  1052
                                               SIDELE+F  G   + + G+ ++ S 
Sbjct  290   AKLGVSSNSSTKLKSPPKSAQVSKGDKERSSGVSSIDELEEFAKGTVQNNATGRTNFHSH  349

Query  1051  KE---SNVKKTHSAGDIL----SNT---------STDHMFDGLFNNNGGGTKDKWTSHGT  920
             ++   S  ++  S+ D L    SN+         + D +FD   NN GG  + + TS GT
Sbjct  350   EDVETSATRRGRSSEDDLMGFRSNSVPRSWAAPATLDPVFDAPTNNRGG-PRPQGTS-GT  407

Query  919   QSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARA  740
              S+ K  S      DD  S           E  EVEGES ERR+ARL  H R  ER  +A
Sbjct  408   SSSMKKSSSATGIFDDLFSMNGASPAFVEFE--EVEGESEERRKARLGRHQRAHERALQA  465

Query  739   LAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAV  560
             +A+ NQRD +TQQEQDEK R+AE L+ +IK W+ GKEGN+RALLSSLQ VLWPE GW+ V
Sbjct  466   VADMNQRDRKTQQEQDEKRRIAETLNIKIKSWSYGKEGNMRALLSSLQSVLWPESGWEPV  525

Query  559   SLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             SLTDLITS SVKKVY KATLC+HPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  526   SLTDLITSGSVKKVYRKATLCIHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  584



>ref|XP_007019170.1| Chaperone DnaJ-domain superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY16395.1| Chaperone DnaJ-domain superfamily protein, putative isoform 1 
[Theobroma cacao]
Length=561

 Score =   273 bits (699),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 194/483 (40%), Positives = 241/483 (50%), Gaps = 100/483 (21%)
 Frame = -1

Query  1654  YDLDG-VFRSGKTSGQQN-YDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnr  1481
             +DLD  +F SG  S   N Y   D+FGG   S NS+                        
Sbjct  119   FDLDSMLFNSGPKSSSTNLYVVDDLFGGMPGSENSSN-----------------------  155

Query  1480  nnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHD-------SDDLIPG  1322
                   D    F S+ K   S  DL G+    +  LK ++ +N  D        DDLIPG
Sbjct  156   -----DDIIGSFASSTKQKGSAGDLLGDFSGVAAKLKSSSRKNSWDWGKTEAGFDDLIPG  210

Query  1321  FGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLA  1142
             FG          +  + ++++ + K +    +DPF V ES       SS   +DPLE+ +
Sbjct  211   FG--------GSSPPANRTNIKTTKSTFKSTEDPFVVLESASSSAYNSSETPTDPLEEFS  262

Query  1141  ETNPS-------------------------------------IDELEDFVSGR--GTSTS  1079
               N S                                     IDELEDF  GR    ++ 
Sbjct  263   MLNESGGSKLRGSSNASRSLRPPPKPAQVLKADKVKSSGASPIDELEDFAMGRVFNKASR  322

Query  1078  QGQQHYVSRKES-----------NVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWT  932
               +   V+RK              V    ++      T+ D MFD   +      + + T
Sbjct  323   SKEAEDVARKNQEKRADDLESFFGVSSRSNSAPKSRATTLDPMFDAHTHQ-----RQQKT  377

Query  931   SHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRER  752
             S G  ST K  SP          S        F EF EV+GES ERRRARL  H RT++R
Sbjct  378   SPGASSTAKKSSPATMMNGVDDLSSIFGAAPMFGEFEEVDGESEERRRARLGRHQRTQDR  437

Query  751   MARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECG  572
             +ARA+A+ NQRD QTQ EQ+E+ R+AEA+D EIKRWAAGKEGN+RALLSSLQ VLWPECG
Sbjct  438   VARAVADMNQRDRQTQHEQEERRRIAEAMDFEIKRWAAGKEGNVRALLSSLQQVLWPECG  497

Query  571   WQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNA  392
             W+ +SLTDLITS SVKKVY KATLCVHPDKVQQK A+L +KYIAEKVFDILKEA  KFN 
Sbjct  498   WEPISLTDLITSGSVKKVYRKATLCVHPDKVQQKGATLEQKYIAEKVFDILKEASNKFNK  557

Query  391   EEL  383
             EEL
Sbjct  558   EEL  560



>emb|CDY04660.1| BnaC05g16980D [Brassica napus]
Length=479

 Score =   269 bits (687),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 206/515 (40%), Positives = 268/515 (52%), Gaps = 79/515 (15%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPN--------DSGQKSSHNSDPYDL  1646
             MDEFGVL ERYG+K +G S P+A     SK S   PN         S  K S N   Y+ 
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMA----ASKRSHSTPNPQTWKSYASSSNKVSGNGSSYNG  56

Query  1645  DGVFRSGKTSGQQNYDNS---DIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnn  1475
             D +F +  +S   N  +S   D+FGG   + NS +A   H D D F   ++  N      
Sbjct  57    DDIFFTSSSSTTMNGASSGGFDVFGG-MNNKNSKSAHGFHAD-DLFGAPNSVGND-----  109

Query  1474  sNLRDEFDFFGSAPKPSDSVDDL---FGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSN  1304
                 D F  F S+ K    VDDL   FG  GF                D+LIPGFG  S+
Sbjct  110   ----DVFGSFSSSTKQYAPVDDLLARFGKNGF----------------DELIPGFGATSH  149

Query  1303  SEKSARTS------------HSQQSSVHSYKQSSTFADDPFSVFEST------PPVQNVS  1178
             + +S  T+             S  S  HS   SS    DP   F ++       P  N S
Sbjct  150   ATRSKTTASNFVDADPFVVLESTMSRAHS---SSGMFVDPLDAFAASVSSQGHKPSYNAS  206

Query  1177  SW--PSSDPLEKLAETNPSIDELEDFVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDILS  1004
             +   P   P +K+     S+DEL+ F  G    ++         +E+   K     D+ S
Sbjct  207   TKLKPPPKPTQKVNRAKSSVDELDHFAMGTMRRSASASDAASKCREAEETKQFGVDDLDS  266

Query  1003  NTSTDHMFDGLFNNNGGGTKD--------KWTSHGTQSTGKSKSPLKNFVddfssslfgd  848
               S+      +  +               K T++G  S  K  +P  N VDDFS+    D
Sbjct  267   FFSSGPRSSSVPKSRTATQAPRKPAVNVPKKTANGVSSAKKPPAPA-NLVDDFSALFGED  325

Query  847   lgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEA  668
                   EF E+ GE+ ERR+AR +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E 
Sbjct  326   PLFK--EFEEIPGETEERRKARWDREQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISET  383

Query  667   LDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHP  488
              D EIKRWA GKEGN+RALLSSLQ VLWP CGW+AVSLTDLITS++VKKVY KATL VHP
Sbjct  384   ADAEIKRWATGKEGNMRALLSSLQIVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHP  443

Query  487   DKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             DKVQQK A+L +KYIAEKVFDILKEA+ KFN EEL
Sbjct  444   DKVQQKGATLEQKYIAEKVFDILKEAWNKFNKEEL  478



>ref|XP_004290908.1| PREDICTED: auxilin-related protein 1-like [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   271 bits (692),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 225/580 (39%), Positives = 300/580 (52%), Gaps = 135/580 (23%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPY-------DLD  1643
             MD+FGVL ER+G+K +G S P+A  ++ + P +   + S + +S+++          D +
Sbjct  1     MDDFGVLTERFGLKPQGKSAPMAASRSTTNPQTTSYSSSSKSNSNSNSNSAYASFLDDQN  60

Query  1642  GVFRSGKTSGQQNYDNSDIFGGQ--FPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsN  1469
             G F   ++S  QN   S  FGG        S  A+ S  DLD+ F GS+    +      
Sbjct  61    GFF--SQSSSTQNAAGSGGFGGYDFLGGGVSKPAKGSDFDLDSVFSGSSANTSS------  112

Query  1468  LRDEFDFFGS--------------------APKPSDS-VDDLFGNLGFKSGGLKK-----  1367
               D FD FGS                    APK S +  +DL G+LG    G+++     
Sbjct  113   FDDGFDVFGSSGGSVNSNVKDDDLFGSFASAPKQSAAPSNDLLGDLG----GVRRRLQSM  168

Query  1366  ------------TAVQNVHDSDDLIPGFGFHSNSEKSART--SHSQQSSVHSYKQS-STF  1232
                         TA +N  DSDDL+PGFG  S S   + T  S +QQS+V+  + + S+ 
Sbjct  169   NSNGNGNGNRYGTAARNATDSDDLLPGFGVTSASNSGSYTQESRTQQSTVNLTRSNFSSP  228

Query  1231  ADDPFSVFESTPPVQNVSSWPSSDPLEKL-------------------------------  1145
               DPF V ES      VSS   +D L+ L                               
Sbjct  229   MVDPFVVLES------VSSSGPADSLDYLSGLEQFSKMSNSGGAKQGGSSNSSTKLKAPP  282

Query  1144  --AETNPSIDELEDFVSGRGTSTSQGQQHYVSRKE----SNVKKTHSAGDILSNTSTDHM  983
               A+ +  ID+LE F S    +  +      SR +    S  +   S+GD L     D M
Sbjct  283   KPAQVSKDIDDLEIFAS---ATVPKSAPRVPSRNDGVESSATRHGKSSGDDL-----DFM  334

Query  982   F-----------------DGLFN---NNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfss  863
             F                 D +F+   +N GG + + TS  T  + K KSP  + + D   
Sbjct  335   FSTGFRSSSVPKSRVKKPDPIFDAQTDNRGGPRPQMTSSRTSGSMK-KSPSASGIFDDLF  393

Query  862   slfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKS  683
             S+ G      +   EVEGES ERR+ARL  H RT+ R  +A+A+ NQRD +TQQEQ+E+ 
Sbjct  394   SMDGGSSMVAEF-EEVEGESEERRKARLGRHQRTKARALQAVADMNQRDFRTQQEQEERR  452

Query  682   RLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKAT  503
             R+AE++D +IK WAAGKEGN+RALLSSLQYVLWPECGW+ VSLTDLITS SVKKVY KAT
Sbjct  453   RIAESMDTKIKSWAAGKEGNMRALLSSLQYVLWPECGWEPVSLTDLITSGSVKKVYRKAT  512

Query  502   LCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             L VHPDKVQQK ASL++KY AEKVFD+LKEA+ KFN EEL
Sbjct  513   LFVHPDKVQQKGASLQQKYTAEKVFDVLKEAWTKFNKEEL  552



>gb|KFK44269.1| hypothetical protein AALP_AA1G236200 [Arabis alpina]
Length=522

 Score =   268 bits (686),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 213/557 (38%), Positives = 280/557 (50%), Gaps = 120/557 (22%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSG--QKSSHNS-------DPYD  1649
             MDEFGVL ERYG+K +G S P+A  K    P++G   + G   KS+ NS       + Y 
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMAASKRPVNPNNGQSWNFGVNSKSTTNSSWNKESGNGYG  60

Query  1648  LDGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDL---------------DTFF  1514
              D +F +  +SG   +++ D+FGG     N TT+  +  DL               D  F
Sbjct  61    GDNIFFTSSSSG---FNDFDVFGGL----NKTTSSGNSNDLFGNLGNKTSSSLGGDDDLF  113

Query  1513  KGSTnqngnnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAV----QNVH  1346
                      +  + +  D F  F S+ K    VDDL G+ G K+    + +     +N +
Sbjct  114   --GVLPGSKSSVSVSNDDIFGSFSSSTKQYPVVDDLLGDFGTKTKSWNENSSVGMEKNAN  171

Query  1345  DSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD-DPFSVFESTPPVQNVSSWP  1169
             + ++L+PGFG             SQ +S  S    S FAD DPF V E T     +SS  
Sbjct  172   NFNELLPGFG-----------GTSQTTS--SKTPVSNFADTDPFVVLEPT-----ISSGL  213

Query  1168  SSDPLEKLAET-----------------------------------NPSIDELEDFVSG-  1097
               DPLE+ A +                                     SIDELEDF  G 
Sbjct  214   FVDPLEEFAASVSSQGKKPSNTSQASTKLKPPPKPTQKVERVKSSGMSSIDELEDFAMGT  273

Query  1096  ----RGTSTSQGQQHYVSRKESNVKKTHSAGDIL---------------SNTSTDHMFDG  974
                 R  S S     Y   +++  K      D L               S T+T+     
Sbjct  274   NAMRRSASASDTASKYREAEDAGTKTKQFGADDLDSIFSPGHRSSSVPKSRTTTEPTRKQ  333

Query  973   LFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVER  794
               N        K T +G  S  K  +P  N VDDFS+    D      EF E+ GES ER
Sbjct  334   AVN------VPKKTPNGVLSAKKPPAPA-NLVDDFSALFGEDPIFR--EFEEIPGESEER  384

Query  793   RRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRA  614
             R+AR +   RT+ R+A+A+A+ N RD Q++ EQ+E++R++E +D EI+RWA GKEGN+RA
Sbjct  385   RKARWDREQRTKSRVAQAVADMNNRDHQSRIEQEERTRISETVDAEIRRWATGKEGNMRA  444

Query  613   LLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEK  434
             LLSSLQ VLWP CGW+ VSLTDLITS++VKKVY KATL VHPDKVQQK A+L +KYIAEK
Sbjct  445   LLSSLQIVLWPGCGWETVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKYIAEK  504

Query  433   VFDILKEAFGKFNAEEL  383
             VFDILKEA+ KFN EEL
Sbjct  505   VFDILKEAWNKFNKEEL  521



>ref|XP_010095436.1| hypothetical protein L484_013393 [Morus notabilis]
 gb|EXB60128.1| hypothetical protein L484_013393 [Morus notabilis]
Length=546

 Score =   267 bits (683),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 207/559 (37%), Positives = 273/559 (49%), Gaps = 106/559 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPYDLDG----VF  1634
             MDEFGVL ERYG+K +G + P+A  K     ++    + G  S+ N  P ++ G    +F
Sbjct  1     MDEFGVLTERYGLKPQGKAAPMAASKIAVDNNNAQSWNFGVNSNINPKPSNVLGDQNRIF  60

Query  1633  RSGKTSGQQN------YDNSDIFGGQFPSSNS--TTAQQSHVDLDTFFKGS---------  1505
              S   S   N      YD  DIF    P   S       S  D ++FF  S         
Sbjct  61    DSIGDSKPYNNGASGHYD--DIFVHINPPKQSFAGGGGGSSFDYESFFSYSNGNTSSFHA  118

Query  1504  ------------TnqngnnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTA  1361
                            + +  N+SN  D F  F S PK S  +DDL G+        K ++
Sbjct  119   YGSDDIFDGMPGVKSSISANNDSNSDDIFGPFASPPKQSAPIDDLLGDFVQADAKPKGSS  178

Query  1360  VQNVHDSDDLIPGFGFHSNSEKSARTSHS-QQSSVHSYKQSSTFADDPFSVFESTPPVQN  1184
                  + DDLIPGFG +      + + HS +QS+ HS K + T ++DPF V EST    +
Sbjct  179   GNTTSNFDDLIPGFGDNIPPNDGSASKHSARQSTPHSTKSNFTSSEDPFIVLESTSVCTS  238

Query  1183  VSSWPSSDPL----EKLAETNPS------------------------------IDELEDF  1106
              +++ SSD L    E + + N S                              +DELEDF
Sbjct  239   KNAYASSDVLTDQMEGIDKLNKSGGIKPPRLKSPPIATQVSREPKVRSSDVSFLDELEDF  298

Query  1105  VSGRGTSTSQGQQHYVSRKESNVKKTHSAGDILSN------------------TSTDHMF  980
               G   + + G+ +           +HS+GD L +                  T+ D +F
Sbjct  299   ARGSVHNNANGRSN-----------SHSSGDDLESFFSVKHGPRSNSAPRSRTTTMDPLF  347

Query  979   DGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESV  800
             D   N  G    +        S    KSP  N V   +       G    +F EV G+S 
Sbjct  348   DAATNKRGVPRPE------VPSPSIKKSPSAN-VIVNNPFSVFGDGKMSGQFEEVRGDSD  400

Query  799   ERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNL  620
              RR+ +L+   +T+ERM  AL +  QRD Q QQEQ+E+ R+AE L+  IKRWAAGKEGN+
Sbjct  401   SRRKQKLDQQRKTQERMHNALNDMKQRDFQAQQEQEERHRIAETLNVGIKRWAAGKEGNI  460

Query  619   RALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIA  440
             RALLSSL YVLWPECGWQ V LTDLITS SVKKVY+KA LCVHPDKVQQK A++  K+ A
Sbjct  461   RALLSSLHYVLWPECGWQPVLLTDLITSDSVKKVYNKAKLCVHPDKVQQKGANIERKFTA  520

Query  439   EKVFDILKEAFGKFNAEEL  383
             EKVFDIL+EA+ KF  EEL
Sbjct  521   EKVFDILQEAWKKFEKEEL  539



>ref|XP_009149684.1| PREDICTED: auxilin-related protein 2 isoform X2 [Brassica rapa]
Length=487

 Score =   264 bits (675),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 216/545 (40%), Positives = 274/545 (50%), Gaps = 131/545 (24%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPN-------DSGQKSSHNSDPYDLD  1643
             MDEFGVL ERYG+K +G S P+A     SK S   PN        S  K S N D    D
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMA----ASKRSHNTPNWKSYASSSSSNKVSGNGD----D  52

Query  1642  GVFRSGKTSGQQNYDNS---DIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnns  1472
               F S  T+   N  +S   D+FGG   + NS ++  +H D                   
Sbjct  53    IFFTSSSTTTTMNGASSGDFDVFGG-MNNKNSKSSSSAHAD-------------------  92

Query  1471  NLRDEFDFFGSAPKPSDSVDDLFGNL---------------GFKSGGLKKTA--VQNVHD  1343
                   D FG+ P   ++ DD+FG+                GF  G LK     + N   
Sbjct  93    ------DLFGAMPTAPNNDDDIFGSFSSSTNQYPPVDDLLAGF--GALKSQTFNLNNSSA  144

Query  1342  SDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD-DPFSVFESTPPVQNVSSWPS  1166
             SD+LIPGFGF         TSHS+ ++       S F D DPF V EST    + SS   
Sbjct  145   SDELIPGFGFA--------TSHSKTTA-------SNFVDTDPFVVLESTMSGAHSSSGIF  189

Query  1165  SDPLEKLAET------NPS----------------------IDELEDFVSGRGTSTSQGQ  1070
              DPL+  A +       PS                      +DEL+DF  G GT      
Sbjct  190   VDPLDAFAASVSSQGQKPSNNTTHSSTKLKPPPKPTQKVNRVDELDDFAMG-GTMRRSAS  248

Query  1069  QHYVSRKESNVKKTHSAG-DIL---------------SNTSTDHMFDGLFNNNGGGTKDK  938
                 + K    ++T   G D L               S T+T+       N        K
Sbjct  249   ASDAASKYREAQETKQFGVDDLDSFFSSGPRSSSVPKSRTATEAPRKPAVN------VPK  302

Query  937   WTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTR  758
              T++G  S  K  +P  N VDDFS+    D      EF E+ GE+ ERR+AR +   RT+
Sbjct  303   KTTNGVSSAKKPPAPAANLVDDFSALFGEDPPIFK-EFEEIPGETEERRKARWDREQRTK  361

Query  757   ERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPE  578
              R+A+A+A+ N RD Q++ EQ++++R++E  D EIKRWA GKEGN+RALLSSLQ VLWP 
Sbjct  362   SRVAQAVADMNNRDHQSRIEQEQRTRISETADAEIKRWATGKEGNMRALLSSLQIVLWPG  421

Query  577   CGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKF  398
             CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L +KYIAEKVFDILKEA+ KF
Sbjct  422   CGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKYIAEKVFDILKEAWNKF  481

Query  397   NAEEL  383
             N EEL
Sbjct  482   NKEEL  486



>ref|XP_009149683.1| PREDICTED: auxilin-related protein 1 isoform X1 [Brassica rapa]
Length=495

 Score =   261 bits (668),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 216/553 (39%), Positives = 274/553 (50%), Gaps = 139/553 (25%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPN-------DSGQKSSHNSDPYDLD  1643
             MDEFGVL ERYG+K +G S P+A     SK S   PN        S  K S N D    D
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMA----ASKRSHNTPNWKSYASSSSSNKVSGNGD----D  52

Query  1642  GVFRSGKTSGQQNYDNS---DIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnns  1472
               F S  T+   N  +S   D+FGG   + NS ++  +H D                   
Sbjct  53    IFFTSSSTTTTMNGASSGDFDVFGG-MNNKNSKSSSSAHAD-------------------  92

Query  1471  NLRDEFDFFGSAPKPSDSVDDLFGNL---------------GFKSGGLKKTA--VQNVHD  1343
                   D FG+ P   ++ DD+FG+                GF  G LK     + N   
Sbjct  93    ------DLFGAMPTAPNNDDDIFGSFSSSTNQYPPVDDLLAGF--GALKSQTFNLNNSSA  144

Query  1342  SDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD-DPFSVFESTPPVQNVSSWPS  1166
             SD+LIPGFGF         TSHS+ ++       S F D DPF V EST    + SS   
Sbjct  145   SDELIPGFGFA--------TSHSKTTA-------SNFVDTDPFVVLESTMSGAHSSSGIF  189

Query  1165  SDPLEKLAET-----------------------NP-------------SIDELEDFVSGR  1094
              DPL+  A +                        P             S+DEL+DF  G 
Sbjct  190   VDPLDAFAASVSSQGQKPSNNTTHSSTKLKPPPKPTQKVNRAKSSVMSSVDELDDFAMG-  248

Query  1093  GTSTSQGQQHYVSRKESNVKKTHSAG-DIL---------------SNTSTDHMFDGLFNN  962
             GT          + K    ++T   G D L               S T+T+       N 
Sbjct  249   GTMRRSASASDAASKYREAQETKQFGVDDLDSFFSSGPRSSSVPKSRTATEAPRKPAVN-  307

Query  961   NGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRAR  782
                    K T++G  S  K  +P  N VDDFS+    D      EF E+ GE+ ERR+AR
Sbjct  308   -----VPKKTTNGVSSAKKPPAPAANLVDDFSALFGEDPPIFK-EFEEIPGETEERRKAR  361

Query  781   LNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSS  602
              +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E  D EIKRWA GKEGN+RALLSS
Sbjct  362   WDREQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISETADAEIKRWATGKEGNMRALLSS  421

Query  601   LQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDI  422
             LQ VLWP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L +KYIAEKVFDI
Sbjct  422   LQIVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKYIAEKVFDI  481

Query  421   LKEAFGKFNAEEL  383
             LKEA+ KFN EEL
Sbjct  482   LKEAWNKFNKEEL  494



>ref|XP_004502523.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Cicer arietinum]
Length=539

 Score =   263 bits (671),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 214/562 (38%), Positives = 283/562 (50%), Gaps = 113/562 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSS---------GFPNDSGQKSSHNSD---  1658
             MDEFGVL ER+G+K +G S P+A+ K +S P++         G  + S   S  N     
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSK-RSTPTTVSDSHFGSFGTGSGSNPMSPQNGSRSP  59

Query  1657  ---PYDLDGVFRSG----KTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTn  1499
                 +D D VF S     ++SG    D   IFGG    S S       +D D  F G  N
Sbjct  60    QYSAFDYD-VFASSDKKTQSSGGFGDDIDQIFGG---ISKSHVGNGVSIDDDPIFGGLNN  115

Query  1498  qngnnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGL---KKTAVQNVHDSDDLI  1328
                   +     D  D FG   + S  VDDL      K GGL    K+++   H  DDL+
Sbjct  116   SVSTPSSPPVYVD--DIFGGVNEKSVGVDDLLD----KIGGLHTNAKSSINQSHGFDDLL  169

Query  1327  PGFGFHS---NSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDP  1157
              GFG  S   N + S   +  ++ +V S+       DDPF VFE+T  +   SS    D 
Sbjct  170   GGFGVSSASNNGKASNEMNKPRKPTVTSH-------DDPFLVFETT--LSTASSESFLDS  220

Query  1156  LEKLAETN---------------------------------PSIDELEDFVSGR------  1094
             LE++++ N                                  S+DELE+F  GR      
Sbjct  221   LEQMSKLNNSKGTSGSSSTSPLLRPPPKSANASNSINNSSISSLDELENFAMGRVQNNAS  280

Query  1093  -GTSTSQGQQHYVSRKESN---------VKKTHSAGDILS---------------NTSTD  989
               T+T+ G+    S  ++N         V + + A D+ S                 + D
Sbjct  281   RKTNTNTGEIKQSSAAKTNKDKGSPATRVNQLNGADDLESFFSMGSRSNSVPKSRAATMD  340

Query  988   HMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEG  809
              MFD   N+ G     +    G+ +  K  S    F   F         S   +F EVEG
Sbjct  341   PMFDRQVNSKGKPEGSQKVPSGSPANAKKSS----FTTSFDDLSLIFGASPSSQFEEVEG  396

Query  808   ESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKE  629
             E+ ERR+ARL  H RT+ER  +A+A+ NQRDL+++ EQ+E+ R+A+ +D +IKRWAAGKE
Sbjct  397   ETEERRKARLGRHQRTQERALKAVADMNQRDLESKMEQEERRRIADTMDVQIKRWAAGKE  456

Query  628   GNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREK  449
             GN+RALLSSLQ VL P+ GWQ VSLTD+ITS SVKKVY KATLC+HPDKVQQK A+L +K
Sbjct  457   GNMRALLSSLQNVLSPDYGWQPVSLTDMITSASVKKVYRKATLCIHPDKVQQKGANLEQK  516

Query  448   YIAEKVFDILKEAFGKFNAEEL  383
             Y AEKVFDILKEA+ KFNAEEL
Sbjct  517   YTAEKVFDILKEAWTKFNAEEL  538



>emb|CBI21587.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
            S+D +FD  F N  G    + T+    ST +  S   N VDD SS       S   +F +
Sbjct  15   SSDPVFDTQFQNRRGPEVAR-TAASASSTMRKASSTTNIVDDLSSIFGAAPSSG--DFQD  71

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            VEGES +RRRARL  H RT+ER A+ALAEKNQRDLQ Q++Q E+ R+AE LD EIKRW+A
Sbjct  72   VEGESEDRRRARLERHQRTQERAAKALAEKNQRDLQAQRDQAERHRIAETLDVEIKRWSA  131

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK A+L
Sbjct  132  GKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKGANL  191

Query  457  REKYIAEKVFDILKEAFGKFNAEEL  383
            ++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  192  QQKYIAEKVFDLLKEAWNKFNSEEL  216



>ref|XP_006416279.1| hypothetical protein EUTSA_v10007304mg [Eutrema salsugineum]
 gb|ESQ34632.1| hypothetical protein EUTSA_v10007304mg [Eutrema salsugineum]
Length=540

 Score =   259 bits (663),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 212/568 (37%), Positives = 283/568 (50%), Gaps = 124/568 (22%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSK-----------PSSGF-PNDSGQKSSH---  1667
             MDEFGVL ERYG+K +G S P+A  K               P+SG     S   +SH   
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMAASKRSVNNPNNGQSWNFGPASGLNTTKSASYASHSSR  60

Query  1666  -----NSDPYDLDGVFRSGKTSGQQN-----YDNSDIFGG--QFPSSNSTTAQQSHVDLD  1523
                  N   YD + +F +  ++ +       +++ D+FGG  +  S NS ++    +   
Sbjct  61    NSESGNGSLYDDEDIFFTSSSTNRNGAKSTGFNDFDVFGGLNKTSSGNSKSSLNDDLMFS  120

Query  1522  TFFKGSTnqngnnrnnsNLRDEFDFFGSAP---------------------KPSDSVDDL  1406
             +F  G +    ++     + D  D FG  P                     K S +VDDL
Sbjct  121   SF--GKSGMKTSSSAQGFVTD--DLFGVMPGSKSSASVSNDEIFGSFSTSTKQSGAVDDL  176

Query  1405  FGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD  1226
              G++G   G   K  ++   D  +LIPGFG             +Q ++      S+  A 
Sbjct  177   LGDMG---GFGPKAKIEAGFD--ELIPGFG-----------GSTQTTTSSKTTTSNFDAA  220

Query  1225  DPFSVFESTP------PVQ----NVSSW---------------PSSDPLEKLAETN----  1133
             DPF V EST       P++    +VSS                P   P +K+        
Sbjct  221   DPFVVLESTTSGLFVDPLEEFAASVSSQGKKPSNTSQTSTKLKPPPKPTQKVDRVKGSGM  280

Query  1132  PSIDELEDFVSG---RGTSTSQGQQHYVSRKESNVKKTHSAGDIL---------------  1007
              SIDELEDF  G   R  S S     Y   +++  KKT    D L               
Sbjct  281   SSIDELEDFAMGTMRRSASASDTASKYREAEDAGTKKTEFGVDDLDSFFSSGPRSSSVPK  340

Query  1006  SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDE  827
             S T+T+       N        K T +G  S  K  +P  N VDDFS+    D      E
Sbjct  341   SRTTTETTRKQAVN------VPKKTPNGVSSVKKPPAPA-NLVDDFSALFGEDPIFR--E  391

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             F E+ GES ERR+AR +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E +D EIKR
Sbjct  392   FEEIPGESEERRKARWDREQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISETVDAEIKR  451

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             WA GKEGN+RALLSSLQ VLWP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK 
Sbjct  452   WATGKEGNMRALLSSLQIVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKG  511

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L +KYIAEKVFDILKEA+ KFN EEL
Sbjct  512   ATLEQKYIAEKVFDILKEAWNKFNKEEL  539



>ref|XP_011089568.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 2-like 
[Sesamum indicum]
Length=752

 Score =   261 bits (667),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 158/217 (73%), Gaps = 1/217 (0%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             +  SA    +NT TD +FD  F N GG    K T+  +     +     +  +    S  
Sbjct  536   RASSAPRARANT-TDSLFDQQFQNKGGSEAAKRTTSSSSGGSSNIKKASSTTNFDDLSSI  594

Query  853   gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLA  674
                  S  EF EVEGE+ ERRRARL+ H RT+ER A+ALAEKNQRDLQ Q+EQ+E+ R+A
Sbjct  595   FGAAPSSGEFQEVEGETEERRRARLDRHQRTQERAAKALAEKNQRDLQAQREQEERHRIA  654

Query  673   EALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCV  494
             E LD EIKRWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+
Sbjct  655   ETLDIEIKRWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCI  714

Query  493   HPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             HPDKVQQK A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  715   HPDKVQQKGATLQQKYIAEKVFDLLKEAWNKFNSEEL  751



>ref|XP_002890450.1| heat shock protein binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66709.1| heat shock protein binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   255 bits (652),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 212/561 (38%), Positives = 274/561 (49%), Gaps = 128/561 (23%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQK------SSHNSDPYDLDG  1640
             MDEFGVL ERYG+K +G S P+A  K         PN++GQ       S  N+       
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMAASKRN-------PNNNGQSWNFGTGSGLNAKSTSFSS  53

Query  1639  VFRSGKTSGQQN-YDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLR  1463
                  K S   + YD  DIF   FP+ NST    S+ D D F     + +  + + S+L 
Sbjct  54    NSSWNKESSNGSLYDGDDIF---FPA-NSTNRNGSN-DFDVFSGLKKSSSSGDNSKSSLN  108

Query  1462  DEFDF--FGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQN-----------------VHD-  1343
             D+  F  FG+  K +   DDLFG  G   G     +V+N                 V D 
Sbjct  109   DDLLFSNFGNLGKKTSDNDDLFG--GVMPGSKISASVKNDDLFGSFSSSEKQYAAAVDDL  166

Query  1342  --------SDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQ  1187
                      D LIPGFG             S Q+++      +  A DPF V EST    
Sbjct  167   LGGKNEAGYDGLIPGFG------------GSSQTTISKTTPLNFDATDPFVVLEST----  210

Query  1186  NVSSWPSSDPLEKLAET--------------------------------NP---SIDELE  1112
               S+    DPLE+ A +                                +P   SIDELE
Sbjct  211   -TSTGLFVDPLEEFAASVSSQGKKPSNTSQTSTKLKPPPKPTQKVNRGKSPEMSSIDELE  269

Query  1111  DFVSG---RGTSTSQGQQHYVSRKESNVKKTHSAGDIL---------------SNTSTDH  986
             DF  G   R  S S     Y   +++  K      D L               S T+T+ 
Sbjct  270   DFAMGTMRRSASASDTASKYREAEDAGTKNKQFGVDDLDSFVSAGPRSSSVPKSRTTTET  329

Query  985   MFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGE  806
                   N        K T +G  +  K  +P  N VDDFS+    D      +F E+ GE
Sbjct  330   TCKQASNT------PKKTPNGVSNAKKPPAP-ANLVDDFSALFGEDPIFR--QFEEIPGE  380

Query  805   SVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEG  626
             S ERR+AR +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E +D EI+RWA GKEG
Sbjct  381   SEERRKARWDREQRTKSRVAQAVADMNNRDHQSRVEQEQRTRISETVDAEIRRWATGKEG  440

Query  625   NLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKY  446
             N+RALLSSLQ VLWP CGW+ VSLTDLITS++VKKVY KATL VHPDKVQQK A+L +KY
Sbjct  441   NMRALLSSLQIVLWPGCGWETVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKY  500

Query  445   IAEKVFDILKEAFGKFNAEEL  383
             IAEKVFDILKEA+ KFN EEL
Sbjct  501   IAEKVFDILKEAWNKFNKEEL  521



>ref|XP_010270274.1| PREDICTED: auxilin-related protein 2-like [Nelumbo nucifera]
Length=968

 Score =   263 bits (673),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            T++D +FD  F N GG    + TS  T S+ +  S   N VDD +S   G   S   EF 
Sbjct  765  TTSDPVFDTQFQNKGGPDGTRKTSF-TSSSMRKASSTTNIVDDLTSIFGGSPSSG--EFQ  821

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            E+EGES ERR+AR   H RT+ER A+ALAEKNQRDLQTQ+EQ E+ R+AE LD EIKRWA
Sbjct  822  EIEGESEERRKARWERHQRTQERAAKALAEKNQRDLQTQREQAERHRIAETLDVEIKRWA  881

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLITS SVKKVY KATLC+HPDKVQQK A+
Sbjct  882  AGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITSASVKKVYRKATLCIHPDKVQQKGAN  941

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  942  LQQKYIAEKVFDLLKEAWNKFNSEEL  967


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 72/134 (54%), Gaps = 10/134 (7%)
 Frame = -1

Query  1462  DEFDFFGSAPKPSDSVDDLFGNLG-----FKSGGLKKTAV--QNVHDSDDLIPGFGFHS-  1307
             D F    S PK + + DDL GNL      FKS   K++    +++   DDLIPGFG  S 
Sbjct  169   DVFSSMSSPPKQT-AFDDLLGNLTGKEPEFKSSSGKRSGKVEKDLPGFDDLIPGFGGSSP  227

Query  1306  -NSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETNP  1130
              N+  +++ S  QQS+V S K +++  +DPF V EST      SS   +DPLE +++T+ 
Sbjct  228   SNNRGTSKASQRQQSTVPSSKSTASMMEDPFVVLESTSTTAYSSSDMFTDPLEHMSKTSN  287

Query  1129  SIDELEDFVSGRGT  1088
             S     D   GRG 
Sbjct  288   SGSTKIDPSIGRGV  301



>ref|XP_008466755.1| PREDICTED: auxilin-related protein 2 isoform X2 [Cucumis melo]
Length=430

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 178/408 (44%), Positives = 225/408 (55%), Gaps = 73/408 (18%)
 Frame = -1

Query  1417  VDDLFGNLGFKSGGLK--------KTAVQNVHDSDDLIPGFGFHSN--SEKSARTSHSQQ  1268
             +DDLFG+  F S  +K        K+A  N    D+LI GF    +  +  S + + +QQ
Sbjct  33    IDDLFGD--FSSNVVKPTPNPNGLKSAPNNAAPFDELISGFDDSKSRINRASMQDNLTQQ  90

Query  1267  SSVHSYKQSSTFADDPFSVFEST--PPVQNVSSWPSSDPLEKLAETN-------------  1133
             ++ HS K + + A DPF   ES   P   +  ++P  DPLE++ + N             
Sbjct  91    ATSHS-KSTFSSARDPFIELESASIPSYNSSEAFP--DPLEEMTKFNNKFDNSYNSSPPF  147

Query  1132  --------------PSIDELEDFVSGRGTSTSQGQQHYVSRKES-NVKKTHSAG------  1016
                             IDELEDF  G+  + S+G     +R  S N    H+AG      
Sbjct  148   RVPPVPKPVKSSSSSPIDELEDFAKGKVRNNSEGNVDASTRTTSKNSNDAHTAGLNHQKT  207

Query  1015  --DILS---------------NTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLK  887
               D+ S                T+ D +FD +   N      K T   + S  K  S   
Sbjct  208   VDDLDSFFNVGPRSKSAPRSRTTTPDPLFD-VPKYNKPPEIPKPTPSASFSHIKKSSSAV  266

Query  886   NFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQT  707
             NFVDD         G     F EV+GES ERRRARL    RT+ER ARA+A+ N+RD QT
Sbjct  267   NFVDDLFFGGSPSFG----HFEEVDGESEERRRARLGRLQRTQERAARAVADLNERDFQT  322

Query  706   QQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSV  527
             Q EQ+EK R+AE+LD +IKRWAAGKEGN+RALLSSLQYVLW  CGW+ VSLTD+ITSTSV
Sbjct  323   QHEQEEKRRIAESLDVDIKRWAAGKEGNMRALLSSLQYVLWSGCGWEPVSLTDMITSTSV  382

Query  526   KKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             KKVY KA LC+HPDKVQQK AS+ +KY AEKVFDILKEA+ KF+ EEL
Sbjct  383   KKVYRKAVLCIHPDKVQQKGASIEQKYTAEKVFDILKEAWNKFSKEEL  430



>emb|CDY01318.1| BnaA07g10910D [Brassica napus]
Length=514

 Score =   254 bits (649),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 214/548 (39%), Positives = 280/548 (51%), Gaps = 110/548 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPYDLDGV-----  1637
             MDEFGVL ERYG+K +G S P+A   A  +P +  P     +S +N     L GV     
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMA---ASKRPPTTTP-----QSLNN-----LGGVNPKST  47

Query  1636  -FRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLRD  1460
              + S K S   ++D   +FGG   +  + T   S  D D  F  +     ++ +     D
Sbjct  48    SYSSNKVSVNDDFD---VFGGGL-NKPTNTKSSSLNDDDLMFSNNFGMKTSSSSARGF-D  102

Query  1459  EFDFFGSAP-------------------KPSDSVDDLFGNLGFKSGGLK-KTAVQNVHDS  1340
             + D FG+ P                   + +  VDDL G++G    GL+ KT  Q+    
Sbjct  103   DVDLFGAVPVSVGVGNDDIFGAFSSSTKQDAAGVDDLLGDMG--GFGLESKTWNQSSSGK  160

Query  1339  ---DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD-DPFSVFESTPPVQNVSSW  1172
                D+LIPGFG             S Q++      SS FAD DPF V EST      SS 
Sbjct  161   NGFDELIPGFG------------GSSQTTSSKTSASSNFADADPFVVLESTTSAARSSSG  208

Query  1171  PSSDPLEKLAET-----------------NP-------------SIDELEDFVSG-----  1097
                DPL++ A +                  P             SIDELEDF  G     
Sbjct  209   LFVDPLDEFAASVSSQGKKPSNTKLKPPPKPTQKVDRVKSSGLSSIDELEDFAMGSSTMR  268

Query  1096  RGTSTSQGQQHYVSRKESNVKKTH-SAGDILSNTSTDHMFDGL---------FNNNGGGT  947
             R  S S     +   +++  KK    A D+ S  S+ H    +                 
Sbjct  269   RSASASDTASKFREAEDAGTKKQQFGADDLDSFFSSGHRSSSVPKSRATTEATRKQAAVN  328

Query  946   KDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHT  767
               K T +G  S  K  +P  N VDDFS+   GD      EF E+ GES ERR+AR +   
Sbjct  329   VPKKTPNGVSSAKKPPAP-ANLVDDFSALFGGDPIFR--EFEEIPGESDERRKARWDREQ  385

Query  766   RTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVL  587
             RT+ R+A+A+A+ N RD Q++ EQ++++R++E +D EI+RWA GKEGN+RALLSSLQ VL
Sbjct  386   RTKSRVAQAVADMNNRDHQSRIEQEQRTRISEGVDAEIRRWATGKEGNMRALLSSLQIVL  445

Query  586   WPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAF  407
             WP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L +KYIAEKVFDILKEA+
Sbjct  446   WPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKYIAEKVFDILKEAW  505

Query  406   GKFNAEEL  383
              KFN EEL
Sbjct  506   NKFNKEEL  513



>gb|KEH35332.1| DnaJ domain protein [Medicago truncatula]
Length=521

 Score =   254 bits (649),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 206/548 (38%), Positives = 290/548 (53%), Gaps = 101/548 (18%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPS----SGFPNDSGQKSSHNSDPYDLDGVF  1634
             MDEFGVL ERYG+K +G S P+A++K +S P+    S F + +G +S  +S  +D D   
Sbjct  1     MDEFGVLTERYGLKPQGKSAPMASIK-RSTPTPPTNSHFQSQNGSRSPQHST-FDFDFGV  58

Query  1633  RSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLRDEF  1454
             +   + G  +  + DIFGG   ++ S        D D  F   +  + +++   +     
Sbjct  59    KPQHSGGFGDAID-DIFGG---NTKSKVGYGVSFDDDPIFGSVSTSSSSSQVYVD-----  109

Query  1453  DFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEKSARTSHS  1274
             D FG   + +  VDDL  N+G       K++++  HD  D + GFG  S        S++
Sbjct  110   DIFGGVNQKTVGVDDLLNNIGGLHATNSKSSIKKSHDFGDFMSGFGGSS-------VSNN  162

Query  1273  QQSSV---HSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETNPS--------  1127
              ++S+   +  K ++T  DDPF VFE++    +  S+   D LE++ + +          
Sbjct  163   GKASIEKNNPRKPTATPHDDPFLVFETSSSTASSESF--LDSLEQITKNSSKHTSGSSST  220

Query  1126  -------------------------IDELEDFVSGR---------GTSTSQGQQHYVSRK  1049
                                      IDELE+F  GR          T+T + +Q+  ++ 
Sbjct  221   SPLLRPPPKPVNASNSINNSSLSSSIDELENFAKGRVQSNPSRKANTNTGEIKQNSAAKP  280

Query  1048  -------ESNVKKTHSAGDILS---------------NTSTDHMFDGLFNNNGGGTKDKW  935
                     + V + + A D+ S                T  D MFD   N+       K 
Sbjct  281   VKDRGAPAARVNQLNGADDLESFFSMGSRSSSAPKSRTTPVDPMFDRQVNS-------KV  333

Query  934   TSHGTQ--STGKSKSPLK-NFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTR  764
                G+Q   +G   +P K +F   F         S   EF EVEGE+ ERR+ARL  H R
Sbjct  334   KHEGSQRGPSGSPANPKKPSFTSSFDDLSLIFGASQSSEFEEVEGETEERRKARLGRHQR  393

Query  763   TRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLW  584
             T+ER  +A+A+ NQRDLQ++ EQ+E+ R+A+ +D +IKRWAAGKEGN+RALLSSLQ VL 
Sbjct  394   TQERALKAVADMNQRDLQSKLEQEERRRIADTVDVQIKRWAAGKEGNMRALLSSLQNVLS  453

Query  583   PECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFG  404
             P+ GWQ VSLTD+ITS SVKKVY KATLC+HPDKVQQK ASL +KY AEKVFDILKEA+ 
Sbjct  454   PDYGWQPVSLTDMITSASVKKVYRKATLCIHPDKVQQKGASLEQKYTAEKVFDILKEAWT  513

Query  403   KFNAEELR  380
             KFNAEELR
Sbjct  514   KFNAEELR  521



>gb|EPS68726.1| hypothetical protein M569_06042, partial [Genlisea aurea]
Length=158

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF+E+EGE  ERRRARLN H R  ERMA ALAEKNQRD Q QQEQDEK RLAE LD +IK
Sbjct  9    EFNEIEGEPEERRRARLNRHIRINERMAEALAEKNQRDHQLQQEQDEKRRLAETLDHDIK  68

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKE NLRALLSSLQ VLWPECGW+ VSLTD+I+S SVKKVY KA+LC+HPDKVQQK
Sbjct  69   RWAAGKEANLRALLSSLQEVLWPECGWRGVSLTDMISSESVKKVYKKASLCIHPDKVQQK  128

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEELR  380
             A+L +KYIAEKVFD+LKEA+ KF+A+ELR
Sbjct  129  GANLEQKYIAEKVFDVLKEAWNKFSADELR  158



>gb|EYU36870.1| hypothetical protein MIMGU_mgv1a001096mg [Erythranthe guttata]
Length=890

 Score =   260 bits (665),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 158/208 (76%), Gaps = 4/208 (2%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGG--GTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDE  827
            ++TD   D  F N G    TK   TS G  S  K  SP  NFVDD SS   G   +   E
Sbjct  684  STTDPFSDQQFQNKGASEATKRPPTSSGASSNIKKASPTPNFVDDLSSIFGGAPSAV--E  741

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F E+EGE+ ERRRARL+   RT+ER A+ALAEKNQRDLQ Q++Q+E++R+ E LD EIKR
Sbjct  742  FQEIEGETDERRRARLDRQQRTQERAAKALAEKNQRDLQAQRDQEERNRIGETLDFEIKR  801

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS++QYVLWPECGW  VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  802  WAAGKEGNLRALLSTMQYVLWPECGWTPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  861

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  862  ATLQQKYIAEKVFDLLKEAWNKFNSEEL  889



>ref|XP_002307457.2| hypothetical protein POPTR_0005s20410g [Populus trichocarpa]
 gb|EEE94453.2| hypothetical protein POPTR_0005s20410g [Populus trichocarpa]
Length=537

 Score =   253 bits (646),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 221/562 (39%), Positives = 299/562 (53%), Gaps = 115/562 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA------NLKAKSKPSSGFPNDS-GQKSSHNSDPY---  1652
             MDEFGVL ER+G+K +G S P++      N + +  PSS   ++S   KS++NS+ Y   
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMSASRGTNNAQTRDFPSSNPKSNSYSSKSTYNSNSYNGS  60

Query  1651  ---DLDGVFRSGKTSGQQNY-DNSDIFGG-QFPSSNSTTAQQSHVD--------------  1529
                D + +F + K+   QN+ D+ DIFGG Q  S  ++T     +D              
Sbjct  61    FMDDRETLFSNSKS---QNFGDDFDIFGGFQKNSKQTSTGFAFDIDSVFSSTKSSSVQSS  117

Query  1528  -LDTFFKG--STnqngnnrnnsNLRDEFDFFGS-----APKPSDSVDDLFGNLGFKSGGL  1373
              +D  F G   ++ + NN NN+N  ++ D FG+       K S  V DL G  G K   L
Sbjct  118   FVDDIFGGLNGSSSSVNNNNNNNNNEDGDIFGAFTSSKGAKQSAPVKDLLGGFGTK---L  174

Query  1372  KKTAVQNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPP  1193
             K  +       DDLIPGFG  ++S K        + ++H+   + T ++DPF+V E T  
Sbjct  175   KPPSRNGSVGFDDLIPGFGPSNSSRK--------EKNMHTITTAFTSSEDPFAVLEQT--  224

Query  1192  VQNVSSWPSSDPLEKLAETNPS-----------------------------------IDE  1118
               + ++   +DPLE+  + N S                                   IDE
Sbjct  225   --STTTKSFTDPLEEFGKFNHSGRTKPAVSSNCSPPLRPPPKPGQVLKTGKVLDVSAIDE  282

Query  1117  LEDFVSGR----GTSTSQGQQHYVSRKESNVKKTHSAGDILSNTST---------DHMFD  977
             LEDF  GR      S S G  H+    + +     S    +S +S+         D +FD
Sbjct  283   LEDFAMGRMQNNARSVSNG--HHAGEVKQSADDLESFFGRVSQSSSVPKLRSGVLDPLFD  340

Query  976   GLFNNNGGG----TKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEG  809
                N  G       K    S G + T  + + L +       SL     +   EF EVEG
Sbjct  341   AKINGKGKPEFPFKKASSPSPGIRKTSSTTNALGDL------SLIFGDATLSGEFEEVEG  394

Query  808   ESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKE  629
             ES ERRRAR + H RTR+RM +A+A+ NQRDLQT  EQ+E+ R+A+ +D +IK WAAGKE
Sbjct  395   ESEERRRARWDRHQRTRDRMEQAVADMNQRDLQTLHEQEERRRIADKMDVQIKHWAAGKE  454

Query  628   GNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREK  449
             GNLRALLSSLQ+VLWPEC W+ VSLTDLITSTSVKKVY KATLCVHPDKVQQK A++++K
Sbjct  455   GNLRALLSSLQHVLWPECDWKPVSLTDLITSTSVKKVYRKATLCVHPDKVQQKGATIQQK  514

Query  448   YIAEKVFDILKEAFGKFNAEEL  383
             Y +EKVFDILKEA+ KF+ EEL
Sbjct  515   YTSEKVFDILKEAWNKFSKEEL  536



>ref|XP_008466754.1| PREDICTED: auxilin-related protein 2 isoform X1 [Cucumis melo]
Length=436

 Score =   249 bits (637),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 178/414 (43%), Positives = 225/414 (54%), Gaps = 79/414 (19%)
 Frame = -1

Query  1417  VDDLFGNLGFKSGGLK--------KTAVQNVHDSDDLIPGFGFHSN--SEKSARTSHSQQ  1268
             +DDLFG+  F S  +K        K+A  N    D+LI GF    +  +  S + + +QQ
Sbjct  33    IDDLFGD--FSSNVVKPTPNPNGLKSAPNNAAPFDELISGFDDSKSRINRASMQDNLTQQ  90

Query  1267  SSVHSYKQSSTFADDPFSVFEST--PPVQNVSSWPSSDPLEKLAETN-------------  1133
             ++ HS K + + A DPF   ES   P   +  ++P  DPLE++ + N             
Sbjct  91    ATSHS-KSTFSSARDPFIELESASIPSYNSSEAFP--DPLEEMTKFNNKFDNSYNSSPPF  147

Query  1132  --------------------PSIDELEDFVSGRGTSTSQGQQHYVSRKES-NVKKTHSAG  1016
                                   IDELEDF  G+  + S+G     +R  S N    H+AG
Sbjct  148   RVPPVPKPGHKAVKVKSSSSSPIDELEDFAKGKVRNNSEGNVDASTRTTSKNSNDAHTAG  207

Query  1015  --------DILS---------------NTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGK  905
                     D+ S                T+ D +FD +   N      K T   + S  K
Sbjct  208   LNHQKTVDDLDSFFNVGPRSKSAPRSRTTTPDPLFD-VPKYNKPPEIPKPTPSASFSHIK  266

Query  904   SKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKN  725
               S   NFVDD         G     F EV+GES ERRRARL    RT+ER ARA+A+ N
Sbjct  267   KSSSAVNFVDDLFFGGSPSFG----HFEEVDGESEERRRARLGRLQRTQERAARAVADLN  322

Query  724   QRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDL  545
             +RD QTQ EQ+EK R+AE+LD +IKRWAAGKEGN+RALLSSLQYVLW  CGW+ VSLTD+
Sbjct  323   ERDFQTQHEQEEKRRIAESLDVDIKRWAAGKEGNMRALLSSLQYVLWSGCGWEPVSLTDM  382

Query  544   ITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             ITSTSVKKVY KA LC+HPDKVQQK AS+ +KY AEKVFDILKEA+ KF+ EEL
Sbjct  383   ITSTSVKKVYRKAVLCIHPDKVQQKGASIEQKYTAEKVFDILKEAWNKFSKEEL  436



>ref|XP_009103287.1| PREDICTED: auxilin-related protein 2-like [Brassica rapa]
Length=515

 Score =   251 bits (642),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 210/552 (38%), Positives = 283/552 (51%), Gaps = 117/552 (21%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFP---NDSGQKSSHNSDPYDLDGVFR  1631
             MDEFGVL ERYG+K +G S P+A   A  +P +  P   N+ G  +  ++        + 
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMA---ASKRPPTTTPQSLNNLGVANPKSTS-------YS  50

Query  1630  SGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLR--DE  1457
             S K S   ++D   +FGG    +  T  + S ++ D     +      + ++S+ R  D+
Sbjct  51    SNKVSVNDDFD---VFGGGL--NKPTNTKSSSLNDDGLMFSTNFGMKTSSSSSSARGFDD  105

Query  1456  FDFFGSAP-------------------KPSDSVDDLFGNLGFKSGGLK-KTAVQNVHDS-  1340
              D FG+ P                   + +  VDDL G++G    GL+ +T  Q+     
Sbjct  106   VDLFGAVPVSVGVGNDDIFGAFSSSTKQDAAGVDDLLGDMG--GFGLESRTWNQSSSGKN  163

Query  1339  --DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD-DPFSVFESTPPVQNVSSWP  1169
               D+LIPGFG             S Q++      SS FAD DPF V EST    + SS  
Sbjct  164   GFDELIPGFG------------GSSQTTSSKTSASSIFADADPFVVLESTTSAAHSSSGL  211

Query  1168  SSDPLEKLAET-----------------NP-------------SIDELEDFVSG-----R  1094
               DPL++ A +                  P             SIDELEDF  G     R
Sbjct  212   FVDPLDEFAASVSSQGKKPSNTKLKPPPKPTQKVDRVKSSGLSSIDELEDFAMGSSTMRR  271

Query  1093  GTSTSQGQQHYVSRKESNVKKTHSAGDIL---------------SNTSTDHMFDGLFNNN  959
               S S     +   +++  KK     D L               S T+T+       N  
Sbjct  272   SASASDTASKFREAEDAGTKKQQFGADDLDSVFSSGHRSSSVPKSRTTTEATRKQAVN--  329

Query  958   GGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARL  779
                 + K T +G  S+ K   P  N VDDFS+   GD      EF E+ GES ERR+AR 
Sbjct  330   ----EPKKTPNGV-SSAKKPPPPANLVDDFSALFGGDPIFR--EFEEIPGESDERRKARW  382

Query  778   NHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSL  599
             +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E +D EI+RWA GKEGN+RALLSSL
Sbjct  383   DREQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISEGVDAEIRRWATGKEGNMRALLSSL  442

Query  598   QYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDIL  419
             Q VLWP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQ  A+L +KYIAEKVFDIL
Sbjct  443   QIVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQNGATLEQKYIAEKVFDIL  502

Query  418   KEAFGKFNAEEL  383
             KEA+ KFN EEL
Sbjct  503   KEAWNKFNKEEL  514



>ref|NP_173585.1| Chaperone DnaJ-domain superfamily protein [Arabidopsis thaliana]
 gb|AAD41419.1|AC007727_8 EST gb|AA042488 comes from this gene [Arabidopsis thaliana]
 gb|AAM20429.1| auxilin-like protein [Arabidopsis thaliana]
 gb|AAQ56825.1| At1g21660 [Arabidopsis thaliana]
 gb|AEE30136.1| Chaperone DnaJ-domain superfamily protein [Arabidopsis thaliana]
Length=523

 Score =   251 bits (640),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 210/559 (38%), Positives = 273/559 (49%), Gaps = 123/559 (22%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQ-------------------  1679
             MDEFGVL ERYG+K +G S P+A  K         PN++GQ                   
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMAASKRN-------PNNNGQSWNFGTGSSGLNAKSTSFS  53

Query  1678  ------KSSHNSDPYDLDGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTF  1517
                   K S N   +D D +F    ++ ++  ++ D+F G   SS+S    +S ++ D F
Sbjct  54    SNSSWNKDSTNGSLFDGDDIFFPANSTNRKVSNDFDVFAGLNKSSSSGDNSKSSLNDDLF  113

Query  1516  FKGSTnqngnnrnnsNLRDEFDFFGSAPKPSDSV--DDLFGNLGFKSGGLKKTAV-----  1358
             F  S   N      S+  D F       K SDSV  DDLFG+  F S   +  A      
Sbjct  114   F--SNFGNPGKTTPSSADDLFGGVIPGSKSSDSVKNDDLFGS--FSSSEKQYAAAVDDLL  169

Query  1357  ---QNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQ  1187
                +N    D LIPGFG  + +  S  T  +              A DPF V EST    
Sbjct  170   GLGKNEAGYDGLIPGFGGSTQTTSSKTTPSNFD------------ATDPFVVLEST----  213

Query  1186  NVSSWPSSDPLEKLAET-----------------------------------NPSIDELE  1112
               S+    DPLE+ A T                                     SIDELE
Sbjct  214   -TSTGLFVDPLEEFAATVSSQGIKPSNTSHTSTKLKPPPKPTQKVNRGKSVGMSSIDELE  272

Query  1111  DFVSG---RGTSTSQGQQHYVSRKESNVKKTHSAGDIL-------------SNTSTDHMF  980
             DF  G   R  S S     Y   +++  K      D L             S T+T+   
Sbjct  273   DFAMGTMRRSASASDTASKYREAEDAATKNKQFGVDDLDSFFSARSSSVPKSRTTTETTR  332

Query  979   DGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESV  800
                 N        K T +G  +  K  +P  N VDDFS+    D      +F E+ GES 
Sbjct  333   KQASN------APKKTPNGVSNAKKPPAP-ANLVDDFSALFGEDPIFR--QFEEIPGESE  383

Query  799   ERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNL  620
             ERR+AR +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E +D EI+RWA GKEGN+
Sbjct  384   ERRKARWDREQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISETVDTEIRRWATGKEGNM  443

Query  619   RALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIA  440
             RALLSSL  VLWP CGW+AVS+TDLITS++VKKVY KATL VHPDKVQQK A+L +KYIA
Sbjct  444   RALLSSLHIVLWPGCGWEAVSITDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKYIA  503

Query  439   EKVFDILKEAFGKFNAEEL  383
             EKVFDILKEA+ KFN EEL
Sbjct  504   EKVFDILKEAWNKFNKEEL  522



>ref|XP_010269037.1| PREDICTED: auxilin-related protein 2 [Nelumbo nucifera]
Length=1000

 Score =   259 bits (661),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 157/206 (76%), Gaps = 2/206 (1%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            T++D +FD  F N GG    +  S GT S  +  S   N VDD +S   G   S   EF 
Sbjct  796  TASDTLFDTQFQNRGGPDGTRNASFGTSSGMRKASSTTNIVDDLTSIFGGAPSSG--EFQ  853

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            EVEGES ERR+AR   H RT+ER A+ALA KN+RDLQTQ+EQ E+ R+AE LD EIKRWA
Sbjct  854  EVEGESEERRKARWERHQRTQERAAKALAVKNERDLQTQREQAERHRIAETLDVEIKRWA  913

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLITS SVKKVY KATL +HPDKVQQK A+
Sbjct  914  AGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITSASVKKVYRKATLFIHPDKVQQKGAN  973

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  974  LQQKYIAEKVFDLLKEAWNKFNSEEL  999


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 83/290 (29%), Positives = 122/290 (42%), Gaps = 69/290 (24%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSK-PSSG---FPNDSG------------QKS  1673
             MDEF G+L   +G + +G S P+A  K      SSG   F   SG             KS
Sbjct  1     MDEFPGILARDFGFRPQGKSAPMAASKGTGNLGSSGTLNFGIGSGGDTRSSSVSSNRPKS  60

Query  1672  SHNSDPY------DLDGVF------RSGKTSGQQNYDNSDIFGGQFPSSNSTTAQ-----  1544
               NS+        D DG+F      +S  + G   YD  D+FG     +N + ++     
Sbjct  61    GWNSNSVGGSFLDDHDGLFGSAGNQKSQDSGGLGGYD--DVFGAPPKYTNRSDSRGGASS  118

Query  1543  QSHVDLDTFFKGSTnqn------------------------gnnrnnsNLRDEFDFFGSA  1436
              S  D D+ F+GS + +                          + ++    D F    S 
Sbjct  119   TSTFDYDSIFQGSKDSSSKSPSLPVFDKPVYDDDIFDGLPGMKSSSSVKYDDVFSSISSP  178

Query  1435  PKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS-------DDLIPGFGFHS--NSEKSART  1283
             PK + + DDL G+L  K    K ++ +   D        DDLIPGFG  S  N   ++ T
Sbjct  179   PKQTAAFDDLLGSLSGKEPEFKSSSGKRPGDVEKDLPGFDDLIPGFGGSSTQNKRGTSET  238

Query  1282  SHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN  1133
             S  +Q +V S K +++  +DPF V EST      SS   +DPLE++ + N
Sbjct  239   SQREQPTVPSTKPTTSMMEDPFVVLESTSSPAYSSSDFFTDPLEQMGKPN  288



>ref|XP_010914449.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=927

 Score =   255 bits (652),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 154/206 (75%), Gaps = 2/206 (1%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            TS++ MFD      G       TS G+ ST K  S   N  DD SS       S   EF 
Sbjct  723  TSSETMFDTQAQGKGSSNAPWRTSSGSSSTMKKASSTTNITDDLSSIFGAPSSSG--EFQ  780

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            E+EGES ERR+AR   H RT ER A+ALAEKN+RDLQTQ+EQ E+ R+AE LD EIKRW+
Sbjct  781  EIEGESEERRKARFERHQRTLERAAKALAEKNERDLQTQREQAERHRIAETLDVEIKRWS  840

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK A+
Sbjct  841  AGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKGAN  900

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  901  LQQKYIAEKVFDLLKEAWNKFNSEEL  926



>emb|CDY08188.1| BnaA06g15380D [Brassica napus]
Length=487

 Score =   246 bits (629),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 206/540 (38%), Positives = 264/540 (49%), Gaps = 135/540 (25%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPN-------DSGQKSSHNSDPYDLD  1643
             MDEFGVL ERYG+K +G S P+A     SK S   PN        S  K S N D    D
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMA----ASKRSHNTPNWKSYASSSSSNKVSGNGD----D  52

Query  1642  GVFRSGKTSGQQNYDNS---DIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnns  1472
               F S  T+   N  +S   D+FGG   + NS ++  +H D                   
Sbjct  53    IFFTSSSTTTTMNGASSGDFDVFGGMN-NKNSKSSSSAHAD-------------------  92

Query  1471  NLRDEFDFFGSAPKPSDSVDDLFGNL---------------GFKSGGLKKTAVQNVHDSD  1337
                   D FG+ P   ++ DD+FG+                GF +   K   + N   SD
Sbjct  93    ------DLFGAMPTAPNNDDDIFGSFSSSTNQYPPVDDLLAGFGALNSKTFNLNNSSASD  146

Query  1336  DLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFAD-DPFSVFESTPPVQNVSSWPSSD  1160
             +LIPGFGF         TSHS+ ++       S F D DPF V EST    + SS    D
Sbjct  147   ELIPGFGFG--------TSHSKTTA-------SNFVDTDPFVVLESTMSGAHSSSGIFVD  191

Query  1159  PLEKLAET-----------------------NP-------------SIDELEDFVSGRGT  1088
             PL+  A +                        P             S+DEL+DF  G GT
Sbjct  192   PLDAFAASVSSQGQKPSNNTTHSSTKLKPPPKPTQKVNRAKSSVMSSVDELDDFSMG-GT  250

Query  1087  STSQGQQHYVSRKESNVKKTHSAG-DIL---------------SNTSTDHMFDGLFNNNG  956
                       + K    ++T   G D L               S T+T+       N   
Sbjct  251   MRRSASASDAASKYREAQETKQFGVDDLDSFFSSGPRSSSVPKSRTATEAPRKPAVN---  307

Query  955   GGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLN  776
                  K T++G  S  K  +P  N VDDFS+    D      EF E+ GE+ ERR+AR +
Sbjct  308   ---VPKKTTNGVSSAKKPPAPAANLVDDFSALFGEDPPIFK-EFEEIPGETEERRKARWD  363

Query  775   HHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQ  596
                RT+ R+A+A+A+ N RD Q++ EQ++++R++E  D EIKRWA GKEGN+RALLSSLQ
Sbjct  364   REQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISETADAEIKRWATGKEGNMRALLSSLQ  423

Query  595   YVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILK  416
              VLWP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L +KYIAEKVFDILK
Sbjct  424   IVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKYIAEKVFDILK  483



>ref|XP_003602665.1| Auxilin-like protein [Medicago truncatula]
 ref|XP_003638236.1| Auxilin-like protein [Medicago truncatula]
 gb|AES72916.1| DnaJ domain protein [Medicago truncatula]
Length=735

 Score =   252 bits (644),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGES ERR+ARL    R +ER A+ALAEKNQRDL+TQ+EQDE+ RLAE LD E+K
Sbjct  586  EFQEVEGESEERRKARLERLQRAQERAAKALAEKNQRDLRTQREQDERHRLAETLDFEVK  645

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQAVSLTDLIT+ +VKK Y KATLC+HPDKVQQK
Sbjct  646  RWAAGKEGNLRALLSTLQYVLWPECGWQAVSLTDLITAATVKKAYRKATLCIHPDKVQQK  705

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  706  GATLQQKYIAEKVFDLLKEAWNKFNSEEL  734



>ref|XP_004502522.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Cicer arietinum]
Length=569

 Score =   248 bits (632),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 212/604 (35%), Positives = 292/604 (48%), Gaps = 124/604 (21%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSS---------GFPNDSGQKSSHNSD---  1658
             MDEFGVL ER+G+K +G S P+A+ K +S P++         G  + S   S  N     
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSK-RSTPTTVSDSHFGSFGTGSGSNPMSPQNGSRSP  59

Query  1657  ---PYDLDGVFRSG----KTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTn  1499
                 +D D VF S     ++SG    D   IFGG    S S       +D D  F G  N
Sbjct  60    QYSAFDYD-VFASSDKKTQSSGGFGDDIDQIFGGI---SKSHVGNGVSIDDDPIFGGLNN  115

Query  1498  qngnnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGL---KKTAVQNVHDSDDLI  1328
                   +     D  D FG   + S  VDDL      K GGL    K+++   H  DDL+
Sbjct  116   SVSTPSSPPVYVD--DIFGGVNEKSVGVDDLLD----KIGGLHTNAKSSINQSHGFDDLL  169

Query  1327  PGFGFHS---NSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDP  1157
              GFG  S   N + S   +  ++ +V S+       DDPF VFE+T  +   SS    D 
Sbjct  170   GGFGVSSASNNGKASNEMNKPRKPTVTSH-------DDPFLVFETT--LSTASSESFLDS  220

Query  1156  LEKLAETN---------------------------------PSIDELEDFVSGR------  1094
             LE++++ N                                  S+DELE+F  GR      
Sbjct  221   LEQMSKLNNSKGTSGSSSTSPLLRPPPKSANASNSINNSSISSLDELENFAMGRVQNNAS  280

Query  1093  -GTSTSQGQQHYVSRKESN---------VKKTHSAGDILS---------------NTSTD  989
               T+T+ G+    S  ++N         V + + A D+ S                 + D
Sbjct  281   RKTNTNTGEIKQSSAAKTNKDKGSPATRVNQLNGADDLESFFSMGSRSNSVPKSRAATMD  340

Query  988   HMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEG  809
              MFD   N+ G     +    G+ +  K  S    F   F         S   +F EVEG
Sbjct  341   PMFDRQVNSKGKPEGSQKVPSGSPANAKKSS----FTTSFDDLSLIFGASPSSQFEEVEG  396

Query  808   ESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKE  629
             E+ ERR+ARL  H RT+ER  +A+A+ NQRDL+++ EQ+E+ R+A+ +D +IKRWAAGKE
Sbjct  397   ETEERRKARLGRHQRTQERALKAVADMNQRDLESKMEQEERRRIADTMDVQIKRWAAGKE  456

Query  628   GNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREK  449
             GN+RALLSSLQ VL P+ GWQ VSLTD+ITS SVKKVY KATLC+HPDKVQQK A+L +K
Sbjct  457   GNMRALLSSLQNVLSPDYGWQPVSLTDMITSASVKKVYRKATLCIHPDKVQQKGANLEQK  516

Query  448   YIAEKVFDILKEAFGKFNAEELR*VSIISSLVPFYC*WTNSVNPHHKGGYGLCNRYSLVI  269
             Y AEKVFDIL     K   +     +     +PF+     S+  H+   Y +   Y +++
Sbjct  517   YTAEKVFDIL-----KVPCQITLKNTYTKKTIPFFI---PSLKSHNSSSYAI---YIILL  565

Query  268   AWIC  257
             ++ C
Sbjct  566   SYSC  569



>ref|XP_002275766.1| PREDICTED: auxilin-related protein 2-like [Vitis vinifera]
Length=949

 Score =   254 bits (648),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
            S+D +FD  F N  G    + T+    ST +  S   N VDD SS       S   +F +
Sbjct  747  SSDPVFDTQFQNRRGPEVAR-TAASASSTMRKASSTTNIVDDLSSIFGAAPSSG--DFQD  803

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            VEGES +RRRARL  H RT+ER A+ALAEKNQRDLQ Q++Q E+ R+AE LD EIKRW+A
Sbjct  804  VEGESEDRRRARLERHQRTQERAAKALAEKNQRDLQAQRDQAERHRIAETLDVEIKRWSA  863

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK A+L
Sbjct  864  GKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKGANL  923

Query  457  REKYIAEKVFDILKEAFGKFNAEEL  383
            ++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  924  QQKYIAEKVFDLLKEAWNKFNSEEL  948



>ref|XP_004503905.1| PREDICTED: auxilin-related protein 2-like [Cicer arietinum]
Length=915

 Score =   253 bits (647),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGES ERR+ARL  H R++ER+A+ALAEKNQRDLQTQ+EQ E++RLAE LD EIK
Sbjct  766  EFQEVEGESEERRKARLERHQRSQERVAKALAEKNQRDLQTQREQAERNRLAETLDFEIK  825

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGK+GNLRALLS+LQYVLWPECGWQ V LTDLIT+ +VKK Y KATLC+HPDKVQQK
Sbjct  826  RWAAGKDGNLRALLSTLQYVLWPECGWQPVGLTDLITAAAVKKAYRKATLCIHPDKVQQK  885

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  886  GATLQQKYIAEKVFDLLKEAWNKFNSEEL  914


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 116/260 (45%), Gaps = 50/260 (19%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSKPSSGFPN------DSGQKSSHNSDPYDLD  1643
             M++F G+L   + +K +G S P+A      K SS  PN      D G +S+ NSD     
Sbjct  1     MNDFDGLLASDFALKPQGKSAPMA---PPPKGSSNLPNSTSLNFDFGSRSARNSD-----  52

Query  1642  GVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLR  1463
              +F  G ++ + N D +  F   F + + +    +  DLD+ F GS+N   +   NS+  
Sbjct  53    SLF--GSSTSRHNRD-AGSFDDLFTAGSKSRGADAPFDLDSMFPGSSNDFASRSGNSSPP  109

Query  1462  DEFD-------------------------FFGSAPKPSDSVDDLFGNLGFKSGGLKKTAV  1358
               +D                          F S    S + DDL G  G +S G  +   
Sbjct  110   PVYDKPVYDDDVFDGVPGLKSTAKVNFDNVFASTKTESGAFDDLLGGFGKESKGSGRKGS  169

Query  1357  QN----VHDSDDLIPGFG---FHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFEST  1199
             +     V D DDL+ GFG     S+   +     S + +V + K +ST A+DPF VFEST
Sbjct  170   EKDDKGVSDFDDLLAGFGSSRAPSSDRHAPDIGLSTEPTVSASKTTSTAAEDPFKVFEST  229

Query  1198  PPVQNVSSWPSSDPLEKLAE  1139
                 + S+   +DPLE++++
Sbjct  230   SAPMDSSTGNFTDPLEEISK  249



>gb|KEH35623.1| DnaJ domain protein [Medicago truncatula]
Length=672

 Score =   249 bits (636),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGES ERR+ARL    R +ER A+ALAEKNQRDL+TQ+EQDE+ RLAE LD E+K
Sbjct  523  EFQEVEGESEERRKARLERLQRAQERAAKALAEKNQRDLRTQREQDERHRLAETLDFEVK  582

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQAVSLTDLIT+ +VKK Y KATLC+HPDKVQQK
Sbjct  583  RWAAGKEGNLRALLSTLQYVLWPECGWQAVSLTDLITAATVKKAYRKATLCIHPDKVQQK  642

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  643  GATLQQKYIAEKVFDLLKEAWNKFNSEEL  671



>emb|CBI18977.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   239 bits (611),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGES ERRRAR   H RT+ERMA+ALAEKN+ DLQTQQEQ+E+ R+AE+LD +IK
Sbjct  189  EFQEVEGESEERRRARFQSHQRTQERMAKALAEKNRYDLQTQQEQEERHRIAESLDTKIK  248

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             WAAGKEGNLRALLSSLQYVL PECGWQ VSLTDLITS SV+KVY KATLC+HPDK+QQK
Sbjct  249  HWAAGKEGNLRALLSSLQYVLGPECGWQPVSLTDLITSDSVRKVYRKATLCIHPDKIQQK  308

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS+++KYIAEKVFD+LKEA+ K   EE
Sbjct  309  GASVQQKYIAEKVFDVLKEAWNKCKTEE  336



>gb|KEH20914.1| auxilin-like protein [Medicago truncatula]
Length=913

 Score =   253 bits (645),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGES ERR+ARL  H R++ER+A+ALAEKNQRDLQTQ+EQ E+SRL E LD EIK
Sbjct  764  EFQEVEGESEERRKARLERHQRSQERVAKALAEKNQRDLQTQREQAERSRLGETLDFEIK  823

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RW+AGKEGNLRALLS+LQYVLWPECGWQ V LTDLIT+ +VKK Y KATLC+HPDKVQQK
Sbjct  824  RWSAGKEGNLRALLSTLQYVLWPECGWQPVGLTDLITAAAVKKAYRKATLCIHPDKVQQK  883

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  884  GATLQQKYIAEKVFDLLKEAWNKFNSEEL  912



>gb|EYU32507.1| hypothetical protein MIMGU_mgv1a020422mg [Erythranthe guttata]
Length=160

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF E++GES ERRRARLN H RT  R+A ALAEKNQRDLQ+QQEQ+EK RLAE LD +IK
Sbjct  11   EFREIKGESEERRRARLNRHIRTNARVAEALAEKNQRDLQSQQEQEEKHRLAETLDRDIK  70

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             WAAGKEGNLRALLSSLQ VLWPEC W+ VS TDLITS SVKKVY KATL VHPDKVQQK
Sbjct  71   SWAAGKEGNLRALLSSLQQVLWPECNWRPVSPTDLITSDSVKKVYKKATLYVHPDKVQQK  130

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEELR  380
             A+L++KYIAEKVFD+LKEA+ KF+ EELR
Sbjct  131  GANLQQKYIAEKVFDLLKEAWNKFSREELR  160



>ref|XP_008338677.1| PREDICTED: auxilin-related protein 2 isoform X2 [Malus domestica]
Length=568

 Score =   245 bits (625),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 209/584 (36%), Positives = 278/584 (48%), Gaps = 128/584 (22%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK------------------------------AKSK  1712
             MDEFGVL ER+G+K +G S P+A+ K                                  
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSKRPAAANDXQSWDFGVGSGVSTKTSSYSSGSPPXN  60

Query  1711  PSSGF------PNDSGQKSSHNSDPY--DLDGVFRSGKTSGQQNYDNSDIFGGQFPSSNS  1556
             P+S +      PN   Q SS+N       LD +F +     +Q+  +S  F   F  SNS
Sbjct  61    PNSDYXSFVDGPNGLFQSSSNNKTRSFGGLDDIFTAPSKPVKQSGGSSFNFDSMFVGSNS  120

Query  1555  TTAQQSHVDLD-TFFKGSTnqngnnrnnsNLRDE--FDFFGSAPKPSDSVDDLFGNLGF-  1388
              T+     + D   F G      ++   S+ +D+  F  F S  K S  VDDL G+L   
Sbjct  121   KTSSFGGYNDDYDVFAGMPGLKSSSSGKSSAKDDDIFGSFASGSKQSAPVDDLLGDLSGV  180

Query  1387  --KSGGLKKTAVQNVH----------DSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQ  1244
               K  GL     +NV+          D DDLIPGFG  + S      +  ++S+VHS K 
Sbjct  181   RQKLQGLNVKNDRNVNSARKVAKKGGDFDDLIPGFGGSTPSNNGTPENRPRRSTVHSTKS  240

Query  1243  S-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN----------------------  1133
             +  +  DDPF V ES     +   + SSD   +L + +                      
Sbjct  241   NFGSSMDDPFVVLESVSTSASTPGYDSSDIFSELEQISKLSNSGGAKPGDSSNSSTKLKS  300

Query  1132  ------------PSIDELEDFVSGRGTSTSQGQQHYVSRKE----SNVKKTHSAGDIL--  1007
                          SIDELE+F      + + G+ +  S +E    S  ++  S+ D L  
Sbjct  301   PPKGDKERSSXVSSIDELEEFARATVRNNATGRTNVPSHEERVETSATRRGRSSEDDLMG  360

Query  1006  --SN-------TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
               SN       T+ D +FD   NN G  T                 P ++     S    
Sbjct  361   FRSNSVPRSKPTNLDSVFDSQTNNRGRPT-----------------PQRSSGTSSSMKKS  403

Query  853   gdlgssfDEFHEVEGESVE-------RRRARLNHHTRTRERMARALAEKNQRDLQTQQEQ  695
                   FD    ++GE  E       RR+ARL  H R+++R  +A+A+ NQRD +TQQEQ
Sbjct  404   SSATGLFDGLFSMDGEFEEVEGESEERRKARLARHQRSQQRALQAVADMNQRDRKTQQEQ  463

Query  694   DEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVY  515
             +++ R+AE LD +IK W+ GKEGN+RALLSSLQ VLW E GW+ VSLTDLITS SVK+VY
Sbjct  464   EDRRRIAENLDIKIKSWSYGKEGNMRALLSSLQSVLWAESGWEPVSLTDLITSGSVKRVY  523

Query  514   HKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
              KATLCVHPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  524   RKATLCVHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  567



>ref|XP_007159871.1| hypothetical protein PHAVU_002G274800g [Phaseolus vulgaris]
 gb|ESW31865.1| hypothetical protein PHAVU_002G274800g [Phaseolus vulgaris]
Length=906

 Score =   250 bits (639),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF +VEGES +RRRARL  H RT+ER A+ALAEKNQRD+QTQ+EQ E++RL E LD EIK
Sbjct  757  EFQDVEGESEDRRRARLERHQRTQERAAKALAEKNQRDMQTQREQAERNRLGETLDFEIK  816

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKE NLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKK Y KATLC+HPDKVQQK
Sbjct  817  RWAAGKEANLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKAYRKATLCIHPDKVQQK  876

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  877  GANLQQKYVAEKVFDLLKEAWNKFNSEEL  905


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 111/251 (44%), Gaps = 58/251 (23%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPYDLD-GVFRS  1628
             M++F G+    +G+K +G S P+A       PS G         S N+DP + D G  RS
Sbjct  1     MNDFDGLFTSDFGLKPQGKSAPMA------PPSKG---------SSNADPLNFDFGSSRS  45

Query  1627  GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLRDEFD-  1451
               T     +D  D+  G   + + T    S  DLD+ + G   ++ ++      +  +D 
Sbjct  46    AST-----FD--DLLAG---AGSDTRRADSPFDLDSMYGGPPARSTSSPPPVYDKPVYDD  95

Query  1450  -FFGSAP--KPSDSV------------------DDLFGNLG--FKSGGLKKTA--VQNVH  1346
               F   P  K +  V                  DD+FG  G   KS G K++    +   
Sbjct  96    DIFDGVPGMKTTSKVRFDDVFATTESGGSAAAFDDIFGGFGKEPKSSGGKRSEKDAKGAS  155

Query  1345  DSDDLIPGFGFHSNSEKSAR----TSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVS  1178
             D DDL+ GFG HS +  S R    T+ S + +  + K +ST A+DPF VFES     + S
Sbjct  156   DFDDLLAGFG-HSRAPSSGRHTPDTTFSSEPTASASKTTSTMAEDPFKVFESASAPGDSS  214

Query  1177  SWPSSDPLEKL  1145
             +    DPLE++
Sbjct  215   TGHFMDPLEEI  225



>ref|XP_008800820.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 2-like 
[Phoenix dactylifera]
Length=949

 Score =   251 bits (640),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -1

Query  1006  SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDE  827
             S TS++  FD      G     +  S G+ ST K K+     + D  SS+FG   S   E
Sbjct  742   SATSSETTFDTQAQGRGSADGARKKSSGSSSTMKKKASSTTHIVDDLSSIFGAPSSLG-E  800

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             F E+EGES ERR+ARL  H RT ER A+ALAEKN+RDLQTQ+EQ+E+ R+AE LD E+KR
Sbjct  801   FQEIEGESDERRKARLERHQRTLERAAKALAEKNERDLQTQREQEERHRIAETLDIEVKR  860

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             W+AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK 
Sbjct  861   WSAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKG  920

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ K N+EEL
Sbjct  921   ANLQQKYIAEKVFDLLKEAWNKLNSEEL  948



>ref|XP_008338676.1| PREDICTED: auxilin-related protein 2 isoform X1 [Malus domestica]
Length=574

 Score =   244 bits (624),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 208/590 (35%), Positives = 277/590 (47%), Gaps = 134/590 (23%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK------------------------------AKSK  1712
             MDEFGVL ER+G+K +G S P+A+ K                                  
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSKRPAAANDXQSWDFGVGSGVSTKTSSYSSGSPPXN  60

Query  1711  PSSGF------PNDSGQKSSHNSDPY--DLDGVFRSGKTSGQQNYDNSDIFGGQFPSSNS  1556
             P+S +      PN   Q SS+N       LD +F +     +Q+  +S  F   F  SNS
Sbjct  61    PNSDYXSFVDGPNGLFQSSSNNKTRSFGGLDDIFTAPSKPVKQSGGSSFNFDSMFVGSNS  120

Query  1555  TTAQQSHVDLD-TFFKGSTnqngnnrnnsNLRDE--FDFFGSAPKPSDSVDDLFGNLGF-  1388
              T+     + D   F G      ++   S+ +D+  F  F S  K S  VDDL G+L   
Sbjct  121   KTSSFGGYNDDYDVFAGMPGLKSSSSGKSSAKDDDIFGSFASGSKQSAPVDDLLGDLSGV  180

Query  1387  --KSGGLKKTAVQNVH----------DSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQ  1244
               K  GL     +NV+          D DDLIPGFG  + S      +  ++S+VHS K 
Sbjct  181   RQKLQGLNVKNDRNVNSARKVAKKGGDFDDLIPGFGGSTPSNNGTPENRPRRSTVHSTKS  240

Query  1243  S-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN----------------------  1133
             +  +  DDPF V ES     +   + SSD   +L + +                      
Sbjct  241   NFGSSMDDPFVVLESVSTSASTPGYDSSDIFSELEQISKLSNSGGAKPGDSSNSSTKLKS  300

Query  1132  ------------PSIDELEDFVSGRGTSTSQGQQHYVSRKE----SNVKKTHSAGDIL--  1007
                          SIDELE+F      + + G+ +  S +E    S  ++  S+ D L  
Sbjct  301   PPKGDKERSSXVSSIDELEEFARATVRNNATGRTNVPSHEERVETSATRRGRSSEDDLMG  360

Query  1006  --SN-------TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
               SN       T+ D +FD   NN G  T                 P ++     S    
Sbjct  361   FRSNSVPRSKPTNLDSVFDSQTNNRGRPT-----------------PQRSSGTSSSMKKS  403

Query  853   gdlgssfDEFHEVEGESVE-------------RRRARLNHHTRTRERMARALAEKNQRDL  713
                   FD    ++G S               RR+ARL  H R+++R  +A+A+ NQRD 
Sbjct  404   SSATGLFDGLFSMDGASTGFVEFEEVEGESEERRKARLARHQRSQQRALQAVADMNQRDR  463

Query  712   QTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITST  533
             +TQQEQ+++ R+AE LD +IK W+ GKEGN+RALLSSLQ VLW E GW+ VSLTDLITS 
Sbjct  464   KTQQEQEDRRRIAENLDIKIKSWSYGKEGNMRALLSSLQSVLWAESGWEPVSLTDLITSG  523

Query  532   SVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             SVK+VY KATLCVHPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  524   SVKRVYRKATLCVHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  573



>ref|XP_010664177.1| PREDICTED: auxilin-related protein 2 [Vitis vinifera]
Length=516

 Score =   243 bits (619),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGES ERRRAR   H RT+ERMA+ALAEKN+ DLQTQQEQ+E+ R+AE+LD +IK
Sbjct  367  EFQEVEGESEERRRARFQSHQRTQERMAKALAEKNRYDLQTQQEQEERHRIAESLDTKIK  426

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             WAAGKEGNLRALLSSLQYVL PECGWQ VSLTDLITS SV+KVY KATLC+HPDK+QQK
Sbjct  427  HWAAGKEGNLRALLSSLQYVLGPECGWQPVSLTDLITSDSVRKVYRKATLCIHPDKIQQK  486

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS+++KYIAEKVFD+LKEA+ K   EE
Sbjct  487  GASVQQKYIAEKVFDVLKEAWNKCKTEE  514


 Score = 94.7 bits (234),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 86/254 (34%), Positives = 123/254 (48%), Gaps = 48/254 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPYDL-DGVFRSG  1625
             MDEFG L + +G+K +G S P+A LK         P+ +G   + N   +D+  GV  +G
Sbjct  1     MDEFGRLTQSFGLKPQGKSAPMAALKR--------PSTTGNDGAFN---FDVGSGVHSNG  49

Query  1624  KTSGQQNY----DNSDIFGGQ----------------------FPSSNSTTAQQSHVDLD  1523
              +   QN+    D  DIFGG+                      F + NS+ A +   + D
Sbjct  50    GSGVSQNFGGLDDYDDIFGGRNRNSNTWGGGGGGGSLLDHDSVFGNLNSSGANRGGSNYD  109

Query  1522  TFFKGSTnqngnnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHD  1343
               F G       +    N  D F F  S  K SD  DD  GN    SGG++K A +    
Sbjct  110   GDFFGGI-SEVKSSGTVNYNDVFGFTDSGSKQSDQFDDFLGN----SGGVEKNAPRGF--  162

Query  1342  SDDLIPGFGFHSNSEK--SARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWP  1169
              DDLIPGFG    ++K  ++ T+   QS+V S K +ST A+DPF +FEST    + SS  
Sbjct  163   -DDLIPGFGGSGAAKKGMNSETNKLNQSAVGSTKSTSTLAEDPFVLFESTSTPADTSSPV  221

Query  1168  SSDPLEKLAETNPS  1127
              SDPLE++++ + S
Sbjct  222   FSDPLEEMSKISNS  235



>ref|XP_010931651.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=940

 Score =   250 bits (639),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
            S++ MFD      G     + TS G+ ST K  S   N VDD SS       S   EF E
Sbjct  737  SSETMFDTQAQGRGSSDGARRTSSGSSSTMKKASSTTNIVDDLSSIFGAPSSSG--EFQE  794

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            +EGES ERR+ARL  H RT ER A+ALAEKN+RDLQ Q+EQ E+ R+AE LD EIKRWAA
Sbjct  795  IEGESDERRKARLERHQRTLERAAKALAEKNERDLQAQREQAERHRIAETLDIEIKRWAA  854

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  +VKKVY KATLC+HPDKVQQK A+L
Sbjct  855  GKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGAAVKKVYRKATLCIHPDKVQQKGANL  914

Query  457  REKYIAEKVFDILKEAFGKFNAEEL  383
            ++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  915  QQKYIAEKVFDLLKEAWNKFNSEEL  939



>ref|XP_010477407.1| PREDICTED: auxilin-related protein 2-like [Camelina sativa]
Length=548

 Score =   243 bits (620),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 205/580 (35%), Positives = 264/580 (46%), Gaps = 140/580 (24%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA----------------NLKAKSKPSSGFPNDSGQKS-  1673
             MDEFGVL ERYG+K +G S P+A                N    S  SSG    S   S 
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMAASKRSVNNHNNNAQSWNFATASSSSSGVNAKSKSTSF  60

Query  1672  SHNSDPYDLDGVF-----------RSGKTSGQQNYDNSDIFG------------------  1580
             S N   YD D +F           R G  S    +D+ D+F                   
Sbjct  61    SGNGSVYDGDDIFFTASSTTNNINRKGSNS-SSGFDDFDVFSGLNKSSSSSSGFNNNNSK  119

Query  1579  ---------GQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLRDEFDFFGS----  1439
                      G    SN   +     D D F  G    +      +N++++ D FGS    
Sbjct  120   SSSSLNNDDGGLLFSNFGNSGNKASDDDLF--GGIMPSSKTSATTNVKND-DLFGSFSSS  176

Query  1438  APKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSV  1259
               + + +VDDL G LG           +N    D LIPGFG          T+ S +++ 
Sbjct  177   EKQYATAVDDLLG-LG-----------KNDASYDGLIPGFG---------GTATSSKTTT  215

Query  1258  HSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAET-------------------  1136
              ++  S     DPF V EST    + S     DPLE+ A +                   
Sbjct  216   LNFDSS-----DPFVVLESTASASHSSPGLFVDPLEEFAASVSSQGKKPSTTSHTSSILK  270

Query  1135  ----------------NPSIDELEDFVSG---RGTSTSQGQQHYVSRKESNVKKTH----  1025
                               SIDELEDF  G   R  S S     Y   +++  K       
Sbjct  271   PPPKPTQKVNRVKSSGMSSIDELEDFAMGTMRRSASASDTASKYREAEDAGTKNKEFGVD  330

Query  1024  ------SAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfss  863
                   SAG   S+           +        K T +G  S  K      N V     
Sbjct  331   DLDPFFSAGYRSSSVPKSRTTTTETSRKQPSNVPKKTPNGV-SNAKKPPAQANLV--DDF  387

Query  862   slfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKS  683
             S        F +F E+ GES ERR+AR +   RT+ R+A+A+A+ N RD Q++ EQ++++
Sbjct  388   SALFGEDPIFRQFEEIPGESEERRKARWDREQRTKSRVAQAVADMNNRDHQSRIEQEQRT  447

Query  682   RLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKAT  503
             R++E +D EI+RWA GKEGN+RALLSSLQ VLWP CGW+AVSLTDLITS++VKKVY KAT
Sbjct  448   RISETVDTEIRRWATGKEGNMRALLSSLQIVLWPGCGWEAVSLTDLITSSAVKKVYRKAT  507

Query  502   LCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             L VHPDKVQQK A+L +KYIAEKVFDILKEA+ KFN EEL
Sbjct  508   LYVHPDKVQQKGATLEQKYIAEKVFDILKEAWNKFNKEEL  547



>ref|XP_011013120.1| PREDICTED: auxilin-related protein 1-like isoform X1 [Populus 
euphratica]
 ref|XP_011013121.1| PREDICTED: auxilin-related protein 1-like isoform X2 [Populus 
euphratica]
Length=985

 Score =   250 bits (638),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             +T SA    +NTS D   D    N GG    + TS G  S+ +  S   N VDD +S   
Sbjct  772   RTTSAQRPRTNTS-DPFSDS--QNKGGPEPVRRTSVGATSSVRKTSSTTNVVDDLTSIFG  828

Query  853   gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLA  674
             G  GSS  EF EVEGE+ ERR+AR+  H RT+ER A+ALAEKNQRDLQ Q++Q E+ R+A
Sbjct  829   GGTGSSG-EFQEVEGETEERRKARMERHQRTQERAAKALAEKNQRDLQAQRDQAERHRIA  887

Query  673   EALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCV  494
             E LD EIKRWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  +VKK Y KATLC+
Sbjct  888   ETLDVEIKRWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGAAVKKAYRKATLCI  947

Query  493   HPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             HPDKVQQK A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  948   HPDKVQQKGANLQQKYVAEKVFDLLKEAWNKFNSEEL  984



>ref|XP_011008205.1| PREDICTED: auxilin-related protein 1-like [Populus euphratica]
Length=985

 Score =   250 bits (638),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             +T SA    +NTS D   D    N GG    + TS G  S+ +  S   N VDD +S   
Sbjct  772   RTTSAQRPRTNTS-DPFSDS--QNKGGPEPVRRTSVGATSSVRKTSSTTNVVDDLTSIFG  828

Query  853   gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLA  674
             G  GSS  EF EVEGE+ ERR+AR+  H RT+ER A+ALAEKNQRDLQ Q++Q E+ R+A
Sbjct  829   GGTGSSG-EFQEVEGETEERRKARMERHQRTQERAAKALAEKNQRDLQAQRDQAERHRIA  887

Query  673   EALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCV  494
             E LD EIKRWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  +VKK Y KATLC+
Sbjct  888   ETLDVEIKRWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGAAVKKAYRKATLCI  947

Query  493   HPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             HPDKVQQK A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  948   HPDKVQQKGANLQQKYVAEKVFDLLKEAWNKFNSEEL  984



>ref|XP_006664621.1| PREDICTED: auxilin-related protein 1-like [Oryza brachyantha]
Length=814

 Score =   248 bits (633),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF E+EGE+ ERRRAR + H RTRER A+ALAEKN+RD+Q Q+EQ E+ R++E +D EIK
Sbjct  665  EFQEIEGETEERRRARFDRHQRTRERAAKALAEKNERDMQVQREQAERHRISETMDFEIK  724

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  725  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQK  784

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  785  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  813



>ref|XP_008361516.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Malus domestica]
Length=568

 Score =   242 bits (617),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 208/584 (36%), Positives = 276/584 (47%), Gaps = 128/584 (22%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK------------------------------AKSK  1712
             MDEFGVL ER+G+K +G S P+A+ K                                  
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSKRPAAANDXQSWDFGVGSGVSTKTSSYSSGSPPXN  60

Query  1711  PSSGF------PNDSGQKSSHNSDPY--DLDGVFRSGKTSGQQNYDNSDIFGGQFPSSNS  1556
             P+S +      PN   Q SS+N       LD +F +     +Q+  +S  F   F  SNS
Sbjct  61    PNSDYXSFVDGPNGLFQSSSNNKTRSFGGLDDIFTAPSKPVKQSGGSSFNFDSMFVGSNS  120

Query  1555  TTAQQSHVDLD-TFFKGSTnqngnnrnnsNLRDE--FDFFGSAPKPSDSVDDLFGNLGF-  1388
              T+     + D   F G      ++   S+ +D+  F  F S  K S  VDDL G+L   
Sbjct  121   KTSSFGGYNDDYDVFAGMPGLKSSSSGKSSAKDDDIFGSFASGSKQSAPVDDLLGDLSGV  180

Query  1387  --KSGGLKKTAVQNVH----------DSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQ  1244
               K  GL     +NV+          D DDLIPGFG  + S      +   +S+VHS K 
Sbjct  181   RQKLQGLNVKNDRNVNSARKVAKKGGDFDDLIPGFGGSTPSNNGTPENRPXRSTVHSTKS  240

Query  1243  S-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN----------------------  1133
             +  +  DDPF   ES     +   + SSD   +L + +                      
Sbjct  241   NFGSSMDDPFVXLESVSTSASTPGYDSSDIFSELEQISKLSNSGGAKPGDSSNSSTKLKS  300

Query  1132  ------------PSIDELEDFVSGRGTSTSQGQQHYVSRKE----SNVKKTHSAGDIL--  1007
                          SIDELE+F      + + G+ +  S +E    S  ++  S+ D L  
Sbjct  301   PPKGDKERSSXVSSIDELEEFARATVRNNATGRTNVPSHEERVETSATRRGRSSEDDLMG  360

Query  1006  --SN-------TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
               SN       T+ D +FD   NN G  T                 P ++     S    
Sbjct  361   FRSNSVPRSKPTNLDSVFDSQTNNRGRPT-----------------PQRSSGTSSSMKKS  403

Query  853   gdlgssfDEFHEVEGESVE-------RRRARLNHHTRTRERMARALAEKNQRDLQTQQEQ  695
                   FD    ++GE  E       RR+ARL  H R+++R  +A+A+ NQRD +TQQEQ
Sbjct  404   SSATGLFDGLFSMDGEFEEVEGESEERRKARLARHQRSQQRALQAVADMNQRDRKTQQEQ  463

Query  694   DEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVY  515
             +++ R+AE LD +IK W+ GKEGN+RALLSSLQ VLW E GW+ VSLTDLITS SVK+VY
Sbjct  464   EDRRRIAENLDIKIKSWSYGKEGNMRALLSSLQSVLWAESGWEPVSLTDLITSGSVKRVY  523

Query  514   HKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
              KATLCVHPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  524   RKATLCVHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  567



>gb|EYU23866.1| hypothetical protein MIMGU_mgv1a015354mg [Erythranthe guttata]
Length=160

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EFHE+EGE  ERRRARLN H R  ERMA ALA KNQRDL+ Q EQDEK RLAE  + +IK
Sbjct  11   EFHEIEGEPAERRRARLNRHMRMNERMAGALAAKNQRDLEIQYEQDEKRRLAETFEHDIK  70

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLSSL+ VL PE GW+ VSLTDLITS SVKKVY KATL VHPDKVQQ+
Sbjct  71   RWAAGKEGNLRALLSSLEQVLGPESGWRPVSLTDLITSDSVKKVYKKATLYVHPDKVQQR  130

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEELR  380
             A+L++KYIAEKVFDILKEA  KF AEELR
Sbjct  131  GANLQQKYIAEKVFDILKEASNKFTAEELR  160



>ref|XP_006375591.1| hypothetical protein POPTR_0014s17160g [Populus trichocarpa]
 gb|ERP53388.1| hypothetical protein POPTR_0014s17160g [Populus trichocarpa]
Length=998

 Score =   248 bits (634),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 152/194 (78%), Gaps = 1/194 (1%)
 Frame = -1

Query  964  NNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRA  785
            N GG    + TS G  S+ +  S   N VDD +S   G  GSS  EF +VEGE+ ERR+A
Sbjct  805  NKGGPEPVRRTSVGATSSVRKTSSTTNVVDDLTSIFGGGTGSSG-EFQDVEGETEERRKA  863

Query  784  RLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLS  605
            RL  H RT+ER A+ALAEKNQRDLQ Q++Q E+ R+AE LD EIKRWAAGKEGNLRALLS
Sbjct  864  RLERHQRTQERAAKALAEKNQRDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNLRALLS  923

Query  604  SLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFD  425
            +LQYVLWPECGWQ VSLTDLIT  +VKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD
Sbjct  924  TLQYVLWPECGWQPVSLTDLITGAAVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFD  983

Query  424  ILKEAFGKFNAEEL  383
            +LKEA+ K N+EEL
Sbjct  984  LLKEAWNKLNSEEL  997



>ref|XP_008361515.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Malus domestica]
Length=574

 Score =   241 bits (616),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 207/590 (35%), Positives = 275/590 (47%), Gaps = 134/590 (23%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK------------------------------AKSK  1712
             MDEFGVL ER+G+K +G S P+A+ K                                  
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSKRPAAANDXQSWDFGVGSGVSTKTSSYSSGSPPXN  60

Query  1711  PSSGF------PNDSGQKSSHNSDPY--DLDGVFRSGKTSGQQNYDNSDIFGGQFPSSNS  1556
             P+S +      PN   Q SS+N       LD +F +     +Q+  +S  F   F  SNS
Sbjct  61    PNSDYXSFVDGPNGLFQSSSNNKTRSFGGLDDIFTAPSKPVKQSGGSSFNFDSMFVGSNS  120

Query  1555  TTAQQSHVDLD-TFFKGSTnqngnnrnnsNLRDE--FDFFGSAPKPSDSVDDLFGNLGF-  1388
              T+     + D   F G      ++   S+ +D+  F  F S  K S  VDDL G+L   
Sbjct  121   KTSSFGGYNDDYDVFAGMPGLKSSSSGKSSAKDDDIFGSFASGSKQSAPVDDLLGDLSGV  180

Query  1387  --KSGGLKKTAVQNVH----------DSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQ  1244
               K  GL     +NV+          D DDLIPGFG  + S      +   +S+VHS K 
Sbjct  181   RQKLQGLNVKNDRNVNSARKVAKKGGDFDDLIPGFGGSTPSNNGTPENRPXRSTVHSTKS  240

Query  1243  S-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN----------------------  1133
             +  +  DDPF   ES     +   + SSD   +L + +                      
Sbjct  241   NFGSSMDDPFVXLESVSTSASTPGYDSSDIFSELEQISKLSNSGGAKPGDSSNSSTKLKS  300

Query  1132  ------------PSIDELEDFVSGRGTSTSQGQQHYVSRKE----SNVKKTHSAGDIL--  1007
                          SIDELE+F      + + G+ +  S +E    S  ++  S+ D L  
Sbjct  301   PPKGDKERSSXVSSIDELEEFARATVRNNATGRTNVPSHEERVETSATRRGRSSEDDLMG  360

Query  1006  --SN-------TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
               SN       T+ D +FD   NN G  T                 P ++     S    
Sbjct  361   FRSNSVPRSKPTNLDSVFDSQTNNRGRPT-----------------PQRSSGTSSSMKKS  403

Query  853   gdlgssfDEFHEVEGESVE-------------RRRARLNHHTRTRERMARALAEKNQRDL  713
                   FD    ++G S               RR+ARL  H R+++R  +A+A+ NQRD 
Sbjct  404   SSATGLFDGLFSMDGASTGFVEFEEVEGESEERRKARLARHQRSQQRALQAVADMNQRDR  463

Query  712   QTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITST  533
             +TQQEQ+++ R+AE LD +IK W+ GKEGN+RALLSSLQ VLW E GW+ VSLTDLITS 
Sbjct  464   KTQQEQEDRRRIAENLDIKIKSWSYGKEGNMRALLSSLQSVLWAESGWEPVSLTDLITSG  523

Query  532   SVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             SVK+VY KATLCVHPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  524   SVKRVYRKATLCVHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  573



>ref|XP_008807324.1| PREDICTED: auxilin-related protein 2-like [Phoenix dactylifera]
Length=930

 Score =   247 bits (631),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF ++EGES ERR+AR   H RT ER A+ALAEKN+RDLQTQ++Q E+ R+AE LD EIK
Sbjct  781  EFQDIEGESEERRKARFERHQRTLERAAKALAEKNERDLQTQRDQAERHRIAETLDAEIK  840

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKE NLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  841  RWAAGKEANLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQK  900

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  901  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  929



>ref|XP_011007017.1| PREDICTED: auxilin-related protein 2-like isoform X4 [Populus 
euphratica]
Length=962

 Score =   247 bits (631),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGE+ ERR+ARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIK
Sbjct  813  EFQEVEGETEERRKARLERHQRTQERAAKALAEKNQRDLQAQREQAERHRIAETLDVEIK  872

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWA+GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATL +HPDKVQQK
Sbjct  873  RWASGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLSIHPDKVQQK  932

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  933  GANLQQKYVAEKVFDLLKEAWNKFNSEEL  961



>ref|XP_011007014.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Populus 
euphratica]
Length=978

 Score =   247 bits (631),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGE+ ERR+ARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIK
Sbjct  829  EFQEVEGETEERRKARLERHQRTQERAAKALAEKNQRDLQAQREQAERHRIAETLDVEIK  888

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWA+GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATL +HPDKVQQK
Sbjct  889  RWASGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLSIHPDKVQQK  948

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  949  GANLQQKYVAEKVFDLLKEAWNKFNSEEL  977



>ref|XP_011007015.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Populus 
euphratica]
Length=977

 Score =   247 bits (631),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGE+ ERR+ARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIK
Sbjct  828  EFQEVEGETEERRKARLERHQRTQERAAKALAEKNQRDLQAQREQAERHRIAETLDVEIK  887

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWA+GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATL +HPDKVQQK
Sbjct  888  RWASGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLSIHPDKVQQK  947

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  948  GANLQQKYVAEKVFDLLKEAWNKFNSEEL  976



>gb|EYU46089.1| hypothetical protein MIMGU_mgv1a000900mg [Erythranthe guttata]
Length=947

 Score =   247 bits (631),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 160/222 (72%), Gaps = 5/222 (2%)
 Frame = -1

Query  1042  NVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSH--GTQSTGKSKSPLKNFVddf  869
             N+ +  SA    +NT T+   D  F N  G    K TS   GT S  K  S   N VDD 
Sbjct  728   NMGRASSAPKGRANT-TNPFSDQQFPNKEGSEAAKRTSSSSGTASNMKKASSTTNIVDDL  786

Query  868   ssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDE  689
             SS       S    F EVEGE+ ERR+AR+  + RT+ER A+A+AEKNQRDLQ Q+EQ+E
Sbjct  787   SSIFDVAPSSGA--FQEVEGENEERRKARMVRNQRTQERAAKAVAEKNQRDLQVQREQEE  844

Query  688   KSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHK  509
             + R A+ALD EIKRWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLI  +SVKK Y K
Sbjct  845   RHRFADALDFEIKRWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLIIGSSVKKAYRK  904

Query  508   ATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             ATLC+HPDKVQQK A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  905   ATLCIHPDKVQQKGATLQQKYIAEKVFDLLKEAWNKFNSEEL  946



>ref|XP_010459888.1| PREDICTED: auxilin-related protein 2-like [Camelina sativa]
 ref|XP_010459889.1| PREDICTED: auxilin-related protein 2-like [Camelina sativa]
Length=548

 Score =   240 bits (613),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 214/565 (38%), Positives = 276/565 (49%), Gaps = 110/565 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPYDLDGV-FRSG  1625
             MDEFGVL ERYG+K +G S P+    A SK S    N +    S N       GV  +S 
Sbjct  1     MDEFGVLTERYGIKPQGKSAPM----AASKRSVNNNNPNNNAQSWNFATASSSGVNAKSK  56

Query  1624  KTSGQQN---YDNSDIFGGQFPSSNSTTAQQSHV-----DLDTF--------FKGSTnqn  1493
              TS   N   YD  DIF     ++N+   + S+      D D F          G  N N
Sbjct  57    STSFSGNGSVYDGDDIFFTASSTTNNNNRKGSNSSSGFDDFDVFSGLNKSSSSSGFINNN  116

Query  1492  gnnrnnsNLRDE----FDFFG-SAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLI  1328
              +  ++S   D+    F  FG S  K SD  DDLFG +   S   K +A  NV + DDL 
Sbjct  117   NSKSSSSLNNDDDGLLFSNFGNSGNKASD--DDLFGGIMPSS---KTSATTNVKN-DDL-  169

Query  1327  PGFGFHSNSEKSARTSHSQQSSVHSYKQSSTF----------------------ADDPFS  1214
               FG  S+SEK   T+      +   K  +++                      + DPF 
Sbjct  170   --FGSFSSSEKQYATAVDDLLGLG--KNDASYDGLIPGFGGTTTTSKTTTLNFDSSDPFV  225

Query  1213  VFESTPPVQNVSSWPSSDPLEKLAET----------------------------------  1136
             V EST    + S     DPLE+ A +                                  
Sbjct  226   VLESTASAAHSSPGLFVDPLEEFAASVSSQGKKPSTTSHTSSILKPPPKPTQKVNRVKSS  285

Query  1135  -NPSIDELEDFVSG---RGTSTSQGQQHYVSRKESNVKKTH----------SAGDILSNT  998
                SIDELEDF  G   R  S S     Y   +++  K             SAG   S+ 
Sbjct  286   GMSSIDELEDFAMGTMRRSASASDTASKYREAEDAGTKNKEFGVDDLDSFFSAGHRSSSV  345

Query  997   STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
                       +        K T +G  +  K  +P  N VDDFS+    D      +F E
Sbjct  346   PKSRTTTTETSRKQASNVPKKTPNGVSNAKKPPAP-ANLVDDFSALFGEDPIFR--QFEE  402

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             + GES ERR+AR +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E +D EI+RWA 
Sbjct  403   IPGESEERRKARWDREQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISETVDTEIRRWAT  462

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGN+RALLSSLQ VLWP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L
Sbjct  463   GKEGNMRALLSSLQIVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATL  522

Query  457   REKYIAEKVFDILKEAFGKFNAEEL  383
              +KYIAEKVFDILKEA+ KFN EEL
Sbjct  523   EQKYIAEKVFDILKEAWNKFNKEEL  547



>ref|XP_003630317.1| Auxilin-like protein [Medicago truncatula]
Length=1017

 Score =   247 bits (631),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             EF EVEGES ERR+ARL  H R++ER+A+ALAEKNQRDLQTQ+EQ E+SRL E LD EIK
Sbjct  868   EFQEVEGESEERRKARLERHQRSQERVAKALAEKNQRDLQTQREQAERSRLGETLDFEIK  927

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW+AGKEGNLRALLS+LQYVLWPECGWQ V LTDLIT+ +VKK Y KATLC+HPDKVQQK
Sbjct  928   RWSAGKEGNLRALLSTLQYVLWPECGWQPVGLTDLITAAAVKKAYRKATLCIHPDKVQQK  987

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEEL  383
              A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  988   GATLQQKYIAEKVFDLLKEAWNKFNSEEL  1016



>ref|XP_011007016.1| PREDICTED: auxilin-related protein 2-like isoform X3 [Populus 
euphratica]
Length=974

 Score =   247 bits (630),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGE+ ERR+ARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIK
Sbjct  825  EFQEVEGETEERRKARLERHQRTQERAAKALAEKNQRDLQAQREQAERHRIAETLDVEIK  884

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWA+GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATL +HPDKVQQK
Sbjct  885  RWASGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLSIHPDKVQQK  944

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  945  GANLQQKYVAEKVFDLLKEAWNKFNSEEL  973



>ref|XP_010498622.1| PREDICTED: auxilin-related protein 2-like [Camelina sativa]
Length=547

 Score =   239 bits (610),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 203/564 (36%), Positives = 264/564 (47%), Gaps = 109/564 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKA-----------------KSKPSSGFPNDSGQKS  1673
             MDEFGVL ERYG+K +G S P+A  K                   +  SSG    +   S
Sbjct  1     MDEFGVLTERYGIKPQGKSAPMAASKRSVHNNNPNNNNAQSWNFATASSSGVNAKTKSTS  60

Query  1672  -SHNSDPYDLDGVFRSGKTSGQQN----------YDNSDIFGGQFPSSNSTTAQQSHVDL  1526
              S N   YD D +F +  ++   N          +D+ D F G   SS+S+    +    
Sbjct  61    FSGNGSVYDADDIFFTASSTTNNNIRKSSNSSSGFDDFDGFSGLNKSSSSSGFNNNSKSS  120

Query  1525  DTFFKGSTnqngnnrnnsNLRDEFDFFGS---APKPSDSV-----DDLFGNLGFKSGGLK  1370
                         N  N+ N   + D FG    + KPS +      DDLFG+    S    
Sbjct  121   SLNNDDDGLLFSNFGNSGNKASDDDLFGGIMPSSKPSATTGTVKNDDLFGSFS-SSEKQY  179

Query  1369  KTAV-------QNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSV  1211
              TAV       +N    D LIPGFG  + S K+   +                + DPF V
Sbjct  180   ATAVDDLLGLGKNDASYDGLIPGFGGTTTSSKTTTLNFD--------------SSDPFVV  225

Query  1210  FESTPPVQNVSSWPSSDPLEKLAET-----------------------------------  1136
              EST    + S     DPLE+ A +                                   
Sbjct  226   LESTASASHSSPGLFVDPLEEFAASVSSQGKKPSTTSHTSSILKPPPKPTQKVNRVKSSG  285

Query  1135  NPSIDELEDFVSG---RGTSTSQGQQHYVSRKESNVKKTH----------SAGDILSNTS  995
               SIDELEDF  G   R  S S     Y   +++  K             SAG   S+  
Sbjct  286   MSSIDELEDFAMGTMRRSASASDTASKYREAEDAGTKNKEFGVDDLDSFFSAGHRSSSVP  345

Query  994   TDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEV  815
                      +        K T +G  +  K  +P  N V     S        F +F E+
Sbjct  346   KSRTTTTETSRKQASNVPKKTPNGVSNAKKPPAP-ANLV--DDFSALFGEDPIFRQFEEI  402

Query  814   EGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAG  635
              GES ERR+AR +   RT+ R+A+A+A+ N RD Q++ EQ++++R++E +D EI+RWA G
Sbjct  403   PGESEERRKARWDREQRTKSRVAQAVADMNNRDHQSRIEQEQRTRISETVDTEIRRWATG  462

Query  634   KEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLR  455
             KEGN+RALLSSLQ VLWP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L 
Sbjct  463   KEGNMRALLSSLQIVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLE  522

Query  454   EKYIAEKVFDILKEAFGKFNAEEL  383
             +KYIAEKVFDILKEA+ KFN EEL
Sbjct  523   QKYIAEKVFDILKEAWNKFNKEEL  546



>ref|XP_010524634.1| PREDICTED: auxilin-related protein 2-like [Tarenaya hassleriana]
Length=900

 Score =   246 bits (627),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF E+ GE+ ERRRAR +   RT+ER A+ALAEKN+RDLQ Q+EQ EK+R+AE LD EIK
Sbjct  751  EFREINGETEERRRARFDREQRTKERAAKALAEKNERDLQAQREQAEKNRIAETLDMEIK  810

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWP+CGWQ VSLTDLIT+  VKKVY KATLC+HPDKVQQK
Sbjct  811  RWAAGKEGNLRALLSTLQYVLWPDCGWQPVSLTDLITAAMVKKVYRKATLCIHPDKVQQK  870

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  871  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  899



>ref|XP_007137764.1| hypothetical protein PHAVU_009G153800g [Phaseolus vulgaris]
 gb|ESW09758.1| hypothetical protein PHAVU_009G153800g [Phaseolus vulgaris]
Length=918

 Score =   245 bits (625),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 6/204 (3%)
 Frame = -1

Query  994  TDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEV  815
            +D +FD  F ++       W S G  S+ K  S   N VDD SS       SS   F EV
Sbjct  720  SDPVFDAQFQSDA-----TWKSPGVSSSMKKASSSTNIVDDLSSIFGAAPSSSGA-FQEV  773

Query  814  EGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAG  635
            EGES ERR+ARL    R +ER  +ALAEKNQRD+QTQ+EQ EK R+AE LD EIKRWAAG
Sbjct  774  EGESEERRKARLERQQRAQERATKALAEKNQRDIQTQREQAEKDRVAETLDFEIKRWAAG  833

Query  634  KEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLR  455
            KEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +V+KVY KATLC+HPDKVQQK A+++
Sbjct  834  KEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVRKVYRKATLCIHPDKVQQKGATIQ  893

Query  454  EKYIAEKVFDILKEAFGKFNAEEL  383
            +K IAEKVFDILKEA+ KFN+EEL
Sbjct  894  QKCIAEKVFDILKEAWNKFNSEEL  917



>ref|XP_011002448.1| PREDICTED: auxilin-related protein 2-like [Populus euphratica]
Length=536

 Score =   238 bits (606),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 211/561 (38%), Positives = 286/561 (51%), Gaps = 114/561 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSS--------------------------G  1700
             MDEFGV  ER G+K +G S P++  +  +   +                           
Sbjct  1     MDEFGVFTERLGLKPQGKSAPMSTSRGPNNAQTRDFPSSNPKSNSSSSKSTYNSNSYNGS  60

Query  1699  FPND-----SGQKSSHNSDPYDLDGVFR--SGKTSGQQNYDNSDIFGGQFPSSNSTTAQQ  1541
             F +D     +  KS +  D +D+ G F+  S +TS    +D   +F     ++ S++ Q 
Sbjct  61    FMDDHETLFNNSKSQNFGDDFDIFGGFQKNSKQTSTGFGFDIDSVFS----NTKSSSVQS  116

Query  1540  SHVDLDTFFKGSTnqngnnrnnsNLRDEFDFFGS-----APKPSDSVDDLFGNLGFKSGG  1376
             S VD D F   + + +  N NN+N  ++ D FG+     A K S  V DL G  G K   
Sbjct  117   SFVD-DIFGGLNGSSSSVNNNNNNNNEDDDIFGAFTSSKAAKQSAPVKDLLGGFGTK---  172

Query  1375  LKKTAVQNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTP  1196
             LK  +       DDLIPGFG  ++S K        + ++H+   + T ++DPF+V E T 
Sbjct  173   LKPPSSNGSVCFDDLIPGFGPINSSWK--------EKNMHTITPAFTSSEDPFAVLEQT-  223

Query  1195  PVQNVSSWPSSDPLEKLAETNPS-----------------------------------ID  1121
                + ++   +DPLE+  + N S                                   ID
Sbjct  224   ---STTTKSFTDPLEEFGKFNHSGRTEPAVSSNCSPPLRPPPKPGQVLKTGKVLDVSAID  280

Query  1120  ELEDFVSGR----GTSTSQGQ-----QHYVSRKESNVKKTHSAGDI--LSNTSTDHMFDG  974
             ELEDF  GR      S S G      +      ES   +   + +I  L +   D +FD 
Sbjct  281   ELEDFAMGRMQNNARSVSNGHHAGEVKESADDLESFFGRVSQSSNIPKLRSGVLDPLFDA  340

Query  973   LFNNNGGG----TKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGE  806
               N  G       K    S G + T  + + L +       SL     +   EF EVEGE
Sbjct  341   KINGKGKPEFPFKKASSPSPGIRKTSSTTNALGDL------SLIFGDATLSGEFEEVEGE  394

Query  805   SVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEG  626
             S ERRRAR + H RTR+RM +A+A+ NQRDLQT  EQ+E+ R+A  +D +IK WAAGKEG
Sbjct  395   SEERRRARWDRHQRTRDRMEQAVADMNQRDLQTLHEQEERHRIAAKMDVQIKHWAAGKEG  454

Query  625   NLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKY  446
             N+RALLSSLQ+VLWPEC W+ VSLTDLITSTSVKKVY KATLCVHPDKVQQK A++++KY
Sbjct  455   NMRALLSSLQHVLWPECDWKPVSLTDLITSTSVKKVYRKATLCVHPDKVQQKGATIQQKY  514

Query  445   IAEKVFDILKEAFGKFNAEEL  383
              +EKVFDILKEA+ KF+ EEL
Sbjct  515   TSEKVFDILKEAWNKFSKEEL  535



>ref|XP_004968715.1| PREDICTED: auxilin-related protein 1-like [Setaria italica]
Length=954

 Score =   243 bits (621),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 156/207 (75%), Gaps = 3/207 (1%)
 Frame = -1

Query  1003  NTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEF  824
             +T+T + FD     N G    + TS G+ S   ++ P  N VDD SS       S+   F
Sbjct  750   HTATTNPFDVQPQGNAGSGAVRRTSSGSVSPF-TQPPPSNLVDDLSSVFGAPSSSAV--F  806

Query  823   HEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRW  644
              EV GES ERR+ARL  H RT ER A+ALAEKN+RDLQ Q+EQ+E+ R+ E+LD EIKRW
Sbjct  807   QEVRGESEERRKARLERHQRTMERAAKALAEKNERDLQAQREQEERHRIGESLDFEIKRW  866

Query  643   AAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRA  464
             AAGKEGNLRALLS+LQY+LWPECGW+ +SLTDLIT+ SVKK Y KATLC+HPDKVQQK A
Sbjct  867   AAGKEGNLRALLSTLQYILWPECGWRPISLTDLITAASVKKEYRKATLCIHPDKVQQKGA  926

Query  463   SLREKYIAEKVFDILKEAFGKFNAEEL  383
             +L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  927   NLQQKYIAEKVFDLLKEAWNKFNSEEL  953



>gb|KCW62475.1| hypothetical protein EUGRSUZ_H05116 [Eucalyptus grandis]
Length=964

 Score =   243 bits (621),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            +F EVEGES ERR+ARL    R +ER A+ALAEKNQRDLQ Q+EQ E+ R++E LD EIK
Sbjct  815  DFQEVEGESEERRKARLERQQRAQERAAKALAEKNQRDLQVQREQAERHRISETLDVEIK  874

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLSSLQYVLWPECGWQ VSLTDLIT  +VKKVY KATLC+HPDKVQQK
Sbjct  875  RWAAGKEGNLRALLSSLQYVLWPECGWQPVSLTDLITVAAVKKVYRKATLCIHPDKVQQK  934

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ + N+EEL
Sbjct  935  GANLQQKYVAEKVFDLLKEAWNRLNSEEL  963



>ref|XP_010025742.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW62477.1| hypothetical protein EUGRSUZ_H05116 [Eucalyptus grandis]
Length=972

 Score =   243 bits (621),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            +F EVEGES ERR+ARL    R +ER A+ALAEKNQRDLQ Q+EQ E+ R++E LD EIK
Sbjct  823  DFQEVEGESEERRKARLERQQRAQERAAKALAEKNQRDLQVQREQAERHRISETLDVEIK  882

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLSSLQYVLWPECGWQ VSLTDLIT  +VKKVY KATLC+HPDKVQQK
Sbjct  883  RWAAGKEGNLRALLSSLQYVLWPECGWQPVSLTDLITVAAVKKVYRKATLCIHPDKVQQK  942

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ + N+EEL
Sbjct  943  GANLQQKYVAEKVFDLLKEAWNRLNSEEL  971



>ref|XP_010674406.1| PREDICTED: auxilin-related protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=939

 Score =   243 bits (620),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            +F EV+GE+ +RR+AR+  H RT+ER A+ALAEKN RDL+ Q+EQ E+ R AE+LD EI+
Sbjct  790  DFPEVDGETDDRRKARMERHHRTQERAAKALAEKNARDLEAQREQTERHRFAESLDAEIR  849

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK
Sbjct  850  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQK  909

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  910  GATLQQKYVAEKVFDLLKEAWNKFNSEEL  938



>ref|XP_011012111.1| PREDICTED: auxilin-related protein 2-like [Populus euphratica]
Length=536

 Score =   236 bits (601),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 212/562 (38%), Positives = 285/562 (51%), Gaps = 116/562 (21%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSS--------------------------G  1700
             MDEFGV  ER G+K +G S P++  +  +   +                           
Sbjct  1     MDEFGVFTERLGLKPQGKSAPMSTSRGPNNAQTRDFPSSNPKSNSSSSKSTYNSNSYNGS  60

Query  1699  FPND-----SGQKSSHNSDPYDLDGVFR--SGKTSGQQNYDNSDIFGGQFPSSNSTTAQQ  1541
             F +D     +  KS +  D +D+ G F+  S +TS    +D   +F     ++ S++ Q 
Sbjct  61    FMDDHETLFNNSKSQNFGDDFDIFGGFQKNSKQTSTGFGFDIDSVFS----NTKSSSVQS  116

Query  1540  SHVDLDTFFKGSTnqngnnrnnsNLRDEFDFFGS-----APKPSDSVDDLFGNLGFKSGG  1376
             S VD D F   + + +  N NN+N  ++ D FG+     A K S  V DL G  G K   
Sbjct  117   SFVD-DIFGGLNGSSSSVNNNNNNNNEDDDIFGAFTSSKAAKQSAPVKDLLGGFGTK---  172

Query  1375  LKKTAVQNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTP  1196
             LK  +       DDLIPGFG  ++S K        + ++H+   + T ++DPF+V E T 
Sbjct  173   LKPPSSNGSVCFDDLIPGFGPSNSSWK--------EKNMHTITPAFTSSEDPFAVLEQT-  223

Query  1195  PVQNVSSWPSSDPLEKLAETNPS-----------------------------------ID  1121
                + ++   +DPLE+  + N S                                   ID
Sbjct  224   ---STTTKSFTDPLEEFGKFNHSGRTEPAVSSNCSPPLRPPPKPGQVLKTGKVLDVSAID  280

Query  1120  ELEDFVSGR----GTSTSQGQQHYVSRKESNVKKTHSAGDI--------LSNTSTDHMFD  977
             ELEDF  GR      S S G  H    KES        G +        L +   D +FD
Sbjct  281   ELEDFAMGRMQNNARSVSNGH-HAGEVKESADDLESFFGRVSQSSNVPKLRSGVLDPLFD  339

Query  976   GLFNNNGGG----TKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEG  809
                N  G       K    S G + T  + + L +       SL     +   EF EVEG
Sbjct  340   AKINGKGKPEFPFKKASSPSPGIRKTSSTTNALGDL------SLIFGDATLSGEFEEVEG  393

Query  808   ESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKE  629
             ES ERRRAR + H RTR+RM +A+A+ NQRD QT  EQ+E+ R+A+ +D +IK WAAGKE
Sbjct  394   ESEERRRARWDRHQRTRDRMEQAVADMNQRDRQTLHEQEERRRIADKMDVQIKHWAAGKE  453

Query  628   GNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREK  449
             GN+RALLSSLQ+VLWPEC W+ VSLTDLITSTSVKKVY KATLCVHPDKVQQK A++++K
Sbjct  454   GNMRALLSSLQHVLWPECDWKPVSLTDLITSTSVKKVYRKATLCVHPDKVQQKGATIQQK  513

Query  448   YIAEKVFDILKEAFGKFNAEEL  383
             Y +EKVFDILKEA+ KF+ EEL
Sbjct  514   YTSEKVFDILKEAWNKFSKEEL  535



>ref|XP_010025743.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW62476.1| hypothetical protein EUGRSUZ_H05116 [Eucalyptus grandis]
Length=965

 Score =   243 bits (619),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            +F EVEGES ERR+ARL    R +ER A+ALAEKNQRDLQ Q+EQ E+ R++E LD EIK
Sbjct  816  DFQEVEGESEERRKARLERQQRAQERAAKALAEKNQRDLQVQREQAERHRISETLDVEIK  875

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLSSLQYVLWPECGWQ VSLTDLIT  +VKKVY KATLC+HPDKVQQK
Sbjct  876  RWAAGKEGNLRALLSSLQYVLWPECGWQPVSLTDLITVAAVKKVYRKATLCIHPDKVQQK  935

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFD+LKEA+ + N+EEL
Sbjct  936  GANLQQKYVAEKVFDLLKEAWNRLNSEEL  964



>ref|XP_009418913.1| PREDICTED: auxilin-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=935

 Score =   241 bits (616),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            +F EVEGES +RR ARL  H RT+E  A+ALAEKN+RD+Q Q+EQ E+ R+AEALD EIK
Sbjct  786  KFQEVEGESEKRRAARLERHQRTQELAAKALAEKNERDMQIQREQAERHRIAEALDIEIK  845

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY +ATLCVHPDKVQQK
Sbjct  846  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRRATLCVHPDKVQQK  905

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ K N+EEL
Sbjct  906  GATLQQKYIAEKVFDLLKEAWNKLNSEEL  934



>ref|NP_001042996.1| Os01g0355500 [Oryza sativa Japonica Group]
 dbj|BAD52602.1| 200 kDa antigen p200 -like protein [Oryza sativa Japonica Group]
 dbj|BAD52753.1| 200 kDa antigen p200 -like protein [Oryza sativa Japonica Group]
 dbj|BAF04910.1| Os01g0355500 [Oryza sativa Japonica Group]
 dbj|BAG94548.1| unnamed protein product [Oryza sativa Japonica Group]
Length=948

 Score =   241 bits (616),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F EV+GES ERR+ARL  H RT ER A+ALAEKN+RDLQ Q EQ+E+ R+ E LD EIKR
Sbjct  800  FQEVDGESEERRKARLERHQRTMERAAKALAEKNERDLQVQWEQEERHRIGETLDFEIKR  859

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS+LQYVLWPECGW+ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK 
Sbjct  860  WAAGKEGNLRALLSTLQYVLWPECGWRPVSLTDLITAASVKKEYRKATLCIHPDKVQQKG  919

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  920  ANLQQKYIAEKVFDLLKEAWNKFNSEEL  947



>ref|XP_008674031.1| PREDICTED: auxilin-related protein 1-like isoform X1 [Zea mays]
Length=962

 Score =   241 bits (616),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F EV+GES ERR+ARL  H RT ER A+ALAEKN+RDLQ QQEQ+E+ R+ E+LD EIKR
Sbjct  814  FQEVDGESEERRKARLERHQRTMERAAKALAEKNERDLQAQQEQEERHRIGESLDFEIKR  873

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALL++LQY+LWPECGW+ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK 
Sbjct  874  WAAGKEGNLRALLTTLQYILWPECGWRPVSLTDLITAASVKKEYRKATLCIHPDKVQQKG  933

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  934  ANLQQKYIAEKVFDLLKEAWKKFNSEEL  961



>ref|XP_006644158.1| PREDICTED: auxilin-related protein 1-like [Oryza brachyantha]
Length=930

 Score =   239 bits (611),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F EV+GES ERR+ARL  H RT ER A+ALAEKN+RDLQ Q+EQ+E+ R++E  D EIKR
Sbjct  782  FQEVDGESEERRQARLERHQRTMERAAKALAEKNERDLQVQREQEERHRISETFDFEIKR  841

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS+LQYVLWPECGW+ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK 
Sbjct  842  WAAGKEGNLRALLSTLQYVLWPECGWRPVSLTDLITAASVKKEYRKATLCIHPDKVQQKG  901

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  902  ANLQQKYIAEKVFDLLKEAWNKFNSEEL  929



>ref|XP_002457810.1| hypothetical protein SORBIDRAFT_03g013900 [Sorghum bicolor]
 gb|EES02930.1| hypothetical protein SORBIDRAFT_03g013900 [Sorghum bicolor]
Length=959

 Score =   239 bits (610),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F EV+GES ERR+ARL  H RT ER A+ALAEKN+RDLQ Q EQ+E+ R+ E+LD EIKR
Sbjct  811  FQEVDGESEERRKARLERHQRTMERAAKALAEKNERDLQAQWEQEERHRIGESLDFEIKR  870

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS+LQY+LWPECGW+ +SLTDLIT+ SVKK Y KATLC+HPDKVQQK 
Sbjct  871  WAAGKEGNLRALLSTLQYILWPECGWRPISLTDLITAASVKKEYRKATLCIHPDKVQQKG  930

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  931  ANLQQKYIAEKVFDLLKEAWNKFNSEEL  958



>ref|XP_006307189.1| hypothetical protein CARUB_v10008781mg [Capsella rubella]
 gb|EOA40087.1| hypothetical protein CARUB_v10008781mg [Capsella rubella]
Length=544

 Score =   232 bits (592),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 190/494 (38%), Positives = 243/494 (49%), Gaps = 115/494 (23%)
 Frame = -1

Query  1693  NDSGQKSSHNSDPYDLDGVFRSGKTS---GQQNYDNSDIFGGQFPSSNSTTAQQSHVDLD  1523
             ND+  KSS N D         SG  S     Q +D  D+FGG  P SNS++  ++     
Sbjct  108   NDNYSKSSLNDDLL-FSNFGNSGNKSSSPAAQGFDADDLFGGVMPGSNSSSGVKND----  162

Query  1522  TFFKGSTnqngnnrnnsNLRDEFDFFGSAPKP-SDSVDDLFGNLGFKSGGLKKTAVQNVH  1346
                                 D F  F S+ K  + +VDDL G LG           +N  
Sbjct  163   --------------------DLFGSFASSEKQYATAVDDLLG-LG-----------KNAA  190

Query  1345  DSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPS  1166
               D LIPGFG  + +  S  T+ +              A DPF V EST    + SS   
Sbjct  191   GYDGLIPGFGGSTQTTSSKTTTSNFD------------AADPFVVLESTTSAAHSSSGLF  238

Query  1165  SDPLEKLAET-----------------------------------NPSIDELEDFVSG--  1097
              DPLE+ A +                                     SIDELEDF  G  
Sbjct  239   VDPLEEFAASVSSQGKKPSNISQTSSKLKPPPKPTQKVDRVKSSGMSSIDELEDFAMGTM  298

Query  1096  -RGTSTSQGQQHYVSRKESNVKKTHSAGDIL---------------SNTSTDHMFDGLFN  965
              R  S S     Y   +++  KK     D L               S T+T+      FN
Sbjct  299   RRSASASDTASKYREAEDAGTKKKEFGVDDLDSFFSAGPRSSSVPKSRTTTETTRKQAFN  358

Query  964   NNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRA  785
                     K T++G  S  K   P  N VDDFS+    D      +F E+ GE+ ERR+A
Sbjct  359   ------VPKKTANGVSSV-KKPPPPANLVDDFSALFGEDPMFK--QFEEIPGETEERRKA  409

Query  784   RLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLS  605
             R +   RT+ R+A+A+A+ N RD Q++ EQ++++ ++E +D EI+RWA GKEGN+RALLS
Sbjct  410   RWDREQRTKSRVAQAVADMNNRDHQSRIEQEQRTMISETVDSEIRRWATGKEGNMRALLS  469

Query  604   SLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFD  425
             SLQ VLWP CGW+AVSLTDLITS++VKKVY KATL VHPDKVQQK A+L +KYIAEKVFD
Sbjct  470   SLQIVLWPGCGWEAVSLTDLITSSAVKKVYRKATLYVHPDKVQQKGATLEQKYIAEKVFD  529

Query  424   ILKEAFGKFNAEEL  383
             ILKEA+ KFN EEL
Sbjct  530   ILKEAWNKFNKEEL  543



>ref|XP_006828838.1| hypothetical protein AMTR_s00001p00148480 [Amborella trichopoda]
 gb|ERM96254.1| hypothetical protein AMTR_s00001p00148480 [Amborella trichopoda]
Length=934

 Score =   234 bits (598),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 148/206 (72%), Gaps = 2/206 (1%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             + +SA    + TS+D   D  + N G     + TS GT ++ +  S   N VDD S+   
Sbjct  729   RPNSAPRQRTATSSDSSVDAQYQNKGTSDGSRRTSTGTSASMRKASSTTNIVDDLSTIFG  788

Query  853   gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLA  674
                 S   EF E+EGES +RR+ARL  H RT ER A+ALAEKN+RD Q  ++Q E+ R+ 
Sbjct  789   AAPQSG--EFQEIEGESEDRRKARLERHQRTLERAAKALAEKNERDSQLLRDQAERHRIG  846

Query  673   EALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCV  494
             E LD EIKRWA GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+TSVKKVY KATLC+
Sbjct  847   ETLDAEIKRWAFGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITATSVKKVYRKATLCI  906

Query  493   HPDKVQQKRASLREKYIAEKVFDILK  416
             HPDKVQQK A++++KYIAEKVFDILK
Sbjct  907   HPDKVQQKGANIQQKYIAEKVFDILK  932



>ref|XP_006344354.1| PREDICTED: auxilin-related protein 1-like [Solanum tuberosum]
Length=939

 Score =   234 bits (596),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            ++ D++FD  F N  G    K T+    S  +  S   +FVDD SS       S   EF 
Sbjct  735  STPDNIFDSQFQNKAGSEGPKSTAGVASSNMRKASSTTSFVDDLSSIFGASASSG--EFQ  792

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            +VEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q++QDE+ R++E LD EIKRWA
Sbjct  793  DVEGETEERRRARLERHQRTQERAAKALAEKNQRDLQVQRDQDERHRISETLDFEIKRWA  852

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLI   SVKKVY KATLC+HPDKVQQK A+
Sbjct  853  AGKEGNLRALLSTLQYVLWPECGWQPVSLTDLIVGASVKKVYRKATLCIHPDKVQQKGAN  912

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  913  LQQKYIAEKVFDLLKEAWNKFNSEEL  938


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 103/230 (45%), Gaps = 20/230 (9%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPL---ANLKAKSKPSSGFPND-----SGQKSSHNSDPYDL  1646
             MD+  VL    G +  G S P+       + S P +   ND         +++NS  ++ 
Sbjct  1     MDDLDVLARDLGFRHAGKSAPMRSDVRSTSSSDPDAVLFNDVFGGPPKYTNTNNSADFNY  60

Query  1645  DGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNL  1466
             D +F SGKT+   N ++ +I    FP  +         D D F      +N +  ++S L
Sbjct  61    DSIFISGKTN---NNNDDNIKTSSFPVYDKPV-----YDDDIFDGLPGVKNKSLSSSSTL  112

Query  1465  RDEFDFFG---SAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEK  1295
             R E D F    S P+ +   DDL GN G      +  +     + DDL+ GFG  ++S  
Sbjct  113   RFEDDVFATMTSPPQQNTHFDDLLGNFGRNEKVAQPKSSAGSTEFDDLLAGFGTGTSSRS  172

Query  1294  SARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKL  1145
                +++  + +  S K SS+  DDPF V EST    N      SDPLE++
Sbjct  173   FTDSTYPSKPAGDSNK-SSSMLDDPFVVLESTLVPANSPPEEFSDPLEEI  221



>ref|XP_008662610.1| PREDICTED: auxilin-related protein 1-like [Zea mays]
Length=884

 Score =   233 bits (593),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 155/205 (76%), Gaps = 10/205 (5%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
            + D MFD    N G  T          ST   K+     V D  S+LFG   +S +EF E
Sbjct  689  TVDSMFDSQTQNRGTST----------STSMKKASSTANVADDLSALFGGAPTSSNEFQE  738

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            V+GES ERRRARL  H RTRER A+ALAEKN+RD+Q Q++Q E+ RLAE LD EIKRWAA
Sbjct  739  VDGESEERRRARLERHQRTRERAAKALAEKNERDMQQQRDQAERHRLAETLDFEIKRWAA  798

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK A+L
Sbjct  799  GKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKGANL  858

Query  457  REKYIAEKVFDILKEAFGKFNAEEL  383
            ++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  859  QQKYIAEKVFDLLKEAWNKFNSEEL  883



>ref|XP_002443330.1| hypothetical protein SORBIDRAFT_08g017590 [Sorghum bicolor]
 gb|EES17168.1| hypothetical protein SORBIDRAFT_08g017590 [Sorghum bicolor]
Length=897

 Score =   233 bits (593),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EV+GES ERRRARL  H RTRER A+ALAEKN+RD+Q Q+EQ E+ RLAE LD EIK
Sbjct  748  EFQEVDGESEERRRARLERHQRTRERAAKALAEKNERDMQQQREQAERHRLAETLDFEIK  807

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  808  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQK  867

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  868  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  896



>gb|AGT16729.1| auxilin-related protein [Saccharum hybrid cultivar R570]
Length=898

 Score =   233 bits (593),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EV+GES ERRRARL  H RTRER A+ALAEKN+RD+Q Q+EQ E+ RLAE LD EIK
Sbjct  749  EFQEVDGESEERRRARLERHQRTRERAAKALAEKNERDMQQQREQAERHRLAETLDFEIK  808

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  809  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQK  868

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  869  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  897



>gb|KHF99207.1| hypothetical protein F383_08933 [Gossypium arboreum]
Length=950

 Score =   233 bits (593),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F EV+GE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIKR
Sbjct  802  FQEVDGETEERRRARLERHQRTQERAAKALAEKNQRDLQVQREQAERHRIAETLDVEIKR  861

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK 
Sbjct  862  WAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKG  921

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  922  ANLQQKYVAEKVFDLLKEAWNKFNSEEL  949


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 121/262 (46%), Gaps = 43/262 (16%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLK-AKSKPSSGFPNDSGQKSSHNSDPYDLDGVFRS  1628
             MD+  G+  + +G+K +G + P+A  + + S P+ G+ +D  + SS N      + +F  
Sbjct  1     MDDLPGLFAKDFGIKPQGKAAPMAPPRNSSSGPNYGYRSDFTRSSSANVK-SSSNSIFDD  59

Query  1627  GKTSGQQNYDNSDIFGG--QFPS-SNSTTAQQSHVDLDTFFKGSTn--------------  1499
                 G   +D  D++GG  ++ S S +TTAQ S  D D+FFK                  
Sbjct  60    QDRDGGLVFD--DVYGGPPKYSSESRATTAQTSSFDYDSFFKDPKPPVYDKPVYDDDIFD  117

Query  1498  -----qngnnrnnsNLRDEFDFFGSAPKPSD------SVDDLFGNLGFKSGGLKKTA--V  1358
                  ++ +  + +   D F   GS P+P +        DDL GNLG K   +K  +  V
Sbjct  118   GLPGIKSSSTTSAAKYDDVFSISGSPPRPKNKSPNNSPFDDLLGNLGGKEPEMKVKSERV  177

Query  1357  QNVHDS---DDLIPGFGFHSNSEKSARTS----HSQQSSVHSYKQSSTFADDPFSVFEST  1199
             ++  D+   DDL+ GFG  S+S   AR++     SQ    +S K  S   +DPF V  ST
Sbjct  178   KSEKDAPLCDDLLSGFG-RSSSPTPARSTSDAGQSQNPPSNSSKTGSNLMEDPFVVLGST  236

Query  1198  PPVQNVSSWPSSDPLEKLAETN  1133
                   SS    DP E +++ N
Sbjct  237   SDPAAASSGLFMDPSEVISKPN  258



>ref|XP_006386806.1| hypothetical protein POPTR_0002s22300g [Populus trichocarpa]
 gb|ERP64603.1| hypothetical protein POPTR_0002s22300g [Populus trichocarpa]
Length=981

 Score =   232 bits (592),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EVEGE+ ERR+ARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIK
Sbjct  829  EFQEVEGETEERRKARLERHQRTQERAAKALAEKNQRDLQAQREQAERHRIAETLDVEIK  888

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATL +HPDKVQQK
Sbjct  889  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLSIHPDKVQQK  948

Query  469  RASLREKYIAEKVFDILK  416
             A+L++KY+AEKVFD+LK
Sbjct  949  GANLQQKYVAEKVFDLLK  966


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 82/270 (30%), Positives = 119/270 (44%), Gaps = 46/270 (17%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSKPSSGF------PNDSGQKSSHNSDP-YD-  1649
             MD+F G+L   +G K +G S P+A  ++ +  S+ F      P  +   SSH S P +D 
Sbjct  1     MDDFPGLLARDFGFKPQGKSAPMAPPRSTNSNSTNFNLGSGGPVHTRSSSSHKSAPLFDN  60

Query  1648  ---LDGVF--------------RSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDT  1520
                 DG+               R G ++   ++D   IF  Q P S S       V  D 
Sbjct  61    QAGTDGLLFNDVFGGPPKYSESRGGASATASSFDFDSIFKEQNPKSASLPISDKPVYDDD  120

Query  1519  FFKG-----STnqngnnrnnsNLRDEFDFFGSAPKP--------SDSVDDLFGNLGFKSG  1379
              F G     S++  G + +     D F    S PK         S   DDL GNLG K  
Sbjct  121   IFDGLPGLKSSSSGGGSASAPKFDDAFGSVSSPPKQQHRRPVRDSSPFDDLLGNLGKKEA  180

Query  1378  GLKKTAVQNVHDS---DDLIPGFGFHSNSEKSARTSHS---QQSSVHSYKQSSTFADDPF  1217
               K+ + +   DS   DDL+PGFG  S+   +  TS S   Q+ S++S +      +DPF
Sbjct  181   EPKRESGRVDKDSTAFDDLLPGFGRISSHTVNRSTSESGLFQKQSLNSARSVPGVMEDPF  240

Query  1216  SVFESTPPVQNVSSWPSSDPLEKLAET-NP  1130
              V EST      SS   ++PL ++++T NP
Sbjct  241   VVLESTSSHATSSSGLFTEPLGEISKTGNP  270



>ref|XP_011080586.1| PREDICTED: auxilin-related protein 2-like [Sesamum indicum]
Length=942

 Score =   232 bits (591),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 155/207 (75%), Gaps = 4/207 (2%)
 Frame = -1

Query  997  STDHMFDGLFNNNGG--GTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEF  824
            STD  FD  F N GG    K   +S G     K  S   N VDD SS       S   EF
Sbjct  737  STDPFFDQQFQNQGGSEAAKRASSSSGAPFNMKKASSTTNIVDDLSSIFGAVPSSG--EF  794

Query  823  HEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRW  644
             EVEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q++Q+E+ R++E LD EIKRW
Sbjct  795  QEVEGETEERRRARLERHQRTQERAAKALAEKNQRDLQAQKDQEERHRISETLDVEIKRW  854

Query  643  AAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRA  464
            AAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK A
Sbjct  855  AAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKGA  914

Query  463  SLREKYIAEKVFDILKEAFGKFNAEEL  383
            +L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  915  TLQQKYIAEKVFDLLKEAWNKFNSEEL  941



>ref|XP_004962813.1| PREDICTED: auxilin-related protein 1-like [Setaria italica]
Length=908

 Score =   231 bits (590),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF E++GES ERRRARL  H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+AE LD EIK
Sbjct  759  EFQEIDGESEERRRARLERHQRTRERAAKALAEKNERDMQQQREQAERHRIAETLDFEIK  818

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  819  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQK  878

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  879  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  907



>ref|XP_009393210.1| PREDICTED: auxilin-related protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=856

 Score =   231 bits (588),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF E  GES ERR+ARL  H RT ER A+ALAEKN+RD+Q Q+EQ E+ R+AEALD +IK
Sbjct  707  EFQEA-GESEERRKARLERHQRTLERAAKALAEKNERDMQIQREQAERQRIAEALDFDIK  765

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWA+GKEGNLRALLS+LQYV+WPEC WQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  766  RWASGKEGNLRALLSTLQYVVWPECSWQPVSLTDLITAAAVKKVYRKATLCLHPDKVQQK  825

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KF++ EL
Sbjct  826  GANLQQKYIAEKVFDLLKEAWNKFSSAEL  854



>emb|CDP04001.1| unnamed protein product [Coffea canephora]
Length=990

 Score =   231 bits (589),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHG-TQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            S++ MFD  F + GG    K TS G T S  +  S   N VDD SS           EF 
Sbjct  787  SSETMFDTNFQSTGGPQGPKPTSFGGTSSNMRKASSTTNIVDDLSSIFAAPSSG---EFQ  843

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            EVEGE+ ERRRAR+  H RT+ER A+ALAEKNQRD+Q  +EQ+E+ R+AE LD EIKRWA
Sbjct  844  EVEGETEERRRARMERHQRTKERAAKALAEKNQRDIQALKEQEERYRIAETLDIEIKRWA  903

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  +VKKVY KATLC+HPDKVQQK A+
Sbjct  904  AGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGPNVKKVYRKATLCIHPDKVQQKGAT  963

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  964  LQQKYIAEKVFDLLKEAWNKFNSEEL  989



>ref|XP_002524574.1| auxilin, putative [Ricinus communis]
 gb|EEF37782.1| auxilin, putative [Ricinus communis]
Length=983

 Score =   231 bits (588),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = -1

Query  958  GGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARL  779
            GG    + TS GT    K  S   N VDD SS   G    +  +F EVEGE+ ERRRARL
Sbjct  791  GGSEAARRTSVGTTPNMKKASSTTNIVDDLSSIFGGTATGTSGDFQEVEGETEERRRARL  850

Query  778  NHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSL  599
              H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIKRWAAGKEGNLRALLS+L
Sbjct  851  ERHQRTQERAAKALAEKNQRDLQAQREQAERHRIAETLDVEIKRWAAGKEGNLRALLSTL  910

Query  598  QYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDIL  419
            QYVLWPECGWQ VSLTDLIT  +VKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+L
Sbjct  911  QYVLWPECGWQPVSLTDLITGAAVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLL  970

Query  418  KEAFGKFNAEEL  383
            KEA+ KFN+EEL
Sbjct  971  KEAWNKFNSEEL  982



>ref|XP_009799251.1| PREDICTED: auxilin-related protein 2-like [Nicotiana sylvestris]
 ref|XP_009799252.1| PREDICTED: auxilin-related protein 2-like [Nicotiana sylvestris]
 ref|XP_009799253.1| PREDICTED: auxilin-related protein 2-like [Nicotiana sylvestris]
Length=959

 Score =   231 bits (588),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            ++ D++FD  F    G    K TS    S  +  S   +FVDD SS       S   +F 
Sbjct  755  STPDNVFDSQFQTKAGSEGPKSTSGVASSNMRKASSTTSFVDDLSSIFGASASSG--DFQ  812

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            +VEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ  ++Q+E+ R+AE LD EIKRWA
Sbjct  813  DVEGETEERRRARLERHQRTQERAAKALAEKNQRDLQVLRDQEERHRIAETLDFEIKRWA  872

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ+VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+
Sbjct  873  AGKEGNLRALLSTLQYVLWPECGWQSVSLTDLITGASVKKVYRKATLCIHPDKVQQKGAN  932

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  933  LQQKYIAEKVFDLLKEAWNKFNSEEL  958



>ref|XP_008674361.1| PREDICTED: auxilin-related protein 1-like [Zea mays]
Length=884

 Score =   230 bits (587),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EV+GES ERRRAR+  H RTRER A+ALAEKN+RD+Q Q+EQ E+ RLAE LD EIK
Sbjct  735  EFQEVDGESEERRRARMERHQRTRERAAKALAEKNERDMQQQREQAERHRLAETLDFEIK  794

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  795  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQK  854

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ K N+EEL
Sbjct  855  GANLQQKYIAEKVFDLLKEAWNKLNSEEL  883



>gb|KDP45177.1| hypothetical protein JCGZ_15042 [Jatropha curcas]
Length=974

 Score =   230 bits (587),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 160/217 (74%), Gaps = 5/217 (2%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             +  SA    +NTS D  FD      GG    + TS G  S+ K  S   N VDD SS   
Sbjct  762   RPSSAPRPRANTS-DPFFDT--QTKGGSEAARRTSVGATSSMKKASSTANIVDDLSSIFG  818

Query  853   gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLA  674
                 S   EF EVEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+A
Sbjct  819   ATGTSG--EFQEVEGETEERRRARLERHQRTQERAAKALAEKNQRDLQAQREQAERHRIA  876

Query  673   EALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCV  494
             E LD EIKRWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+
Sbjct  877   ETLDVEIKRWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCI  936

Query  493   HPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             HPDKVQQK A+L++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  937   HPDKVQQKGANLQQKYVAEKVFDLLKEAWNKFNSEEL  973



>ref|XP_002449945.1| hypothetical protein SORBIDRAFT_05g026150 [Sorghum bicolor]
 gb|EES08933.1| hypothetical protein SORBIDRAFT_05g026150 [Sorghum bicolor]
Length=909

 Score =   230 bits (586),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 153/209 (73%), Gaps = 11/209 (5%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgd----lgssfD  830
            + D MF       G G +   T++G+Q    + +P++      S            +S D
Sbjct  707  TVDSMF-------GFGAQGTGTTNGSQRAASTSAPVRKVASATSFGDDLSDLFGAPASSD  759

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             F EV+GES ERRRARL  H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ ++LD EIK
Sbjct  760  VFQEVQGESEERRRARLERHQRTRERAAKALAEKNERDMQVQREQAERDRIGDSLDFEIK  819

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RW+AGKEGNLRALLS+LQY+LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK
Sbjct  820  RWSAGKEGNLRALLSTLQYILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQK  879

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFDILKEA+ KFN+EEL
Sbjct  880  GATLQQKYIAEKVFDILKEAWNKFNSEEL  908



>ref|XP_009373905.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009373908.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Pyrus x 
bretschneideri]
Length=583

 Score =   225 bits (574),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 218/593 (37%), Positives = 282/593 (48%), Gaps = 131/593 (22%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK----AKSKPSSGFPNDSG---QKSSH--------  1667
             MDEFGVL ER+G+K +G S P+A+ K    A    S  F   SG   + SS+        
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSKRPAAANDAQSWDFGVGSGVSTKTSSYSSGSPPVN  60

Query  1666  -NSDPYDL----DGVFRSGKT------SGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDT  1520
              NSD        +G+F+S          G  +YD  DIF    PS     +  S  + D+
Sbjct  61    PNSDYASFFDGPNGLFQSSSNDKTRSFGGLDDYD--DIFTA--PSKPVKQSGGSSFNFDS  116

Query  1519  FFKGSTnqngnnrnnsNLRDEFDFFGSAP-------------------------KPSDSV  1415
              F GS  +  +        D++D F   P                         K S  V
Sbjct  117   MFVGSNAKTSSFGG---YNDDYDVFAGMPGLKSSSSGKSSAKDDDIFGSFASGSKQSAPV  173

Query  1414  DDLFGNLGF---KSGGLKKTAVQNVH----------DSDDLIPGFGFHSNSEKSARTSHS  1274
             DDL G+L     K  GL     +NV+          D DDLIPGFG  + S   A  +  
Sbjct  174   DDLLGDLSGVRQKLQGLNVKNDRNVNSAGKVAKKGGDFDDLIPGFGGSTPSNNGAPENRP  233

Query  1273  QQSSVHSYKQS-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN------------  1133
             + S+VHS K +  +  DDPF V ES     +   + SSD   +L + +            
Sbjct  234   RPSTVHSTKSNFGSSMDDPFVVLESVSTSASTLGYDSSDIFSELEQISKLSNSGGAKPGV  293

Query  1132  ----------------------------PSIDELEDFVSGRGTSTSQGQQHYVSRKESNV  1037
                                          SIDELE+F      + + G+ +  S +E   
Sbjct  294   SSNSSTKLKSPPKSAQASKGDKERSSGVSSIDELEEFARATVRNNATGRTNVPSHEERVE  353

Query  1036  KKTHSAGDILSN---------------TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKS  902
                   G ++ +               T+ D +FD   NN G  T  +  S  + S  KS
Sbjct  354   TSATRRGRLIEDDLMGFRSNSVPRSKPTNLDSVFDSQTNNRGRPTPQR-ASVTSNSMKKS  412

Query  901   KSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQ  722
              S    F             + F EF EVEGES ERRRARL  H R+++R  +A+A+ NQ
Sbjct  413   SSATGLF---DGLFSMDGASTGFVEFEEVEGESEERRRARLARHQRSQQRALQAVADMNQ  469

Query  721   RDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLI  542
             RD +T+QEQ+++ R+AE LD +IK W+ GKEGN+RALLSSLQ VLW E GW+ VSLTDLI
Sbjct  470   RDRKTRQEQEDRRRIAENLDIKIKSWSYGKEGNMRALLSSLQSVLWAESGWEPVSLTDLI  529

Query  541   TSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             TS SVKKVY KATLCVHPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  530   TSGSVKKVYRKATLCVHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  582



>ref|XP_009373906.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Pyrus x 
bretschneideri]
 ref|XP_009373909.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Pyrus x 
bretschneideri]
Length=577

 Score =   225 bits (573),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 219/593 (37%), Positives = 282/593 (48%), Gaps = 137/593 (23%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLK----AKSKPSSGFPNDSG---QKSSH--------  1667
             MDEFGVL ER+G+K +G S P+A+ K    A    S  F   SG   + SS+        
Sbjct  1     MDEFGVLTERFGLKPQGKSAPMASSKRPAAANDAQSWDFGVGSGVSTKTSSYSSGSPPVN  60

Query  1666  -NSDPYDL----DGVFRSGKT------SGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDT  1520
              NSD        +G+F+S          G  +YD  DIF    PS     +  S  + D+
Sbjct  61    PNSDYASFFDGPNGLFQSSSNDKTRSFGGLDDYD--DIFTA--PSKPVKQSGGSSFNFDS  116

Query  1519  FFKGSTnqngnnrnnsNLRDEFDFFGSAP-------------------------KPSDSV  1415
              F GS  +  +        D++D F   P                         K S  V
Sbjct  117   MFVGSNAKTSSFGG---YNDDYDVFAGMPGLKSSSSGKSSAKDDDIFGSFASGSKQSAPV  173

Query  1414  DDLFGNLGF---KSGGLKKTAVQNVH----------DSDDLIPGFGFHSNSEKSARTSHS  1274
             DDL G+L     K  GL     +NV+          D DDLIPGFG  + S   A  +  
Sbjct  174   DDLLGDLSGVRQKLQGLNVKNDRNVNSAGKVAKKGGDFDDLIPGFGGSTPSNNGAPENRP  233

Query  1273  QQSSVHSYKQS-STFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN------------  1133
             + S+VHS K +  +  DDPF V ES     +   + SSD   +L + +            
Sbjct  234   RPSTVHSTKSNFGSSMDDPFVVLESVSTSASTLGYDSSDIFSELEQISKLSNSGGAKPGV  293

Query  1132  ----------------------------PSIDELEDFVSGRGTSTSQGQQHYVSRKESNV  1037
                                          SIDELE+F      + + G+ +  S +E   
Sbjct  294   SSNSSTKLKSPPKSAQASKGDKERSSGVSSIDELEEFARATVRNNATGRTNVPSHEERVE  353

Query  1036  KKTHSAGDILSN---------------TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKS  902
                   G ++ +               T+ D +FD   NN G  T  +  S  + S  KS
Sbjct  354   TSATRRGRLIEDDLMGFRSNSVPRSKPTNLDSVFDSQTNNRGRPTPQR-ASVTSNSMKKS  412

Query  901   KSPLKNFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQ  722
              S    F           L S   EF EVEGES ERRRARL  H R+++R  +A+A+ NQ
Sbjct  413   SSATGLF---------DGLFSMDGEFEEVEGESEERRRARLARHQRSQQRALQAVADMNQ  463

Query  721   RDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLI  542
             RD +T+QEQ+++ R+AE LD +IK W+ GKEGN+RALLSSLQ VLW E GW+ VSLTDLI
Sbjct  464   RDRKTRQEQEDRRRIAENLDIKIKSWSYGKEGNMRALLSSLQSVLWAESGWEPVSLTDLI  523

Query  541   TSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             TS SVKKVY KATLCVHPDKVQQK ASL +KY AEKVFDILKEA+ KFN EEL
Sbjct  524   TSGSVKKVYRKATLCVHPDKVQQKGASLEQKYTAEKVFDILKEAWNKFNKEEL  576



>ref|XP_004246243.1| PREDICTED: auxilin-related protein 2 [Solanum lycopersicum]
 ref|XP_010325724.1| PREDICTED: auxilin-related protein 2 [Solanum lycopersicum]
Length=921

 Score =   230 bits (586),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 155/205 (76%), Gaps = 2/205 (1%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
            ++D++FD  F N  G    K T+    S  +  S   +FVDD SS       S   EF  
Sbjct  718  TSDNIFDSPFQNKAGPEGPKSTAGVASSNIRKASSTTSFVDDLSSIFGASASSG--EFQG  775

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            VEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q++Q+E+ R++E LD EIKRWAA
Sbjct  776  VEGETEERRRARLERHQRTQERAAKALAEKNQRDLQVQRDQEERHRISETLDFEIKRWAA  835

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQYVLWPECGWQ VSLTDLI   SVKKVY KATLC+HPDKVQQK A+L
Sbjct  836  GKEGNLRALLSTLQYVLWPECGWQPVSLTDLIMDASVKKVYRKATLCIHPDKVQQKGANL  895

Query  457  REKYIAEKVFDILKEAFGKFNAEEL  383
            ++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  896  QQKYIAEKVFDLLKEAWNKFNSEEL  920


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 66/229 (29%), Positives = 104/229 (45%), Gaps = 19/229 (8%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPL-ANLKAKSK--PSSGFPNDSG----QKSSHNSDPYDLD  1643
             MD+  VL    G +  G S P+ +++++ S   P     N  G       ++NS  Y+ D
Sbjct  1     MDDLDVLARDLGFRHAGKSAPMRSDIRSTSSSDPDPMLFNVFGGPPKYTKTNNSADYNYD  60

Query  1642  GVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnnsNLR  1463
              +F S K +   +    +I    FP ++         D D F      ++    ++S LR
Sbjct  61    SIFVSAKNNNNND---DNIKTSSFPVNDKPV-----YDDDIFDGLPGVKSKALSSSSTLR  112

Query  1462  DEFDFFG---SAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDSDDLIPGFGFHSNSEKS  1292
              E D F    S P+ +   DDL GNLG      +  +     + DDL+ GFG  ++S   
Sbjct  113   FEDDVFATMTSPPQQNIHFDDLLGNLGRNEKVAQPKSSVGSTEFDDLLAGFGTGTSSRSF  172

Query  1291  ARTSHSQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKL  1145
               +++  + + +S K SS+  DDPF V EST    N S    SDPLE++
Sbjct  173   TDSTYPSKPAENSNK-SSSMLDDPFVVLESTSVPANSSGGEFSDPLEEI  220



>ref|XP_002968053.1| hypothetical protein SELMODRAFT_451301 [Selaginella moellendorffii]
 gb|EFJ31400.1| hypothetical protein SELMODRAFT_451301 [Selaginella moellendorffii]
Length=768

 Score =   228 bits (581),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F E++GE+ +RR+ARL    RT+ R  +AL EK++RDL TQ+EQ EK R +E LD EIKR
Sbjct  620  FREIDGETPDRRKARLERDQRTQARARQALDEKHRRDLATQREQAEKHRASETLDSEIKR  679

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDL+T  +VKKVY +ATLCVHPDKVQQK 
Sbjct  680  WAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLLTGAAVKKVYRRATLCVHPDKVQQKG  739

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A++++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  740  ATIQQKYIAEKVFDLLKEAWNKFNSEEL  767



>ref|XP_002992586.1| hypothetical protein SELMODRAFT_451303 [Selaginella moellendorffii]
 gb|EFJ06288.1| hypothetical protein SELMODRAFT_451303 [Selaginella moellendorffii]
Length=768

 Score =   228 bits (581),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F E++GE+ +RR+ARL    RT+ R  +AL EK++RDL TQ+EQ EK R +E LD EIKR
Sbjct  620  FREIDGETPDRRKARLERDQRTQARARQALDEKHRRDLATQREQAEKHRASETLDSEIKR  679

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDL+T  +VKKVY +ATLCVHPDKVQQK 
Sbjct  680  WAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLLTGAAVKKVYRRATLCVHPDKVQQKG  739

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A++++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  740  ATIQQKYIAEKVFDLLKEAWNKFNSEEL  767



>gb|EPS64905.1| hypothetical protein M569_09873, partial [Genlisea aurea]
Length=836

 Score =   229 bits (583),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT++R A+ALAEKNQRDLQ Q+EQ+E+ R+AE LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  706  HQRTQQRAAKALAEKNQRDLQVQREQEERHRIAEVLDTEIKRWAAGKEGNLRALLSTLQY  765

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  766  VLWPECGWQPVSLTDLITGVSVKKVYRKATLCIHPDKVQQKGATLQQKYIAEKVFDLLKE  825

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  826  AWNKFNSEEL  835



>ref|XP_007049495.1| Chaperone DnaJ-domain superfamily protein, putative isoform 1 
[Theobroma cacao]
 ref|XP_007049496.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX93652.1| Chaperone DnaJ-domain superfamily protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX93653.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma 
cacao]
Length=972

 Score =   229 bits (584),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 158/205 (77%), Gaps = 3/205 (1%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
            S+D +FDG   N GG    + TS G+ S+ +  S   N VDD SS       SS  EF E
Sbjct  770  SSDPLFDG--QNKGGPEVARRTSVGSSSSMRKVSSTANIVDDLSSIFGAAASSSG-EFQE  826

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            VEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R+AE LD EIKRWAA
Sbjct  827  VEGETEERRRARLERHQRTQERAAKALAEKNQRDLQVQREQAERHRIAETLDVEIKRWAA  886

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L
Sbjct  887  GKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGAAVKKAYRKATLCIHPDKVQQKGANL  946

Query  457  REKYIAEKVFDILKEAFGKFNAEEL  383
            ++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  947  QQKYIAEKVFDLLKEAWNKFNSEEL  971


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 121/283 (43%), Gaps = 78/283 (28%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSD-----------  1658
             MD+F G+L + +G+K +G S P+A  +    PSSG    SG      SD           
Sbjct  1     MDDFPGLLAKDFGIKPQGKSAPMAPPR---NPSSGTNISSGSNYGFRSDFTRSSSGNAKS  57

Query  1657  -------PYDLDGVFRSGKTSGQQNYDNSDIFGG--QFPS-SNSTTAQQSHVDLDTFFKG  1508
                     +D DG+  +            D+FGG  ++ S S +TTAQ S  D D+ FK 
Sbjct  58    SSNSIFDDHDRDGLIFN------------DVFGGPPKYSSESRATTAQTSSFDYDSIFKD  105

Query  1507  STnqngnnrnnsNLRDEFD-----------------------FFGSAPKP------SDSV  1415
                   +     +  D FD                         GS+P P      S   
Sbjct  106   PKPPVFDKPVYDD--DLFDGLPGIKSSSSAASAAKYDDVFASISGSSPPPKHRSVSSSPF  163

Query  1414  DDLFGNLGFKSGGLKKTA--VQNVHDS---DDLIPGFGFHSNSEKSARTS----HSQQSS  1262
             D+L GNLG K    K  +  V+   D+   DDL+PGFG  S+S   AR++     SQ+ +
Sbjct  164   DELLGNLGRKETDTKTKSERVKAEKDAPVFDDLLPGFG-RSSSPAPARSTSDAHRSQKPA  222

Query  1261  VHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAETN  1133
              +S K  S   +DPF V EST    + SS   +DPLE++ + N
Sbjct  223   SNSIKTGSNSMEDPFVVIESTSVPADSSSGLFTDPLEEINKIN  265



>ref|XP_006580346.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006580347.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Glycine 
max]
Length=983

 Score =   228 bits (582),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQTQ+EQ E+ RLAE LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  853  HQRTKERAAKALAEKNQRDLQTQREQAERHRLAETLDFEIKRWAAGKEGNLRALLSTLQY  912

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +VKK Y KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  913  VLWPECGWQPVSLTDLITAAAVKKAYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  972

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  973  AWNKFNSEEL  982



>ref|XP_009587427.1| PREDICTED: auxilin-related protein 2-like [Nicotiana tomentosiformis]
Length=960

 Score =   228 bits (582),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 155/206 (75%), Gaps = 2/206 (1%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            ++ D++FD  F    G    K +S    S  +  S   +FVDD SS       S   +F 
Sbjct  756  STPDNVFDSQFQTKAGSEGPKSSSGVASSNMRKASSTTSFVDDLSSIFGASASSG--DFQ  813

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            +VEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ  ++Q+E+ R+AE LD EIKRWA
Sbjct  814  DVEGETEERRRARLERHHRTQERAAKALAEKNQRDLQVLRDQEERHRIAETLDFEIKRWA  873

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+
Sbjct  874  AGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKGAT  933

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  934  LQQKYIAEKVFDLLKEAWNKFNSEEL  959



>ref|XP_009800690.1| PREDICTED: auxilin-related protein 2-like [Nicotiana sylvestris]
Length=958

 Score =   228 bits (581),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            +F +VEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q+EQ+E+ R+ E LD EIK
Sbjct  809  DFQDVEGETEERRRARLERHQRTQERAAKALAEKNQRDLQVQREQEERHRIGETLDFEIK  868

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK
Sbjct  869  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQK  928

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  929  GATLQQKYIAEKVFDMLKEAWNKFNSEEL  957



>gb|KHN16939.1| Auxilin-related protein 2 [Glycine soja]
Length=816

 Score =   227 bits (579),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQTQ+EQ E+ RLAE LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  686  HQRTKERAAKALAEKNQRDLQTQREQAERHRLAETLDFEIKRWAAGKEGNLRALLSTLQY  745

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +VKK Y KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  746  VLWPECGWQPVSLTDLITAAAVKKAYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  805

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  806  AWNKFNSEEL  815



>ref|XP_009600153.1| PREDICTED: auxilin-related protein 2-like [Nicotiana tomentosiformis]
Length=958

 Score =   228 bits (580),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            +F +VEGE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q+EQ+E+ R+ E LD EIK
Sbjct  809  DFQDVEGETEERRRARLERHQRTQERAAKALAEKNQRDLQVQREQEERHRIGETLDFEIK  868

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK
Sbjct  869  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQK  928

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  929  GATLQQKYIAEKVFDMLKEAWNKFNSEEL  957



>gb|AAL91223.1| auxilin-like protein [Arabidopsis thaliana]
 gb|AAP81797.1| At4g12780 [Arabidopsis thaliana]
Length=485

 Score =   220 bits (561),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  337  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDRIGVTLDVEIKR  396

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK 
Sbjct  397  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKG  456

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  457  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  484



>gb|KFK35296.1| hypothetical protein AALP_AA5G266200 [Arabis alpina]
Length=517

 Score =   220 bits (561),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 172/269 (64%), Gaps = 48/269 (18%)
 Frame = -1

Query  1186  NVSSWPSSDPLEKLAETNPSIDELEDFVSGRGTSTSQGQQHYVSRKES-NVKKTHSAGDI  1010
             N  S PSS P ++   TNPS D  +D  +  G+  S      V    S N++K  SA +I
Sbjct  295   NSVSRPSSAPRQR---TNPS-DPFQDSWNKGGSFESSRASSLVPPGASENLRKASSATNI  350

Query  1009  LSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfD  830
             + + S+      +F   GGG+        TQS G                          
Sbjct  351   VDDISS------IF---GGGS-------ATQSGG--------------------------  368

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
              F +VEGE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q++Q E++R+ E LD EIK
Sbjct  369   -FPDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQVQRDQAERNRIGETLDVEIK  427

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLI   SVKKVY KATLC+HPDKVQQK
Sbjct  428   RWGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLIMGASVKKVYRKATLCIHPDKVQQK  487

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEEL  383
              A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  488   GANLQQKYIAEKVFDMLKEAWNKFNSEEL  516



>ref|XP_006366804.1| PREDICTED: auxilin-related protein 1-like [Solanum tuberosum]
Length=954

 Score =   226 bits (576),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQ Q EQ E+ R++E LD EIKRWAAGKEGNLRALLS++QY
Sbjct  824  HQRTQERAAKALAEKNQRDLQVQMEQQERHRISETLDIEIKRWAAGKEGNLRALLSTMQY  883

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  884  VLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKGATLQQKYVAEKVFDMLKE  943

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  944  AWNKFNSEEL  953



>ref|XP_004242447.1| PREDICTED: auxilin-related protein 2-like [Solanum lycopersicum]
Length=963

 Score =   226 bits (576),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQ Q EQ E+ R++E+LD EIKRWAAGKEGNLRALLS++QY
Sbjct  833  HQRTQERAAKALAEKNQRDLQVQMEQQERHRISESLDIEIKRWAAGKEGNLRALLSTMQY  892

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  893  VLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKGATLQQKYVAEKVFDMLKE  952

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  953  AWNKFNSEEL  962



>ref|NP_193014.5| auxilin-related protein 1 [Arabidopsis thaliana]
 sp|Q9SU08.2|AUXI1_ARATH RecName: Full=Auxilin-related protein 1 [Arabidopsis thaliana]
 gb|AEE83179.1| auxilin-related protein 1 [Arabidopsis thaliana]
Length=904

 Score =   226 bits (575),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  756  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDRIGVTLDVEIKR  815

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK 
Sbjct  816  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKG  875

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  876  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  903



>ref|XP_006283093.1| hypothetical protein CARUB_v10004108mg [Capsella rubella]
 gb|EOA15991.1| hypothetical protein CARUB_v10004108mg [Capsella rubella]
Length=876

 Score =   225 bits (574),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  728  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQLQREQAEKDRIGVTLDVEIKR  787

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK 
Sbjct  788  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKG  847

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  848  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  875



>ref|XP_010450239.1| PREDICTED: auxilin-related protein 2 isoform X1 [Camelina sativa]
Length=895

 Score =   226 bits (575),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 169/269 (63%), Gaps = 49/269 (18%)
 Frame = -1

Query  1186  NVSSWPSSDPLEKLAETNPSIDELED-FVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDI  1010
             N  S P+S P ++   TNP +D  +D +  G    +S+      SR   N++KT SA +I
Sbjct  674   NSVSRPNSAPRQR---TNP-LDPFQDSWNKGGSFESSRPSSQVPSRATENLRKTSSATNI  729

Query  1009  LSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfD  830
             + + S+  +F    + +GG                                         
Sbjct  730   VDDLSS--IFGAPASQSGG-----------------------------------------  746

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
              F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+ E LD EI+
Sbjct  747   -FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGETLDVEIR  805

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW AGKEGNLRALLS+LQYVLWP CGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK
Sbjct  806   RWGAGKEGNLRALLSTLQYVLWPGCGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQK  865

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEEL  383
              A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  866   GANLQQKYIAEKVFDMLKEAWNKFNSEEL  894



>gb|EMS56462.1| Auxilin-related protein 2 [Triticum urartu]
Length=692

 Score =   223 bits (569),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ ++LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  562  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDSLDFEIKRWAAGKEGNLRALLSTLQY  621

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KYIAEKVFDILKE
Sbjct  622  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGATLQQKYIAEKVFDILKE  681

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  682  AWNKFNSEEL  691



>ref|XP_010435356.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Camelina 
sativa]
Length=897

 Score =   225 bits (574),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 169/269 (63%), Gaps = 49/269 (18%)
 Frame = -1

Query  1186  NVSSWPSSDPLEKLAETNPSIDELED-FVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDI  1010
             N  S P+S P ++   TNP +D  +D +  G    +S+      SR   N++KT SA +I
Sbjct  676   NSVSRPNSAPRQR---TNP-LDPFQDSWNKGGSFESSRPSSQVPSRATENLRKTSSATNI  731

Query  1009  LSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfD  830
             + + S+  +F    + +GG                                         
Sbjct  732   VDDLSS--IFGAPASQSGG-----------------------------------------  748

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
              F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+ E LD EI+
Sbjct  749   -FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGETLDVEIR  807

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW AGKEGNLRALLS+LQYVLWP CGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK
Sbjct  808   RWGAGKEGNLRALLSTLQYVLWPGCGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQK  867

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEEL  383
              A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  868   GANLQQKYIAEKVFDMLKEAWNKFNSEEL  896



>ref|XP_010451586.1| PREDICTED: auxilin-related protein 1-like [Camelina sativa]
Length=810

 Score =   224 bits (572),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 170/269 (63%), Gaps = 49/269 (18%)
 Frame = -1

Query  1186  NVSSWPSSDPLEKLAETNPSIDELED-FVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDI  1010
             N  S P+S P ++   TNP +D  +D +  G    +S+      SR   N++KT S+ +I
Sbjct  589   NSVSRPNSAPRQR---TNP-LDPFQDSWNKGGSFESSRPSSQVPSRATENLRKTSSSTNI  644

Query  1009  LSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfD  830
             + + S+  +F    + +GG                                         
Sbjct  645   VDDLSS--IFGAPASQSGG-----------------------------------------  661

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
              F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIK
Sbjct  662   -FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDRIGVTLDVEIK  720

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK
Sbjct  721   RWGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQK  780

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEEL  383
              A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  781   GANLQQKYIAEKVFDMLKEAWNKFNSEEL  809



>gb|KHG12625.1| hypothetical protein F383_17312 [Gossypium arboreum]
Length=710

 Score =   223 bits (568),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 157/203 (77%), Gaps = 3/203 (1%)
 Frame = -1

Query  991  DHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHEVE  812
            D +FDG   N GG    K TS G+ S+ K  S   N VDD SS       SS  EF EVE
Sbjct  510  DPVFDG--QNRGGPEVAKRTSVGSSSSMKKASSTTNIVDDLSSIFGAAASSSG-EFQEVE  566

Query  811  GESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGK  632
            GE+ ERRRARL  H RT+ER A+ALAEKNQRDLQ Q+EQ E+ R++E LD EIKRWAAGK
Sbjct  567  GETEERRRARLERHQRTQERAAKALAEKNQRDLQVQREQAERHRISETLDVEIKRWAAGK  626

Query  631  EGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLRE  452
            EGNLRALLS++QYVLWPECGWQ VSLTDLIT+ +VKK Y KATLC+HPDKVQQK A+L++
Sbjct  627  EGNLRALLSTMQYVLWPECGWQPVSLTDLITAAAVKKAYRKATLCIHPDKVQQKGANLQQ  686

Query  451  KYIAEKVFDILKEAFGKFNAEEL  383
            KYI+EKVFD+LKEA+ KFN+EEL
Sbjct  687  KYISEKVFDLLKEAWNKFNSEEL  709



>ref|XP_003526879.1| PREDICTED: auxilin-related protein 2-like [Glycine max]
Length=922

 Score =   225 bits (573),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQTQ++Q E+ R+AE LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  792  HQRTQERAAKALAEKNQRDLQTQRDQAERHRVAETLDFEIKRWAAGKEGNLRALLSTLQY  851

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +V+KVY KATLC HPDKVQQK A++++KYIAEKVFD+LKE
Sbjct  852  VLWPECGWQPVSLTDLITAAAVRKVYRKATLCTHPDKVQQKGATIQQKYIAEKVFDLLKE  911

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  912  AWNKFNSEEL  921



>ref|XP_010440618.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Camelina 
sativa]
Length=894

 Score =   225 bits (573),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  746  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDRIGVTLDVEIKR  805

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK 
Sbjct  806  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKG  865

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  866  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  893



>ref|XP_010450240.1| PREDICTED: auxilin-related protein 2 isoform X2 [Camelina sativa]
Length=893

 Score =   225 bits (573),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+ E LD EI+R
Sbjct  745  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGETLDVEIRR  804

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWP CGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  805  WGAGKEGNLRALLSTLQYVLWPGCGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  864

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  865  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  892



>ref|XP_010542046.1| PREDICTED: auxilin-related protein 2-like [Tarenaya hassleriana]
Length=956

 Score =   225 bits (573),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN+RDLQ Q EQ E+ R+ E LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  826  HQRTQERAAKALAEKNERDLQAQNEQAERHRIGETLDFEIKRWAAGKEGNLRALLSTLQY  885

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  886  VLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  945

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  946  AWNKFNSEEL  955


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 87/193 (45%), Gaps = 44/193 (23%)
 Frame = -1

Query  1654  YDLDGVFRSGKTSGQQN---YD----NSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnq  1496
             +D D +F+  KTS       YD    + DIF G  P   ST+  QS              
Sbjct  95    FDYDAMFKDQKTSKSAPIPVYDKPVYDEDIFEG-IPGLKSTSTSQS--------------  139

Query  1495  ngnnrnnsNLRDEFDFFGSAPK----PSDSVDDLFGNLGFKSGGLKKT-AVQNVHDS---  1340
                    +   D F    S+PK     S   DDL GNLG K    KKT +V+    S   
Sbjct  140   -------ARFDDVFSSISSSPKHKKQNSSPFDDLLGNLGRKDTEPKKTESVREGKGSSIF  192

Query  1339  DDLIPGFGFHSNS---EKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSS  1175
             DDLIPGF   S+      ++ TS SQ+ S  + K SS   +DPF+V +  STPPV +   
Sbjct  193   DDLIPGFPSRSSPPIDRSTSETSESQKPSSGTSKTSSPLVEDPFAVLQSASTPPVSSTRE  252

Query  1174  WPSSDPLEKLAET  1136
             +   DPLE+ ++ 
Sbjct  253   F--GDPLEEFSKV  263



>ref|XP_008442142.1| PREDICTED: auxilin-related protein 2-like [Cucumis melo]
Length=987

 Score =   225 bits (574),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EV+GES ERRRARL  H R + R A+ALAEKN+RDLQ Q+EQ E+ R+AE LD EIK
Sbjct  838  EFQEVDGESEERRRARLERHQRVQTRAAKALAEKNERDLQMQREQAERHRIAETLDAEIK  897

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLT+++   +VKKVY KATLC+HPDKVQQK
Sbjct  898  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTEMVIPNAVKKVYRKATLCIHPDKVQQK  957

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFDILKEA+ KFN+EEL
Sbjct  958  GATLQQKYVAEKVFDILKEAWNKFNSEEL  986



>ref|XP_010440619.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Camelina 
sativa]
Length=892

 Score =   224 bits (572),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  744  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDRIGVTLDVEIKR  803

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK 
Sbjct  804  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKG  863

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  864  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  891



>dbj|BAJ93380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=633

 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF  VEGES ERRRARL  H RTRER A+ALAEKN+RD+  Q+EQ E+ R++E+LD EIK
Sbjct  484  EFQAVEGESEERRRARLERHQRTRERAAKALAEKNERDMNVQREQAERDRISESLDFEIK  543

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS++QYVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK
Sbjct  544  RWAAGKEGNLRALLSTMQYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQK  603

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  604  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  632



>ref|NP_193013.2| auxilin-related protein 2 [Arabidopsis thaliana]
 sp|Q0WQ57.1|AUXI2_ARATH RecName: Full=Auxilin-related protein 2 [Arabidopsis thaliana]
 dbj|BAF00742.1| auxilin-like protein [Arabidopsis thaliana]
 gb|AEE83177.1| auxilin-related protein 2 [Arabidopsis thaliana]
Length=891

 Score =   224 bits (572),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EI+R
Sbjct  743  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGGTLDVEIRR  802

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  803  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  862

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  863  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  890



>ref|XP_010435339.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Camelina 
sativa]
Length=891

 Score =   224 bits (572),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  743  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDRIGVTLDVEIKR  802

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  803  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  862

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  863  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  890



>ref|XP_002863292.1| hypothetical protein ARALYDRAFT_497125 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39551.1| hypothetical protein ARALYDRAFT_497125 [Arabidopsis lyrata subsp. 
lyrata]
Length=890

 Score =   224 bits (572),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER  +ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  742  FQDVDGETEERRRARLERHQRTQERAVKALAEKNERDLQVQREQVEKDRIGVTLDVEIKR  801

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK 
Sbjct  802  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKG  861

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  862  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  889



>ref|XP_010435338.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Camelina 
sativa]
Length=893

 Score =   224 bits (572),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EIKR
Sbjct  745  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDRIGVTLDVEIKR  804

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  805  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  864

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  865  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  892



>gb|ACG29251.1| hypothetical protein [Zea mays]
Length=568

 Score =   220 bits (560),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ + LD EIKRW+AGKEGNLRALLS+LQY
Sbjct  438  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDTLDFEIKRWSAGKEGNLRALLSTLQY  497

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KYIAEKVFDILKE
Sbjct  498  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGATLQQKYIAEKVFDILKE  557

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  558  AWNKFNSEEL  567



>ref|NP_001190708.1| auxilin-related protein 2 [Arabidopsis thaliana]
 gb|AEE83178.1| auxilin-related protein 2 [Arabidopsis thaliana]
Length=889

 Score =   224 bits (572),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EI+R
Sbjct  741  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGGTLDVEIRR  800

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  801  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  860

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  861  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  888



>ref|XP_006286120.1| hypothetical protein CARUB_v10007669mg [Capsella rubella]
 gb|EOA19018.1| hypothetical protein CARUB_v10007669mg [Capsella rubella]
Length=882

 Score =   224 bits (571),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+   LD EI+R
Sbjct  734  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGGTLDIEIRR  793

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  794  WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  853

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  854  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  881



>ref|XP_010435357.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Camelina 
sativa]
Length=895

 Score =   224 bits (570),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK R+ E LD EI+R
Sbjct  747  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGETLDVEIRR  806

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWP CGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  807  WGAGKEGNLRALLSTLQYVLWPGCGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  866

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  867  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  894



>gb|KHG03751.1| hypothetical protein F383_26895 [Gossypium arboreum]
Length=954

 Score =   224 bits (571),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = -1

Query  997  STDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFHE  818
            S+D +FDG   N GG    + TS G+ S+ +  S   N VDD SS       S   EF E
Sbjct  752  SSDPLFDG--QNKGGPEVARGTSAGSSSSMRKASSSANIVDDLSSIFGAAASSFG-EFQE  808

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            V+GE+ ERRRARL    RT+ER A+ALAEKN RDLQ Q+EQ E+ R++E LD EIKRWAA
Sbjct  809  VDGETEERRRARLERQQRTQERAAKALAEKNHRDLQVQREQAERHRISETLDVEIKRWAA  868

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQYVLWPECGWQ VSLTDLI   +VKK Y KATLC+HPDKVQQK A+L
Sbjct  869  GKEGNLRALLSTLQYVLWPECGWQPVSLTDLIMGAAVKKAYRKATLCIHPDKVQQKGANL  928

Query  457  REKYIAEKVFDILKEAFGKFNAEEL  383
            ++KY+AEKVFD+LKEA+ KFN+EEL
Sbjct  929  QQKYVAEKVFDLLKEAWNKFNSEEL  953



>gb|KGN54785.1| hypothetical protein Csa_4G496260 [Cucumis sativus]
Length=987

 Score =   224 bits (571),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EV+GE+ ERRRARL  H R + R A+ALAEKN+RDLQ Q+EQ E+ R+AE LD EIK
Sbjct  838  EFQEVDGETEERRRARLERHQRVQTRAAKALAEKNERDLQMQREQAERHRIAETLDAEIK  897

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLT+++   +VKKVY KATLC+HPDKVQQK
Sbjct  898  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTEMVIPNAVKKVYRKATLCIHPDKVQQK  957

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFDILKEA+ KFN+EEL
Sbjct  958  GATLQQKYVAEKVFDILKEAWNKFNSEEL  986



>ref|XP_004146411.1| PREDICTED: auxilin-related protein 1-like [Cucumis sativus]
Length=974

 Score =   224 bits (570),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EV+GE+ ERRRARL  H R + R A+ALAEKN+RDLQ Q+EQ E+ R+AE LD EIK
Sbjct  825  EFQEVDGETEERRRARLERHQRVQTRAAKALAEKNERDLQMQREQAERHRIAETLDAEIK  884

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLT+++   +VKKVY KATLC+HPDKVQQK
Sbjct  885  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTEMVIPNAVKKVYRKATLCIHPDKVQQK  944

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFDILKEA+ KFN+EEL
Sbjct  945  GATLQQKYVAEKVFDILKEAWNKFNSEEL  973



>ref|XP_006584657.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006584658.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Glycine 
max]
Length=934

 Score =   224 bits (570),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  763  TRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLW  584
            T+ER A+ALAEKNQRDLQTQ+EQ E+ RLAE LD EIKRWAAGKEGNLRALLS+LQYVLW
Sbjct  807  TKERAAKALAEKNQRDLQTQREQAERHRLAETLDFEIKRWAAGKEGNLRALLSTLQYVLW  866

Query  583  PECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFG  404
            PECGWQ VSLTDLIT+ +VKK Y KATLC+HPDKVQQK A+L++KY+AEKVFD+LKEA+ 
Sbjct  867  PECGWQPVSLTDLITAAAVKKAYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKEAWN  926

Query  403  KFNAEEL  383
            KFN+EEL
Sbjct  927  KFNSEEL  933


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 106/254 (42%), Gaps = 60/254 (24%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSD-----------  1658
             M++F G+    +G+K +G S P+A     S  S+    D G +SS N D           
Sbjct  21    MNDFDGLFTSDFGLKPQGKSAPMAPQSKGSSNSASLNLDFGSRSSSNFDDLLAGAGSDNR  80

Query  1657  ----PYDLDGVF-----RSGKTSGQQNYD----NSDIFGGQFPSSNSTTAQQSHVDLDTF  1517
                 P+DLD ++     RS  +     YD    + DIF G  P   ST    S V  D  
Sbjct  81    RSDSPFDLDSMYGGPPARSTNSPPPPVYDKPVYDDDIFDG-VPGLKST----SKVKFDDV  135

Query  1516  FKGSTnqngnnrnnsNLRDEFDFFGSAPKPSDSVDDLFGNLGFKS----GGLKKTAVQNV  1349
             F  +T                   G+A       DDL G  G +S    G   +   + V
Sbjct  136   FATTTESGR---------------GAA------FDDLLGGFGKESKSSDGKRSEKDGKGV  174

Query  1348  HDSDDLIPGFGFHSNSEKSARTSH----SQQSSVHSYKQSSTFADDPFSVFESTPPVQNV  1181
              D DDL+ GFG HS S    R +     S + +  + K + T A+DPF VFES     + 
Sbjct  175   SDLDDLLAGFG-HSRSSSGGRHTPDIGLSSEPTASASKTTPTSAEDPFKVFESASAPVDS  233

Query  1180  SSWPSSDPLEKLAE  1139
             S+    DPLE++++
Sbjct  234   SAGHFMDPLEEISK  247



>ref|XP_006415007.1| hypothetical protein EUTSA_v10024361mg [Eutrema salsugineum]
 gb|ESQ56460.1| hypothetical protein EUTSA_v10024361mg [Eutrema salsugineum]
Length=894

 Score =   223 bits (568),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN+RDLQ Q+EQ EK+R+ E LD EIKRW AGKEGNLRALLS+LQY
Sbjct  764  HQRTQERAAKALAEKNERDLQVQREQAEKNRIGETLDVEIKRWGAGKEGNLRALLSTLQY  823

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  824  VLWPECGWQPVSLTDLITAASVKKSYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKE  883

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  884  AWNKFNSEEL  893


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 108/270 (40%), Gaps = 56/270 (21%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSK-------PSSGFPNDSGQKSSHNSDPYDL  1646
             MD+F G+L   +G+K +G S P+A     S        PS  F N +  K   +S P   
Sbjct  1     MDDFTGLLARDFGLKPQGKSAPMAPQTNSSAADFSSFAPSYSFAN-ASSKKKSDSSPV-F  58

Query  1645  DGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnn--s  1472
             D + R G      +   +D+F G   S + T       D D  FK  T     +      
Sbjct  59    DDLSRDG-----DDLLFNDVFSGSSDSRSQTKPSAPAFDYDAMFKERTTPKSASMPVYDK  113

Query  1471  NLRDE--FDFFGSAPKPSDS-------------------------VDDLFGNLGFKSGGL  1373
              + DE  F+ F     PS S                          DDL GNLG +    
Sbjct  114   PVYDEDVFEAFPELKIPSTSQSARFDDVFSSISSPRKHRKQNSSPFDDLIGNLGKRETEP  173

Query  1372  KKTAVQNVHDS----DDLIPGFGFHSNS---EKSARTSHSQQSSVHSYKQSSTFADDPFS  1214
             KKT  +         DDLIPGFG  S+      ++ TS SQ+    + K SS   +DPF 
Sbjct  174   KKTESEREEQGSSVFDDLIPGFGRTSSPPTKRPTSETSQSQKPPYRTAKTSSNLVEDPFV  233

Query  1213  VFE---STPPVQNVSSWPSSDPLEKLAETN  1133
             V E   STP   +   +  +DPLE++ + N
Sbjct  234   VLEESASTPSEPSTGGF--TDPLEEIGKFN  261



>gb|KFK35298.1| hypothetical protein AALP_AA5G266400, partial [Arabis alpina]
Length=716

 Score =   221 bits (563),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN+RDLQ Q++Q E++R+ E LD EIKRW AGKEGNLRALLS+LQY
Sbjct  586  HQRTQERAAKALAEKNERDLQVQRDQAERNRIGETLDVEIKRWGAGKEGNLRALLSTLQY  645

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  646  VLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKE  705

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  706  AWNKFNSEEL  715



>ref|XP_010532937.1| PREDICTED: auxilin-related protein 2-like [Tarenaya hassleriana]
Length=920

 Score =   222 bits (566),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN+RDLQ Q+EQ E+ R++E LD EIKRWA GKEGNLRA+LS+LQY
Sbjct  790  HQRTQERAAKALAEKNERDLQAQKEQAERHRISETLDVEIKRWALGKEGNLRAMLSTLQY  849

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ SVKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  850  VLWPECGWQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  909

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  910  AWNKFNSEEL  919


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 67/139 (48%), Gaps = 19/139 (14%)
 Frame = -1

Query  1462  DEFDFFGSAPK----PSDSVDDLFGNLGFKSGGLKKTAVQNVHDS------DDLIPGFGF  1313
             D F    S+PK     S   DDL GNLG K    +    +NV +       DDLIPGFG 
Sbjct  143   DVFSSISSSPKHKKHNSSPFDDLLGNLGRKD--TEPMKAENVREEKGSSIFDDLIPGFGR  200

Query  1312  HSNS---EKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPSSDPLEK  1148
              S++     ++ TS SQ+ S    K SS   +DPF V E  STPP  +   +  SDPLE+
Sbjct  201   SSSTPVDRSTSETSQSQKPSTGRTKASSPLVEDPFVVLESASTPPASSTGEF--SDPLEE  258

Query  1147  LAETNPSIDELEDFVSGRG  1091
              ++ + S     D  S  G
Sbjct  259   FSKFSSSNSRKADHSSAHG  277



>ref|XP_009383742.1| PREDICTED: auxilin-related protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   222 bits (566),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = -1

Query  1000 TSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDEFH  821
            T ++ MFDG   N GG    + T+    S  K+ S   NF DD +S   G   S   EF 
Sbjct  751  TPSEAMFDGQAQNKGGFDATRRTTSSYSSVRKTAS-TSNFADDLASIFGGPPSSG--EFQ  807

Query  820  EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
            E+EGES ERRRARL  H RT ER A+ALAEKN+RD+QTQ+EQ E+ R+AE  D EIKRWA
Sbjct  808  EIEGESEERRRARLERHQRTLERAAKALAEKNERDMQTQREQAERHRIAETQDIEIKRWA  867

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            +GKEGNLR LLS+L YVLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK A+
Sbjct  868  SGKEGNLRTLLSTLHYVLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKGAT  927

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  928  LQQKYIAEKVFDLLKEAWNKFNSEEL  953


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 75/278 (27%), Positives = 117/278 (42%), Gaps = 60/278 (22%)
 Frame = -1

Query  1801  MDEF-GVLVERYGVKSRGNSIPLANLKAKSKPSSGFPN---DSGQKSSHN----------  1664
             MD+F G+L   +G + +G S+P+A  KA +    G  N    SG+ S+ N          
Sbjct  1     MDDFPGILARDFGFRPQGKSVPMAASKAAASSGGGSANFEFGSGRSSAANGSWGKSRSGW  60

Query  1663  -----SDPYDLDGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKG---  1508
                  S+P+  D      ++     YD  D+FGG    SN + +       D+ F G   
Sbjct  61    NPNSDSEPWLGDHGVEISESRSPPAYD--DVFGGPARPSNRSASSSPPPAFDSIFDGYNK  118

Query  1507  ------STnqngnnrnnsNLRDEF----------------DFFGSAPKPSDSV-----DD  1409
                   S++ +    +     D+                 D FGS    S++V     +D
Sbjct  119   DAAVKPSSSSSLPVYDKPVYDDDIFDGVPGVKSSSSFKYDDVFGSMSSGSNNVYPPPYED  178

Query  1408  LFGNLGFKSGGLKKTAV--------QNVHDSDDLIPGFGFHSNSEKSA-RTSHSQQSSVH  1256
             L  NLG  +   K T+         Q++   DDLIPGFG  S  +K     ++ Q+ +V 
Sbjct  179   LLENLGKPTSESKGTSYRGSAVEKNQDLSGFDDLIPGFGGSSPPKKREFSVANEQKPAVS  238

Query  1255  SYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLA  1142
             S K  ++  +DPF V ES PP    +S   +DPLE ++
Sbjct  239   SAKPPASTTEDPFVVLESKPPSTYSASGFFADPLEHIS  276



>ref|XP_009364182.1| PREDICTED: auxilin-related protein 2-like [Pyrus x bretschneideri]
Length=977

 Score =   223 bits (567),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF +VEGE+ ERRRARL  H RT+ER  +ALAEKN+RDLQ Q+EQ E+ R+AE+LD EIK
Sbjct  828  EFQDVEGETEERRRARLERHQRTQERTLKALAEKNERDLQAQREQAERHRIAESLDVEIK  887

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWA GKEGNLRALLS++QYVLWPECGWQ VSLTD+IT+ SVKKVY KATLC+HPDKVQQK
Sbjct  888  RWAVGKEGNLRALLSTMQYVLWPECGWQPVSLTDMITAASVKKVYRKATLCIHPDKVQQK  947

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  948  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  976



>gb|ACN33245.1| unknown [Zea mays]
 tpg|DAA42394.1| TPA: hypothetical protein ZEAMMB73_086624 [Zea mays]
Length=898

 Score =   222 bits (566),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ + LD EIKRW+AGKEGNLRALLS+LQY
Sbjct  768  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDTLDFEIKRWSAGKEGNLRALLSTLQY  827

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KYIAEKVFDILKE
Sbjct  828  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGATLQQKYIAEKVFDILKE  887

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  888  AWNKFNSEEL  897



>ref|NP_001146349.1| uncharacterized protein LOC100279927 [Zea mays]
 gb|ACL53743.1| unknown [Zea mays]
Length=898

 Score =   222 bits (565),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ + LD EIKRW+AGKEGNLRALLS+LQY
Sbjct  768  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDTLDFEIKRWSAGKEGNLRALLSTLQY  827

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KYIAEKVFDILKE
Sbjct  828  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGATLQQKYIAEKVFDILKE  887

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  888  AWNKFNSEEL  897



>ref|XP_006447895.1| hypothetical protein CICLE_v10014131mg [Citrus clementina]
 ref|XP_006447896.1| hypothetical protein CICLE_v10014131mg [Citrus clementina]
 gb|ESR61135.1| hypothetical protein CICLE_v10014131mg [Citrus clementina]
 gb|ESR61136.1| hypothetical protein CICLE_v10014131mg [Citrus clementina]
Length=1017

 Score =   223 bits (567),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             +  SA    +NTS D +FD    + GG    + TS G  S  +  S   N VDD SS   
Sbjct  804   RPSSAPRPRANTS-DSLFDS--QSKGGPEPARRTSVGASSNMRKASSTTNIVDDLSSIFG  860

Query  853   gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLA  674
                 S+  EF +VEGE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q++Q E+ R+A
Sbjct  861   AAGSSAG-EFQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIA  919

Query  673   EALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCV  494
             E LD EIKRWAAGKEGN+RALL+++QYVLWPE GWQ VSLTDLIT+ +VKK Y KATLC+
Sbjct  920   ETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCI  979

Query  493   HPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             HPDKVQQK A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  980   HPDKVQQKGANLQQKYIAEKVFDLLKEAWNKFNSEEL  1016


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 77/261 (30%), Positives = 117/261 (45%), Gaps = 45/261 (17%)
 Frame = -1

Query  1801  MDEFGVLVER-YGVKSRGNSIPLANLKAKSKP------SSGFPNDSGQKSSHNSDPYDLD  1643
             MDEF  L+ R +G K +G S P+A  +A +        +S FP  S  +S+   D +D D
Sbjct  1     MDEFPSLLARDFGFKPQGKSAPMAPSRASNSSFVLGSNASEFPKSSSLRSTDVFDDHDRD  60

Query  1642  GVF-------------------RSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDT  1520
             G F                   RSG TS   ++D   I G    +S     +  + D   
Sbjct  61    GPFFNDVFVGPPKYSSTSAVDSRSGNTS---SFDYGSISGSSNANSMPVYDKPVYDDDVD  117

Query  1519  FFKG----STnqngnnrnnsNLRDEFDFFGS---------APKPSDSVDDLFGNLGFKSG  1379
              FKG     T+       +S+  +  D F S         + + S  +DDL GNLG K  
Sbjct  118   IFKGLPGLRTSSTPAAAASSSGANFDDVFASFSRSSAKHESARESSPLDDLLGNLGKKET  177

Query  1378  GLKKTAVQNVHDSDDLIPGFG---FHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVF  1208
               +  + ++V   DDL+PGFG     S++  ++ +S SQ+   +S K +S+  +DPF V 
Sbjct  178   ESRVKSEKDVSAFDDLLPGFGRSRSPSSNRSTSESSQSQKPPSNSTKTASSVMEDPFGVS  237

Query  1207  ESTPPVQNVSSWPSSDPLEKL  1145
             EST      SS   +D LE++
Sbjct  238   ESTSTHVGSSSEVFTDRLEEI  258



>ref|XP_006469380.1| PREDICTED: auxilin-related protein 2-like [Citrus sinensis]
Length=1017

 Score =   222 bits (566),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             +  SA    +NTS D +FD    + GG    + TS G  S  +  S   N VDD SS   
Sbjct  804   RPSSAPRPRANTS-DSLFDS--QSKGGPEPARRTSVGASSNMRKASSTTNIVDDLSSIFG  860

Query  853   gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLA  674
                 S+  EF +VEGE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q++Q E+ R+A
Sbjct  861   AAGSSAG-EFQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIA  919

Query  673   EALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCV  494
             E LD EIKRWAAGKEGN+RALL+++QYVLWPE GWQ VSLTDLIT+ +VKK Y KATLC+
Sbjct  920   ETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCI  979

Query  493   HPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             HPDKVQQK A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  980   HPDKVQQKGANLQQKYIAEKVFDLLKEAWNKFNSEEL  1016


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 77/261 (30%), Positives = 117/261 (45%), Gaps = 45/261 (17%)
 Frame = -1

Query  1801  MDEFGVLVER-YGVKSRGNSIPLANLKAKSKP------SSGFPNDSGQKSSHNSDPYDLD  1643
             MDEF  L+ R +G K +G S P+A  +A +        +S FP  S  +S+   D +D D
Sbjct  1     MDEFPSLLARDFGFKPQGKSAPMAPSRASNSSFVLGSNASEFPKSSSLRSTDVFDDHDRD  60

Query  1642  GVF-------------------RSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDT  1520
             G F                   RSG TS   ++D   I G    +S     +  + D   
Sbjct  61    GPFFNDVFVGTPKYSSTSAVDSRSGNTS---SFDYGSISGSSNANSMPVYDKPVYDDDVD  117

Query  1519  FFKG----STnqngnnrnnsNLRDEFDFFGS---------APKPSDSVDDLFGNLGFKSG  1379
              FKG     T+       +S+  +  D F S         + + S  +DDL GNLG K  
Sbjct  118   IFKGLPGLRTSSTPAAAASSSGANFDDVFASFSRSSAKHESARESSPLDDLLGNLGKKET  177

Query  1378  GLKKTAVQNVHDSDDLIPGFG---FHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVF  1208
               +  + ++V   DDL+PGFG     S++  ++ +S SQ+   +S K +S+  +DPF V 
Sbjct  178   ESRVKSEKDVSAFDDLLPGFGRSRSPSSNRSTSESSQSQKPPSNSTKTASSVMEDPFGVS  237

Query  1207  ESTPPVQNVSSWPSSDPLEKL  1145
             EST      SS   +D LE++
Sbjct  238   ESTSTHVGSSSEVFTDRLEEI  258



>gb|KDO51042.1| hypothetical protein CISIN_1g002109mg [Citrus sinensis]
Length=914

 Score =   222 bits (565),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 157/208 (75%), Gaps = 4/208 (2%)
 Frame = -1

Query  1006  SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDE  827
             +NTS D +FD    + GG    + TS G  S  +  S   N VDD SS       S+  E
Sbjct  710   ANTS-DSLFDS--QSKGGPEPARRTSVGASSNMRKASSTTNIVDDLSSIFGAAGSSAG-E  765

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             F +VEGE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q++Q E+ R+AE LD EIKR
Sbjct  766   FQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIAETLDVEIKR  825

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             WAAGKEGN+RALL+++QYVLWPE GWQ VSLTDLIT+ +VKK Y KATLC+HPDKVQQK 
Sbjct  826   WAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKG  885

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  886   ANLQQKYIAEKVFDLLKEAWNKFNSEEL  913



>ref|XP_006578776.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Glycine 
max]
Length=912

 Score =   222 bits (565),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQTQ++Q E+ R+AE LD EIKRWAAGK GNLRALLS+LQY
Sbjct  782  HQRTQERAAKALAEKNQRDLQTQRDQAERHRVAETLDFEIKRWAAGKVGNLRALLSTLQY  841

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +V+KVY KATLC HPDKVQQK A++++KYIAEKVFD+LKE
Sbjct  842  VLWPECGWQPVSLTDLITAAAVRKVYRKATLCTHPDKVQQKGATIQQKYIAEKVFDLLKE  901

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  902  AWNKFNSEEL  911



>ref|NP_001066970.1| Os12g0548200 [Oryza sativa Japonica Group]
 gb|ABA98877.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29989.1| Os12g0548200 [Oryza sativa Japonica Group]
Length=925

 Score =   222 bits (565),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R++E +D EIKRWAAGKEGNLRALLS+LQY
Sbjct  795  HQRTRERAAKALAEKNERDMQVQREQAERHRISETMDFEIKRWAAGKEGNLRALLSTLQY  854

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  855  VLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  914

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  915  AWNKFNSEEL  924



>ref|XP_008365846.1| PREDICTED: auxilin-related protein 1-like [Malus domestica]
Length=973

 Score =   222 bits (565),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF +VEGE+ ERRRARL  H RT+ER  +ALAEKN+RDLQ Q+EQ E+ R+AE LD EIK
Sbjct  824  EFQDVEGETEERRRARLERHQRTQERTLKALAEKNERDLQAQREQAERHRIAETLDVEIK  883

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWA GKEGNLRALLS++QYVLWPECGWQ VSLTD+IT+ SVKKVY KATLC+HPDKVQQK
Sbjct  884  RWAVGKEGNLRALLSTMQYVLWPECGWQPVSLTDMITAASVKKVYRKATLCIHPDKVQQK  943

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  944  GANLQQKYIAEKVFDLLKEAWNKFNSEEL  972



>gb|EEC69454.1| hypothetical protein OsI_38641 [Oryza sativa Indica Group]
Length=925

 Score =   222 bits (565),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R++E +D EIKRWAAGKEGNLRALLS+LQY
Sbjct  795  HQRTRERAAKALAEKNERDMQVQREQAERHRISETMDFEIKRWAAGKEGNLRALLSTLQY  854

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  855  VLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  914

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  915  AWNKFNSEEL  924



>ref|XP_010027574.1| PREDICTED: auxilin-related protein 2-like [Eucalyptus grandis]
 ref|XP_010027575.1| PREDICTED: auxilin-related protein 2-like [Eucalyptus grandis]
 gb|KCW54138.1| hypothetical protein EUGRSUZ_I00114 [Eucalyptus grandis]
Length=862

 Score =   221 bits (563),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQT +EQ+E+ R+AE LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  732  HQRTQERTAKALAEKNQRDLQTLKEQEERHRIAETLDVEIKRWAAGKEGNLRALLSTLQY  791

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGW+ VSLTDLI + SVKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD LKE
Sbjct  792  VLWPECGWEPVSLTDLIAAASVKKFYRKATLCIHPDKVQQKGANLQQKYIAEKVFDFLKE  851

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  852  AWNKFNSEEL  861



>dbj|BAJ97040.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=874

 Score =   221 bits (563),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ ++LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  744  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDSLDFEIKRWAAGKEGNLRALLSTLQY  803

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  SVKK Y KATLC+HPDKVQQK A+L++KYIAE VFD+LKE
Sbjct  804  ILWPECGWQAVSLTDLITGASVKKQYRKATLCIHPDKVQQKGATLQQKYIAEMVFDMLKE  863

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  864  AWNKFNSEEL  873


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 79/184 (43%), Gaps = 45/184 (24%)
 Frame = -1

Query  1654  YDLDGVFRSGKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnrnn  1475
             YD DGVF  G  S    YD   +F     +S++ +A  S+ D   F  G           
Sbjct  104   YDSDGVFGMGAPSAAPAYD---VF-----TSSNRSAPPSYGD---FLGG-----------  141

Query  1474  sNLRDEFDFFGSAPKPSD--SV-----DDLFGNLGFKSGGLKKTAV----QNVHDSDDLI  1328
                      FG  P+  +  SV     DDL G  G K  G KK +V    Q     DDLI
Sbjct  142   ---------FGGKPQAEEIKSVVVEDDDDLLGGFGMKPAGEKKKSVVEEDQQGTGFDDLI  192

Query  1327  PGFGFHSNSE-KSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPSSDP  1157
             PGF   S  + ++    + ++ +V + K +++F DDPF V E  S P     S    +DP
Sbjct  193   PGFASSSPPKSRNPNDDNKKKPAVPASKSTTSFVDDPFVVLERVSVPGSACPSPGRFTDP  252

Query  1156  LEKL  1145
             LE L
Sbjct  253   LEDL  256



>ref|XP_004165963.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 1-like 
[Cucumis sativus]
Length=974

 Score =   222 bits (565),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF EV+GE+ ERRRARL  H R + R A+ALA KN+RDLQ Q+EQ E+ R+AE LD EIK
Sbjct  825  EFQEVDGETEERRRARLERHQRVQTRAAKALAXKNERDLQMQREQAERHRIAETLDAEIK  884

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGKEGNLRALLS+LQYVLWPECGWQ VSLT+++   +VKKVY KATLC+HPDKVQQK
Sbjct  885  RWAAGKEGNLRALLSTLQYVLWPECGWQPVSLTEMVIPNAVKKVYRKATLCIHPDKVQQK  944

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A+L++KY+AEKVFDILKEA+ KFN+EEL
Sbjct  945  GATLQQKYVAEKVFDILKEAWNKFNSEEL  973



>ref|XP_009355852.1| PREDICTED: auxilin-related protein 2-like [Pyrus x bretschneideri]
Length=979

 Score =   221 bits (564),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER  +ALAEKN+RDLQ Q++Q E++R+AE LD EIKRWAAGKEGNLRALLS++QY
Sbjct  849  HQRTQERTLKALAEKNERDLQAQRDQAERTRIAETLDVEIKRWAAGKEGNLRALLSTMQY  908

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTD+IT+ SVKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  909  VLWPECGWQPVSLTDMITAASVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  968

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  969  AWNKFNSEEL  978



>ref|XP_008394184.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-related protein 2-like 
[Malus domestica]
Length=991

 Score =   221 bits (564),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER  +ALAEKN+RDLQ Q++Q E++R+AE LD EIKRWAAGKEGNLRALLS++QY
Sbjct  849  HQRTQERTLKALAEKNERDLQAQRDQVERTRIAETLDVEIKRWAAGKEGNLRALLSTMQY  908

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ +SLTD+IT+ SVKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  909  VLWPECGWQPISLTDMITAASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKE  968

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  969  AWNKFNSEEL  978



>ref|XP_003575620.1| PREDICTED: auxilin-related protein 2-like [Brachypodium distachyon]
Length=910

 Score =   221 bits (562),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+  Q+EQ E+ R+++ LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  780  HQRTRERAAKALAEKNERDMNVQREQAERDRISDTLDFEIKRWAAGKEGNLRALLSTLQY  839

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +VKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  840  VLWPECGWQPVSLTDLITAAAVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKE  899

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  900  AWNKFNSEEL  909



>ref|XP_004288492.1| PREDICTED: auxilin-related protein 2-like [Fragaria vesca subsp. 
vesca]
Length=935

 Score =   220 bits (561),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER  +ALAEKN+RDLQ Q+EQ E+ R+AE LD EIKRWAAGKEGNLRALLS++QY
Sbjct  805  HQRTKERTVKALAEKNERDLQVQREQAERHRIAETLDVEIKRWAAGKEGNLRALLSTMQY  864

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTD+I +  VKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKE
Sbjct  865  VLWPECGWQPVSLTDMINAAQVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKE  924

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  925  AWNKFNSEEL  934



>ref|XP_009108483.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Brassica 
rapa]
Length=836

 Score =   220 bits (560),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN RDL+ Q+EQ EK+R+ E LD EIKRW AGKEGNLRALLS+LQY
Sbjct  706  HQRTQERAAQALAEKNDRDLRAQREQAEKNRIGETLDVEIKRWGAGKEGNLRALLSTLQY  765

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  766  VLWPECGWQPVSLTDLITAASVKKFYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKE  825

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  826  AWNKFNSEEL  835



>ref|XP_010093098.1| hypothetical protein L484_007907 [Morus notabilis]
 gb|EXB53536.1| hypothetical protein L484_007907 [Morus notabilis]
Length=910

 Score =   220 bits (560),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF  VEGES +RRRARL    RT+ER  +AL EKN RDLQ Q++Q E+ R AE LD EIK
Sbjct  748  EFQFVEGESEDRRRARLERQKRTKERAEKALEEKNLRDLQIQRDQAERHRFAETLDVEIK  807

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGK+GNLRALLS+LQYVLWPECGWQ VSLTD+IT  SVKK Y KATLC+HPDKVQQK
Sbjct  808  RWAAGKDGNLRALLSTLQYVLWPECGWQPVSLTDMITGASVKKAYRKATLCIHPDKVQQK  867

Query  469  RASLREKYIAEKVFDILK  416
             A+L++KYIAEKVFD+LK
Sbjct  868  GANLQQKYIAEKVFDLLK  885



>emb|CDX76445.1| BnaA08g09550D [Brassica napus]
Length=834

 Score =   219 bits (559),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN RDL+ Q+EQ EK+R+ E LD EIKRW AGKEGNLRALLS+LQY
Sbjct  704  HQRTQERAAQALAEKNDRDLRAQREQAEKNRIGETLDVEIKRWGAGKEGNLRALLSTLQY  763

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  764  VLWPECGWQPVSLTDLITAASVKKFYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKE  823

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  824  AWNKFNSEEL  833



>gb|EEC68581.1| hypothetical protein OsI_36921 [Oryza sativa Indica Group]
Length=887

 Score =   220 bits (560),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ + LD EI+RWAAGKEGNLRALLS+LQY
Sbjct  757  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDTLDFEIRRWAAGKEGNLRALLSTLQY  816

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KY AEKVFDILKE
Sbjct  817  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGANLQQKYTAEKVFDILKE  876

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  877  AWNKFNSEEL  886



>ref|XP_006663095.1| PREDICTED: auxilin-related protein 2-like [Oryza brachyantha]
Length=885

 Score =   220 bits (560),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+A+ LD EI+RWAAGKEGNLRALLS+LQ+
Sbjct  755  HQRTRERAAKALAEKNERDMQVQREQAERDRIADTLDFEIRRWAAGKEGNLRALLSTLQF  814

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KY AEKVFDILKE
Sbjct  815  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGATLQQKYTAEKVFDILKE  874

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  875  AWNKFNSEEL  884



>emb|CDY31429.1| BnaC03g63950D [Brassica napus]
Length=816

 Score =   219 bits (559),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN RDL+ Q+EQ EK+R+ E LD EIKRW AGKEGNLRALLS+LQY
Sbjct  686  HQRTQERAAQALAEKNDRDLRAQREQAEKNRIGETLDVEIKRWGAGKEGNLRALLSTLQY  745

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  746  VLWPECGWQPVSLTDLITAASVKKFYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKE  805

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  806  AWNKFNSEEL  815



>ref|XP_009108484.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Brassica 
rapa]
Length=834

 Score =   219 bits (559),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN RDL+ Q+EQ EK+R+ E LD EIKRW AGKEGNLRALLS+LQY
Sbjct  704  HQRTQERAAQALAEKNDRDLRAQREQAEKNRIGETLDVEIKRWGAGKEGNLRALLSTLQY  763

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ SVKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  764  VLWPECGWQPVSLTDLITAASVKKFYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKE  823

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  824  AWNKFNSEEL  833



>gb|ABA95242.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEE52522.1| hypothetical protein OsJ_34734 [Oryza sativa Japonica Group]
Length=888

 Score =   219 bits (559),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ + LD EI+RWAAGKEGNLRALLS+LQY
Sbjct  758  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDTLDFEIRRWAAGKEGNLRALLSTLQY  817

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KY AEKVFDILKE
Sbjct  818  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGANLQQKYTAEKVFDILKE  877

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  878  AWNKFNSEEL  887



>ref|XP_004979900.1| PREDICTED: auxilin-related protein 2-like [Setaria italica]
Length=891

 Score =   219 bits (559),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RTRER A+ALAEKN+RD+Q Q+EQ E+ R+ ++LD EIKRW+AGKEGNLRALLS+LQY
Sbjct  761  HQRTRERAAKALAEKNERDMQVQREQAERDRIGDSLDFEIKRWSAGKEGNLRALLSTLQY  820

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            +LWPECGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  821  ILWPECGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKGATLQQKYIAEKVFDLLKE  880

Query  412  AFGKFNAEEL  383
            ++ KFN+EEL
Sbjct  881  SWNKFNSEEL  890



>ref|XP_006578777.1| PREDICTED: auxilin-related protein 2-like isoform X2 [Glycine 
max]
Length=872

 Score =   219 bits (558),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQTQ++Q E+ R+AE LD EIKRWAAGK GNLRALLS+LQY
Sbjct  742  HQRTQERAAKALAEKNQRDLQTQRDQAERHRVAETLDFEIKRWAAGKVGNLRALLSTLQY  801

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTDLIT+ +V+KVY KATLC HPDKVQQK A++++KYIAEKVFD+LKE
Sbjct  802  VLWPECGWQPVSLTDLITAAAVRKVYRKATLCTHPDKVQQKGATIQQKYIAEKVFDLLKE  861

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  862  AWNKFNSEEL  871



>ref|XP_007213691.1| hypothetical protein PRUPE_ppa000822mg [Prunus persica]
 gb|EMJ14890.1| hypothetical protein PRUPE_ppa000822mg [Prunus persica]
Length=991

 Score =   219 bits (559),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN+RDL   +EQ E+ R+AE LD EIKRWAAGKEGNLRALLS++QY
Sbjct  861  HQRTQERTAKALAEKNERDLHALREQAERHRIAETLDVEIKRWAAGKEGNLRALLSTMQY  920

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTD+IT+ SVKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  921  VLWPECGWQPVSLTDMITAASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKE  980

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  981  AWNKFNSEEL  990



>ref|XP_010440616.1| PREDICTED: auxilin-related protein 2-like isoform X1 [Camelina 
sativa]
Length=894

 Score =   219 bits (558),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDL+ Q+EQ EK R+   LD EI+R
Sbjct  746  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLEVQREQVEKDRIGVTLDVEIRR  805

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            W AGKEGNLRALLS+LQYVLWP CGWQ VSLTDLIT  SVKKVY KATLC+HPDKVQQK 
Sbjct  806  WGAGKEGNLRALLSTLQYVLWPGCGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG  865

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  866  ANLQQKYIAEKVFDMLKEAWNKFNSEEL  893



>ref|XP_008227521.1| PREDICTED: auxilin-related protein 1-like [Prunus mume]
Length=983

 Score =   219 bits (558),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKN+RDL   +EQ E+ R+AE LD EIKRWAAGKEGNLRALLS++QY
Sbjct  853  HQRTQERTAKALAEKNERDLHALREQAERHRIAETLDVEIKRWAAGKEGNLRALLSTMQY  912

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKE  413
            VLWPECGWQ VSLTD+IT+ SVKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKE
Sbjct  913  VLWPECGWQPVSLTDMITAASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKE  972

Query  412  AFGKFNAEEL  383
            A+ KFN+EEL
Sbjct  973  AWNKFNSEEL  982



>ref|XP_003577264.1| PREDICTED: auxilin-related protein 1-like [Brachypodium distachyon]
Length=857

 Score =   217 bits (553),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
            F +VEGES ERRRARL  H RT ER+ +ALAEKN+RD+Q Q+EQ E+ R+ ++LD EIKR
Sbjct  709  FQDVEGESEERRRARLERHQRTNERVEKALAEKNERDMQVQREQAERDRIGDSLDFEIKR  768

Query  646  WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
            WAAGKEGNLRALLS+LQY+LWP CGWQAVSLTDLIT  +VKK Y KATLC+HPDKVQQK 
Sbjct  769  WAAGKEGNLRALLSTLQYILWPACGWQAVSLTDLITGAAVKKQYRKATLCIHPDKVQQKG  828

Query  466  ASLREKYIAEKVFDILKEAFGKFNAEEL  383
            A+L++KYIAEKVFDILKEA+ KFN+EEL
Sbjct  829  ATLQQKYIAEKVFDILKEAWNKFNSEEL  856



>ref|XP_010055974.1| PREDICTED: auxilin-related protein 2 isoform X2 [Eucalyptus grandis]
Length=609

 Score =   211 bits (538),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  781  LNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSS  602
            L  H RT+ER+A+A+AE NQRD QTQQEQ+E+ R+AE LD +IK WAAGKEGNLRALLSS
Sbjct  476  LGRHERTQERVAKAVAEMNQRDSQTQQEQEERRRIAENLDMKIKSWAAGKEGNLRALLSS  535

Query  601  LQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDI  422
            LQ VLWPE GW+ VSLTDLITSTSVK+VY KATL VHPDKVQQK A+L++KY AEKVFDI
Sbjct  536  LQQVLWPESGWEPVSLTDLITSTSVKQVYRKATLRVHPDKVQQKGANLQQKYTAEKVFDI  595

Query  421  LKEAFGKFNAEELR  380
            LKEA+ KF  EELR
Sbjct  596  LKEAWKKFETEELR  609


 Score = 82.4 bits (202),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 134/343 (39%), Gaps = 96/343 (28%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPYDL--------  1646
             MDEFGVL ERYG+K +G S P+A     SK   G     G+ S   +             
Sbjct  1     MDEFGVLTERYGLKPQGKSAPMA----ASKRPDGIGAARGRSSGAPAAAAGRSSSRASAS  56

Query  1645  -------DGVFRSG-----------KTSGQQNYDN-SDIFGGQFPSSNSTTAQQSHVDLD  1523
                    +G F  G           K  G  N D+  D+FGG    S S        D D
Sbjct  57    SWNSGSGNGAFADGFGEFLQSSGGSKAQGFGNLDDFGDLFGGSKKPSKSPAGDSGGFDYD  116

Query  1522  TFFKGSTnqngnnrnnsNLRDEFDFFG-----------------------SAPKPSDSVD  1412
             + F      + +        D  D FG                       S P+ S  VD
Sbjct  117   SLFNSGAGPSSSY-------DNDDIFGGMPGVKSSASVVGGGSGVFGSFASPPRQSSPVD  169

Query  1411  DL------------FGNLGFKSGGLKKTAVQNVH---DSDDLIPGFGFHSNSEKSARTSH  1277
             DL            FG +G KSG    +A    H   +SDDLIPGFG  S+S    +   
Sbjct  170   DLLGGFQNDDHDDIFGGIGTKSGKTDSSASVAGHGAAESDDLIPGFG-GSSSPADGQRRQ  228

Query  1276  SQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAE--------------  1139
              Q+++V+S + SS  ++DPF V EST    + SS   SDPLE+ ++              
Sbjct  229   PQKTNVYSAESSSNLSEDPFVVLESTSKPVHASSEIFSDPLEESSQFGNFQRANKVGDKV  288

Query  1138  TNPSI---DELEDFVSG--RGTSTSQGQQHYVSRKESNVKKTH  1025
              +PS+   DELEDF  G  RG + +Q     V +     KK  
Sbjct  289   KSPSVSSLDELEDFAMGQTRGNTDTQSDFFSVGKGSGAGKKAR  331



>ref|NP_001190709.1| auxilin-related protein 1 [Arabidopsis thaliana]
 gb|AEE83180.1| auxilin-related protein 1 [Arabidopsis thaliana]
Length=894

 Score =   214 bits (546),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 129/165 (78%), Gaps = 17/165 (10%)
 Frame = -1

Query  826  FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKS------------  683
            F +V+GE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q+EQ EK             
Sbjct  729  FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQVEKDNKKLRHLSILSH  788

Query  682  -----RLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKV  518
                 R+   LD EIKRW AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKKV
Sbjct  789  CFFPFRIGVTLDVEIKRWGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKV  848

Query  517  YHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
            Y KATLC+HPDKVQQK A+L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  849  YRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKEAWNKFNSEEL  893



>ref|XP_010055973.1| PREDICTED: auxilin-related protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW72543.1| hypothetical protein EUGRSUZ_E01009 [Eucalyptus grandis]
Length=629

 Score =   212 bits (539),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -1

Query  781  LNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSS  602
            L  H RT+ER+A+A+AE NQRD QTQQEQ+E+ R+AE LD +IK WAAGKEGNLRALLSS
Sbjct  496  LGRHERTQERVAKAVAEMNQRDSQTQQEQEERRRIAENLDMKIKSWAAGKEGNLRALLSS  555

Query  601  LQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDI  422
            LQ VLWPE GW+ VSLTDLITSTSVK+VY KATL VHPDKVQQK A+L++KY AEKVFDI
Sbjct  556  LQQVLWPESGWEPVSLTDLITSTSVKQVYRKATLRVHPDKVQQKGANLQQKYTAEKVFDI  615

Query  421  LKEAFGKFNAEELR  380
            LKEA+ KF  EELR
Sbjct  616  LKEAWKKFETEELR  629


 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 107/368 (29%), Positives = 143/368 (39%), Gaps = 101/368 (27%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLANLKAKSKPSSGFPNDSGQKSSHNSDPYDL--------  1646
             MDEFGVL ERYG+K +G S P+    A SK   G     G+ S   +             
Sbjct  1     MDEFGVLTERYGLKPQGKSAPM----AASKRPDGIGAARGRSSGAPAAAAGRSSSRASAS  56

Query  1645  -------DGVFRSG-----------KTSGQQNYDN-SDIFGGQFPSSNSTTAQQSHVDLD  1523
                    +G F  G           K  G  N D+  D+FGG    S S        D D
Sbjct  57    SWNSGSGNGAFADGFGEFLQSSGGSKAQGFGNLDDFGDLFGGSKKPSKSPAGDSGGFDYD  116

Query  1522  TFFKGSTnqngnnrnnsNLRDEFDFFG-----------------------SAPKPSDSVD  1412
             + F      + +        D  D FG                       S P+ S  VD
Sbjct  117   SLFNSGAGPSSSY-------DNDDIFGGMPGVKSSASVVGGGSGVFGSFASPPRQSSPVD  169

Query  1411  DL------------FGNLGFKSGGLKKTAVQNVH---DSDDLIPGFGFHSNSEKSARTSH  1277
             DL            FG +G KSG    +A    H   +SDDLIPGFG  S+S    +   
Sbjct  170   DLLGGFQNDDHDDIFGGIGTKSGKTDSSASVAGHGAAESDDLIPGFG-GSSSPADGQRRQ  228

Query  1276  SQQSSVHSYKQSSTFADDPFSVFESTPPVQNVSSWPSSDPLEKLAE--------------  1139
              Q+++V+S + SS  ++DPF V EST    + SS   SDPLE+ ++              
Sbjct  229   PQKTNVYSAESSSNLSEDPFVVLESTSKPVHASSEIFSDPLEESSQFGNFQRANKVGDKV  288

Query  1138  TNPSI---DELEDFVSGRGTSTSQGQQHYVSRKESNVKKTHSAGDILSNTSTDHMFDGLF  968
              +PS+   DELEDF  G+    +  Q  + S     V K   +G    NT T   F  + 
Sbjct  289   KSPSVSSLDELEDFAMGQTRGNTDTQSDFFS-----VGK--GSGQAWGNTDTQSDFLSVG  341

Query  967   NNNGGGTK  944
               +G G K
Sbjct  342   KGSGAGKK  349



>ref|XP_002863218.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39477.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   213 bits (542),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  748  ARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGW  569
            A+ALAEKN+RDLQ Q+EQ EK R+ E LD EI+RW AGKEGNLRALLS+LQYVLWPECGW
Sbjct  798  AKALAEKNERDLQVQREQAEKDRIGETLDVEIRRWGAGKEGNLRALLSTLQYVLWPECGW  857

Query  568  QAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAE  389
            Q VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKEA+ KFN+E
Sbjct  858  QPVSLTDLITGASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKEAWNKFNSE  917

Query  388  EL  383
            EL
Sbjct  918  EL  919



>ref|XP_006878529.1| hypothetical protein AMTR_s00011p00222440 [Amborella trichopoda]
 gb|ERM94674.1| hypothetical protein AMTR_s00011p00222440 [Amborella trichopoda]
Length=1053

 Score =   213 bits (543),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  820   EVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWA  641
             E  GES ERR+ARL  H RT+ER A+ALAEKN RD+  Q+EQ E+ RLAE+LD ++KRW+
Sbjct  908   EAGGESAERRKARLERHQRTKERAAKALAEKNARDILVQREQAERQRLAESLDADVKRWS  967

Query  640   AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
             +GKEGNLRALLS+LQY+LWP+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQK A+
Sbjct  968   SGKEGNLRALLSTLQYILWPDSGWQPIPLTEVITAAAVKKAYRKATLCVHPDKMQQKGAT  1027

Query  460   LREKYIAEKVFDILKEAFGKFNAEE  386
             L +KYI+EKVFD+LK+A+ KFN+EE
Sbjct  1028  LPQKYISEKVFDLLKDAWNKFNSEE  1052



>ref|XP_002321224.1| auxilin-related family protein [Populus trichocarpa]
 gb|EEE99539.1| auxilin-related family protein [Populus trichocarpa]
Length=941

 Score =   212 bits (539),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -1

Query  748  ARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGW  569
            A+ALAEKNQRDLQ Q++Q E+ R+AE LD EIKRWAAGKEGNLRALLS+LQYVLWPECGW
Sbjct  819  AKALAEKNQRDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNLRALLSTLQYVLWPECGW  878

Query  568  QAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAE  389
            Q VSLTDLIT  +VKKVY KATLC+HPDKVQQK A+L++KY+AEKVFD+LKEA+ K N+E
Sbjct  879  QPVSLTDLITGAAVKKVYRKATLCIHPDKVQQKGANLQQKYVAEKVFDLLKEAWNKLNSE  938

Query  388  EL  383
            EL
Sbjct  939  EL  940



>gb|KHN11110.1| Auxilin-related protein 1 [Glycine soja]
Length=488

 Score =   206 bits (524),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            E  E EGES +R RARL  + RT ER A+AL EKN RDL  Q+EQ E++RLAE LD E++
Sbjct  340  ERSEREGESAQRCRARLERYRRTAERAAKALEEKNMRDLVAQKEQAERNRLAETLDTEVR  399

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RW++GKEGNLRALLS+LQY+L P+ GWQ + LTD+ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  400  RWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITSAAVKKAYRKATLCVHPDKLQQR  459

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  460  GASIQHKYICEKVFDLLKEAWNKFNSEE  487



>ref|XP_002992806.1| hypothetical protein SELMODRAFT_448911 [Selaginella moellendorffii]
 gb|EFJ06096.1| hypothetical protein SELMODRAFT_448911 [Selaginella moellendorffii]
Length=891

 Score =   211 bits (537),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF  ++GE  ERR++RL  H R  ER+A+ALAEKN RDL+ ++ Q+EK R+AE LD+ IK
Sbjct  742  EFEVIDGEHPERRKSRLERHQRAVERVAKALAEKNNRDLELERVQEEKQRVAELLDDVIK  801

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGK+GNLRALLS+LQY+LWPECGWQA+SL D+I  TSV+K Y KATL VHPDK+QQK
Sbjct  802  RWAAGKQGNLRALLSTLQYILWPECGWQAISLIDIIEPTSVRKAYKKATLYVHPDKLQQK  861

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS   KYIAEKVFD+L+EA+  FN E+
Sbjct  862  NASTEHKYIAEKVFDLLQEAWTTFNLEQ  889



>emb|CAB40994.1| auxilin-like protein [Arabidopsis thaliana]
 emb|CAB78319.1| auxilin-like protein [Arabidopsis thaliana]
Length=909

 Score =   210 bits (534),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  748  ARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGW  569
            A+ALAEKN+RDLQ Q+EQ EK R+   LD EI+RW AGKEGNLRALLS+LQYVLWPECGW
Sbjct  787  AKALAEKNERDLQVQREQAEKDRIGGTLDVEIRRWGAGKEGNLRALLSTLQYVLWPECGW  846

Query  568  QAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAE  389
            Q VSLTDLIT  SVKKVY KATLC+HPDKVQQK A+L++KYIAEKVFD+LKEA+ KFN+E
Sbjct  847  QPVSLTDLITGASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKEAWNKFNSE  906

Query  388  EL  383
            EL
Sbjct  907  EL  908



>ref|XP_006383175.1| trichohyalin-related family protein [Populus trichocarpa]
 gb|ERP60972.1| trichohyalin-related family protein [Populus trichocarpa]
Length=1462

 Score =   211 bits (536),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1318  VEGESPQRCKARLERHRRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  1377

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1378  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSAAVKKVYRKATLCVHPDKLQQRGASL  1437

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1438  QQKYICEKVFDLLKEAWNKFNSEE  1461



>gb|EMT09705.1| UBA domain-containing protein 7 [Aegilops tauschii]
Length=781

 Score =   207 bits (527),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 149/209 (71%), Gaps = 3/209 (1%)
 Frame = -1

Query  1033  KTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslf  854
             K ++A  ++ + S D MFD    + G     + T+  + ST K+  P    +     S  
Sbjct  529   KKNTAHQMMLSPSFDSMFDSQPQDRGTVNGSQRTASTSASTRKTNPPSATNIFGNGLSDL  588

Query  853   ---gdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKS  683
                    SS D F +VEGES ERRRARL  H RTRER A+ALAEKN+RD+Q Q+EQ E+ 
Sbjct  589   FEFESTRSSSDAFQDVEGESEERRRARLERHQRTRERAAKALAEKNERDMQVQREQAERD  648

Query  682   RLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKAT  503
             R+ ++LD EIKRWAAGKEGNLRALLS+LQY+LWPECGWQAVSLTDLIT  +VKK Y KAT
Sbjct  649   RIGDSLDFEIKRWAAGKEGNLRALLSTLQYILWPECGWQAVSLTDLITGAAVKKQYRKAT  708

Query  502   LCVHPDKVQQKRASLREKYIAEKVFDILK  416
             LC+HPDKVQQK A+L++KYIAEKVFD+LK
Sbjct  709   LCIHPDKVQQKGATLQQKYIAEKVFDMLK  737



>gb|KHN36088.1| Auxilin-related protein 2 [Glycine soja]
Length=862

 Score =   207 bits (528),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -1

Query  814  EGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAG  635
            EGES +R RARL  + RT ER A+ALAEKN RDL  Q+EQ E++RL+E LD E++RW+ G
Sbjct  719  EGESAQRCRARLERYRRTAERAAKALAEKNMRDLLAQKEQAERNRLSETLDAEVRRWSGG  778

Query  634  KEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLR  455
            KEGNLRALLS+LQY+L P+ GWQA+ LT++ITS +VKK Y KATLCVHPDK+QQ+ AS++
Sbjct  779  KEGNLRALLSTLQYILGPDSGWQAIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASIQ  838

Query  454  EKYIAEKVFDILKEAFGKFNAEE  386
             KYI EKVFD+LKEA+ KFN+EE
Sbjct  839  HKYICEKVFDLLKEAWNKFNSEE  861



>ref|XP_007156969.1| hypothetical protein PHAVU_002G032500g [Phaseolus vulgaris]
 gb|ESW28963.1| hypothetical protein PHAVU_002G032500g [Phaseolus vulgaris]
Length=1329

 Score =   209 bits (532),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             E  E EGES +R RARL  H RT ER A+ALAEKN RDL  Q+EQ EK+RL+E LD E++
Sbjct  1181  ERSEREGESAQRCRARLERHRRTAERAAKALAEKNMRDLLAQKEQAEKNRLSETLDAEVR  1240

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW+ GKEGNLRALLS+LQY+L P+ GWQ++ LT++ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  1241  RWSGGKEGNLRALLSTLQYILGPDSGWQSIPLTEVITSAAVKKAYRKATLCVHPDKLQQR  1300

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEE  386
              AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  1301  GASIQHKYICEKVFDLLKEAWNKFNSEE  1328



>ref|XP_010471928.1| PREDICTED: auxilin-related protein 2-like [Camelina sativa]
Length=386

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 145/348 (42%), Positives = 184/348 (53%), Gaps = 57/348 (16%)
 Frame = -1

Query  1378  GLKKTAVQNVHDSDDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFEST  1199
             G K++   +  D D+LIPGFG           S    S+  ++   +  ADDPF V  S 
Sbjct  79    GKKRSCFSDDFD-DELIPGFG--------GGLSQPSNSATDTW---NVIADDPFEVRPS-  125

Query  1198  PPVQNVSSWPSSDPLEKLAETNP---SIDELEDFVSGRGTSTSQGQQHYVSRKESNVKKT  1028
                 N+   PSS        TNP   S+DEL +F  G    +S    + V  +E   KK 
Sbjct  126   ----NLVD-PSS-------VTNPRIASVDELAEFAMGILHCSSLDSDNDVDVEE---KKQ  170

Query  1027  HSAGDIL-------------SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLK  887
                 D L             S  +T+  F        G  K+K    G+ ST K  +P  
Sbjct  171   EFGVDDLESIFIPGSKSVPDSYATTEEEF--------GVPKEKCNEEGSLSTKKPDAPAH  222

Query  886   NFVddfssslfgdlgssfDEFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQT  707
                                EF  + GES +RR AR     R +++M +A+++ N RD Q 
Sbjct  223   VL---DELFPLFGDDPFLREFKAIPGESDKRRIARWEREQRIKKQMDQAVSDMNDRDRQI  279

Query  706   QQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSV  527
             Q  Q+E+SR++E LD EIK WAAGKEGN+RALLSSL  VLWP CGW+AVSLTDLIT  +V
Sbjct  280   QIGQEERSRISETLDAEIKLWAAGKEGNMRALLSSLHLVLWPGCGWKAVSLTDLITCAAV  339

Query  526   KKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEEL  383
             KKVY KA L VHPDKVQQK A  ++KYIAEKVF+ILKEA+ KFN EEL
Sbjct  340   KKVYKKANLYVHPDKVQQKGA--QQKYIAEKVFNILKEAWDKFNKEEL  385



>emb|CDP01994.1| unnamed protein product [Coffea canephora]
Length=1419

 Score =   209 bits (532),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             +EGES +R +ARL  + RT ER A+ALAEKN RDL  Q+EQ E++RLAE+LD E+KRW++
Sbjct  1275  LEGESPQRCKARLERYRRTAERAAKALAEKNMRDLLAQREQAERNRLAESLDAEVKRWSS  1334

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+CGWQ + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1335  GKEGNLRALLSTLQYILGPDCGWQPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  1394

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+  FN+EE
Sbjct  1395  QQKYICEKVFDLLKEAWNTFNSEE  1418



>gb|KCW54137.1| hypothetical protein EUGRSUZ_I00114 [Eucalyptus grandis]
Length=613

 Score =   203 bits (517),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEGNLRALLSSLQY  593
            H RT+ER A+ALAEKNQRDLQT +EQ+E+ R+AE LD EIKRWAAGKEGNLRALLS+LQY
Sbjct  472  HQRTQERTAKALAEKNQRDLQTLKEQEERHRIAETLDVEIKRWAAGKEGNLRALLSTLQY  531

Query  592  VLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKYIAEKVFDILK  416
            VLWPECGW+ VSLTDLI + SVKK Y KATLC+HPDKVQQK A+L++KYIAEKVFD LK
Sbjct  532  VLWPECGWEPVSLTDLIAAASVKKFYRKATLCIHPDKVQQKGANLQQKYIAEKVFDFLK  590



>ref|XP_002987499.1| hypothetical protein SELMODRAFT_447002 [Selaginella moellendorffii]
 gb|EFJ11335.1| hypothetical protein SELMODRAFT_447002 [Selaginella moellendorffii]
Length=910

 Score =   206 bits (523),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF  ++GE  ERR++RL  H R  ER+A+ALAEKN RDL+ ++ Q+EK R+AE L++ IK
Sbjct  761  EFEVIDGEHPERRKSRLERHQRAVERVAKALAEKNNRDLELERVQEEKQRVAELLNDVIK  820

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
            RWAAGK+GNLRALLS+LQY+LWPECGWQ +SL D+I   SV+K Y KATL VHPDK+QQK
Sbjct  821  RWAAGKQGNLRALLSTLQYILWPECGWQPISLIDIIEPASVRKAYKKATLYVHPDKLQQK  880

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS   KYIAEKVFD+L+EA+  FN E+
Sbjct  881  NASTEHKYIAEKVFDLLQEAWTTFNLEQ  908



>gb|KDO70977.1| hypothetical protein CISIN_1g003023mg [Citrus sinensis]
Length=848

 Score =   205 bits (522),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            +EGES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  704  IEGESAQRCKARLERHRRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  763

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQY+L P+ GW  + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  764  GKEGNLRALLSTLQYILGPDSGWHPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  823

Query  457  REKYIAEKVFDILKEAFGKFNAEE  386
            ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  824  QQKYICEKVFDLLKEAWNKFNSEE  847



>gb|KDO70975.1| hypothetical protein CISIN_1g003023mg [Citrus sinensis]
Length=856

 Score =   205 bits (522),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            +EGES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  712  IEGESAQRCKARLERHRRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  771

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQY+L P+ GW  + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  772  GKEGNLRALLSTLQYILGPDSGWHPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  831

Query  457  REKYIAEKVFDILKEAFGKFNAEE  386
            ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  832  QQKYICEKVFDLLKEAWNKFNSEE  855



>gb|KDO70976.1| hypothetical protein CISIN_1g003023mg [Citrus sinensis]
Length=853

 Score =   205 bits (522),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817  VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
            +EGES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  709  IEGESAQRCKARLERHRRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  768

Query  637  GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
            GKEGNLRALLS+LQY+L P+ GW  + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  769  GKEGNLRALLSTLQYILGPDSGWHPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  828

Query  457  REKYIAEKVFDILKEAFGKFNAEE  386
            ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  829  QQKYICEKVFDLLKEAWNKFNSEE  852



>gb|KHN41951.1| Auxilin-related protein 2 [Glycine soja]
Length=1388

 Score =   208 bits (529),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             E  E EGES +R RARL  H RT ER A+ALAEKN RDL  Q+EQ E++RL+E LD E++
Sbjct  1240  ERSEREGESAQRCRARLERHRRTAERAAKALAEKNMRDLLAQKEQAERNRLSETLDAEVR  1299

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW+ GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  1300  RWSGGKEGNLRALLSTLQYILGPDSGWQLIPLTEVITSAAVKKAYRKATLCVHPDKLQQR  1359

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEE  386
              AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  1360  GASIQHKYICEKVFDLLKEAWNKFNSEE  1387



>ref|XP_003537600.2| PREDICTED: auxilin-like protein 1-like [Glycine max]
Length=1388

 Score =   208 bits (529),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             E  E EGES +R RARL  H RT ER A+ALAEKN RDL  Q+EQ E++RL+E LD E++
Sbjct  1240  ERSEREGESAQRCRARLERHRRTAERAAKALAEKNMRDLLAQKEQAERNRLSETLDAEVR  1299

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW+ GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  1300  RWSGGKEGNLRALLSTLQYILGPDSGWQLIPLTEVITSAAVKKAYRKATLCVHPDKLQQR  1359

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEE  386
              AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  1360  GASIQHKYICEKVFDLLKEAWNKFNSEE  1387



>gb|KCW60593.1| hypothetical protein EUGRSUZ_H03319 [Eucalyptus grandis]
Length=1289

 Score =   207 bits (527),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R RARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1145  VEGESAQRCRARLERHRRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  1204

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ V LT++ITS +VK+ Y KATLC+HPDK+QQ+ A++
Sbjct  1205  GKEGNLRALLSTLQYILGPDSGWQPVPLTEVITSAAVKRAYRKATLCIHPDKLQQRGANI  1264

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1265  QQKYICEKVFDLLKEAWNKFNSEE  1288



>ref|XP_011074560.1| PREDICTED: auxilin-like protein 1 [Sesamum indicum]
Length=1402

 Score =   207 bits (527),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  808   ESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKE  629
             ES +RR+ARL  H R  ER A+ALAEKN RDL  Q+EQ E++RLAE+LD +IKRWA GKE
Sbjct  1261  ESAQRRKARLERHQRIMERAAKALAEKNMRDLLAQKEQAERNRLAESLDADIKRWATGKE  1320

Query  628   GNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREK  449
             GNLRALLS+LQY+L PE GWQ +SLT++IT+ +VKK Y KATLCVHPDK+QQ+ AS+++K
Sbjct  1321  GNLRALLSTLQYILGPESGWQPISLTEIITTAAVKKAYRKATLCVHPDKLQQRGASIQQK  1380

Query  448   YIAEKVFDILKEAFGKFNAEE  386
             YI EKVFD+LK A+ +FN+EE
Sbjct  1381  YICEKVFDLLKAAWNRFNSEE  1401



>gb|KDO51043.1| hypothetical protein CISIN_1g002109mg [Citrus sinensis]
Length=965

 Score =   205 bits (521),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 164/244 (67%), Gaps = 14/244 (6%)
 Frame = -1

Query  1006  SNTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDE  827
             +NTS D +FD    + GG    + TS G  S  +  S   N VDD SS       S+  E
Sbjct  710   ANTS-DSLFDS--QSKGGPEPARRTSVGASSNMRKASSTTNIVDDLSSIFGAAGSSAG-E  765

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             F +VEGE+ ERRRARL  H RT+ER A+ALAEKN+RDLQ Q++Q E+ R+AE LD EIKR
Sbjct  766   FQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIAETLDVEIKR  825

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             WAAGKEGN+RALL+++QYVLWPE GWQ VSLTDLIT+ +VKK Y KATLC+HPDKVQQK 
Sbjct  826   WAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKG  885

Query  466   ASLREKYIAEKVFDILK--EAFGKFNAEELR*VSIISSLVPFYC*WTNSVNPHHKGGYGL  293
             A+L++KYIAEKVFD+LK  + + +F         I+  L  F     +S   ++ G +  
Sbjct  886   ANLQQKYIAEKVFDLLKVQQIYCRF--------FILLCLEGFNLTMQDSFLVYYFGCFTF  937

Query  292   CNRY  281
             C ++
Sbjct  938   CCQF  941



>ref|XP_006472829.1| PREDICTED: auxilin-related protein 1-like isoform X1 [Citrus 
sinensis]
Length=554

 Score =   201 bits (510),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 211/567 (37%), Positives = 282/567 (50%), Gaps = 110/567 (19%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA-------NLKAKSKPSSGFPNDSGQKSSHNSDPYDL-  1646
             MDEF  L ER+G+K +G S P+A       N  A+S  S+   N      S N + Y   
Sbjct  1     MDEFSALTERFGLKQQGKSAPMAASKRPASNGTARSFSSNSGSNSKPSSHSQNQNSYSGG  60

Query  1645  ---DGVFRS--GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnr  1481
                D +F+S  G    Q  YD  D FG QF +S   ++  S +D  +   GS     N  
Sbjct  61    FPDDILFQSNTGNKESQGRYD--DHFG-QFQTSTINSSNGSSLDYGSVVMGSGISGSNAY  117

Query  1480  nnsNLRDEFDF-------------FGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS  1340
                +  D+  F             F S P+  DSVDDL G  G  +    ++  QN   S
Sbjct  118   TYDDDDDDDIFGLKKNINDDLSGSFVSPPEKGDSVDDLLGGFGVGADSNSESLKQNEAGS  177

Query  1339  DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPS  1166
             DDLIPGFG        A TS +  ++  + + +   A DPF V E  S P   +  S+  
Sbjct  178   DDLIPGFG--------ASTSSNDGTNAKATESTYLSAKDPFIVLEAASNPAYGSSDSFTD  229

Query  1165  S-DPLEKLAET-------------------------------NP---SIDELEDFVSGR-  1094
             + D L KL ++                               NP   SIDELEDF   R 
Sbjct  230   ALDELGKLTQSGATKPDGPSTASRTLKPPPKPSQVLKADEVQNPVVSSIDELEDFARCRV  289

Query  1093  -------GTSTSQGQQHYVSRKESNVKKTHSAG---------DILS--------------  1004
                       T +  + + S K S  K+   A          D+ S              
Sbjct  290   RDSPDRSSVCTPKEMREWHSPKASKYKEAKDAAKRTPKKSEDDLESYSSVGTRSSSVPKS  349

Query  1003  -NTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDE  827
               TS+D +FD   N  G     + TS G+    K+ S     ++D   S+ G   S+  E
Sbjct  350   RATSSDPIFDAKINRKGPDMVQEKTSGGSSHIKKASSATN--LEDDFFSVLGAATSAVGE  407

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             F E EGES ERRRARL    +T +RM +A+A+ NQ++ QTQQEQ+E+ R+A++L+ EIKR
Sbjct  408   FEEYEGESEERRRARLKRQQKTHDRMVKAVADFNQQEFQTQQEQEERRRIADSLNVEIKR  467

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             W AGKEGN+RALLSSLQYVLWPECGW+ V LTDLITS+SVKKV+ KA L +HPDKVQ   
Sbjct  468   WVAGKEGNMRALLSSLQYVLWPECGWEPVPLTDLITSSSVKKVFRKARLLLHPDKVQG--  525

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEE  386
             A++++KY AEKVF+IL+EA+ KF+ EE
Sbjct  526   ANIQQKYTAEKVFNILQEAWEKFSKEE  552



>ref|XP_006573573.1| PREDICTED: auxilin-like protein 1-like isoform X1 [Glycine max]
Length=1404

 Score =   207 bits (527),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -1

Query  814   EGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAG  635
             EGES +R RARL  + RT ER A+ALAEKN RDL  Q+EQ E++RL+E LD E++RW+ G
Sbjct  1261  EGESAQRCRARLERYRRTAERAAKALAEKNMRDLLAQKEQAERNRLSETLDAEVRRWSGG  1320

Query  634   KEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLR  455
             KEGNLRALLS+LQY+L P+ GWQA+ LT++ITS +VKK Y KATLCVHPDK+QQ+ AS++
Sbjct  1321  KEGNLRALLSTLQYILVPDSGWQAIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASIQ  1380

Query  454   EKYIAEKVFDILKEAFGKFNAEE  386
              KYI EKVFD+LKEA+ KFN+EE
Sbjct  1381  HKYICEKVFDLLKEAWNKFNSEE  1403



>ref|XP_006415005.1| hypothetical protein EUTSA_v10024354mg [Eutrema salsugineum]
 gb|ESQ56458.1| hypothetical protein EUTSA_v10024354mg [Eutrema salsugineum]
Length=908

 Score =   204 bits (519),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 16/146 (11%)
 Frame = -1

Query  772  HTRTRERMARALAEKNQRDLQTQQEQDEKS----------------RLAEALDEEIKRWA  641
            H RT+ER A+ALAEK++RDLQ +++Q E++                R+ E LD EIKRW 
Sbjct  762  HQRTQERAAKALAEKHERDLQVKRDQAERNFEPLNPEWQRICLVFQRIGETLDVEIKRWG  821

Query  640  AGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRAS  461
            AGKEGNLRALLS+LQYVLWPECGWQ VSLTDLIT+ SVKK Y KA+LC+HPDKVQQK A+
Sbjct  822  AGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKFYRKASLCIHPDKVQQKGAN  881

Query  460  LREKYIAEKVFDILKEAFGKFNAEEL  383
            L++KYIAEKVFD+LKEA+ KFN+EEL
Sbjct  882  LQQKYIAEKVFDLLKEAWNKFNSEEL  907


 Score = 53.1 bits (126),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 57/122 (47%), Gaps = 15/122 (12%)
 Frame = -1

Query  1453  DFFGSAPKP-------SDSVDDLFGNLGFKSGGLKKTAVQNVHDS----DDLIPGFGFHS  1307
             D F S   P       S   DDL GNLG +    K+T  +         DDLIPGFG  S
Sbjct  140   DVFSSISSPTKHRKQNSSPFDDLIGNLGKRETEPKETESEREEKGSSVFDDLIPGFGRSS  199

Query  1306  ---NSEKSARTSHSQQSSVHSYKQSSTFADDPF-SVFESTPPVQNVSSWPSSDPLEKLAE  1139
                N   ++ TS SQ+ S  + K SS   DDPF  + ES    +  S    +DPLE++ +
Sbjct  200   SPPNKRPTSETSQSQKPSYRTTKTSSNLVDDPFVGLEESASTFREPSKGEFTDPLEEIGK  259

Query  1138  TN  1133
              N
Sbjct  260   FN  261



>ref|XP_011015131.1| PREDICTED: auxilin-like protein 1 isoform X3 [Populus euphratica]
Length=1437

 Score =   207 bits (526),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H R  ER A+ALAEKN RDL  Q+EQ E++R+AE LD ++KRW++
Sbjct  1293  VEGESPQRCKARLERHRRIAERAAKALAEKNMRDLLAQREQAERNRVAETLDADVKRWSS  1352

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1353  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSQAVKKVYRKATLCVHPDKLQQRGASL  1412

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1413  QQKYICEKVFDLLKEAWNKFNSEE  1436



>ref|XP_011011933.1| PREDICTED: auxilin-like protein 1 isoform X1 [Populus euphratica]
 ref|XP_011011934.1| PREDICTED: auxilin-like protein 1 isoform X1 [Populus euphratica]
Length=1460

 Score =   207 bits (526),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H R  ER A+ALAEKN RDL  Q+EQ E++R+AE LD ++KRW++
Sbjct  1316  VEGESPQRCKARLERHRRIAERAAKALAEKNMRDLLAQREQAERNRVAETLDADVKRWSS  1375

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1376  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSQAVKKVYRKATLCVHPDKLQQRGASL  1435

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1436  QQKYICEKVFDLLKEAWNKFNSEE  1459



>ref|XP_002981984.1| hypothetical protein SELMODRAFT_445035 [Selaginella moellendorffii]
 gb|EFJ17077.1| hypothetical protein SELMODRAFT_445035 [Selaginella moellendorffii]
Length=1154

 Score =   206 bits (524),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             +F E++GE+ ERR+ARL  + RT+ R A+ALA+KN+RDL+ Q EQ E+ RLAE LD +IK
Sbjct  1005  DFQELKGETPERRKARLERYRRTQNRAAQALAQKNKRDLELQSEQAERQRLAERLDSDIK  1064

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW+ GK+GN+RALLS+LQYVLWPE GW+ V+LT+LI   +VKK Y +ATLCVHPDK+QQK
Sbjct  1065  RWSVGKDGNIRALLSTLQYVLWPESGWKQVTLTELINPAAVKKAYRRATLCVHPDKMQQK  1124

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEEL  383
              AS+++KYIAEKVF IL+ A+ +FN++E+
Sbjct  1125  HASVQQKYIAEKVFHILQVAWNRFNSQEM  1153



>ref|XP_010024161.1| PREDICTED: trichohyalin [Eucalyptus grandis]
Length=1587

 Score =   207 bits (527),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R RARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1443  VEGESAQRCRARLERHRRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  1502

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ V LT++ITS +VK+ Y KATLC+HPDK+QQ+ A++
Sbjct  1503  GKEGNLRALLSTLQYILGPDSGWQPVPLTEVITSAAVKRAYRKATLCIHPDKLQQRGANI  1562

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1563  QQKYICEKVFDLLKEAWNKFNSEE  1586



>ref|XP_007017583.1| Auxin-like 1 protein [Theobroma cacao]
 gb|EOY14808.1| Auxin-like 1 protein [Theobroma cacao]
Length=1304

 Score =   206 bits (525),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  811   GESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGK  632
             GES +R +ARL  H RT ER A+ALAEKN+RDL  Q+EQ E++RLAE LD E+KRW++GK
Sbjct  1162  GESAQRCKARLERHQRTAERAAKALAEKNKRDLLAQKEQAERNRLAETLDAEVKRWSSGK  1221

Query  631   EGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLRE  452
             +GNLRALLS+LQY+L P+CGWQ + LTD+I + +VKK Y KATLCVHPDK+QQ+ AS+++
Sbjct  1222  QGNLRALLSTLQYILGPDCGWQPIPLTDIIATAAVKKAYRKATLCVHPDKLQQRGASIQQ  1281

Query  451   KYIAEKVFDILKEAFGKFNAEE  386
             KY  EKVFD+LKE + KF+AEE
Sbjct  1282  KYTCEKVFDLLKEGWNKFSAEE  1303



>ref|XP_011011937.1| PREDICTED: auxilin-like protein 1 isoform X3 [Populus euphratica]
Length=1449

 Score =   207 bits (526),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H R  ER A+ALAEKN RDL  Q+EQ E++R+AE LD ++KRW++
Sbjct  1305  VEGESPQRCKARLERHRRIAERAAKALAEKNMRDLLAQREQAERNRVAETLDADVKRWSS  1364

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1365  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSQAVKKVYRKATLCVHPDKLQQRGASL  1424

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1425  QQKYICEKVFDLLKEAWNKFNSEE  1448



>ref|XP_011011935.1| PREDICTED: auxilin-like protein 1 isoform X2 [Populus euphratica]
Length=1458

 Score =   207 bits (526),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H R  ER A+ALAEKN RDL  Q+EQ E++R+AE LD ++KRW++
Sbjct  1314  VEGESPQRCKARLERHRRIAERAAKALAEKNMRDLLAQREQAERNRVAETLDADVKRWSS  1373

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1374  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSQAVKKVYRKATLCVHPDKLQQRGASL  1433

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1434  QQKYICEKVFDLLKEAWNKFNSEE  1457



>ref|XP_011015129.1| PREDICTED: auxilin-like protein 1 isoform X1 [Populus euphratica]
Length=1448

 Score =   207 bits (526),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H R  ER A+ALAEKN RDL  Q+EQ E++R+AE LD ++KRW++
Sbjct  1304  VEGESPQRCKARLERHRRIAERAAKALAEKNMRDLLAQREQAERNRVAETLDADVKRWSS  1363

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1364  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSQAVKKVYRKATLCVHPDKLQQRGASL  1423

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1424  QQKYICEKVFDLLKEAWNKFNSEE  1447



>ref|XP_006472830.1| PREDICTED: auxilin-related protein 1-like isoform X2 [Citrus 
sinensis]
Length=553

 Score =   200 bits (509),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 204/580 (35%), Positives = 274/580 (47%), Gaps = 137/580 (24%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA-------NLKAKSKPSSGFPNDSGQKSSHNSDPYDL-  1646
             MDEF  L ER+G+K +G S P+A       N  A+S  S+   N      S N + Y   
Sbjct  1     MDEFSALTERFGLKQQGKSAPMAASKRPASNGTARSFSSNSGSNSKPSSHSQNQNSYSGG  60

Query  1645  ---DGVFRS--GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnr  1481
                D +F+S  G    Q  YD  D FG QF +S   ++  S +D  +   GS     N  
Sbjct  61    FPDDILFQSNTGNKESQGRYD--DHFG-QFQTSTINSSNGSSLDYGSVVMGSGISGSNAY  117

Query  1480  nnsNLRDEFDF-------------FGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS  1340
                +  D+  F             F S P+  DSVDDL G  G  +    ++  QN   S
Sbjct  118   TYDDDDDDDIFGLKKNINDDLSGSFVSPPEKGDSVDDLLGGFGVGADSNSESLKQNEAGS  177

Query  1339  DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPS  1166
             DDLIPGFG        A TS +  ++  + + +   A DPF V E  S P   +  S+  
Sbjct  178   DDLIPGFG--------ASTSSNDGTNAKATESTYLSAKDPFIVLEAASNPAYGSSDSFTD  229

Query  1165  S-DPLEKLAET-------------------------------NP---SIDELEDFVSGR-  1094
             + D L KL ++                               NP   SIDELEDF   R 
Sbjct  230   ALDELGKLTQSGATKPDGPSTASRTLKPPPKPSQVLKADEVQNPVVSSIDELEDFARCRV  289

Query  1093  -------GTSTSQGQQHYVSRKESNVKKTHSAG---------DILS--------------  1004
                       T +  + + S K S  K+   A          D+ S              
Sbjct  290   RDSPDRSSVCTPKEMREWHSPKASKYKEAKDAAKRTPKKSEDDLESYSSVGTRSSSVPKS  349

Query  1003  -NTSTDHMFDGLFNNNGGGTKDKWTSHGTQSTGKSKSPLKNFVddfssslfgdlgssfDE  827
               TS+D +FD   N  G     + TS G+    K+ S                  +  D+
Sbjct  350   RATSSDPIFDAKINRKGPDMVQEKTSGGSSHIKKASS----------------ATNLEDD  393

Query  826   FHEVEGES-------------VERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEK  686
             F  V G +              ERRRARL    +T +RM +A+A+ NQ++ QTQQEQ+E+
Sbjct  394   FFSVLGATSAVGEFEEYEGESEERRRARLKRQQKTHDRMVKAVADFNQQEFQTQQEQEER  453

Query  685   SRLAEALDEEIKRWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKA  506
              R+A++L+ EIKRW AGKEGN+RALLSSLQYVLWPECGW+ V LTDLITS+SVKKV+ KA
Sbjct  454   RRIADSLNVEIKRWVAGKEGNMRALLSSLQYVLWPECGWEPVPLTDLITSSSVKKVFRKA  513

Query  505   TLCVHPDKVQQKRASLREKYIAEKVFDILKEAFGKFNAEE  386
              L +HPDKVQ   A++++KY AEKVF+IL+EA+ KF+ EE
Sbjct  514   RLLLHPDKVQG--ANIQQKYTAEKVFNILQEAWEKFSKEE  551



>ref|XP_011015130.1| PREDICTED: auxilin-like protein 1 isoform X2 [Populus euphratica]
Length=1446

 Score =   207 bits (526),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H R  ER A+ALAEKN RDL  Q+EQ E++R+AE LD ++KRW++
Sbjct  1302  VEGESPQRCKARLERHRRIAERAAKALAEKNMRDLLAQREQAERNRVAETLDADVKRWSS  1361

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1362  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSQAVKKVYRKATLCVHPDKLQQRGASL  1421

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1422  QQKYICEKVFDLLKEAWNKFNSEE  1445



>ref|XP_006434263.1| hypothetical protein CICLE_v10000812mg [Citrus clementina]
 gb|ESR47503.1| hypothetical protein CICLE_v10000812mg [Citrus clementina]
Length=536

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 200/560 (36%), Positives = 269/560 (48%), Gaps = 114/560 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA-------NLKAKSKPSSGFPNDSGQKSSHNSDPYDL-  1646
             MDEF  L ER+G+K +G S P+A       N  A+S  S+   N      S N + Y   
Sbjct  1     MDEFSALTERFGLKQQGKSAPMAASKRPAYNGTARSFSSNSGSNSKPSSHSQNQNSYSGG  60

Query  1645  ---DGVFRS--GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnr  1481
                D +F+S  G    Q  YD  D FG QF +S   ++  S +D  + F GS     N  
Sbjct  61    FPDDILFQSNTGNKESQGRYD--DHFG-QFQTSTINSSNGSSLDYGSAFMGSGISGSNAY  117

Query  1480  nnsNLRDEFDF-------------FGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS  1340
                +  D+  F             F S P+  DSVDDL G  G  +    +   QN   S
Sbjct  118   TYDDDDDDDLFGLKKNINEDLSGSFVSPPEKGDSVDDLLGGFGVGADSNSERLKQNEAGS  177

Query  1339  DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPS  1166
             DDLIPGFG        A TS +  ++  + + +   A DPF V E  S P   +  S+  
Sbjct  178   DDLIPGFG--------ASTSSNDGTNAKATESTYLSAKDPFIVLEAASNPAYGSSDSFTD  229

Query  1165  S-DPLEKLAET-------------------------------NP---SIDELEDFVSGR-  1094
             + D L KL ++                               NP   SIDELEDF   R 
Sbjct  230   ALDELGKLTQSGATKPDGPSTASRTLKPPPKPSQVLKVDEVQNPVVSSIDELEDFARCRV  289

Query  1093  -------GTSTSQGQQHYVSRKESNVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKW  935
                       T +  + + S K S  K+   A       S D +             + +
Sbjct  290   RDSPDRSSVCTPKEMREWHSPKASKYKEAKDAAKRTPKKSEDDL-------------ESY  336

Query  934   TSHGTQSTGKSKSPL----KNFVddfssslfgdlgssfDEFHEVEGES------------  803
             +S GT+S+   KS      K               +  D+F  V G +            
Sbjct  337   SSVGTRSSSVPKSRATSSEKTSGGSSHIKKASSTTNLEDDFFSVLGATSAVGEFEEYEGE  396

Query  802   -VERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEG  626
               ERRRARL    +T +RM +A+A+ NQ++ QTQQEQ+E+ R+A++L+ EIKRW AGKEG
Sbjct  397   SEERRRARLKRQQKTHDRMVKAVADFNQQEFQTQQEQEERRRIADSLNVEIKRWVAGKEG  456

Query  625   NLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKY  446
             N+RALLSSLQYVLWPECGW+ V LTDLITS+SVKKV+ KA L +HPDKVQ   A++++KY
Sbjct  457   NMRALLSSLQYVLWPECGWEPVPLTDLITSSSVKKVFRKARLLLHPDKVQG--ANIQQKY  514

Query  445   IAEKVFDILKEAFGKFNAEE  386
              AEKVF+IL+EA+ KF+ EE
Sbjct  515   TAEKVFNILQEAWEKFSKEE  534



>ref|XP_006434262.1| hypothetical protein CICLE_v10000812mg [Citrus clementina]
 gb|ESR47502.1| hypothetical protein CICLE_v10000812mg [Citrus clementina]
Length=537

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 199/561 (35%), Positives = 268/561 (48%), Gaps = 115/561 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA-------NLKAKSKPSSGFPNDSGQKSSHNSDPYDL-  1646
             MDEF  L ER+G+K +G S P+A       N  A+S  S+   N      S N + Y   
Sbjct  1     MDEFSALTERFGLKQQGKSAPMAASKRPAYNGTARSFSSNSGSNSKPSSHSQNQNSYSGG  60

Query  1645  ---DGVFRS--GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnr  1481
                D +F+S  G    Q  YD  D FG QF +S   ++  S +D  + F GS     N  
Sbjct  61    FPDDILFQSNTGNKESQGRYD--DHFG-QFQTSTINSSNGSSLDYGSAFMGSGISGSNAY  117

Query  1480  nnsNLRDEFDF-------------FGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS  1340
                +  D+  F             F S P+  DSVDDL G  G  +    +   QN   S
Sbjct  118   TYDDDDDDDLFGLKKNINEDLSGSFVSPPEKGDSVDDLLGGFGVGADSNSERLKQNEAGS  177

Query  1339  DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPS  1166
             DDLIPGFG        A TS +  ++  + + +   A DPF V E  S P   +  S+  
Sbjct  178   DDLIPGFG--------ASTSSNDGTNAKATESTYLSAKDPFIVLEAASNPAYGSSDSFTD  229

Query  1165  S-DPLEKLAET-------------------------------NP---SIDELEDFVSGR-  1094
             + D L KL ++                               NP   SIDELEDF   R 
Sbjct  230   ALDELGKLTQSGATKPDGPSTASRTLKPPPKPSQVLKVDEVQNPVVSSIDELEDFARCRV  289

Query  1093  -------GTSTSQGQQHYVSRKESNVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKW  935
                       T +  + + S K S  K+   A       S D +             + +
Sbjct  290   RDSPDRSSVCTPKEMREWHSPKASKYKEAKDAAKRTPKKSEDDL-------------ESY  336

Query  934   TSHGTQSTGKSKSPL----KNFVddfssslfgdlgssfDEFHEVEGESVE----------  797
             +S GT+S+   KS      K               +  D+F  V G +            
Sbjct  337   SSVGTRSSSVPKSRATSSEKTSGGSSHIKKASSTTNLEDDFFSVLGAATSAVGEFEEYEG  396

Query  796   ----RRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKE  629
                 RRRARL    +T +RM +A+A+ NQ++ QTQQEQ+E+ R+A++L+ EIKRW AGKE
Sbjct  397   ESEERRRARLKRQQKTHDRMVKAVADFNQQEFQTQQEQEERRRIADSLNVEIKRWVAGKE  456

Query  628   GNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREK  449
             GN+RALLSSLQYVLWPECGW+ V LTDLITS+SVKKV+ KA L +HPDKVQ   A++++K
Sbjct  457   GNMRALLSSLQYVLWPECGWEPVPLTDLITSSSVKKVFRKARLLLHPDKVQG--ANIQQK  514

Query  448   YIAEKVFDILKEAFGKFNAEE  386
             Y AEKVF+IL+EA+ KF+ EE
Sbjct  515   YTAEKVFNILQEAWEKFSKEE  535



>ref|XP_011015132.1| PREDICTED: auxilin-like protein 1 isoform X4 [Populus euphratica]
Length=1427

 Score =   206 bits (525),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  H R  ER A+ALAEKN RDL  Q+EQ E++R+AE LD ++KRW++
Sbjct  1283  VEGESPQRCKARLERHRRIAERAAKALAEKNMRDLLAQREQAERNRVAETLDADVKRWSS  1342

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++ITS +VKKVY KATLCVHPDK+QQ+ ASL
Sbjct  1343  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSQAVKKVYRKATLCVHPDKLQQRGASL  1402

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1403  QQKYICEKVFDLLKEAWNKFNSEE  1426



>ref|XP_003519893.2| PREDICTED: auxilin-like protein 1-like [Glycine max]
Length=1440

 Score =   206 bits (525),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             E  E EGES +R RARL  + RT ER A+AL EKN RDL  Q+EQ E++RLAE LD E++
Sbjct  1292  ERSEREGESAQRCRARLERYRRTAERAAKALEEKNMRDLVAQKEQAERNRLAETLDTEVR  1351

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW++GKEGNLRALLS+LQY+L P+ GWQ + LTD+ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  1352  RWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITSAAVKKAYRKATLCVHPDKLQQR  1411

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEE  386
              AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  1412  GASIQNKYICEKVFDLLKEAWNKFNSEE  1439



>ref|XP_006340644.1| PREDICTED: auxilin-like protein 1-like [Solanum tuberosum]
Length=1443

 Score =   206 bits (525),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             +EGES +R +ARL  + RT ER A+ALAEKN RD Q Q+EQ E++RLAE LD E+KRW++
Sbjct  1299  IEGESPQRCKARLERYRRTSERAAKALAEKNMRDFQAQREQAERNRLAETLDAEVKRWSS  1358

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P  GWQ + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1359  GKEGNLRALLSTLQYILGPNSGWQPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  1418

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
              +KYI EKVFD+LKEA+ +FN+EE
Sbjct  1419  HQKYICEKVFDLLKEAWNRFNSEE  1442



>ref|XP_010316381.1| PREDICTED: LOW QUALITY PROTEIN: auxilin-like protein 1 [Solanum 
lycopersicum]
Length=1441

 Score =   206 bits (524),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             +EGES +R +ARL  + RT ER A+ALAEKN RD Q Q+EQ E++RLAE LD E+KRW++
Sbjct  1297  IEGESPQRCKARLERYRRTSERAAKALAEKNMRDFQAQREQAERNRLAETLDAEVKRWSS  1356

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P  GWQ + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1357  GKEGNLRALLSTLQYILGPNSGWQPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  1416

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
              +KYI EKVFD+LKEA+ +FN+EE
Sbjct  1417  HQKYICEKVFDLLKEAWNRFNSEE  1440



>ref|XP_002994190.1| hypothetical protein SELMODRAFT_432122 [Selaginella moellendorffii]
 gb|EFJ04753.1| hypothetical protein SELMODRAFT_432122 [Selaginella moellendorffii]
Length=1207

 Score =   205 bits (522),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             +F E++GE+ ERR+ARL  + RT+ R A+ALA+KN+RDL+ Q EQ E+ RLAE LD +IK
Sbjct  1058  DFQELKGETPERRKARLERYRRTQNRAAQALAQKNKRDLELQSEQAERQRLAERLDSDIK  1117

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW+ GK+GN+RALLS+LQYVLWPE GW+ V+LT+LI   +VKK Y +ATLCVHPDK+QQK
Sbjct  1118  RWSVGKDGNIRALLSTLQYVLWPESGWKQVTLTELINPAAVKKAYRRATLCVHPDKMQQK  1177

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEEL  383
              AS+++KYIAEKVF IL+ A+ +FN++E+
Sbjct  1178  HASVQQKYIAEKVFHILQVAWNRFNSQEM  1206



>ref|XP_010649121.1| PREDICTED: auxilin-like protein 1 isoform X2 [Vitis vinifera]
 emb|CBI17489.3| unnamed protein product [Vitis vinifera]
Length=1455

 Score =   206 bits (523),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  + RT +R A+ALAEKN+RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1311  VEGESAQRCKARLERYRRTADRAAKALAEKNKRDLLAQREQAERNRLAETLDADVKRWSS  1370

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LTD+IT+ +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1371  GKEGNLRALLSTLQYILGPDSGWQPIPLTDVITAVAVKKAYRKATLCVHPDKLQQRGASI  1430

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1431  QQKYICEKVFDLLKEAWNKFNSEE  1454



>ref|XP_002266275.1| PREDICTED: auxilin-like protein 1 isoform X1 [Vitis vinifera]
Length=1458

 Score =   206 bits (523),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  + RT +R A+ALAEKN+RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1314  VEGESAQRCKARLERYRRTADRAAKALAEKNKRDLLAQREQAERNRLAETLDADVKRWSS  1373

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LTD+IT+ +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1374  GKEGNLRALLSTLQYILGPDSGWQPIPLTDVITAVAVKKAYRKATLCVHPDKLQQRGASI  1433

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1434  QQKYICEKVFDLLKEAWNKFNSEE  1457



>ref|XP_003547978.2| PREDICTED: auxilin-like protein 1-like [Glycine max]
Length=1468

 Score =   206 bits (523),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             E  E EGES +R RARL  + RT ER A+AL EKN RDL  Q+EQ E++RLAE LD E++
Sbjct  1320  ERSEREGESAQRCRARLERYRRTAERAAKALEEKNMRDLVAQKEQAERNRLAETLDTEVR  1379

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW++GKEGNLRALLS+LQY+L P+ GWQ + LTD+ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  1380  RWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITSAAVKKAYRKATLCVHPDKLQQR  1439

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEE  386
              AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  1440  GASIQHKYICEKVFDLLKEAWNKFNSEE  1467



>ref|XP_004143520.1| PREDICTED: uncharacterized protein LOC101221934 [Cucumis sativus]
Length=1402

 Score =   205 bits (522),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             V+GES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD +++RW++
Sbjct  1258  VDGESPQRCKARLERHQRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVRRWSS  1317

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1318  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITAVAVKKAYRKATLCVHPDKLQQRGASI  1377

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1378  QQKYICEKVFDLLKEAWNKFNSEE  1401



>ref|XP_010428815.1| PREDICTED: uncharacterized protein LOC104713404 isoform X2 [Camelina 
sativa]
Length=370

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 116/149 (78%), Gaps = 2/149 (1%)
 Frame = -1

Query  829  EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
            EF  + GES +RR AR     R +++M +A++E N RD Q Q EQ+E+SR++E LD EIK
Sbjct  223  EFKGIPGESDKRRIARWEREQRIKKQMDQAVSEMNDRDRQIQIEQEERSRISETLDAEIK  282

Query  649  RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             WAAGKEGN+RALLSSL  VLWP CGW+AVSLTDLIT  +VKKVY KA L VHPDKVQQK
Sbjct  283  LWAAGKEGNMRALLSSLHLVLWPGCGWKAVSLTDLITCAAVKKVYKKANLYVHPDKVQQK  342

Query  469  RASLREKYIAEKVFDILKEAFGKFNAEEL  383
             A  ++KYIAEKVF+ILKEA+ KFN EEL
Sbjct  343  GA--QQKYIAEKVFNILKEAWNKFNKEEL  369



>ref|XP_010649122.1| PREDICTED: auxilin-like protein 1 isoform X3 [Vitis vinifera]
Length=1439

 Score =   206 bits (523),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             VEGES +R +ARL  + RT +R A+ALAEKN+RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1295  VEGESAQRCKARLERYRRTADRAAKALAEKNKRDLLAQREQAERNRLAETLDADVKRWSS  1354

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LTD+IT+ +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1355  GKEGNLRALLSTLQYILGPDSGWQPIPLTDVITAVAVKKAYRKATLCVHPDKLQQRGASI  1414

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1415  QQKYICEKVFDLLKEAWNKFNSEE  1438



>ref|XP_006472831.1| PREDICTED: auxilin-related protein 1-like isoform X3 [Citrus 
sinensis]
Length=537

 Score =   199 bits (505),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 198/561 (35%), Positives = 268/561 (48%), Gaps = 115/561 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA-------NLKAKSKPSSGFPNDSGQKSSHNSDPYDL-  1646
             MDEF  L ER+G+K +G S P+A       N  A+S  S+   N      S N + Y   
Sbjct  1     MDEFSALTERFGLKQQGKSAPMAASKRPASNGTARSFSSNSGSNSKPSSHSQNQNSYSGG  60

Query  1645  ---DGVFRS--GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnr  1481
                D +F+S  G    Q  YD  D FG QF +S   ++  S +D  +   GS     N  
Sbjct  61    FPDDILFQSNTGNKESQGRYD--DHFG-QFQTSTINSSNGSSLDYGSVVMGSGISGSNAY  117

Query  1480  nnsNLRDEFDF-------------FGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS  1340
                +  D+  F             F S P+  DSVDDL G  G  +    ++  QN   S
Sbjct  118   TYDDDDDDDIFGLKKNINDDLSGSFVSPPEKGDSVDDLLGGFGVGADSNSESLKQNEAGS  177

Query  1339  DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPS  1166
             DDLIPGFG        A TS +  ++  + + +   A DPF V E  S P   +  S+  
Sbjct  178   DDLIPGFG--------ASTSSNDGTNAKATESTYLSAKDPFIVLEAASNPAYGSSDSFTD  229

Query  1165  S-DPLEKLAET-------------------------------NP---SIDELEDFVSGR-  1094
             + D L KL ++                               NP   SIDELEDF   R 
Sbjct  230   ALDELGKLTQSGATKPDGPSTASRTLKPPPKPSQVLKADEVQNPVVSSIDELEDFARCRV  289

Query  1093  -------GTSTSQGQQHYVSRKESNVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKW  935
                       T +  + + S K S  K+   A       S D +             + +
Sbjct  290   RDSPDRSSVCTPKEMREWHSPKASKYKEAKDAAKRTPKKSEDDL-------------ESY  336

Query  934   TSHGTQSTGKSKSPL----KNFVddfssslfgdlgssfDEFHEVEGESVE----------  797
             +S GT+S+   KS      K               +  D+F  V G +            
Sbjct  337   SSVGTRSSSVPKSRATSSEKTSGGSSHIKKASSATNLEDDFFSVLGAATSAVGEFEEYEG  396

Query  796   ----RRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKE  629
                 RRRARL    +T +RM +A+A+ NQ++ QTQQEQ+E+ R+A++L+ EIKRW AGKE
Sbjct  397   ESEERRRARLKRQQKTHDRMVKAVADFNQQEFQTQQEQEERRRIADSLNVEIKRWVAGKE  456

Query  628   GNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREK  449
             GN+RALLSSLQYVLWPECGW+ V LTDLITS+SVKKV+ KA L +HPDKVQ   A++++K
Sbjct  457   GNMRALLSSLQYVLWPECGWEPVPLTDLITSSSVKKVFRKARLLLHPDKVQG--ANIQQK  514

Query  448   YIAEKVFDILKEAFGKFNAEE  386
             Y AEKVF+IL+EA+ KF+ EE
Sbjct  515   YTAEKVFNILQEAWEKFSKEE  535



>ref|XP_008440740.1| PREDICTED: auxilin-like protein 1 isoform X2 [Cucumis melo]
Length=1444

 Score =   205 bits (522),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             +  V+GES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD +++R
Sbjct  1297  YEGVDGESPQRCKARLERHQRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVRR  1356

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             W++GKEGNLRALLS+LQY+L P+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQ+ 
Sbjct  1357  WSSGKEGNLRALLSTLQYILGPDSGWQPIHLTEVITAVAVKKAYRKATLCVHPDKLQQRG  1416

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS+++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1417  ASIQQKYICEKVFDLLKEAWNKFNSEE  1443



>ref|XP_008440739.1| PREDICTED: auxilin-like protein 1 isoform X1 [Cucumis melo]
Length=1450

 Score =   205 bits (522),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             +  V+GES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD +++R
Sbjct  1303  YEGVDGESPQRCKARLERHQRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVRR  1362

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             W++GKEGNLRALLS+LQY+L P+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQ+ 
Sbjct  1363  WSSGKEGNLRALLSTLQYILGPDSGWQPIHLTEVITAVAVKKAYRKATLCVHPDKLQQRG  1422

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS+++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1423  ASIQQKYICEKVFDLLKEAWNKFNSEE  1449



>ref|XP_006472832.1| PREDICTED: auxilin-related protein 1-like isoform X4 [Citrus 
sinensis]
Length=536

 Score =   199 bits (505),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 199/560 (36%), Positives = 269/560 (48%), Gaps = 114/560 (20%)
 Frame = -1

Query  1801  MDEFGVLVERYGVKSRGNSIPLA-------NLKAKSKPSSGFPNDSGQKSSHNSDPYDL-  1646
             MDEF  L ER+G+K +G S P+A       N  A+S  S+   N      S N + Y   
Sbjct  1     MDEFSALTERFGLKQQGKSAPMAASKRPASNGTARSFSSNSGSNSKPSSHSQNQNSYSGG  60

Query  1645  ---DGVFRS--GKTSGQQNYDNSDIFGGQFPSSNSTTAQQSHVDLDTFFKGSTnqngnnr  1481
                D +F+S  G    Q  YD  D FG QF +S   ++  S +D  +   GS     N  
Sbjct  61    FPDDILFQSNTGNKESQGRYD--DHFG-QFQTSTINSSNGSSLDYGSVVMGSGISGSNAY  117

Query  1480  nnsNLRDEFDF-------------FGSAPKPSDSVDDLFGNLGFKSGGLKKTAVQNVHDS  1340
                +  D+  F             F S P+  DSVDDL G  G  +    ++  QN   S
Sbjct  118   TYDDDDDDDIFGLKKNINDDLSGSFVSPPEKGDSVDDLLGGFGVGADSNSESLKQNEAGS  177

Query  1339  DDLIPGFGFHSNSEKSARTSHSQQSSVHSYKQSSTFADDPFSVFE--STPPVQNVSSWPS  1166
             DDLIPGFG        A TS +  ++  + + +   A DPF V E  S P   +  S+  
Sbjct  178   DDLIPGFG--------ASTSSNDGTNAKATESTYLSAKDPFIVLEAASNPAYGSSDSFTD  229

Query  1165  S-DPLEKLAET-------------------------------NP---SIDELEDFVSGR-  1094
             + D L KL ++                               NP   SIDELEDF   R 
Sbjct  230   ALDELGKLTQSGATKPDGPSTASRTLKPPPKPSQVLKADEVQNPVVSSIDELEDFARCRV  289

Query  1093  -------GTSTSQGQQHYVSRKESNVKKTHSAGDILSNTSTDHMFDGLFNNNGGGTKDKW  935
                       T +  + + S K S  K+   A       S D +             + +
Sbjct  290   RDSPDRSSVCTPKEMREWHSPKASKYKEAKDAAKRTPKKSEDDL-------------ESY  336

Query  934   TSHGTQSTGKSKSPL----KNFVddfssslfgdlgssfDEFHEVEGES------------  803
             +S GT+S+   KS      K               +  D+F  V G +            
Sbjct  337   SSVGTRSSSVPKSRATSSEKTSGGSSHIKKASSATNLEDDFFSVLGATSAVGEFEEYEGE  396

Query  802   -VERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGKEG  626
               ERRRARL    +T +RM +A+A+ NQ++ QTQQEQ+E+ R+A++L+ EIKRW AGKEG
Sbjct  397   SEERRRARLKRQQKTHDRMVKAVADFNQQEFQTQQEQEERRRIADSLNVEIKRWVAGKEG  456

Query  625   NLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLREKY  446
             N+RALLSSLQYVLWPECGW+ V LTDLITS+SVKKV+ KA L +HPDKVQ   A++++KY
Sbjct  457   NMRALLSSLQYVLWPECGWEPVPLTDLITSSSVKKVFRKARLLLHPDKVQG--ANIQQKY  514

Query  445   IAEKVFDILKEAFGKFNAEE  386
              AEKVF+IL+EA+ KF+ EE
Sbjct  515   TAEKVFNILQEAWEKFSKEE  534



>ref|XP_004168397.1| PREDICTED: uncharacterized LOC101221934 [Cucumis sativus]
Length=1372

 Score =   205 bits (522),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             V+GES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD +++RW++
Sbjct  1228  VDGESPQRCKARLERHQRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVRRWSS  1287

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1288  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITAVAVKKAYRKATLCVHPDKLQQRGASI  1347

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1348  QQKYICEKVFDLLKEAWNKFNSEE  1371



>ref|XP_007156064.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris]
 gb|ESW28058.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris]
Length=1422

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             E  E EGES +R RARL  + RT ER A+AL EKN RDL  Q+EQ E++RLAE LD E++
Sbjct  1274  ERSEREGESAQRCRARLERYRRTAERAAKALEEKNMRDLVAQKEQAERNRLAETLDIEVR  1333

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW++GKEGNLRALLS+LQY+L P+ GWQ + LTD+ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  1334  RWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITSAAVKKAYRKATLCVHPDKLQQR  1393

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEE  386
              AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  1394  GASIQHKYICEKVFDLLKEAWNKFNSEE  1421



>ref|XP_006466828.1| PREDICTED: auxilin-like protein 1-like isoform X2 [Citrus sinensis]
Length=1443

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             +EGES +R +ARL  H RT ER A ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1299  IEGESAQRCKARLERHRRTAERAANALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  1358

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GW  + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1359  GKEGNLRALLSTLQYILGPDSGWHPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  1418

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1419  QQKYICEKVFDLLKEAWNKFNSEE  1442



>ref|XP_009410973.1| PREDICTED: auxilin-like protein 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1317

 Score =   205 bits (521),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  811   GESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAAGK  632
             GES  R +ARL  H RT ER+A+ALAEKN RD+  Q+EQ E++RLAE LD ++KRW+ GK
Sbjct  1175  GESALRCKARLERHQRTAERVAKALAEKNMRDIFAQREQAERNRLAEYLDADVKRWSNGK  1234

Query  631   EGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASLRE  452
             +GNLRALLS+LQY+L PE GWQ +SLTD+IT+ +VKK Y KATLCVHPDK+QQ+ AS+++
Sbjct  1235  QGNLRALLSTLQYILGPESGWQPISLTDVITAAAVKKAYRKATLCVHPDKLQQRGASIQQ  1294

Query  451   KYIAEKVFDILKEAFGKFNAEE  386
             KYI EKVFD+LKEA+ KFN+EE
Sbjct  1295  KYICEKVFDLLKEAWNKFNSEE  1316



>ref|XP_007156063.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris]
 gb|ESW28057.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris]
Length=1421

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -1

Query  829   EFHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIK  650
             E  E EGES +R RARL  + RT ER A+AL EKN RDL  Q+EQ E++RLAE LD E++
Sbjct  1273  ERSEREGESAQRCRARLERYRRTAERAAKALEEKNMRDLVAQKEQAERNRLAETLDIEVR  1332

Query  649   RWAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQK  470
             RW++GKEGNLRALLS+LQY+L P+ GWQ + LTD+ITS +VKK Y KATLCVHPDK+QQ+
Sbjct  1333  RWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITSAAVKKAYRKATLCVHPDKLQQR  1392

Query  469   RASLREKYIAEKVFDILKEAFGKFNAEE  386
              AS++ KYI EKVFD+LKEA+ KFN+EE
Sbjct  1393  GASIQHKYICEKVFDLLKEAWNKFNSEE  1420



>ref|XP_008440741.1| PREDICTED: auxilin-like protein 1 isoform X3 [Cucumis melo]
Length=1440

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             +  V+GES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD +++R
Sbjct  1293  YEGVDGESPQRCKARLERHQRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVRR  1352

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             W++GKEGNLRALLS+LQY+L P+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQ+ 
Sbjct  1353  WSSGKEGNLRALLSTLQYILGPDSGWQPIHLTEVITAVAVKKAYRKATLCVHPDKLQQRG  1412

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS+++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1413  ASIQQKYICEKVFDLLKEAWNKFNSEE  1439



>ref|XP_008440742.1| PREDICTED: auxilin-like protein 1 isoform X4 [Cucumis melo]
Length=1434

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  826   FHEVEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKR  647
             +  V+GES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD +++R
Sbjct  1287  YEGVDGESPQRCKARLERHQRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVRR  1346

Query  646   WAAGKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKR  467
             W++GKEGNLRALLS+LQY+L P+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQ+ 
Sbjct  1347  WSSGKEGNLRALLSTLQYILGPDSGWQPIHLTEVITAVAVKKAYRKATLCVHPDKLQQRG  1406

Query  466   ASLREKYIAEKVFDILKEAFGKFNAEE  386
             AS+++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1407  ASIQQKYICEKVFDLLKEAWNKFNSEE  1433



>gb|KGN48846.1| hypothetical protein Csa_6G502820 [Cucumis sativus]
Length=1433

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             V+GES +R +ARL  H RT ER A+ALAEKN RDL  Q+EQ E++RLAE LD +++RW++
Sbjct  1289  VDGESPQRCKARLERHQRTAERAAKALAEKNMRDLLAQREQAERNRLAETLDADVRRWSS  1348

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GWQ + LT++IT+ +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1349  GKEGNLRALLSTLQYILGPDSGWQPIPLTEVITAVAVKKAYRKATLCVHPDKLQQRGASI  1408

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1409  QQKYICEKVFDLLKEAWNKFNSEE  1432



>ref|XP_006466827.1| PREDICTED: auxilin-like protein 1-like isoform X1 [Citrus sinensis]
Length=1446

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             +EGES +R +ARL  H RT ER A ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1302  IEGESAQRCKARLERHRRTAERAANALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  1361

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GW  + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1362  GKEGNLRALLSTLQYILGPDSGWHPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  1421

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1422  QQKYICEKVFDLLKEAWNKFNSEE  1445



>ref|XP_006425641.1| hypothetical protein CICLE_v10024708mg [Citrus clementina]
 gb|ESR38881.1| hypothetical protein CICLE_v10024708mg [Citrus clementina]
Length=1446

 Score =   205 bits (522),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  817   VEGESVERRRARLNHHTRTRERMARALAEKNQRDLQTQQEQDEKSRLAEALDEEIKRWAA  638
             +EGES +R +ARL  H RT ER A ALAEKN RDL  Q+EQ E++RLAE LD ++KRW++
Sbjct  1302  IEGESAQRCKARLERHRRTAERAANALAEKNMRDLLAQREQAERNRLAETLDADVKRWSS  1361

Query  637   GKEGNLRALLSSLQYVLWPECGWQAVSLTDLITSTSVKKVYHKATLCVHPDKVQQKRASL  458
             GKEGNLRALLS+LQY+L P+ GW  + LT++ITS +VKK Y KATLCVHPDK+QQ+ AS+
Sbjct  1362  GKEGNLRALLSTLQYILGPDSGWHPIPLTEVITSAAVKKAYRKATLCVHPDKLQQRGASI  1421

Query  457   REKYIAEKVFDILKEAFGKFNAEE  386
             ++KYI EKVFD+LKEA+ KFN+EE
Sbjct  1422  QQKYICEKVFDLLKEAWNKFNSEE  1445



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5763899892528