BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77804_g1_i1 len=1241 path=[1219:0-1240]

Length=1241
                                                                      Score     E

ref|XP_009767944.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    286   5e-90   
ref|XP_009605499.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    286   7e-90   
ref|XP_002274560.1|  PREDICTED: palmitoyl-protein thioesterase 1        281   1e-87   Vitis vinifera
ref|XP_009790581.1|  PREDICTED: uncharacterized protein LOC104238022    288   2e-86   
ref|XP_004306990.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    278   2e-86   
ref|XP_011017334.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    273   2e-84   
ref|XP_002511600.1|  Palmitoyl-protein thioesterase 1 precursor, ...    273   3e-84   Ricinus communis
ref|XP_010275409.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    272   4e-84   
ref|XP_002302491.2|  hypothetical protein POPTR_0002s13810g             272   6e-84   Populus trichocarpa [western balsam poplar]
ref|XP_002269785.3|  PREDICTED: palmitoyl-protein thioesterase 1-...    271   8e-84   Vitis vinifera
ref|XP_006837356.1|  hypothetical protein AMTR_s00111p00103430          270   2e-83   
ref|XP_006445409.1|  hypothetical protein CICLE_v10021062mg             270   2e-83   
ref|NP_001136761.1|  palmitoyl-protein thioesterase 1 precursor         269   2e-83   Zea mays [maize]
ref|XP_004983641.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    269   3e-83   
ref|NP_001065397.2|  Os10g0563000                                       269   4e-83   Oryza sativa Japonica Group [Japonica rice]
gb|ACG35638.1|  palmitoyl-protein thioesterase 1 precursor              269   5e-83   Zea mays [maize]
ref|NP_001232846.1|  palmitoyl-protein thioesterase 1 precursor         268   8e-83   
ref|XP_009411584.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    267   1e-82   
ref|XP_006464436.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    270   2e-82   
gb|KHG30728.1|  Palmitoyl-protein thioesterase 1                        268   2e-82   
ref|XP_011081293.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    268   3e-82   
gb|ABK23278.1|  unknown                                                 266   4e-82   Picea sitchensis
dbj|BAJ88880.1|  predicted protein                                      266   5e-82   
ref|XP_008448812.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    265   6e-82   
gb|KHG13172.1|  Palmitoyl-protein thioesterase 1                        266   1e-81   
dbj|BAK02099.1|  predicted protein                                      266   1e-81   
ref|XP_008369995.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    267   1e-81   
ref|XP_010544577.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    265   2e-81   
ref|XP_002468707.1|  hypothetical protein SORBIDRAFT_01g050600          265   2e-81   Sorghum bicolor [broomcorn]
ref|XP_010258785.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    265   3e-81   
ref|XP_009383948.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    264   4e-81   
ref|XP_007157264.1|  hypothetical protein PHAVU_002G056200g             264   1e-80   
gb|AFK44258.1|  unknown                                                 262   2e-80   
ref|XP_009605498.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    262   4e-80   
ref|XP_008232458.1|  PREDICTED: palmitoyl-protein thioesterase 1        262   4e-80   
emb|CDP09444.1|  unnamed protein product                                262   4e-80   
ref|XP_006440241.1|  hypothetical protein CICLE_v10020946mg             262   5e-80   
ref|XP_007202352.1|  hypothetical protein PRUPE_ppa008372mg             261   5e-80   
ref|XP_011089658.1|  PREDICTED: palmitoyl-protein thioesterase 1        261   6e-80   
emb|CDX67823.1|  BnaA07g18630D                                          261   1e-79   
ref|XP_004986087.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    261   1e-79   
ref|XP_004245795.1|  PREDICTED: palmitoyl-protein thioesterase 1        261   1e-79   
ref|XP_004489139.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    259   2e-79   
gb|AAO42190.1|  putative palmitoyl-protein thioesterase precursor       259   2e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28824.1|  hypothetical protein JCGZ_14595                         260   2e-79   
ref|NP_199544.1|  palmitoyl protein thioesterase family protein         259   2e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AFY98638.1|  palmitoyl-protein thioesterase                          261   2e-79   
ref|XP_010524433.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    260   2e-79   
ref|XP_006414227.1|  hypothetical protein EUTSA_v10025863mg             258   3e-79   
ref|XP_004983640.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    259   4e-79   
ref|NP_191593.1|  palmitoyl protein thioesterase family protein         259   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876550.1|  palmitoyl protein thioesterase family protein      259   7e-79   
ref|XP_010052814.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    259   7e-79   
ref|XP_010052813.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    259   8e-79   
ref|XP_006347949.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    258   9e-79   
ref|XP_006402591.1|  hypothetical protein EUTSA_v10006085mg             258   1e-78   
ref|XP_006477132.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    259   1e-78   
ref|XP_009347695.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    258   1e-78   
ref|XP_010919692.1|  PREDICTED: palmitoyl-protein thioesterase 1        258   1e-78   
ref|XP_010524432.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    260   1e-78   
ref|XP_006359268.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   2e-78   
ref|XP_002865126.1|  hypothetical protein ARALYDRAFT_494249             257   2e-78   
ref|XP_010441474.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    257   2e-78   
ref|XP_003572088.2|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   2e-78   
ref|XP_003559046.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   2e-78   
ref|XP_008369436.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    258   2e-78   
ref|XP_007052292.1|  Pentatricopeptide repeat superfamily protein...    271   3e-78   
ref|XP_003517409.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    258   3e-78   
ref|XP_009342091.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    258   3e-78   
ref|XP_003552498.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   4e-78   
ref|XP_007210516.1|  hypothetical protein PRUPE_ppa007666mg             258   4e-78   
ref|XP_010529980.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    255   4e-78   
ref|XP_004229756.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    256   5e-78   
ref|XP_006280829.1|  hypothetical protein CARUB_v10026804mg             256   6e-78   
ref|XP_010413568.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    256   6e-78   
gb|ABF93476.1|  Palmitoyl protein thioesterase containing protein...    256   6e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649221.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   6e-78   
gb|AAM65342.1|  palmitoyl-protein thioesterase precursor-like           256   7e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104259.1|  PREDICTED: palmitoyl-protein thioesterase 1        256   9e-78   
ref|XP_009334531.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   9e-78   
gb|AAK59537.1|  putative palmitoyl-protein thioesterase precursor       256   1e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AAR92492.1|  putative palmitoyl-protein thioesterase                 256   1e-77   Tropaeolum majus
ref|XP_006359249.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   1e-77   
ref|XP_009591270.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    255   2e-77   
ref|XP_008238428.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    256   2e-77   
ref|XP_010439999.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    253   4e-77   
gb|EMS55741.1|  Palmitoyl-protein thioesterase 1                        254   4e-77   
ref|XP_010481340.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    253   5e-77   
ref|XP_010229362.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    253   7e-77   
ref|XP_010494964.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    253   7e-77   
ref|XP_009797089.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    253   7e-77   
ref|XP_002304295.2|  hypothetical protein POPTR_0003s07790g             255   8e-77   Populus trichocarpa [western balsam poplar]
gb|KHN42678.1|  Palmitoyl-protein thioesterase 1                        254   8e-77   
ref|XP_010512353.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    253   9e-77   
emb|CDY64763.1|  BnaC06g42800D                                          253   9e-77   
gb|EMT04362.1|  Palmitoyl-protein thioesterase 1                        253   9e-77   
ref|XP_003611348.1|  Palmitoyl-protein thioesterase                     252   2e-76   
ref|XP_009591269.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    252   3e-76   
emb|CDP10012.1|  unnamed protein product                                253   5e-76   
ref|XP_006291453.1|  hypothetical protein CARUB_v10017590mg             251   5e-76   
ref|XP_004158129.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-pr...    250   6e-76   
ref|XP_006398427.1|  hypothetical protein EUTSA_v10000967mg             250   7e-76   
ref|XP_008437041.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    250   8e-76   
ref|XP_006368987.1|  hypothetical protein POPTR_0001s15440g             251   8e-76   
ref|XP_006662607.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    251   9e-76   
emb|CBI25849.3|  unnamed protein product                                249   9e-76   
emb|CDY64683.1|  BnaA06g40130D                                          249   1e-75   
emb|CDX77758.1|  BnaC07g20120D                                          249   1e-75   
ref|XP_010481339.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    249   1e-75   
ref|XP_009797088.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    250   2e-75   
ref|XP_006368986.1|  hypothetical protein POPTR_0001s15440g             251   2e-75   
ref|XP_004152390.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    249   2e-75   
ref|XP_010434661.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    249   2e-75   
gb|EYU31902.1|  hypothetical protein MIMGU_mgv1a010171mg                249   2e-75   
ref|XP_010439998.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    248   2e-75   
gb|ABK93080.1|  unknown                                                 251   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_010440002.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    248   4e-75   
ref|XP_002967315.1|  hypothetical protein SELMODRAFT_168809             248   4e-75   
ref|XP_002960405.1|  hypothetical protein SELMODRAFT_74606              248   5e-75   
gb|ABD64963.1|  palmitoyl protein thioesterase family protein           248   5e-75   Brassica oleracea
ref|XP_010052812.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    249   6e-75   
ref|XP_010052811.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    249   6e-75   
ref|XP_006285186.1|  hypothetical protein CARUB_v10006536mg             247   7e-75   
ref|NP_001048650.1|  Os03g0101100                                       248   7e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010449608.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    247   1e-74   
ref|XP_006282773.1|  hypothetical protein CARUB_v10006201mg             246   1e-74   
ref|XP_010055462.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    248   1e-74   
emb|CDY41045.1|  BnaA09g18240D                                          247   1e-74   
ref|XP_008658171.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    245   2e-74   
ref|XP_010449610.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    245   3e-74   
ref|XP_010434662.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    245   3e-74   
ref|XP_010494966.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    246   3e-74   
gb|KFK24549.1|  hypothetical protein AALP_AAs62283U000300               246   3e-74   
gb|AAG60184.1|AC084763_4  putative palmitoyl-protein thioesterase       245   4e-74   Oryza sativa [red rice]
ref|XP_008437040.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    245   5e-74   
gb|KFK31386.1|  hypothetical protein AALP_AA6G105200                    245   5e-74   
ref|XP_010677184.1|  PREDICTED: uncharacterized protein LOC104892862    256   5e-74   
ref|XP_011047609.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    247   6e-74   
ref|XP_010451416.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    244   7e-74   
ref|XP_010481338.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    244   1e-73   
ref|NP_193478.1|  palmitoyl protein thioesterase family protein         244   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511714.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    244   2e-73   
ref|XP_010439997.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    244   2e-73   
ref|XP_010449612.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    244   2e-73   
ref|XP_004511713.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    244   2e-73   
ref|XP_004300365.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    244   2e-73   
ref|XP_010089298.1|  Palmitoyl-protein thioesterase 1                   243   2e-73   
gb|ABD65142.1|  palmitoyl protein thioesterase family protein           243   3e-73   Brassica oleracea
gb|KCW71934.1|  hypothetical protein EUGRSUZ_E00394                     244   3e-73   
gb|AAM63476.1|  palmitoyl-protein thioesterase precursor-like           243   4e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44000.1|  hypothetical protein AALP_AA1G201800                    242   5e-73   
ref|XP_006440242.1|  hypothetical protein CICLE_v10020946mg             243   6e-73   
ref|XP_007039751.1|  Alpha/beta-Hydrolases superfamily protein is...    244   6e-73   
emb|CDY18971.1|  BnaC01g20970D                                          242   7e-73   
ref|XP_002868063.1|  palmitoyl protein thioesterase family protein      242   8e-73   
ref|XP_010235003.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    241   8e-73   
emb|CDX90472.1|  BnaA03g43090D                                          241   9e-73   
emb|CDY09625.1|  BnaC07g34360D                                          242   1e-72   
ref|XP_007039750.1|  Alpha/beta-Hydrolases superfamily protein is...    245   1e-72   
ref|XP_009136845.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    241   2e-72   
gb|ACO35364.1|  palmitoyl protein thioesterase                          241   3e-72   Elaeis oleifera
ref|XP_008658169.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    244   3e-72   
ref|XP_002863365.1|  predicted protein                                  240   4e-72   
ref|NP_199545.2|  palmitoyl protein thioesterase family protein         240   5e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ABD65081.1|  palmitoyl protein thioesterase family protein           239   1e-71   Brassica oleracea
gb|EPS59624.1|  hypothetical protein M569_15181                         238   1e-71   
ref|XP_002868061.1|  palmitoyl protein thioesterase family protein      238   2e-71   
ref|XP_009591271.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    239   2e-71   
ref|XP_002877170.1|  hypothetical protein ARALYDRAFT_323005             238   2e-71   
ref|XP_010434663.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    238   3e-71   
ref|XP_010518714.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    237   3e-71   
ref|XP_010325388.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    238   4e-71   
gb|EMS65899.1|  Palmitoyl-protein thioesterase 1                        238   6e-71   
ref|XP_006285486.1|  hypothetical protein CARUB_v10006914mg             236   7e-71   
gb|KFK30318.1|  hypothetical protein AALP_AA7G246200                    237   7e-71   
ref|XP_010439996.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    237   9e-71   
gb|EYU19274.1|  hypothetical protein MIMGU_mgv1a010471mg                236   1e-70   
ref|XP_009797090.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    237   1e-70   
gb|AFW87849.1|  hypothetical protein ZEAMMB73_061678                    235   1e-70   
gb|KDP39913.1|  hypothetical protein JCGZ_03444                         237   2e-70   
ref|XP_009108322.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    235   2e-70   
ref|NP_193477.1|  putative palmitoyl-protein thioesterase               235   5e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004246162.2|  PREDICTED: palmitoyl-protein thioesterase 1-...    233   7e-70   
ref|NP_193479.1|  putative palmitoyl-(protein) hydrolase                234   9e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25974.1|  BnaC09g20130D                                          234   1e-69   
emb|CDP10011.1|  unnamed protein product                                235   1e-69   
ref|XP_002865125.1|  predicted protein                                  234   2e-69   
gb|KFK24041.1|  hypothetical protein AALP_AAs42697U000100               233   2e-69   
ref|XP_006386541.1|  hypothetical protein POPTR_0002s13810g             233   2e-69   
ref|XP_002865123.1|  palmitoyl protein thioesterase family protein      233   3e-69   
gb|EYU19278.1|  hypothetical protein MIMGU_mgv1a023056mg                231   8e-69   
ref|XP_006414226.1|  hypothetical protein EUTSA_v10025854mg             231   9e-69   
ref|XP_002531468.1|  Palmitoyl-protein thioesterase 1 precursor, ...    232   1e-68   Ricinus communis
ref|XP_008437042.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    229   2e-68   
dbj|BAA97168.1|  palmitoyl-protein thioesterase precursor-like          230   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449611.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    230   2e-68   
ref|XP_009144465.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    228   1e-67   
emb|CDX76572.1|  BnaA08g08280D                                          232   4e-67   
ref|XP_010449616.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    227   5e-67   
ref|XP_010440003.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    226   6e-67   
ref|XP_001763636.1|  predicted protein                                  227   1e-66   
gb|ABD65098.1|  palmitoyl protein thioesterase family protein           225   2e-66   Brassica oleracea
ref|NP_001132014.1|  hypothetical protein                               222   5e-66   Zea mays [maize]
ref|XP_010440001.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    224   5e-66   
ref|XP_011017335.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    221   3e-65   
ref|XP_009144453.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    222   4e-65   
gb|KCW76895.1|  hypothetical protein EUGRSUZ_D01239                     220   7e-65   
ref|XP_010275410.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    221   8e-65   
gb|KDO85536.1|  hypothetical protein CISIN_1g016717mg                   219   4e-64   
emb|CAN68811.1|  hypothetical protein VITISV_001083                     218   7e-64   Vitis vinifera
ref|XP_008798849.1|  PREDICTED: palmitoyl-protein thioesterase 1        219   2e-63   
ref|XP_006440240.1|  hypothetical protein CICLE_v10020946mg             215   4e-63   
ref|XP_001765759.1|  predicted protein                                  215   5e-63   
ref|XP_002464925.1|  hypothetical protein SORBIDRAFT_01g028940          215   7e-63   Sorghum bicolor [broomcorn]
ref|XP_008437044.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    213   2e-62   
ref|XP_010677096.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    216   2e-62   
ref|XP_009797091.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    213   6e-62   
ref|XP_010440000.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    212   7e-61   
ref|XP_008437043.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    208   1e-60   
gb|KDO61326.1|  hypothetical protein CISIN_1g024701mg                   207   6e-60   
ref|XP_006282269.1|  hypothetical protein CARUB_v10028547mg             207   9e-60   
emb|CAB10529.1|  thioesterase like protein                              214   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511715.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    206   2e-59   
gb|KDO61327.1|  hypothetical protein CISIN_1g024701mg                   205   4e-59   
ref|XP_002865124.1|  palmitoyl protein thioesterase family protein      204   3e-58   
ref|XP_004511717.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    200   2e-57   
ref|XP_009144476.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    199   2e-57   
emb|CAN78143.1|  hypothetical protein VITISV_032028                     204   3e-57   Vitis vinifera
gb|AAM61704.1|  palmitoyl-protein thioesterase precursor-like           201   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414225.1|  hypothetical protein EUTSA_v10026142mg             197   9e-57   
ref|XP_011081401.1|  PREDICTED: palmitoyl-protein thioesterase 3        198   1e-56   
ref|NP_199546.1|  alpha/beta-Hydrolases superfamily protein             200   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|EMS63343.1|  Palmitoyl-protein thioesterase 1                        199   2e-56   
ref|XP_010677097.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    195   1e-54   
gb|KDO61330.1|  hypothetical protein CISIN_1g024701mg                   189   2e-53   
ref|XP_010677098.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    189   1e-52   
gb|EYU19279.1|  hypothetical protein MIMGU_mgv1a021288mg                183   1e-51   
ref|XP_010104856.1|  Palmitoyl-protein thioesterase 1                   181   4e-49   
ref|XP_006590575.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    175   1e-48   
gb|AFK37690.1|  unknown                                                 175   2e-48   
ref|XP_002868064.1|  hypothetical protein ARALYDRAFT_493131             178   2e-48   
ref|XP_010484736.1|  PREDICTED: palmitoyl-protein thioesterase 3-...    175   4e-48   
ref|XP_009136846.1|  PREDICTED: palmitoyl-protein thioesterase-do...    174   7e-48   
gb|AFK40085.1|  unknown                                                 174   8e-48   
ref|XP_010696246.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    174   1e-47   
gb|EPS61619.1|  hypothetical protein M569_13177                         172   2e-47   
ref|XP_010696248.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    171   2e-46   
gb|EYU19286.1|  hypothetical protein MIMGU_mgv1a021282mg                169   6e-46   
ref|XP_006285286.1|  hypothetical protein CARUB_v10006663mg             167   1e-45   
gb|KGN55843.1|  hypothetical protein Csa_3G019340                       166   5e-45   
ref|XP_001019974.1|  Palmitoyl protein thioesterase containing pr...    167   9e-45   Tetrahymena thermophila
gb|KHN34910.1|  Palmitoyl-protein thioesterase 3                        162   2e-43   
ref|XP_010696247.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    162   6e-43   
gb|KDO61333.1|  hypothetical protein CISIN_1g024701mg                   158   1e-42   
gb|KDO61331.1|  hypothetical protein CISIN_1g024701mg                   158   2e-42   
ref|XP_010054693.1|  PREDICTED: uncharacterized protein LOC104443025    167   3e-42   
gb|KDO61332.1|  hypothetical protein CISIN_1g024701mg                   159   4e-42   
ref|XP_009123837.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    155   3e-41   
ref|XP_008355699.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    153   2e-40   
ref|XP_010696249.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    155   2e-40   
gb|EJY65300.1|  Palmitoyl-protein thioesterase 1                        155   3e-40   
tpg|DAA42790.1|  TPA: hypothetical protein ZEAMMB73_946813              152   4e-40   
emb|CAB10528.1|  thioesterase like protein                              154   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003292685.1|  hypothetical protein DICPUDRAFT_157425             152   6e-39   
emb|CDX95460.1|  BnaC01g33520D                                          149   2e-38   
emb|CDW83133.1|  palmitoyl-protein thioesterase 1-like                  151   2e-38   
gb|EFA78126.1|  palmitoyl-protein thioesterase 1                        155   2e-38   Polysphondylium pallidum PN500
ref|XP_009418133.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    145   1e-37   
dbj|GAM27989.1|  hypothetical protein SAMD00019534_111650               146   1e-36   
gb|KDO35472.1|  hypothetical protein SPRG_00319                         147   2e-36   
emb|CDY18970.1|  BnaC01g20980D                                          142   3e-36   
emb|CCA21412.1|  palmitoylprotein thioesterase 1 putative               145   4e-36   
gb|AIG56249.1|  secreted protein                                        144   2e-35   
gb|AIG55480.1|  secreted protein                                        144   3e-35   
dbj|BAD43298.1|  unknown protein                                        138   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473821.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    139   6e-35   
ref|XP_002400476.1|  palmitoyl-protein thioesterase precursor, pu...    141   1e-34   Ixodes scapularis [blacklegged tick]
ref|XP_004359144.1|  palmitoyl-protein thioesterase 3                   140   1e-34   
ref|XP_008607440.1|  hypothetical protein SDRG_03581                    140   5e-34   
dbj|GAM19389.1|  hypothetical protein SAMD00019534_025640               139   6e-34   
gb|ERG80540.1|  hypothetical protein ASU_11710                          137   7e-34   
ref|XP_008873712.1|  hypothetical protein H310_09425                    139   1e-33   
gb|ETL30639.1|  hypothetical protein L916_16434                         139   1e-33   
ref|XP_008912291.1|  hypothetical protein PPTG_16502                    139   1e-33   
gb|KFP27613.1|  Palmitoyl-protein thioesterase 1                        137   2e-33   
dbj|BAJ93249.1|  predicted protein                                      133   2e-33   
gb|KCW77193.1|  hypothetical protein EUGRSUZ_D01540                     134   2e-33   
ref|XP_010209089.1|  PREDICTED: palmitoyl-protein thioesterase 1        136   3e-33   
ref|XP_638108.1|  palmitoyl-protein thioesterase 1                      137   3e-33   
ref|XP_010696250.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    133   5e-33   
ref|XP_009906837.1|  PREDICTED: palmitoyl-protein thioesterase 1        135   7e-33   
ref|XP_002112536.1|  hypothetical protein TRIADDRAFT_25162              136   7e-33   
ref|XP_008633292.1|  PREDICTED: palmitoyl-protein thioesterase 1        135   8e-33   
emb|CCI49813.1|  unnamed protein product                                140   8e-33   
gb|KFV75094.1|  Palmitoyl-protein thioesterase 1                        134   9e-33   
gb|EJY68525.1|  Palmitoyl protein thioesterase containing protein       135   1e-32   
ref|XP_002432054.1|  Palmitoyl-protein thioesterase 1 precursor, ...    136   1e-32   
ref|XP_003290057.1|  hypothetical protein DICPUDRAFT_154535             135   1e-32   
ref|XP_001698944.1|  hypothetical protein CHLREDRAFT_131913             134   1e-32   
emb|CBY19151.1|  unnamed protein product                                134   1e-32   
ref|XP_001439979.1|  hypothetical protein                               134   2e-32   
gb|EJY83195.1|  palmitoyl protein thioesterase family protein           135   2e-32   
gb|EMP28451.1|  Palmitoyl-protein thioesterase 1                        133   2e-32   
ref|XP_003703061.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    134   2e-32   
ref|XP_007067664.1|  PREDICTED: palmitoyl-protein thioesterase 1        134   2e-32   
gb|KFO90229.1|  Palmitoyl-protein thioesterase 1                        133   2e-32   
ref|XP_010135265.1|  PREDICTED: palmitoyl-protein thioesterase 1        133   2e-32   
ref|XP_005848514.1|  hypothetical protein CHLNCDRAFT_35163              134   3e-32   
ref|XP_009274577.1|  PREDICTED: palmitoyl-protein thioesterase 1        133   3e-32   
gb|KFM05523.1|  Palmitoyl-protein thioesterase 1                        133   3e-32   
ref|XP_009560155.1|  PREDICTED: palmitoyl-protein thioesterase 1        134   3e-32   
gb|KFW72839.1|  Palmitoyl-protein thioesterase 1                        133   3e-32   
ref|XP_009330470.1|  PREDICTED: palmitoyl-protein thioesterase 1        133   3e-32   
gb|EMC79467.1|  Palmitoyl-protein thioesterase 1                        133   3e-32   
ref|XP_005529790.1|  PREDICTED: palmitoyl-protein thioesterase 1        134   4e-32   
ref|XP_009096833.1|  PREDICTED: palmitoyl-protein thioesterase 1        132   5e-32   
ref|XP_009844598.1|  hypothetical protein H257_17486                    134   5e-32   
ref|XP_003212680.2|  PREDICTED: palmitoyl-protein thioesterase 1        133   6e-32   
ref|XP_010406376.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    132   6e-32   
emb|CBY34234.1|  unnamed protein product                                132   7e-32   
ref|XP_005512879.1|  PREDICTED: palmitoyl-protein thioesterase 1        132   8e-32   
ref|NP_001026074.1|  palmitoyl-protein thioesterase 1 precursor         133   8e-32   
ref|XP_005427166.1|  PREDICTED: palmitoyl-protein thioesterase 1        132   9e-32   
ref|XP_004039360.1|  protein kinase domain protein                      135   1e-31   
ref|XP_009506253.1|  PREDICTED: palmitoyl-protein thioesterase 1        131   1e-31   
emb|CDW84115.1|  palmitoyl-protein thioesterase precursor               133   1e-31   
gb|KFW92772.1|  Palmitoyl-protein thioesterase 1                        131   1e-31   
ref|XP_002904995.1|  palmitoyl-protein thioesterase 1, putative         131   2e-31   
ref|XP_010574379.1|  PREDICTED: palmitoyl-protein thioesterase 1        132   2e-31   
ref|XP_009870644.1|  PREDICTED: palmitoyl-protein thioesterase 1        131   2e-31   
gb|KFP72796.1|  Palmitoyl-protein thioesterase 1                        131   2e-31   
gb|KFV02676.1|  Palmitoyl-protein thioesterase 1                        131   2e-31   
ref|XP_010084384.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   2e-31   
ref|XP_008496673.1|  PREDICTED: palmitoyl-protein thioesterase 1        131   2e-31   
gb|KFO76849.1|  Palmitoyl-protein thioesterase 1                        131   2e-31   
ref|XP_006114851.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   3e-31   
ref|XP_009929139.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   3e-31   
ref|XP_009953402.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   3e-31   
gb|KFP95882.1|  Palmitoyl-protein thioesterase 1                        130   3e-31   
ref|XP_010175567.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   3e-31   
ref|XP_009813968.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   3e-31   
ref|XP_010303132.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   3e-31   
ref|XP_009068290.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   3e-31   
gb|KFO05345.1|  Palmitoyl-protein thioesterase 1                        130   4e-31   
gb|KFV56592.1|  Palmitoyl-protein thioesterase 1                        130   4e-31   
ref|XP_006677521.1|  hypothetical protein BATDEDRAFT_86823              131   4e-31   
gb|KFP75598.1|  Palmitoyl-protein thioesterase 1                        130   4e-31   
gb|KFP93230.1|  Palmitoyl-protein thioesterase 1                        130   4e-31   
gb|KFR03497.1|  Palmitoyl-protein thioesterase 1                        130   4e-31   
ref|XP_009469214.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   4e-31   
gb|KFR16527.1|  Palmitoyl-protein thioesterase 1                        130   5e-31   
ref|XP_008544079.1|  PREDICTED: palmitoyl-protein thioesterase 1        130   5e-31   
ref|XP_009978743.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   5e-31   
gb|AAK31283.1|AC079890_19  putative palmitoyl-protein thioesterase      128   5e-31   
gb|KFV00269.1|  Palmitoyl-protein thioesterase 1                        129   5e-31   
gb|KGL91454.1|  Palmitoyl-protein thioesterase 1                        130   5e-31   
ref|XP_010018924.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   5e-31   
gb|KFP10855.1|  Palmitoyl-protein thioesterase 1                        129   5e-31   
ref|XP_003689629.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    130   6e-31   
ref|XP_010224655.1|  PREDICTED: palmitoyl-protein thioesterase 1        128   6e-31   
ref|XP_010121836.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   6e-31   
gb|KFP43453.1|  Palmitoyl-protein thioesterase 1                        129   6e-31   
ref|XP_008873709.1|  hypothetical protein, variant 1                    131   6e-31   
ref|XP_009521054.1|  hypothetical protein PHYSODRAFT_555467             129   6e-31   
ref|XP_009998883.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   6e-31   
gb|KGL85294.1|  Palmitoyl-protein thioesterase 1                        128   6e-31   
ref|XP_005433148.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   7e-31   
gb|ESA21582.1|  hypothetical protein GLOINDRAFT_334791                  130   7e-31   
gb|KFU91852.1|  Palmitoyl-protein thioesterase 1                        129   7e-31   
ref|XP_004359216.1|  palmitoyl-protein thioesterase 1                   135   7e-31   
gb|KFQ55185.1|  Palmitoyl-protein thioesterase 1                        130   7e-31   
ref|XP_009693844.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   7e-31   
gb|KFP62723.1|  Palmitoyl-protein thioesterase 1                        129   7e-31   
gb|AIG56250.1|  secreted protein                                        130   8e-31   
ref|XP_009844600.1|  hypothetical protein H257_17487                    130   8e-31   
gb|KFV77895.1|  Palmitoyl-protein thioesterase 1                        129   8e-31   
gb|ABD64924.1|  palmitoyl-protein thioesterase -related                 127   8e-31   
ref|XP_008353815.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyl-pr...    127   9e-31   
ref|XP_009387902.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    125   1e-30   
gb|EXX70209.1|  hypothetical protein RirG_089550                        130   1e-30   
gb|KFZ64625.1|  Palmitoyl-protein thioesterase 1                        129   1e-30   
ref|XP_009666526.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   1e-30   
ref|XP_009940312.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   1e-30   
gb|KFQ76277.1|  Palmitoyl-protein thioesterase 1                        129   1e-30   
ref|XP_010286701.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   1e-30   
ref|XP_009479693.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   1e-30   
gb|KFW78199.1|  Palmitoyl-protein thioesterase 1                        128   1e-30   
gb|KFQ50899.1|  Palmitoyl-protein thioesterase 1                        128   1e-30   
ref|XP_005140145.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   2e-30   
gb|KFQ77824.1|  Palmitoyl-protein thioesterase 1                        127   2e-30   
ref|XP_010177477.1|  PREDICTED: palmitoyl-protein thioesterase 1        128   2e-30   
gb|KFQ30613.1|  Palmitoyl-protein thioesterase 1                        128   2e-30   
emb|CAX69665.1|  palmitoyl-protein thioesterase 1                       129   2e-30   
ref|XP_009881100.1|  PREDICTED: palmitoyl-protein thioesterase 1        129   2e-30   
ref|XP_009583382.1|  PREDICTED: palmitoyl-protein thioesterase 1        128   2e-30   
gb|EFA75520.1|  palmitoyl-protein thioesterase 3                        128   2e-30   
gb|KFV95616.1|  Palmitoyl-protein thioesterase 1                        128   2e-30   
ref|XP_006615931.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    129   3e-30   
ref|XP_002500030.1|  palmitoyl-protein thioesterase                     128   3e-30   
gb|KFV96681.1|  Palmitoyl-protein thioesterase 1                        127   3e-30   
gb|KFM65845.1|  Palmitoyl-protein thioesterase 1                        129   3e-30   
ref|XP_010158246.1|  PREDICTED: palmitoyl-protein thioesterase 1        127   3e-30   
emb|CCQ18670.1|  Palmitoyl protein thioesterase                         128   3e-30   
ref|XP_005234221.1|  PREDICTED: palmitoyl-protein thioesterase 1        127   3e-30   
gb|KDD74445.1|  palmitoyl protein thioesterase                          128   4e-30   
ref|XP_009964313.1|  PREDICTED: palmitoyl-protein thioesterase 1        126   4e-30   
gb|AAW26730.1|  SJCHGC04223 protein                                     127   4e-30   
ref|XP_009646870.1|  PREDICTED: palmitoyl-protein thioesterase 1        128   4e-30   
ref|XP_003399319.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    128   4e-30   
ref|XP_006593107.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    127   5e-30   
ref|XP_008939592.1|  PREDICTED: palmitoyl-protein thioesterase 1        126   5e-30   
ref|XP_006904029.1|  PREDICTED: palmitoyl-protein thioesterase 1        127   7e-30   
gb|EMD32081.1|  hypothetical protein CERSUDRAFT_119066                  127   8e-30   
ref|XP_003736994.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    126   1e-29   
ref|XP_005302150.1|  PREDICTED: palmitoyl-protein thioesterase 1        127   1e-29   
ref|XP_005838010.1|  palmitoyl protein thioesterase                     126   1e-29   
ref|XP_007950880.1|  PREDICTED: palmitoyl-protein thioesterase 1        126   2e-29   
gb|EYC11577.1|  hypothetical protein Y032_0050g1986                     125   2e-29   
ref|XP_001631725.1|  predicted protein                                  125   2e-29   
ref|XP_008071363.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    125   2e-29   
ref|XP_006631373.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    126   3e-29   
gb|KEP50576.1|  palmitoyl-protein thioesterase                          126   3e-29   
emb|CCD81181.1|  putative palmitoyl-protein thioesterase                125   3e-29   
ref|XP_003112411.1|  CRE-PPT-1 protein                                  126   3e-29   
gb|EPY49496.1|  palmitoyl protein thioesterase-dolichol pyrophosp...    129   3e-29   
ref|XP_004450685.1|  PREDICTED: palmitoyl-protein thioesterase 1        125   4e-29   
ref|XP_004591595.1|  PREDICTED: palmitoyl-protein thioesterase 1        125   4e-29   
gb|KGB35833.1|  Palmitoyl-protein thioesterase 1                        124   4e-29   
ref|XP_006886564.1|  PREDICTED: palmitoyl-protein thioesterase 1        125   4e-29   
ref|XP_006165008.1|  PREDICTED: palmitoyl-protein thioesterase 1        125   5e-29   
ref|XP_004335947.1|  palmitoyl protein thioesterase                     125   5e-29   
ref|XP_003492426.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    125   6e-29   
emb|CEJ00038.1|  hypothetical protein RMCBS344292_14107                 124   6e-29   
ref|XP_005993967.1|  PREDICTED: palmitoyl-protein thioesterase 1        124   7e-29   
ref|XP_004989279.1|  palmitoyl-protein thioesterase 1                   125   7e-29   
ref|XP_624056.3|  PREDICTED: palmitoyl-protein thioesterase 1           122   8e-29   
ref|XP_002540698.1|  conserved hypothetical protein                     125   8e-29   
dbj|GAM21463.1|  hypothetical protein SAMD00019534_046380               124   9e-29   
gb|EMG48733.1|  hypothetical protein G210_0652                          124   1e-28   
ref|XP_008071362.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    124   1e-28   
emb|CEG63420.1|  hypothetical protein RMATCC62417_00564                 125   1e-28   
ref|XP_002863363.1|  hypothetical protein ARALYDRAFT_916694             118   2e-28   
ref|NP_504684.2|  Protein PPT-1                                         123   2e-28   
ref|XP_002593602.1|  hypothetical protein BRAFLDRAFT_128749             123   2e-28   
emb|CDJ92257.1|  Palmitoyl protein thioesterase domain containing...    123   2e-28   
ref|XP_006460944.1|  hypothetical protein AGABI2DRAFT_192516            123   2e-28   
ref|XP_007328415.1|  hypothetical protein AGABI1DRAFT_112549            123   2e-28   
gb|EJT97386.1|  alpha/beta-hydrolase                                    123   2e-28   
gb|KDO35471.1|  hypothetical protein SPRG_00318                         124   2e-28   
ref|XP_007430564.1|  PREDICTED: palmitoyl-protein thioesterase 1        123   2e-28   
gb|AFW87850.1|  hypothetical protein ZEAMMB73_061678                    119   3e-28   
ref|XP_004371954.1|  PREDICTED: palmitoyl-protein thioesterase 1        123   3e-28   
gb|KGQ82459.1|  palmitoyl-protein thioesterase                          123   3e-28   
gb|KGU21305.1|  palmitoyl-protein thioesterase                          123   3e-28   
gb|KHN72039.1|  Palmitoyl-protein thioesterase 1                        122   3e-28   
gb|KGR01923.1|  palmitoyl-protein thioesterase                          123   3e-28   
ref|XP_003989944.1|  PREDICTED: palmitoyl-protein thioesterase 1        122   4e-28   
gb|ELU36948.1|  palmitoyl-protein thioesterase                          122   4e-28   
ref|XP_005628889.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    121   5e-28   
ref|XP_717495.1|  hypothetical protein CaO19.8173                       122   5e-28   
gb|KGQ81780.1|  palmitoyl-protein thioesterase                          122   5e-28   
ref|XP_004740741.1|  PREDICTED: palmitoyl-protein thioesterase 1 ...    122   5e-28   
gb|EPB85387.1|  hypothetical protein HMPREF1544_07847                   121   6e-28   
ref|XP_006867646.1|  PREDICTED: palmitoyl-protein thioesterase 1        122   6e-28   
ref|XP_005646728.1|  palmitoyl protein thioesterase                     122   6e-28   
ref|XP_008832493.1|  PREDICTED: palmitoyl-protein thioesterase 1        122   6e-28   
ref|XP_002125680.1|  PREDICTED: palmitoyl-protein thioesterase 1        121   7e-28   
ref|XP_007077461.1|  PREDICTED: palmitoyl-protein thioesterase 1        122   7e-28   
gb|ELK34615.1|  Palmitoyl-protein thioesterase 1                        120   9e-28   
ref|NP_071947.1|  palmitoyl-protein thioesterase 1 precursor            121   9e-28   
gb|KGB41556.1|  Palmitoyl-protein thioesterase 1                        119   9e-28   
ref|XP_004365354.1|  palmitoyl protein thioesterase                     121   9e-28   
gb|AHH80648.1|  thioesterase-Ap                                         120   1e-27   
emb|CDO74265.1|  hypothetical protein BN946_scf184643.g5                121   1e-27   
ref|XP_002545614.1|  hypothetical protein CTRG_00395                    121   1e-27   
gb|KGU19085.1|  palmitoyl-protein thioesterase                          121   1e-27   
ref|XP_002715236.1|  PREDICTED: palmitoyl-protein thioesterase 1        121   1e-27   
gb|EPS27111.1|  hypothetical protein PDE_02052                          121   1e-27   
ref|XP_006098259.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   1e-27   
ref|XP_007164770.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   2e-27   
ref|XP_007369008.1|  alpha/beta-hydrolase                               121   2e-27   
ref|XP_002637293.1|  C. briggsae CBR-PPT-1 protein                      120   2e-27   
ref|NP_001010944.1|  palmitoyl-protein thioesterase 1 precursor         120   2e-27   
gb|AAU01161.1|  palmitoyl protein thioesterase                          119   2e-27   
ref|XP_006019356.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   2e-27   
ref|XP_006992301.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   2e-27   
ref|XP_005318164.1|  PREDICTED: palmitoyl-protein thioesterase 1        119   2e-27   
emb|CAP36301.2|  Protein CBR-PPT-1                                      120   2e-27   
gb|AIN34691.1|  fatty alcohol acetyltransferase                         120   2e-27   
ref|NP_001091368.1|  palmitoyl-protein thioesterase 1 precursor         120   2e-27   
gb|EPQ09247.1|  Palmitoyl-protein thioesterase 1                        119   3e-27   
ref|XP_008710217.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   3e-27   
ref|XP_007003282.1|  hypothetical protein TREMEDRAFT_29260              120   3e-27   
ref|XP_003415366.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   3e-27   
ref|XP_006268031.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   3e-27   
ref|XP_004704995.1|  PREDICTED: palmitoyl-protein thioesterase 1        120   3e-27   
ref|XP_005098447.1|  PREDICTED: palmitoyl-protein thioesterase 1-...    119   4e-27   
ref|XP_008299740.1|  PREDICTED: palmitoyl-protein thioesterase 1        119   4e-27   
ref|XP_003227610.1|  PREDICTED: palmitoyl-protein thioesterase 1        119   4e-27   
gb|ELR49683.1|  Palmitoyl-protein thioesterase 1                        119   4e-27   



>ref|XP_009767944.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nicotiana sylvestris]
Length=289

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 199/288 (69%), Gaps = 8/288 (3%)
 Frame = -2

Query  1141  STTFIV-LLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             S TFI+ +++IFSSI LS ST FI+LHG+   C D G+ +YT  +S + R  G C+E+GN
Sbjct  6     SETFILFIISIFSSICLSFSTPFILLHGIGQSCNDAGTTFYTSQLSLLSRSNGYCLEIGN  65

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFI  788
             G   S  M +++QV  AC K+  M EL+ GY++V LSQGNMV RG+IE CDG PPVK+FI
Sbjct  66    GAFDSTSMPLDNQVQIACEKVKGMNELQQGYNLVGLSQGNMVARGLIEFCDGAPPVKNFI  125

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+GGPNAG +    C   PWC   G   G+ +Y+  AQ H+ P+GY K+P D+ GYL   
Sbjct  126   SIGGPNAGVAV---CTGGPWCAEAG---GVRIYSDYAQAHYAPSGYTKLPKDIAGYLKGC  179

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             ++LP +NNEI +A +   K+RF+SL  LVLI+F  D++I P+ SS FG+Y +G +S+ +P
Sbjct  180   RYLPKLNNEIPNATNPIYKQRFTSLKNLVLIMFENDSVINPKESSWFGFYQDGTYSQILP  239

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              QQT+LY +DTFG +TLDKAGKVKF   PG HL +   E++ Y+ PY+
Sbjct  240   PQQTNLYLEDTFGLQTLDKAGKVKFIKLPGIHLGMDIQEMQQYVAPYL  287



>ref|XP_009605499.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nicotiana tomentosiformis]
Length=302

 Score =   286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/288 (50%), Positives = 197/288 (68%), Gaps = 8/288 (3%)
 Frame = -2

Query  1141  STTFIVL-LAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             S TFI   ++IFSSI LS ST FI+LHG+   C D GS +YT  +S + R  G C+E+GN
Sbjct  6     SETFIFFTISIFSSICLSFSTPFILLHGIGQSCNDAGSTFYTSQLSLLSRSNGYCLEIGN  65

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFI  788
             G   S  M +++QV  AC K+  M EL+ GY++V LSQGNMV RG+IE CDG PP+K+FI
Sbjct  66    GAFDSSSMPLDNQVQIACEKVKGMNELQRGYNLVGLSQGNMVARGLIEFCDGAPPIKNFI  125

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+GGPNAG ++   C   PWC   G   G+G+Y+   Q H+ P+GY K+P D+ GYL   
Sbjct  126   SIGGPNAGVAA---CTGGPWCAGAG---GVGIYSDYVQAHYAPSGYTKLPNDIAGYLKGC  179

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             ++LP +NNEI +A +   K+RF+SL  LVLI+F  D +I P+ SS FG+Y +G +S+ +P
Sbjct  180   RYLPKLNNEIPNATNPIYKQRFTSLKNLVLIMFENDNVINPKESSWFGFYQDGTYSQILP  239

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              QQT+LY +DTFG +TLDKAGKVKF   PG HL +   E++ Y+ PY+
Sbjct  240   PQQTNLYLEDTFGLQTLDKAGKVKFIKLPGIHLGMDIQEMQQYVAPYL  287



>ref|XP_002274560.1| PREDICTED: palmitoyl-protein thioesterase 1 [Vitis vinifera]
 emb|CBI16648.3| unnamed protein product [Vitis vinifera]
Length=340

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 192/285 (67%), Gaps = 1/285 (0%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
             FI+L+ +F+  P++ S  FIVLHG+   C + G  ++T  +      +G C+E+G+G   
Sbjct  14    FIILVTVFALTPIAHSIPFIVLHGIGDKCSNRGITHFTELLGNWSSSQGYCIEIGDGTWD  73

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGG  776
             SW++ + +Q A  C K+  M EL  GY++V LSQGN++ RGVIE CDG PPVK+FIS+GG
Sbjct  74    SWVLPLLEQTAIVCEKVKEMTELSEGYNIVGLSQGNVIARGVIEFCDGGPPVKNFISLGG  133

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG +S   CG    C L+ +    G+Y+   Q+H  P+GY+KIPTD+  YL   +FLP
Sbjct  134   PHAGTASVPLCGSGFICILVDNLIKSGIYSDYVQEHLAPSGYLKIPTDIISYLEGCRFLP  193

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNEI D +++  K RFSSL  LVLI+F  DTI++P+ ++ FGYYP+G FS   P  +T
Sbjct  194   KLNNEIIDKRNSTYKERFSSLQNLVLIMFEHDTILIPKETAWFGYYPDGSFSSVFPANET  253

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +LY +D  G KTLD+AGKVKF S PG HL I+  +++ Y++PY++
Sbjct  254   ELYTEDWIGLKTLDEAGKVKFISVPGNHLAISRSDMKTYMVPYLE  298



>ref|XP_009790581.1| PREDICTED: uncharacterized protein LOC104238022 [Nicotiana sylvestris]
Length=665

 Score =   288 bits (737),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 202/297 (68%), Gaps = 2/297 (1%)
 Frame = -2

Query  1168  KIMASCFSFSTTFIV-LLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRV  992
             ++ +  +  S TFI+ +++IF SI LS ST FIVLHG+   C D GS +YT  +S + R 
Sbjct  354   EVQSMAYLCSETFILFIISIFCSICLSFSTPFIVLHGLGQSCNDAGSTFYTSQLSLLSRS  413

Query  991   KGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD  812
              G C+E+GNG   S+ M +++QV  AC K+  M EL+ GY++V LSQGNMV RG+IE CD
Sbjct  414   NGYCLEIGNGAYDSYSMPLDNQVQIACEKVKGMNELQQGYNLVGLSQGNMVARGLIEFCD  473

Query  811   G-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPT  635
             G PPVK+FIS+GGPNAG +    C   PWC   G   G+G+Y+   Q H+ P+GY K+P 
Sbjct  474   GAPPVKNFISIGGPNAGVADAPACAGGPWCAGAGGASGIGIYSDYVQAHYAPSGYTKLPN  533

Query  634   DMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYP  455
             D+ GYL   ++LP +NNEI +A +   K+RF+SL  LVLI+F  D +I P+ SS FG+Y 
Sbjct  534   DISGYLRGCRYLPKLNNEIPNATNPIYKQRFTSLQNLVLIMFENDNVINPKESSWFGFYQ  593

Query  454   NGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +G +S+ +P QQT+LY +DTFG +TLDKAGKVKF   PG HL +   E++ Y+ PY+
Sbjct  594   DGTYSQILPPQQTNLYLEDTFGLQTLDKAGKVKFIKLPGYHLGMDIQEMQQYVAPYL  650


 Score =   255 bits (651),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/288 (42%), Positives = 183/288 (64%), Gaps = 1/288 (0%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F++ F ++L +    P+SSS  FIVLHG+   C   G   +T  +S   + +G C+E+GN
Sbjct  3     FNSWFFLILILVVGAPISSSIPFIVLHGIGDQCSHNGVKRFTEELSEWSKSEGYCLEIGN  62

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFI  788
             G   SW M + DQ    C K+  M EL+ GY++V LSQGN++GR V+E C+G P VK+FI
Sbjct  63    GSWDSWFMTLEDQADAVCSKVKEMKELQDGYNIVGLSQGNLIGRAVVEFCEGGPQVKNFI  122

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+GGP+AG +S   CG   +C +        +Y+   Q H  P+GY+K+P ++ GY+   
Sbjct  123   SLGGPHAGTASVPLCGSGIFCIIADSLIKSEIYSAFVQAHLAPSGYLKLPNNIAGYMKAC  182

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
              FLP +NNEI   +++  K+RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F   +P
Sbjct  183   HFLPKLNNEIPSHRNSTYKKRFTSLENLVLIMFEHDTVLIPRETSWFGYYPDGAFDPILP  242

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
               +T+LY +D  G KTLD +GKV++    G HL I+  ++R +++PY+
Sbjct  243   PNKTELYIEDWIGLKTLDDSGKVQYVKVAGNHLQISSNDMRKHVVPYL  290



>ref|XP_004306990.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Fragaria vesca 
subsp. vesca]
Length=331

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 189/286 (66%), Gaps = 1/286 (0%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
             + + ++ IF+ IPL+ S  FIV HG+   C + G  ++T  +S     +G C+E+G+G  
Sbjct  4     SLLPIIFIFTLIPLTVSVPFIVFHGIGDKCTNRGVTHFTELLSNWSGSQGYCIEIGDGSW  63

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW M + +Q A AC K+  M EL  GY++V LSQGNMVGRGVIE CDG PPV++FIS+ 
Sbjct  64    DSWTMPLLEQTAVACEKVKNMSELSDGYNIVGLSQGNMVGRGVIEFCDGGPPVRNFISLA  123

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG    C L+ +     +Y+   Q+H  P+GY+KIPTD+  YL    FL
Sbjct  124   GPHAGTASIPFCGSEWICVLLDNLIKSEIYSSYIQEHLAPSGYLKIPTDIAAYLKGCTFL  183

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNEI   +++  K RF+SL  LVLI+F  DTI++P+ +S FGY+P+G F   +P Q+
Sbjct  184   PKLNNEINSTRNSTYKERFTSLENLVLIMFEQDTILIPKETSWFGYFPDGAFDPILPAQE  243

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             T+LY +D  G KTLD+AGKVKF +  G HL IT  ++R Y++PY++
Sbjct  244   TELYTEDWIGLKTLDEAGKVKFINVSGNHLAITKSDMRKYVVPYLE  289



>ref|XP_011017334.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Populus 
euphratica]
Length=340

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 194/298 (65%), Gaps = 1/298 (0%)
 Frame = -2

Query  1156  SCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCV  977
             S F  +T F+++  +F+S+P + S  F+V HG+S  C + G   +T  +S    ++G C+
Sbjct  4     SLFVKATAFMIITLMFTSVPFTHSVPFVVFHGISDKCSNKGVKQFTELLSKWSGIQGHCI  63

Query  976   EVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPV  800
             E+G+G   SW M + DQ   AC K+  M EL  GY+++ LSQG+++ RGVIE CDG PPV
Sbjct  64    EIGDGAWDSWTMPLQDQTEIACEKVKSMSELSDGYNLIGLSQGSLIARGVIEFCDGGPPV  123

Query  799   KSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGY  620
             K+ I++ G +AG +S   CG    C L+ +     +Y+   Q+H  P+GYIKIPTD+  Y
Sbjct  124   KNLITLAGIHAGIASIPFCGCTIVCVLLDNLIKSEIYSSYVQEHLAPSGYIKIPTDIPAY  183

Query  619   LAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFS  440
             L   +FLP +NNEI++ +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F 
Sbjct  184   LKGCRFLPKLNNEIKNTRNSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFD  243

Query  439   RAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPS  266
               +P Q+T LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY++   PS
Sbjct  244   TVLPAQETLLYTEDWIGLKTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLEEQAPS  301



>ref|XP_002511600.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
 gb|EEF50269.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
Length=335

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 192/296 (65%), Gaps = 4/296 (1%)
 Frame = -2

Query  1162  MASC-FSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKG  986
             MAS   SF    + L   F+ IPL+ S  FIVLHG+   C + G  ++T  +       G
Sbjct  1     MASIPISFINVIVTLFFTFTLIPLTHSVPFIVLHGIGDKCSNRGISHFTELLGNWSGAPG  60

Query  985   SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-G  809
              C+E+G+G + SW + + +Q A AC K+  M EL  GY++V LSQGNMVGRG+IE C+ G
Sbjct  61    YCLEIGDGSLDSWTIPLLEQTALACEKVKNMSELADGYNIVGLSQGNMVGRGIIEFCEGG  120

Query  808   PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDM  629
             PPVK+F+S+GGP+AG +S   CG    C L+     + VY+   Q+H  P+GY+KIPTD+
Sbjct  121   PPVKNFVSLGGPHAGTASVPFCGSSTICILVDILIRLEVYSSYVQEHLAPSGYVKIPTDI  180

Query  628   KGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNG  449
               YL   KFLP +NNEI   Q++  K R +SL  LVLI+F  DT+++P+ +S FGYYP+G
Sbjct  181   ADYLKGCKFLPRLNNEI--IQNSTYKERLTSLENLVLIMFEQDTVLIPKETSWFGYYPDG  238

Query  448   DFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              FS  +PVQ+T LY +D  G KTLD+AGKVKF +  G HL I+   ++ YI+PY++
Sbjct  239   AFSPVLPVQETKLYTEDWIGLKTLDEAGKVKFLTVSGNHLQISQDVMKKYIVPYLE  294



>ref|XP_010275409.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Nelumbo 
nucifera]
Length=329

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/282 (47%), Positives = 185/282 (66%), Gaps = 1/282 (0%)
 Frame = -2

Query  1123  LLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWM  944
             ++  F  IP+S S  FIVLHG+   C + G   +T  +S     KG C+E+G+G   SW+
Sbjct  8     IIVAFLLIPISYSLPFIVLHGIGDKCSNRGISEFTEILSNWSGSKGYCIEIGDGAWDSWV  67

Query  943   MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNA  767
             M + +Q    C K+ +M EL GGY++V LSQGNM+ RGVIE CDG PPVK+F+S+GGP+A
Sbjct  68    MPLQEQTGIVCDKVKKMKELSGGYNIVGLSQGNMIARGVIEFCDGGPPVKNFVSLGGPHA  127

Query  766   GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
             G +S   CG    C L+       +Y+   Q H  P+GY+KIPTD+  YL   KFLP +N
Sbjct  128   GTASVPLCGSSFICILVDSLIKSEIYSDYVQAHLAPSGYLKIPTDIPAYLEGCKFLPKLN  187

Query  586   NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLY  407
             NE+ + +++  K RFSSL  L+LI+F  DT+++P+ +S FGYYP+G FS  +P QQT LY
Sbjct  188   NELPNERNSTYKERFSSLENLILIMFEHDTVLIPRETSWFGYYPDGAFSPILPPQQTKLY  247

Query  406   QKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +D  G KTLD AG+VK+ S PG HL I+   ++ YI+PY++
Sbjct  248   TEDWIGLKTLDDAGRVKYISVPGNHLAISKAGMKKYIVPYLE  289



>ref|XP_002302491.2| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
 gb|EEE81764.2| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
Length=340

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/298 (43%), Positives = 193/298 (65%), Gaps = 1/298 (0%)
 Frame = -2

Query  1156  SCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCV  977
             S F  +T F+++  +F+S+P + S  F+V HG+S  C + G   +T  +S    ++G C+
Sbjct  4     SLFVKATAFMIITLMFTSVPFTHSVPFVVFHGISDKCSNKGVKQFTEHLSKWSGIQGHCI  63

Query  976   EVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPV  800
             E+G+G   SW M + DQ   AC K+  M EL  GY+++ LSQG+++ RGVIE C+G PPV
Sbjct  64    EIGDGAWDSWTMPLQDQTEIACEKVKSMSELSDGYNLIGLSQGSLIARGVIEFCEGGPPV  123

Query  799   KSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGY  620
             K+ I++ G +AG +S   CG    C L+       +Y+   Q+H  P+GYIKIPTD+  Y
Sbjct  124   KNLITLAGIHAGIASIPFCGSTIICALLDDLIKSEIYSSYVQEHLAPSGYIKIPTDIPAY  183

Query  619   LAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFS  440
             +   +FLP +NNEI++ +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F 
Sbjct  184   IKGCRFLPKLNNEIKNTRNSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFD  243

Query  439   RAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPS  266
               +P Q+T LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY++   PS
Sbjct  244   TVLPAQETLLYTEDWIGLKTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLEEQAPS  301



>ref|XP_002269785.3| PREDICTED: palmitoyl-protein thioesterase 1-like [Vitis vinifera]
Length=327

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 186/288 (65%), Gaps = 1/288 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             S +F +LL+ F    LS S  FIVLHG+   C + G   +T  +      +G CVEVG+G
Sbjct  4     SPSFTILLSFFIIFQLSYSIPFIVLHGIGDQCSNKGVKQFTELLRNFSNSEGYCVEVGDG  63

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFIS  785
                SW + M +Q    C K+  M EL+ GY++V LSQGN++GRGV+E CDG PPVK+F+S
Sbjct  64    TWDSWFIPMKEQAEIVCNKVKEMEELRDGYNIVGLSQGNLIGRGVVEFCDGGPPVKNFVS  123

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             + GP+AG +S   CG   +C +  +     +Y+   Q H  P+GY+K+P D+  YL + +
Sbjct  124   LAGPHAGTASVPLCGSGVFCIIADNLIKSQIYSDYVQTHLAPSGYLKLPNDIPKYLEKCR  183

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNE+ D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P 
Sbjct  184   FLPKLNNELPDERNSTYKERFSSLENLVLIMFEQDTVLIPKETSWFGYYPDGAFEPVLPP  243

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             QQT LY +D  G KTLD AG+VK+ S PG HL I+  +++ Y++PY++
Sbjct  244   QQTKLYTEDWIGLKTLDDAGRVKYISVPGNHLGISHSDMKQYVVPYLE  291



>ref|XP_006837356.1| hypothetical protein AMTR_s00111p00103430 [Amborella trichopoda]
 gb|ERN00210.1| hypothetical protein AMTR_s00111p00103430 [Amborella trichopoda]
Length=319

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/288 (47%), Positives = 189/288 (66%), Gaps = 3/288 (1%)
 Frame = -2

Query  1138  TTFIVLLAIFSSI--PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             TTF +LL+ F  I  PLS S  F+V HG+   C + G   +T  +      KG C+E+GN
Sbjct  6     TTFSLLLSAFFLIILPLSQSIPFVVFHGIGDQCSNRGVTQFTELLGNWSSSKGYCIEIGN  65

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFI  788
             G   SW++ + +Q   AC K+  + ELK GY++VSLSQGN++ RGVIE C+G PPVK+FI
Sbjct  66    GSWDSWVLPLAEQTEIACVKVKEIEELKEGYNIVSLSQGNLIARGVIEFCEGGPPVKNFI  125

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+ GP+AG +S   CG+   C L+       +Y+   Q+H  PAG++KIPTD++ YL   
Sbjct  126   SLAGPHAGTASVPLCGRGFICILVDTLIKSEIYSDYVQEHLAPAGFLKIPTDIEDYLKGC  185

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             +FLP +NNEI + +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   + 
Sbjct  186   RFLPKLNNEIPNERNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGSFRTILA  245

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              Q+T LY +D  G KTLD AGKVKF S PG HL I+  ++R YI+PY+
Sbjct  246   PQETALYVEDWIGLKTLDDAGKVKFISVPGNHLGISKSDMRKYIVPYL  293



>ref|XP_006445409.1| hypothetical protein CICLE_v10021062mg [Citrus clementina]
 gb|ESR58649.1| hypothetical protein CICLE_v10021062mg [Citrus clementina]
Length=334

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 182/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query  1111  FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMN  932
             F  IPLS S  FIVLHG+S  C + G   +T  +S     +G C+E+G+G   SW M + 
Sbjct  13    FCLIPLSYSLPFIVLHGISDKCTNRGVTQFTELLSSWSGSQGYCIEIGDGAWDSWTMPLF  72

Query  931   DQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSS  755
              Q A AC K+  M +L  GY+++ LSQGNM+GRG+IE C+G PPVK+ IS+ GP+AG ++
Sbjct  73    QQTAIACEKVKNMSQLSDGYNIIGLSQGNMIGRGIIEFCEGGPPVKNLISLAGPHAGIAA  132

Query  754   TIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQ  575
                CG  P C L+     + +Y+   Q H  P+GY KIPTD+  YL   KFLP +NNEI 
Sbjct  133   IPLCGFLPICILLDALVKLEIYSDFLQDHLAPSGYYKIPTDIPEYLKGCKFLPKLNNEIV  192

Query  574   DAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDT  395
             + +++  K RF+SL  LVLI+F  D++++P+ +S FGYYP+G F   +P QQT LY +D 
Sbjct  193   NERNSTYKERFASLENLVLIMFEQDSVLVPKETSWFGYYPDGSFDPLLPAQQTQLYTEDW  252

Query  394   FGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              G KTLD+AGKVKF +  G HL I+  +++ YI+PY+K
Sbjct  253   IGLKTLDEAGKVKFINVTGSHLEISRSDMKKYIVPYLK  290



>ref|NP_001136761.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
 ref|XP_008658170.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Zea mays]
 gb|ACF82561.1| unknown [Zea mays]
 gb|ACG33007.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
 gb|ACR37702.1| unknown [Zea mays]
 gb|AFW87851.1| palmitoyl-protein thioesterase 1 [Zea mays]
Length=309

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 185/284 (65%), Gaps = 3/284 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
              ++LL + +  P++S   F+VLHG+   C + G   +T  +      KG C+E+G G   
Sbjct  10    LLILLPVLA--PVASGVPFVVLHGIGDECGNDGLSSFTKMLGEWSGSKGYCIEIGRGAWD  67

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGG  776
             SW+M + +Q    C+K+ +M EL  GY++V LSQGN++GR VIE CD GPPVK+FIS+GG
Sbjct  68    SWLMPLQEQANTVCKKVKKMKELSEGYNIVGLSQGNLIGRAVIEYCDCGPPVKNFISIGG  127

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG +S   CG    C L+       +Y+   Q H  P+GY+KIPTDM+ YL   KFLP
Sbjct  128   PHAGTASVPLCGSGFLCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCKFLP  187

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNEI  A++   K RFSSL  LVLI+F  D +++P+ ++ FGYYP+G FS  +P Q+T
Sbjct  188   KLNNEIPSARNTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQET  247

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              LY +D  G KTLD+AG+VKF S PG HL IT  +++ YI+PY+
Sbjct  248   KLYTEDWIGLKTLDEAGRVKFVSVPGGHLRITRSDMKKYIVPYL  291



>ref|XP_004983641.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Setaria 
italica]
Length=310

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 184/275 (67%), Gaps = 1/275 (0%)
 Frame = -2

Query  1096  LSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVAD  917
             ++S+  FIVLHG+   C + G   +T  +      KG C+E+G G   SW+M + +Q   
Sbjct  23    VASAVPFIVLHGIGDECGNDGLASFTEMLGEWSGSKGYCIEIGRGAWDSWLMPLQEQANT  82

Query  916   ACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCG  740
              C+K+ +M EL  GY++V LSQGN++GR VIE CD GPPVK+FIS+GGP+AG +S   CG
Sbjct  83    VCKKVKKMKELSEGYNIVGLSQGNLIGRAVIEYCDCGPPVKNFISIGGPHAGTASVPLCG  142

Query  739   KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSA  560
                 C L+ +   + +Y+   Q H  P+GY+KIPTDM+ YL   +FLP +NNEI+  ++A
Sbjct  143   SGFLCILIDNLIKLEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCRFLPKLNNEIRSERNA  202

Query  559   ERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKT  380
               K RFSSL  LVLI+F  D +++P+ ++ FGYYP+G F+  +P Q+T LY +D  G KT
Sbjct  203   TYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFNPVLPPQETKLYTEDWIGLKT  262

Query  379   LDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
             LD+AG+VKF S PG HL I+  +++ YI+PY+K D
Sbjct  263   LDEAGRVKFVSVPGGHLRISRSDMKKYIVPYLKPD  297



>ref|NP_001065397.2| Os10g0563000 [Oryza sativa Japonica Group]
 gb|ABB47987.1| Palmitoyl protein thioesterase containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG92988.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67448.1| hypothetical protein OsI_34663 [Oryza sativa Indica Group]
 gb|EEE51405.1| hypothetical protein OsJ_32474 [Oryza sativa Japonica Group]
 dbj|BAF27234.2| Os10g0563000 [Oryza sativa Japonica Group]
Length=314

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 182/277 (66%), Gaps = 1/277 (0%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             +P++S+  FIVLHG+   C++ G   +T  +      KG C+E+G G   SW+M + +Q 
Sbjct  25    VPVASAVPFIVLHGIGDQCENGGMASFTEMLGEWSGSKGYCIEIGRGAWDSWLMPLQEQA  84

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIP  746
                C+K+ +M EL+ GY +V LSQGN++GR VIE CDG PPVK+FIS+GGP+AG +S   
Sbjct  85    DTVCKKVKKMKELRKGYSIVGLSQGNLIGRAVIEYCDGGPPVKNFISIGGPHAGTASVPL  144

Query  745   CGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQ  566
             CG    C L+     + +Y+   Q H  P+GY+KIPTDM  YL   KFLP +NNEI   +
Sbjct  145   CGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIPTDMTDYLKGCKFLPKLNNEIPSER  204

Query  565   SAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGF  386
             +A  K+RFSSL  LVLI+F  D +++P+ ++ FGYYP+G FS   P Q+T LY +D  G 
Sbjct  205   NATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVQPPQKTKLYTEDWIGL  264

Query  385   KTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
             K L++AG+VKF S PG HL I+  + + YI+PY+K D
Sbjct  265   KALEEAGRVKFVSVPGGHLSISRSDTKKYIVPYLKPD  301



>gb|ACG35638.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
Length=325

 Score =   269 bits (688),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 190/287 (66%), Gaps = 1/287 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             +T  +VL+ + ++   +S+  FIVLHG+   C + G   +T  ++      G C+E+G G
Sbjct  5     ATAALVLVPLLAAAVQTSALPFIVLHGIGDQCANHGVAKFTKLLADWSGSDGYCLEIGRG  64

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFIS  785
                SW+M +  Q    C K+  M +L+GGY++V LSQGN++GR V+E CD GPPVK+FIS
Sbjct  65    TWDSWVMPLQQQADIICNKVKEMKQLRGGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFIS  124

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   CG   +C ++     + +Y+   Q+H  P+GY+KIPTDM  YL   +
Sbjct  125   LGGPHAGTASVPLCGSGFFCIIVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCR  184

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNEI D ++A  K RFSSL  LVLI+F+ D +++P+ ++ FGYYP+G F   +P 
Sbjct  185   FLPKLNNEIPDKRNATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPP  244

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             Q+T LY++D  G KTLD+AG+VKF S PG HL I+  +++ YI+PY+
Sbjct  245   QKTKLYEEDWIGLKTLDEAGRVKFVSVPGGHLGISKGDMKKYIVPYL  291



>ref|NP_001232846.1| palmitoyl-protein thioesterase 1 precursor [Zea mays]
 ref|XP_008651020.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN33930.1| unknown [Zea mays]
 tpg|DAA42787.1| TPA: palmitoyl-protein thioesterase 1 [Zea mays]
Length=325

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 190/287 (66%), Gaps = 1/287 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             +T  +VL+ + ++   +S+  FIVLHG+   C + G   +T  ++      G C+E+G G
Sbjct  5     ATAALVLVPLLAAAVQTSALPFIVLHGIGDQCVNHGVAKFTKLLADWSGSDGYCLEIGRG  64

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFIS  785
                SW+M +  Q    C K+  M +L+GGY++V LSQGN++GR V+E CD GPPVK+FIS
Sbjct  65    TWDSWVMPLQQQADIICNKVKEMKQLRGGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFIS  124

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   CG   +C ++     + +Y+   Q+H  P+GY+KIPTDM  YL   +
Sbjct  125   LGGPHAGTASVPLCGSGFFCIIVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCR  184

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNEI D ++A  K RFSSL  LVLI+F+ D +++P+ ++ FGYYP+G F   +P 
Sbjct  185   FLPKLNNEIPDKRNATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPP  244

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             Q+T LY++D  G KTLD+AG+VKF S PG HL I+  +++ YI+PY+
Sbjct  245   QKTKLYEEDWIGLKTLDEAGRVKFVSVPGGHLGISKGDMKKYIVPYL  291



>ref|XP_009411584.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Musa acuminata 
subsp. malaccensis]
Length=307

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/295 (44%), Positives = 188/295 (64%), Gaps = 3/295 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             MAS   +    +VLLA  +S P SSS  F+VLHG+   C   G   +T  +    R +G 
Sbjct  1     MASVLLYWGAVVVLLA--ASAPTSSSIPFVVLHGIGDECASKGVSQFTQLLGNWSRSEGY  58

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-P  806
             C+E+GNG+  SW+M +  Q    C K+  MGEL+ GY++V LSQGN++GR V+E C+G P
Sbjct  59    CIEIGNGVWDSWIMPLQQQADVVCEKVKEMGELRAGYNIVGLSQGNLIGRAVVEFCEGGP  118

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PVK+FIS+GGP+AG +S   CG    C L+ +   + +Y+   Q H  P+GY+KIP D+ 
Sbjct  119   PVKNFISLGGPHAGIASVPLCGSGILCKLVDNLIKLQIYSDYVQAHLAPSGYLKIPNDIP  178

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
             GY+    FLP +NNE    ++A  K R SSL  LVLI+F  DT+++P+ +S FGYYP+ +
Sbjct  179   GYMEGCMFLPKLNNEDPSKRNATYKERLSSLQNLVLIMFEHDTVLVPRETSWFGYYPDDN  238

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             F+  +P  QT LY +D  G KTLD AG+VK+ S  G H+ I+  ++R +I+PY++
Sbjct  239   FNPILPPNQTTLYTEDWIGLKTLDDAGRVKYISVKGNHIKISQSDMRKHIVPYLE  293



>ref|XP_006464436.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Citrus sinensis]
 gb|KDO85535.1| hypothetical protein CISIN_1g016717mg [Citrus sinensis]
Length=384

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 182/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query  1111  FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMN  932
             F  IPLS S  FIVLHG+S  C + G   +T  +S     +G C+E+G+G   SW M + 
Sbjct  63    FCLIPLSYSLPFIVLHGISDKCTNRGVTQFTELLSSWSGSQGYCIEIGDGAWDSWTMPLF  122

Query  931   DQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSS  755
              Q A AC K+  M +L  GY+++ LSQGNM+GRG+IE C+G PPVK+ IS+ GP+AG ++
Sbjct  123   QQTAIACEKVKNMSQLSDGYNIIGLSQGNMIGRGIIEFCEGGPPVKNLISLAGPHAGIAA  182

Query  754   TIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQ  575
                CG  P C L+     + +Y+   Q H  P+GY KIPTD+  YL   KFLP +NNEI 
Sbjct  183   IPLCGFLPICILLDALVKLEIYSDFLQDHLAPSGYYKIPTDIPEYLKGCKFLPKLNNEIV  242

Query  574   DAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDT  395
             + +++  K RF+SL  LVLI+F  D++++P+ +S FGYYP+G F   +P QQT LY +D 
Sbjct  243   NERNSTYKERFASLENLVLIMFEQDSVLVPKETSWFGYYPDGSFDPLLPAQQTQLYTEDW  302

Query  394   FGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              G KTLD+AGKVKF +  G HL I+  +++ YI+PY+K
Sbjct  303   IGLKTLDEAGKVKFINVTGSHLEISRSDMKKYIVPYLK  340



>gb|KHG30728.1| Palmitoyl-protein thioesterase 1 [Gossypium arboreum]
Length=339

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 189/300 (63%), Gaps = 1/300 (0%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             MAS    +T   +       IP   +  FIVLHG+   C + G   +T  +S   + +G 
Sbjct  1     MASRLQPTTLLFIFFITLILIPTRHAIPFIVLHGIGDKCSNRGISEFTEVLSDWSKSQGY  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-P  806
             CVE+G+G   SW M +++Q +  C K+ +M EL  GY++V LSQGN++GRGVIE CDG P
Sbjct  61    CVEIGDGSWDSWTMPLSEQTSIVCEKVKKMSELSNGYNIVGLSQGNLIGRGVIEFCDGGP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PVK+FIS+GGP+AG +S   CG    C L+      G+Y+   Q+H  P+GY+KIPTDM 
Sbjct  121   PVKNFISLGGPHAGTASIPFCGSAVICILLDSLIKFGIYSDYLQEHLAPSGYLKIPTDMS  180

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL   +FLP +NNEI   +++  K R +SL  LVLI+F  DT+++P+ ++ F Y+P+G 
Sbjct  181   DYLKGCRFLPKLNNEINGMRNSTYKERLASLQNLVLIMFEDDTVLIPKETAWFSYFPDGA  240

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPS  266
             F   +PVQ   LY++D  G KTLD+AGKVKF +  G HL I+  +++ Y++PY++   P+
Sbjct  241   FEPVLPVQAAKLYKEDWIGLKTLDEAGKVKFVNVSGNHLQISTSDMKKYMVPYLEYQTPA  300



>ref|XP_011081293.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Sesamum indicum]
Length=350

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 191/288 (66%), Gaps = 1/288 (0%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
             + I  L  FS IP+S S  FIVLHG+   C + G  ++T  +S   + +G C+E+G+G  
Sbjct  3     SLIFGLIAFSFIPISVSIPFIVLHGIGDQCSNRGVKHFTQELSDWSKSEGYCIEIGDGSW  62

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW   + +Q    C K+ +M EL+ GY++V LSQGN++GRGV+E CDG PPV++FIS+G
Sbjct  63    DSWFKPLQEQTEIVCNKVKQMKELQDGYNIVGLSQGNLIGRGVVEFCDGGPPVRNFISLG  122

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG   +C +  +     +Y+   Q H  P+GY+K+P ++ GYL + +FL
Sbjct  123   GPHAGTASVPLCGTGIFCIIADNLIKSEIYSDYVQAHLAPSGYLKLPNNIAGYLNKCRFL  182

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNE+   ++A  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F+  VP Q+
Sbjct  183   PKLNNELPGERNATYKERFTSLQNLVLIMFEHDTVLIPKETSLFGYYPDGAFTPVVPPQR  242

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
             T LY +D  G KTLD AG+VK+ + PG HL I+  +++ Y++PY++ D
Sbjct  243   TKLYTEDWIGLKTLDDAGRVKYITVPGNHLGISKDDMKKYVVPYLEDD  290



>gb|ABK23278.1| unknown [Picea sitchensis]
Length=307

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/293 (43%), Positives = 192/293 (66%), Gaps = 1/293 (0%)
 Frame = -2

Query  1150  FSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEV  971
              + +   + LL   + +PL+ S  FIVLHG+   C++ G  ++T  +S      GSC+E+
Sbjct  1     MAMADRLLPLLCTVALLPLAFSLPFIVLHGIGDKCKNKGVSHFTELLSNWSGSSGSCIEI  60

Query  970   GNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKS  794
             G+G ++SW M +  Q    C ++  M +L+ GY++V LSQGN++GRG+IE CDG PPV +
Sbjct  61    GDGYMTSWTMPLEKQAEIVCEQVKAMPDLEDGYNIVGLSQGNVIGRGIIEFCDGGPPVYN  120

Query  793   FISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLA  614
              IS+GGP+AG +S   CG    C L+       +Y+   Q+H  P+GY+KIPTD+  YL 
Sbjct  121   MISLGGPHAGTASVPLCGTSFICELVDALIKGELYSDFVQEHLAPSGYLKIPTDISKYLK  180

Query  613   QSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRA  434
               +FLP +NNE+ D +++  K RFSSL  L+LI+F  DT+++P+ ++ FGYYP+G+FS  
Sbjct  181   GCRFLPKLNNELPDERNSTYKERFSSLKNLILIMFEHDTVLIPRETAWFGYYPDGNFSVI  240

Query  433   VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
             +P  +T LY++D  G KTLD AG+VK+ S PG HL ITP ++  +++PY++ D
Sbjct  241   LPANETALYKEDWIGLKTLDDAGRVKYISVPGNHLGITPSDMLKHVVPYLEED  293



>dbj|BAJ88880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 181/278 (65%), Gaps = 2/278 (1%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             + +  F+VLHG+   C D     +T  ++G     G C+E+GNG   SW+M ++ Q    
Sbjct  26    AEAVPFVVLHGIGGECTDSSVAEFTRLLAGWSAADGHCLEIGNGARDSWLMPLHQQADIM  85

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGK  737
             C K+  M EL GGY++V LSQGN++GR V+E CD GPPVK+FIS+ GP+AG +S   CG 
Sbjct  86    CNKVKEMKELSGGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFISLAGPHAGTASAPHCGS  145

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
               +C ++       +Y+   Q+H  P+GYIKIPTDM  YL   KFLP +NNEI   ++A 
Sbjct  146   GFFCVIVDALIKSEIYSDYVQEHLAPSGYIKIPTDMDDYLKGCKFLPKLNNEIPGERNAT  205

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RFSSL  LVLI+F +DT+++P+ +S FGYYP+G F   +P QQT+LYQ+D  G K L
Sbjct  206   YKERFSSLENLVLIMFESDTVLIPRETSWFGYYPDGAFDPVLPPQQTNLYQEDWIGLKAL  265

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             D A +VKF S  G HL I+  ++R +I+PY+K D PS+
Sbjct  266   DDARRVKFVSVAGDHLGISNIDMRKHILPYLK-DKPSA  302



>ref|XP_008448812.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Cucumis melo]
Length=295

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/285 (46%), Positives = 184/285 (65%), Gaps = 1/285 (0%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
             F  L  +F SIP+S S  F+VLHG+   C   G   +T  +S    V+G C+EVGNG   
Sbjct  10    FFSLALVFVSIPISLSLPFVVLHGIGDQCSHQGVKNFTQLLSNYSGVEGYCLEVGNGAWD  69

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGG  776
             SW M +  Q    C K+ +M ELK GY+MV LSQGN+VGRGVIE CDG PPVK+++S+GG
Sbjct  70    SWFMPLEKQAGIICDKVKKMEELKEGYNMVGLSQGNLVGRGVIELCDGGPPVKNYVSLGG  129

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG +S   CG   +C L        +Y+   Q H  P+GY+K+P  +  YL + +FLP
Sbjct  130   PHAGIASVPLCGSAIFCRLADELIKSEIYSDYVQDHLAPSGYLKLPNAIPKYLEKCRFLP  189

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNE+  A+++  K RFSSL  LVLI+F  DT+++P+ +S FGYY +G  +  +P QQT
Sbjct  190   KLNNELPQAKNSTYKERFSSLQNLVLIMFEHDTVLVPKETSLFGYYLDGALNSTIPAQQT  249

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              LY +D  G KTLD+AG+VK+ S  G+H+ I+  ++  Y+IPY++
Sbjct  250   KLYIEDWIGLKTLDEAGRVKYISVAGEHVKISNSDMIKYVIPYLQ  294



>gb|KHG13172.1| Palmitoyl-protein thioesterase 1 [Gossypium arboreum]
Length=334

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/292 (46%), Positives = 190/292 (65%), Gaps = 2/292 (1%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
             T I +L  F  IP  ++  FIVLHG+S  C   G   +T  +S     +G CVE+G+G  
Sbjct  12    TIIFILFSFVLIPTINAVPFIVLHGISDKCSGHGVTRFTKLLSSWSNSQGYCVEIGDGSW  71

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW M + +Q + AC K+  M EL  GY+MV LSQG+++GRG+IE CDG PPVK+FIS+ 
Sbjct  72    DSWTMPLLEQTSIACEKVKNMTELSQGYNMVGLSQGSLIGRGIIEFCDGGPPVKNFISLA  131

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   C     C  +       VY+   Q+H  P+GY+KIPTD+  YL   +FL
Sbjct  132   GPHAGIASIPFCESTVICIFLDSLIKSEVYSNFVQEHLAPSGYLKIPTDITDYLKGCRFL  191

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNEI+ A+++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+
Sbjct  192   PKLNNEIKGARNSTYKERFASLQNLVLIMFDDDTVLVPKETSWFGYYPDGAFDPILPAQE  251

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             T+LY++D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY+  D PS+
Sbjct  252   TELYKEDWIGLKTLDEAGKVKFVNVSGSHLKISESDMKKYIVPYLG-DHPST  302



>dbj|BAK02099.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93710.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 178/273 (65%), Gaps = 2/273 (1%)
 Frame = -2

Query  1078  FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKIT  899
             F+VLHG+   C + G   +T  ++      G C+E+G+G   SW+M +N Q    C K+ 
Sbjct  30    FVVLHGIGDQCANRGVAEFTRLLADWSAADGHCLEIGSGTWDSWLMPLNQQAQVICNKVK  89

Query  898   RMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCG  722
              M EL GGY++V LSQGN++GR V+E CD GPPVK+FIS+ GP+AG +S   CG   +C 
Sbjct  90    EMKELSGGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFISLAGPHAGTASVPLCGSGIFCI  149

Query  721   LMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRF  542
             +      + +Y+   Q H  P+GYIKIPTDM  YL   +FLP +NNEI   ++A  K RF
Sbjct  150   IADALIKLEIYSDYVQAHLAPSGYIKIPTDMDDYLKGCRFLPKLNNEIPGERNATYKERF  209

Query  541   SSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGK  362
             SSL  LVLI+F  D +++P+ +S FGYYP+G F   +P QQT LYQ+D  G K LD+AG+
Sbjct  210   SSLENLVLIMFENDIVVIPRETSWFGYYPDGAFEPVLPPQQTKLYQEDWIGLKALDEAGR  269

Query  361   VKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             VKF S PG HL I+  ++R +I+PY+K D PS+
Sbjct  270   VKFVSVPGGHLGISNSDMRKHIVPYLK-DKPSA  301



>ref|XP_008369995.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Malus domestica]
Length=378

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 186/276 (67%), Gaps = 3/276 (1%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             IPL+ S  F+V HG+S  C + G   +T  +S     +G C+E+G+G   SW M +++Q 
Sbjct  62    IPLTHSVPFVVFHGISDKCSNRGVALFTELLSNWSGSQGHCIEIGDGSWDSWTMPLSEQT  121

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIP  746
             A AC K+  M EL  GY+MV LSQGN +GRGVI+ CDG PPVK+ IS+ GP+AG +++IP
Sbjct  122   AIACEKVKNMSELSDGYNMVGLSQGNXIGRGVIQFCDGAPPVKNLISLAGPHAG-TASIP  180

Query  745   CGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDA  569
               K  W C L+       +Y+   Q+H  P+GY+KIPTD+ GYL   +FLP +NNEI+ +
Sbjct  181   FCKCEWICVLLDDLIQSEIYSDFIQEHLAPSGYLKIPTDIDGYLKGCRFLPKLNNEIKAS  240

Query  568   QSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFG  389
             +++  K RF+SL  LVLI+F  DT+++P+ +S FGY+P+G F   +P Q+T LY +D  G
Sbjct  241   RNSTYKERFASLENLVLIMFEQDTVLIPKETSWFGYFPDGAFDPILPAQETMLYTEDWIG  300

Query  388   FKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              KTLD+AGKVKF +  G HL I+  +++ YI+PY++
Sbjct  301   LKTLDEAGKVKFINVSGGHLQISRSDMKTYIVPYLE  336



>ref|XP_010544577.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Tarenaya hassleriana]
Length=326

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 188/294 (64%), Gaps = 2/294 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             MA    F      +  IF+ +PL+ S  FIVLHG+S  C + G   +T  +S     KG 
Sbjct  1     MAGLNLFVAVAATVALIFTCLPLAYSVPFIVLHGISDKCSNRGVTQFTDLLSEWSGSKGY  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             C+E+GNG   SW M + DQ++ AC K+  M EL  GY++V LSQGNM+GRG+IE CD GP
Sbjct  61    CLEIGNGSWDSWTMPLIDQISVACEKVKNMPELSEGYNIVGLSQGNMIGRGLIEWCDGGP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PVK+FISV GP+AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ 
Sbjct  121   PVKNFISVAGPHAGTASIPLCGSTWVCIMLDSLIKTEIYSDYIQEHLAPSGFLKIPTDIS  180

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              Y+   KFLP +NNE+   +++  K RFSSL  LVLI+F  D I++P+ +S FGYYP+G 
Sbjct  181   SYMEGCKFLPKLNNELP-VKNSTYKERFSSLDNLVLIMFDHDAILIPKETSWFGYYPDGS  239

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             F   +P Q+T LY +D  G ++LD+AGKVKF +  G HL I+  +++ YI+PY+
Sbjct  240   FQTVLPPQKTKLYTEDWIGLRSLDEAGKVKFVNVSGNHLQISYSDMKKYIVPYL  293



>ref|XP_002468707.1| hypothetical protein SORBIDRAFT_01g050600 [Sorghum bicolor]
 gb|EER95705.1| hypothetical protein SORBIDRAFT_01g050600 [Sorghum bicolor]
Length=332

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/287 (44%), Positives = 186/287 (65%), Gaps = 1/287 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             +   +V + + ++   +SS  FIVLHG+   C + G   +T  ++G     G C+E+G G
Sbjct  5     AAAALVFIPLLAAAVQTSSLPFIVLHGIGDQCANHGVAKFTKLLAGWSGSDGHCLEIGRG  64

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFIS  785
                SW+M +  Q    C K+  M +L+ GY++V LSQGN++GR V+E CD GPPVK+FIS
Sbjct  65    TWDSWVMPLQQQADIICNKVKEMKQLRDGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFIS  124

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   CG    C L+     + +Y+   Q+H  P+GY+KIPTDM  YL   +
Sbjct  125   LGGPHAGTASVPLCGSGILCILVDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCR  184

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNEI + ++A  K RFSSL  LVLI+F+ D +++P+ ++ FGYYP+G F   +P 
Sbjct  185   FLPKLNNEIPEKRNATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPP  244

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             Q+T LY++D  G KTLDKAG+VKF S  G HL I+  +++ YI+PY+
Sbjct  245   QKTKLYEEDWIGLKTLDKAGRVKFVSVAGGHLGISKSDMKKYIVPYL  291



>ref|XP_010258785.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nelumbo nucifera]
Length=334

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 182/275 (66%), Gaps = 1/275 (0%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             IP+S S  FIVLHGV+  C   G   +T  +S     KG C+EVG+G   SW+M + +Q+
Sbjct  19    IPISYSIPFIVLHGVAGNCSYRGVSKFTKHLSNWSGSKGFCIEVGDGAWDSWIMPLQEQI  78

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIP  746
                C K+  M EL  GY++V LSQGN++GRGV+E C+G PP+K+FIS+GGP+AG +S   
Sbjct  79    KIVCDKVKEMKELSQGYNIVGLSQGNLIGRGVLEFCEGGPPIKNFISLGGPHAGTASVPL  138

Query  745   CGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQ  566
             CG    C L+     + +Y+   Q H  P+GY+KIPT++  YL   KFLP +NNE+  A+
Sbjct  139   CGTGVICVLVDSLIRLEIYSDYVQAHLAPSGYLKIPTEIPAYLEGCKFLPKLNNELPTAR  198

Query  565   SAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGF  386
             ++  K RF SL  LVLI+F  DTI++P+ +S FGYYP+G F   +P QQT LY +D  G 
Sbjct  199   NSTYKERFCSLENLVLIMFEHDTILIPRETSWFGYYPDGGFIPILPPQQTKLYIEDWIGL  258

Query  385   KTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             KTLD AG+VK+ S PGQHL I+   ++ YI+PY++
Sbjct  259   KTLDDAGRVKYISVPGQHLQISNANMKKYIVPYLR  293



>ref|XP_009383948.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 183/274 (67%), Gaps = 1/274 (0%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P S S  FIVLHG+   C + G   +T  +S   R KG C+E+G+G+  SW+M + +Q  
Sbjct  18    PASYSLPFIVLHGIGDQCANKGVAQFTQLLSDWSRSKGYCIEIGDGVWDSWVMPLQEQAD  77

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPC  743
              AC+K+  M EL  GY++V LSQGN++GR V+E+C+G PPVK+FIS+GGP+AG +S   C
Sbjct  78    VACQKVKEMEELSMGYNIVGLSQGNLIGRAVVESCEGGPPVKNFISLGGPHAGTASVPLC  137

Query  742   GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQS  563
             G    C L+ +     +Y+   Q H  P+GY+KIPTD+  YL   +FLP +NNE+   ++
Sbjct  138   GSGIICILVDNLIKSQIYSDYVQAHLAPSGYLKIPTDIPEYLEGCRFLPKLNNELPSERN  197

Query  562   AERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFK  383
             +  K RFSSL  L+LI+F  DT+++P+ +S FGYYP+G F+  +P QQT LY +D  G K
Sbjct  198   STYKERFSSLENLILIMFEHDTVLIPRETSWFGYYPDGAFNPILPPQQTTLYTEDWIGLK  257

Query  382   TLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             TLD AG+VKF S  G HL I+  +++ +I+PY++
Sbjct  258   TLDDAGRVKFISVKGNHLRISQSDMKKHIVPYLE  291



>ref|XP_007157264.1| hypothetical protein PHAVU_002G056200g [Phaseolus vulgaris]
 gb|ESW29258.1| hypothetical protein PHAVU_002G056200g [Phaseolus vulgaris]
Length=354

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 182/273 (67%), Gaps = 1/273 (0%)
 Frame = -2

Query  1096  LSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVAD  917
             +S S  FIV+HG+   C + G   +T  +S    V+G C+E+GNG   SW + + +Q   
Sbjct  19    VSHSIPFIVIHGIGDQCSNRGLKKFTQELSSFSGVEGYCIEIGNGSWDSWFVSLKEQAEI  78

Query  916   ACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCG  740
              C K+ +M ELK GY++V LSQGN++GRGV+E C+G PPVK+F+S+GGP+AG +S   CG
Sbjct  79    VCEKVKQMKELKEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG  138

Query  739   KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSA  560
                +C L        VY+   Q+H  P+GY+K+P  +  YL   +FLP +NNEI D +++
Sbjct  139   SGIFCILADQLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCRFLPVLNNEIPDKRNS  198

Query  559   ERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKT  380
               K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F+  +P Q T LY +D  G +T
Sbjct  199   TYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFNPILPPQSTQLYIEDWIGLRT  258

Query  379   LDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LD+AGKV F S PG+HL I+ P+++ Y++PY+K
Sbjct  259   LDEAGKVHFISVPGKHLGISEPDMKKYVVPYLK  291



>gb|AFK44258.1| unknown [Medicago truncatula]
 gb|KEH21572.1| palmitoyl protein thioesterase family protein [Medicago truncatula]
Length=313

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 182/275 (66%), Gaps = 1/275 (0%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             IP++ S  FIVLHG+   C++ G   +   +S     +G C+E+GNG+ +SW   +  Q 
Sbjct  23    IPVTQSLPFIVLHGIGDQCKNGGVTNFVKLLSDWSGSQGYCLEIGNGMWTSWTKPLLKQT  82

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIP  746
             A AC K+ +M EL  GY++V LSQGN++GRG+IE CDG PPVK+FIS+GGP+AG +S   
Sbjct  83    AIACEKVKKMSELNQGYNIVGLSQGNVIGRGIIEFCDGGPPVKNFISLGGPHAGTASIPL  142

Query  745   CGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQ  566
             CG    C L+      GVY+ + Q    P GY+K+P D+ GYL   KFLP +NNEI + +
Sbjct  143   CGSEKVCTLIDSVIKFGVYSSIVQNSLAPTGYVKMPIDIAGYLKGCKFLPKLNNEIINKR  202

Query  565   SAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGF  386
             ++   +RF+SL  LVLI+F  DTI++P+ ++ FG+YP+G     +P QQT LY +D  G 
Sbjct  203   NSTYSKRFASLENLVLIMFDHDTILIPKETAWFGFYPDGALHSVLPPQQTKLYTEDWIGL  262

Query  385   KTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             + LD+AGKVKFF+  G HL I+  +++ YI+PY+K
Sbjct  263   RALDEAGKVKFFNVSGDHLDISHSDMKSYIVPYLK  297



>ref|XP_009605498.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Nicotiana tomentosiformis]
Length=350

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 183/288 (64%), Gaps = 1/288 (0%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F + F ++L +   +P+SSS  FIVLHG+   C   G   +T  +S   + +G C+E+GN
Sbjct  3     FKSWFFLILVLVVGVPISSSVPFIVLHGIGDQCSHNGVKRFTEELSEWSKSEGYCLEIGN  62

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFI  788
             G   SW M + DQ    C K+  M EL+ GY++V LSQGN++GR V+E C+G P VK+FI
Sbjct  63    GSWDSWFMTLEDQADVVCSKVKEMKELQDGYNIVGLSQGNLIGRAVVEFCEGGPQVKNFI  122

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+GGP+AG +S   CG   +C +        +Y+   Q H  P+GY+K+P ++ GY+   
Sbjct  123   SLGGPHAGTASVPLCGSGIFCIIADSLIKSEIYSAFVQAHLAPSGYLKLPNNIAGYMKAC  182

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
              FLP +NNEI   +++  K+RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P
Sbjct  183   HFLPKLNNEIPSHRNSTYKKRFSSLENLVLIMFEHDTVLIPRETSWFGYYPDGVFEPILP  242

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              Q+T LY +D  G KTLD AGKVK+    G HL I+  ++R +++PY+
Sbjct  243   PQKTQLYAEDWIGLKTLDNAGKVKYVKVAGNHLQISSSDMRKHVVPYL  290



>ref|XP_008232458.1| PREDICTED: palmitoyl-protein thioesterase 1 [Prunus mume]
Length=335

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 179/274 (65%), Gaps = 1/274 (0%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             PL  S  FIV HGV   C + G   +T  +S     +G C+E+G+G   SW M + +Q  
Sbjct  20    PLIHSVPFIVFHGVGDKCSNRGVTQFTELLSNWSGSQGYCIEIGDGSWDSWTMPLLEQTT  79

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPC  743
              AC K+  + EL  GY++V LSQGNMVGRGVIE CDG PPVK+FIS+ GP+AG +S   C
Sbjct  80    IACEKVKNISELSEGYNIVGLSQGNMVGRGVIEFCDGGPPVKNFISLAGPHAGTASIPFC  139

Query  742   GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQS  563
             G    C L+ +     +Y+   Q+H  P+GY+KIPTD+  YL   +FLP +NNEI + ++
Sbjct  140   GSEWICVLLDNLIKSEIYSCFIQEHLSPSGYVKIPTDIAAYLKGCRFLPGLNNEINNMRN  199

Query  562   AERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFK  383
             +  K RFSSL  LVLI+F  DTI++P+ +S FGY+P+G F   +P Q+T LY +D  G K
Sbjct  200   STYKERFSSLEKLVLIMFEQDTILIPKETSWFGYFPDGAFDPILPAQETKLYTEDWIGLK  259

Query  382   TLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             TLD+AGKVKF +  G HL I+  +++ Y++PY++
Sbjct  260   TLDEAGKVKFINVSGGHLHISRSDMKKYVVPYLE  293



>emb|CDP09444.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/294 (45%), Positives = 187/294 (64%), Gaps = 5/294 (2%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             ++S FS    F V L +  + P      F+V HG++  C+  G   +T  ++     +G 
Sbjct  3     LSSSFSIVCMFFVTLTLMPTTPYC--IPFVVFHGIADACRHKGVERFTEILANWSGTQGY  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             CVE+GNG+  SW M    Q++ AC K+ ++ EL+ GY++V LSQGNMVGRGVIE CD GP
Sbjct  61    CVEIGNGVWDSWFMPFPKQISIACEKVKKISELRDGYNIVGLSQGNMVGRGVIEFCDEGP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PVK+ IS+ GP+AG +S   CG    C L+     + VY+   Q H  PAGYIKIPTD+ 
Sbjct  121   PVKNLISLAGPHAGIASVPLCGSSILCVLVDFLIQLAVYSDYVQDHLAPAGYIKIPTDID  180

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
             GY    KFLP +NNE    ++A  K+RF+SL  LVLI+F  D +++P+ +S FGYYP+G 
Sbjct  181   GYRKGCKFLPKLNNEFH--KNATYKQRFASLENLVLIMFEQDEVLVPKETSLFGYYPDGS  238

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +   +P Q+T LY++D  G +TLD+AGKVKF +  G HL I+  +++ YI+PY+
Sbjct  239   WCTVLPAQETALYKEDWIGLRTLDEAGKVKFVNVSGSHLEISLGDMKKYIVPYL  292



>ref|XP_006440241.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
 gb|ESR53481.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
Length=345

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 185/290 (64%), Gaps = 2/290 (1%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             S   +FI +L +F   P+S S  FIVLHG+   C + G   +T  +S     KG C+EVG
Sbjct  5     SVPISFITVLLLFF-FPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFSGSKGYCIEVG  63

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSF  791
             +G   SW   + +Q    C K+ +M EL  GY++V LSQGN++GRGV+E C+G PPVK+F
Sbjct  64    DGTWDSWFKPLEEQTEIVCEKVKKMKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNF  123

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             +S+GGP+AG +S   CG   +C +  +     VY+   Q H  P+GY+K P D+  YL +
Sbjct  124   VSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEK  183

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
              KFLP +NNE+ D +++  K RFS L  LVLI+F+ D +++P+ ++ FGYYP+G FS  +
Sbjct  184   CKFLPKLNNELPDKRNSTYKERFSCLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVL  243

Query  430   PVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             P Q+T LY +D  G KTLD AG+V F S  G HL I+  +++ +IIPY+K
Sbjct  244   PPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  293



>ref|XP_007202352.1| hypothetical protein PRUPE_ppa008372mg [Prunus persica]
 gb|EMJ03551.1| hypothetical protein PRUPE_ppa008372mg [Prunus persica]
Length=335

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 177/275 (64%), Gaps = 1/275 (0%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             IPL  S  FIV HG+   C + G   +T  +S     +G C+E+G+G   SW + + +Q 
Sbjct  19    IPLIHSVPFIVFHGIGDKCSNRGVTQFTELLSNWSGSQGYCIEIGDGSWDSWTVPLLEQT  78

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIP  746
               AC K+  + EL  GY+MV LSQGNMVGRGVIE CDG PPVK+FIS+ GP+AG +S   
Sbjct  79    TIACEKVKNISELSEGYNMVGLSQGNMVGRGVIEFCDGGPPVKNFISLAGPHAGTASIPF  138

Query  745   CGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQ  566
             CG    C L+ +     +Y+   Q+H  P+GY+KIPTD+  YL   +FLP +NNE +   
Sbjct  139   CGSEWICALLDNLIKSEIYSSYVQEHLSPSGYLKIPTDIAAYLKGCRFLPRLNNERKTMS  198

Query  565   SAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGF  386
             ++  K RFSSL  LVLI+F  DTI++P+ +S FGY+P+G F   +P Q+T LY +D  G 
Sbjct  199   NSTYKERFSSLEKLVLIMFEQDTILIPKETSWFGYFPDGAFDPILPAQETKLYTEDWIGL  258

Query  385   KTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             KTLD+AGKVKF    G HL I+  +++ Y++PY++
Sbjct  259   KTLDEAGKVKFIKVSGGHLHISRSDMKKYVVPYLE  293



>ref|XP_011089658.1| PREDICTED: palmitoyl-protein thioesterase 1 [Sesamum indicum]
Length=327

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/291 (45%), Positives = 183/291 (63%), Gaps = 3/291 (1%)
 Frame = -2

Query  1153  CFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVE  974
             CF  + T +  +A+F     + S  F+V HG+S  C++ G  ++T  +S     +G C+E
Sbjct  6     CFLITVTVVYAVALFLVPRTAYSIPFVVFHGISDSCRNRGVAHFTTLLSNWSGSQGYCIE  65

Query  973   VGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVK  797
             +GNG   SW M    Q A AC K+ +M EL  GY+++ LSQGNMVGRGV+E CD GPPV+
Sbjct  66    IGNGAWDSWTMPFFKQTAIACEKVKQMSELSQGYNIIGLSQGNMVGRGVVEFCDGGPPVR  125

Query  796   SFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYL  617
             + IS+ GP+AG ++   CG    C L+     + +Y+   Q+H  PA YIKIPTD+  Y 
Sbjct  126   NLISLAGPHAGIAAVPLCGSAEVCILVDLLIELAIYSNFVQEHLAPASYIKIPTDIDAYR  185

Query  616   AQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSR  437
                KFLP +NNEI   +++  K RFSSL  LVLI F  D I++P+ +S FGY+P+G +  
Sbjct  186   KGCKFLPKLNNEIY--KNSTYKERFSSLENLVLIKFEKDDILVPKETSWFGYFPDGSWDT  243

Query  436   AVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              +P Q+T LY +D  G KTLD+AGKVKF S  G HL I+  E++ YI+PY+
Sbjct  244   VLPAQETTLYTEDWIGLKTLDEAGKVKFVSVSGGHLEISYSEMKKYILPYL  294



>emb|CDX67823.1| BnaA07g18630D [Brassica napus]
Length=333

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 188/290 (65%), Gaps = 3/290 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             I++  I S I ++SS  FIVLHG+   C + G  ++T  +S     +G C+E+GNG   S
Sbjct  8     IIVALICSFITIASSVPFIVLHGIGDKCSNSGVNHFTELLSDWSGSQGYCLEIGNGSWDS  67

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGP  773
             W M + DQ A  C K+  M EL  GY +V LSQGNM+GR +IE CD  PPVKSF+SVGGP
Sbjct  68    WTMPLLDQTAVVCEKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDDAPPVKSFVSVGGP  127

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+   +FLP 
Sbjct  128   HAGTASIPFCGVTWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPK  187

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE+   +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +P Q+T 
Sbjct  188   LNNELP-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETK  246

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             LY +D  G +TLD+AGKVKF +  G HL I+  +++ +I+PY+  D PS+
Sbjct  247   LYTEDWIGLRTLDEAGKVKFVNVSGNHLQISHEDMKKHIVPYLS-DKPST  295



>ref|XP_004986087.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Setaria italica]
Length=335

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 179/271 (66%), Gaps = 1/271 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             +S+  FIVLHG+   C + G  ++T  ++      G C+E+G+G   SW+M +  Q    
Sbjct  22    TSTLPFIVLHGIGDQCANHGVAHFTKLLAEWSGSDGHCIEIGSGTWDSWVMPLQQQADII  81

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGK  737
             C K+  M +LK GY++V LSQGN++GR V+E CD GPPVK+FIS+GGP+AG +S   CG 
Sbjct  82    CNKVKEMEQLKSGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFISLGGPHAGTASVPLCGS  141

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
               +C ++     + +Y+   Q H  P+GY+KIPTDM  YL   +FLP +NNEI D ++A 
Sbjct  142   GIFCIIVDALIKLEIYSDYVQAHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPDGRNAT  201

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RFSSL  LVLI+F  D +++P+ ++ FGYYP+G F   +P Q+T LY++D  G KTL
Sbjct  202   YKERFSSLENLVLIMFENDAVLIPRETAWFGYYPDGAFDPILPPQKTKLYEEDWIGLKTL  261

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             D+AG+VKF S  G HL I+  +++ YI+PY+
Sbjct  262   DEAGRVKFVSVAGGHLGISKGDMKKYIVPYL  292



>ref|XP_004245795.1| PREDICTED: palmitoyl-protein thioesterase 1 [Solanum lycopersicum]
Length=357

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 184/287 (64%), Gaps = 1/287 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             S+  + L+ I   +P+SSS  FIVLHG+   C   G   +T  +S   + +G C+E+GNG
Sbjct  8     SSMLVFLILILIGVPISSSVPFIVLHGIGDQCSHRGVKRFTKELSEWSKSEGYCLEIGNG  67

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFIS  785
                SW M + DQ    C K+ +M EL+ GY++V LSQGN++GR V+E C+G P VK+ IS
Sbjct  68    SWDSWFMTLEDQADVVCSKVKKMKELQDGYNIVGLSQGNLIGRAVVEYCEGGPQVKNLIS  127

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   CG   +C +  +     +Y+   Q H  P+GY+K+P ++ GY+   +
Sbjct  128   LGGPHAGTASVPLCGSGIFCIIADNLIKSEIYSDFVQAHLAPSGYLKLPNNIPGYMKSCR  187

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNEI   +++  K+RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P 
Sbjct  188   FLPKLNNEIPSHRNSTYKKRFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFEPILPA  247

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             Q+T LY +D  G KTLD AGKVK+    G HL I+  +++ +++PY+
Sbjct  248   QKTQLYTEDWIGLKTLDDAGKVKYVKVAGNHLQISSRDMKKHVVPYL  294



>ref|XP_004489139.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Cicer arietinum]
Length=305

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 189/292 (65%), Gaps = 8/292 (3%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
              I++L   + I +S S  FIVLHG+   C++ G   +   +S     +G C+E+GNG+ +
Sbjct  8     LIIVLFFLAFIAVSQSVPFIVLHGIGDQCKNGGMKEFVELLSDWSGSQGYCLEIGNGMWT  67

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGG  776
             SW   +  Q A AC K+ +M +L  GY++V LSQGNM+GRG+IE CDG PPVK+FIS+GG
Sbjct  68    SWTKPLIKQTAIACEKVKKMSDLTHGYNIVGLSQGNMIGRGIIEFCDGGPPVKNFISLGG  127

Query  775   PNAGHSSTIPCGKFPW-------CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYL  617
             P+AG +S   CG           C L+     +G+Y+ + Q    P GY+K+P D+ GYL
Sbjct  128   PHAGTASIPLCGVCELSTTSELVCTLIDSVIQLGIYSSLVQNSLAPTGYVKMPIDIDGYL  187

Query  616   AQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSR  437
                +FLP +NNEI + +++   +RFSSL  L+LI+F  DTI++P+ ++ FG+YP+G    
Sbjct  188   KGCRFLPKLNNEIINKRNSTYSQRFSSLENLILIMFDQDTILIPKETAWFGFYPDGALHP  247

Query  436   AVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +PVQQT LY +D  G + LD+AGKVKFF+  G HL I+  +++++I+PY+K
Sbjct  248   VLPVQQTKLYTEDWIGLRALDEAGKVKFFNVSGDHLDISDSDMKIHIVPYLK  299



>gb|AAO42190.1| putative palmitoyl-protein thioesterase precursor [Arabidopsis 
thaliana]
Length=314

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 185/289 (64%), Gaps = 2/289 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V++A+ + + +S S  FI+LHG+S  C +     +T  ++ +    G C+E+GNG+  SW
Sbjct  13    VVVALLTMVHVSVSVPFIMLHGISAQCSNARDANFTQLLTNLSGSPGFCLEIGNGVADSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
             +M +  Q   AC K+ +M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP+
Sbjct  73    LMPLTRQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG   +C L        +Y+   Q H  P+GY+KIPTDM  YL  SK+LP +
Sbjct  133   AGISSVPMCGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLGSSKYLPKL  192

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNEI D ++   K RF+SL  LVLI F+ D +I+P+ SS FG+YP+G+F   +  QQT L
Sbjct  193   NNEIPDQRNQTYKDRFTSLHNLVLIKFQGDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKL  252

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             Y +D  G KTLD AGKVKF S  G+H+ +   ++  +++PY++ D PSS
Sbjct  253   YTEDWIGLKTLDDAGKVKFVSVAGEHIRMVDEDVVKHVVPYLQ-DQPSS  300



>gb|KDP28824.1| hypothetical protein JCGZ_14595 [Jatropha curcas]
Length=334

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 191/295 (65%), Gaps = 3/295 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M S  +  T  IVL   F+ I ++ S  FIVLHG+   C + G   +T  +S      G 
Sbjct  1     MGSLLTSFTIAIVLFFTFNLIQVTLSVPFIVLHGIGDKCSNHGITQFTELLSDWSGAPGY  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-P  806
             C+E+G+G   SW+M + +Q   AC K+  M EL  GY++V LSQGN++GRG+IE C+G P
Sbjct  61    CLEIGDGSWDSWIMPLIEQTTVACEKVKNMSELADGYNIVGLSQGNLIGRGIIELCEGGP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
              VK+FIS+GGP+AG +S   CG    C L+     + +Y+   Q+H  P+GYIKIPTD++
Sbjct  121   AVKNFISLGGPHAGIASVPLCGSGLICILVDALLRLEIYSIYVQEHLAPSGYIKIPTDIE  180

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              Y+   KFLP +NNEI   +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G 
Sbjct  181   HYVKGCKFLPELNNEI--IKNSTYKERFASLENLVLIMFEHDTVLVPKETSWFGYYPDGC  238

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             F+  +P Q+T LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY++
Sbjct  239   FTSVLPPQETKLYTEDWIGLKTLDEAGKVKFINVSGNHLQISRSDMKNYIVPYLE  293



>ref|NP_199544.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 dbj|BAA97167.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
 gb|AAV97798.1| At5g47330 [Arabidopsis thaliana]
 gb|AAW38984.1| At5g47330 [Arabidopsis thaliana]
 gb|AED95499.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=314

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 185/289 (64%), Gaps = 2/289 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V++A+ + + +S S  FI+LHG+S  C +     +T  ++ +    G C+E+GNG+  SW
Sbjct  13    VVVALLAMVHVSVSVPFIMLHGISAQCSNARDANFTQLLTNLSGSPGFCLEIGNGVADSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
             +M +  Q   AC K+ +M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP+
Sbjct  73    LMPLTRQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG   +C L        +Y+   Q H  P+GY+KIPTDM  YL  SK+LP +
Sbjct  133   AGISSVPMCGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLGSSKYLPKL  192

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNEI D ++   K RF+SL  LVLI F+ D +I+P+ SS FG+YP+G+F   +  QQT L
Sbjct  193   NNEIPDQRNQTYKDRFTSLHNLVLIKFQGDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKL  252

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             Y +D  G KTLD AGKVKF S  G+H+ +   ++  +++PY++ D PSS
Sbjct  253   YTEDWIGLKTLDDAGKVKFVSVAGEHIRMVDEDVVKHVVPYLQ-DQPSS  300



>gb|AFY98638.1| palmitoyl-protein thioesterase [Phaseolus vulgaris]
Length=357

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 180/273 (66%), Gaps = 1/273 (0%)
 Frame = -2

Query  1096  LSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVAD  917
             +S S  FIV+HG+   C + G   +T  +S    V+G C+E+GNG   SW + + +Q   
Sbjct  19    VSHSIPFIVIHGIGDQCSNRGLKKFTQELSSFSGVEGYCIEIGNGSWDSWFVSLKEQAEI  78

Query  916   ACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCG  740
              C K+ +M ELK GY++V LSQGN++GRGV+E C+G PPVK+F+S+GGP+AG +S   CG
Sbjct  79    VCEKVKQMKELKEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG  138

Query  739   KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSA  560
                +C L        VY+   Q+H  P+GY+K+P  +  YL   KFLP +NNEI D +++
Sbjct  139   SGIFCILADQLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCKFLPVLNNEIPDKRNS  198

Query  559   ERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKT  380
               K RFSSL  LVLI+F  D +++P+ +S FGYYP+G F+  +P Q T LY +D  G +T
Sbjct  199   PYKERFSSLQNLVLIMFEPDPVLIPKETSWFGYYPDGYFNPILPPQSTQLYIEDWIGLRT  258

Query  379   LDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LD+AGKV F S PG+H  I+ P+++ Y++PY+K
Sbjct  259   LDEAGKVHFISVPGKHFGISEPDMKKYVVPYLK  291



>ref|XP_010524433.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010524434.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010524435.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=337

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 186/294 (63%), Gaps = 2/294 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             MA   +F     ++  I + +PL+ S  FIVLHG+   C + G   +T  +S     +G 
Sbjct  1     MAHLNAFLAVAAIVALISAFLPLAYSAPFIVLHGIGDKCSNRGVTQFTDLLSDWSGSQGY  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             C+E+GNG   SW M + DQ A AC K+  M EL  GY +V LSQGNM+GRG+IE CD GP
Sbjct  61    CLEIGNGSWDSWTMPLIDQTAVACEKVKNMPELSEGYSIVGLSQGNMIGRGLIELCDGGP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PVK+F+SV GP+AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ 
Sbjct  121   PVKNFVSVAGPHAGTASIPFCGSSWVCIMLDSLIKTEIYSEYIQEHLAPSGFLKIPTDVA  180

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              Y+   +FLP +NNE+   +++  K RF SL  LVLI+F  DTI++P+ +S FGYYP+G 
Sbjct  181   NYMEGCRFLPKLNNELP-VKNSTYKERFLSLDNLVLIMFDHDTILIPKETSWFGYYPDGS  239

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             F   +P Q+T LY +D  G + LD+AGKVKF + PG HL I+  +++ YI+PY+
Sbjct  240   FQTVLPPQKTKLYTEDWIGLRMLDEAGKVKFINVPGNHLQISHSDMKKYIVPYL  293



>ref|XP_006414227.1| hypothetical protein EUTSA_v10025863mg [Eutrema salsugineum]
 gb|ESQ55680.1| hypothetical protein EUTSA_v10025863mg [Eutrema salsugineum]
Length=296

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/287 (46%), Positives = 187/287 (65%), Gaps = 6/287 (2%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             +  +V L++F  IP+S S  FI+ HGV   C + G   +T  +S +    GSC+E+GNG 
Sbjct  8     SALLVTLSLFFFIPVSISVPFILFHGVRDQCSNGGPSSFTQLLSNLSSSPGSCLEIGNGE  67

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISV  782
               S  M +  Q + AC K+ +M EL+ GY++V+ SQGNMV RG+IE CD  PPV +++S+
Sbjct  68    KDSVSMPLTQQASVACEKVKQMKELRQGYNIVAQSQGNMVARGLIEFCDNAPPVFNYVSL  127

Query  781   GGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKF  602
             GGP+AG  S IP    P C L+       VY+   Q H  P+GYIKIPTDMK YL  SK+
Sbjct  128   GGPHAG-ISDIPNCSSPVCQLLK----TDVYSDYVQDHIAPSGYIKIPTDMKNYLKHSKY  182

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ  422
             LP +NNE  + +++  K RF+SL  LVL++F+ DT+++P+ S  FGYYP+G  +  +P Q
Sbjct  183   LPKLNNERPNERNSTYKERFTSLHNLVLVMFQGDTVVIPKESCWFGYYPDGASTPLLPPQ  242

Query  421   QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             QT LY++D  G KTLD AGKVKF S PG+HL +   ++  Y++PY++
Sbjct  243   QTKLYKEDWIGLKTLDAAGKVKFVSVPGKHLQMAHDDVVKYVVPYLQ  289



>ref|XP_004983640.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Setaria 
italica]
Length=326

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/291 (44%), Positives = 184/291 (63%), Gaps = 17/291 (6%)
 Frame = -2

Query  1096  LSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVAD  917
             ++S+  FIVLHG+   C + G   +T  +      KG C+E+G G   SW+M + +Q   
Sbjct  23    VASAVPFIVLHGIGDECGNDGLASFTEMLGEWSGSKGYCIEIGRGAWDSWLMPLQEQANT  82

Query  916   ACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCG  740
              C+K+ +M EL  GY++V LSQGN++GR VIE CD GPPVK+FIS+GGP+AG +S   CG
Sbjct  83    VCKKVKKMKELSEGYNIVGLSQGNLIGRAVIEYCDCGPPVKNFISIGGPHAGTASVPLCG  142

Query  739   KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSA  560
                 C L+ +   + +Y+   Q H  P+GY+KIPTDM+ YL   +FLP +NNEI+  ++A
Sbjct  143   SGFLCILIDNLIKLEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCRFLPKLNNEIRSERNA  202

Query  559   ERKRRFSSLTMLVLIL----------------FRADTIILPQISSHFGYYPNGDFSRAVP  428
               K RFSSL  LVLI+                F  D +++P+ ++ FGYYP+G F+  +P
Sbjct  203   TYKERFSSLENLVLIMKILLKIAKSSHFVLLQFEDDAVLIPRETAWFGYYPDGAFNPVLP  262

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
              Q+T LY +D  G KTLD+AG+VKF S PG HL I+  +++ YI+PY+K D
Sbjct  263   PQETKLYTEDWIGLKTLDEAGRVKFVSVPGGHLRISRSDMKKYIVPYLKPD  313



>ref|NP_191593.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 ref|NP_850728.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 emb|CAB87871.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
 gb|AAN13045.1| putative palmitoyl-protein thioesterase precursor [Arabidopsis 
thaliana]
 dbj|BAH20058.1| AT3G60340 [Arabidopsis thaliana]
 gb|AEE80048.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 gb|AEE80049.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=338

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/290 (45%), Positives = 186/290 (64%), Gaps = 4/290 (1%)
 Frame = -2

Query  1150  FSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEV  971
             F  +T  + L+  F+S  L+SS  FIVLHG+   C + G   +T  +S     +G C+E+
Sbjct  3     FLKATIIVALICNFAS--LASSVPFIVLHGIGDKCSNAGVTQFTELLSDWSGSQGYCLEI  60

Query  970   GNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKS  794
             GNG   SW M + DQ +  C K+  M EL  GY +V LSQGNM+GR +IE CDG PPVKS
Sbjct  61    GNGSWDSWTMPLLDQTSVVCEKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDGAPPVKS  120

Query  793   FISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLA  614
             F+SV GP+AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+ 
Sbjct  121   FVSVAGPHAGTASIPFCGATWICIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYME  180

Query  613   QSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRA  434
               +FLP +NNE+   +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   
Sbjct  181   GCRFLPKLNNELP-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTI  239

Query  433   VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +P Q+T LY +D  G +TLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  240   LPPQETKLYTEDWIGLRTLDEAGKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>ref|XP_002876550.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52809.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=338

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 185/289 (64%), Gaps = 2/289 (1%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             +F    I++  I + + L+SS  FIVLHG+   C + G   +T  +S     +G C+E+G
Sbjct  2     AFLKAAIIVALICNFVSLASSVPFIVLHGIGDKCSNAGVTQFTELLSDWSGSQGYCMEIG  61

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSF  791
             NG   SW M + DQ +  C K+  M EL  GY +V LSQGNM+GR +IE CDG PPVK+F
Sbjct  62    NGSWDSWTMPLLDQTSVVCEKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDGAPPVKNF  121

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             +SV GP+AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+  
Sbjct  122   VSVAGPHAGTASIPFCGATWICIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYMEG  181

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
              +FLP +NNE+   +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +
Sbjct  182   CRFLPKLNNELP-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTIL  240

Query  430   PVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             P Q+T LY +D  G KTLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  241   PPQETKLYTEDWIGLKTLDEAGKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>ref|XP_010052814.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X4 [Eucalyptus 
grandis]
Length=339

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 185/290 (64%), Gaps = 2/290 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +   +  P + S  F+V HG+S  C + G   +T  +S     +G C+E+G+G   SW
Sbjct  13    VAVLTLARAPATQSLPFVVFHGISDKCSNTGVARFTELLSNWSGSEGHCIEIGDGTWDSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFISVGGPN  770
              M + +Q A AC K+  M EL  G+++V LSQG M+GRGV+E CDG P VK+FIS+ G +
Sbjct  73    TMPLMEQTAIACEKVKNMSELSDGFNLVGLSQGTMIGRGVVEFCDGAPQVKNFISLAGIH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGM-GVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             AG SS   CG   +C L+ +   + GVY+   Q+H  P+ Y+KIPTD+  YL   KFLP 
Sbjct  133   AGISSIPFCGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPK  192

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE+   +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T+
Sbjct  193   LNNELVHHRNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETE  252

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY+  D  S+
Sbjct  253   LYIEDWIGLKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYLVDDEASA  302



>ref|XP_010052813.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Eucalyptus 
grandis]
 gb|KCW76894.1| hypothetical protein EUGRSUZ_D01239 [Eucalyptus grandis]
Length=339

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 185/290 (64%), Gaps = 2/290 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +   +  P + S  F+V HG+S  C + G   +T  +S     +G C+E+G+G   SW
Sbjct  13    VAVLTLARAPATQSLPFVVFHGISDKCSNTGVARFTELLSNWSGSEGHCIEIGDGTWDSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFISVGGPN  770
              M + +Q A AC K+  M EL  G+++V LSQG M+GRGV+E CDG P VK+FIS+ G +
Sbjct  73    TMPLMEQTAIACEKVKNMSELSDGFNLVGLSQGTMIGRGVVEFCDGAPSVKNFISLAGIH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGM-GVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             AG SS   CG   +C L+ +   + GVY+   Q+H  P+ Y+KIPTD+  YL   KFLP 
Sbjct  133   AGISSIPFCGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPK  192

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE+   +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T+
Sbjct  193   LNNELVHHRNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETE  252

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY+  D  S+
Sbjct  253   LYIEDWIGLKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYLVDDEASA  302



>ref|XP_006347949.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum tuberosum]
Length=333

 Score =   258 bits (660),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 180/288 (63%), Gaps = 4/288 (1%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F+  FI +L    SI + S   F+V HG+S  C + G  ++T  +S      G C+E+GN
Sbjct  3     FTLFFINVLFTLHSITIYS-LPFVVFHGISDKCSNGGITHFTELLSNWSGSSGHCIEIGN  61

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFI  788
             G   SW M    Q+  AC+K+ +M EL  GY+++ LSQGNMVGRGVIE CD GPPV++ I
Sbjct  62    GEWDSWFMPFPKQIDIACQKLKKMSELSEGYNIIGLSQGNMVGRGVIEFCDDGPPVRNLI  121

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+ GP+AG +S   CG   WC L      + +Y+   Q H  PAGYIKIPTD+  Y    
Sbjct  122   SLAGPHAGIASIPLCGSGIWCILEDSLLKLAIYSNFIQAHLAPAGYIKIPTDIANYRKGC  181

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             KFLP +NNE+   +++  K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G FS  +P
Sbjct  182   KFLPVLNNEVH--RNSTYKKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSFSTVLP  239

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              Q+T LY +D  G K LD+AGKVK     G HL I+  E++  I+PY+
Sbjct  240   AQKTKLYTEDWIGLKMLDEAGKVKLLKVCGSHLEISTSEMKKNILPYL  287



>ref|XP_006402591.1| hypothetical protein EUTSA_v10006085mg [Eutrema salsugineum]
 gb|ESQ44044.1| hypothetical protein EUTSA_v10006085mg [Eutrema salsugineum]
Length=337

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 185/289 (64%), Gaps = 2/289 (1%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             +F    I+   I + + L+SS  FIVLHG+   C + G  ++T  +S     +G C+E+G
Sbjct  2     AFLKAGIIFALICTFVSLASSVPFIVLHGIGDKCSNAGVKHFTELLSDWSGSQGYCLEIG  61

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSF  791
             NG   SW M + DQ A  C K+  M EL  GY +V LSQGNM+GR +IE CDG PPVK+F
Sbjct  62    NGSWDSWTMPLLDQTAVVCEKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDGAPPVKNF  121

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             +SV GP+AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+  
Sbjct  122   VSVAGPHAGTASIPFCGATWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYMEG  181

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
              +FLP +NNE+   +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +
Sbjct  182   CRFLPKLNNELP-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTIL  240

Query  430   PVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             P Q+T LY +D  G +TLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  241   PPQETKLYTEDWIGLRTLDEAGKVKFVNVSGNHLQISHADMKKHIVPYL  289



>ref|XP_006477132.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Citrus sinensis]
Length=351

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 184/286 (64%), Gaps = 2/286 (1%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
             +FI +L +F   P+S S  FIVLHG+   C + G   +T  +S     KG C+EVG+G  
Sbjct  9     SFITVLLLFF-FPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFSGSKGYCIEVGDGTW  67

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW   + +Q    C K+ +M EL  GY++V LSQGN++GRGV+E C+G PPVK+F+S+G
Sbjct  68    DSWFKPLEEQTEIVCDKVKKMKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLG  127

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG   +C +  +     VY+   Q H  P+GY+K P D+  YL + KFL
Sbjct  128   GPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFL  187

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNE+ D +++  K  FSSL  LVLI+F+ D +++P+ ++ FGYYP+G FS  +P Q+
Sbjct  188   PKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQR  247

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             T LY +D  G KTLD AG+V F S  G HL I+  +++ +IIPY+K
Sbjct  248   TKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  293



>ref|XP_009347695.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
Length=336

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 182/276 (66%), Gaps = 3/276 (1%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             IPL+ S  F+V HG+S  C + G   +T  +S     +G C+E+G+G   SW M + +Q 
Sbjct  20    IPLTHSVPFVVFHGISDKCSNRGVAQFTELLSNWSGSQGYCIEIGDGSWDSWTMPLLEQT  79

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIP  746
             A AC K+  M EL  GY+MV LSQG+++GRGVIE CDG PPVK+ IS+ G +AG +S IP
Sbjct  80    AIACEKVKNMSELSDGYNMVGLSQGSLIGRGVIEFCDGAPPVKNLISLAGIHAGIAS-IP  138

Query  745   CGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDA  569
               K  W C L+       +Y+   Q+H  P+GYIKIPTD+  YL   +FLP +NNEI+ +
Sbjct  139   FCKSEWICVLLDTLIKSEIYSDFIQEHLAPSGYIKIPTDIDAYLKGCRFLPKLNNEIKAS  198

Query  568   QSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFG  389
             +++  K RF+SL  LVLI+F  DTI++P+ +S FGY+P+G     +P Q+T LY +D  G
Sbjct  199   RNSTYKERFASLENLVLIMFEQDTILIPKETSWFGYFPDGASDPILPAQETMLYTEDWIG  258

Query  388   FKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              KTLD+AGKVKF +  G HL I+  +++ YI+PY++
Sbjct  259   LKTLDEAGKVKFINVSGGHLQISRSDMKTYIVPYLE  294



>ref|XP_010919692.1| PREDICTED: palmitoyl-protein thioesterase 1 [Elaeis guineensis]
Length=328

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 184/283 (65%), Gaps = 3/283 (1%)
 Frame = -2

Query  1120  LAIFSSI--PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             LAIF S+  P SS+  FIVLHG+   C + G   +T  +S     +G C+E+G+G   SW
Sbjct  11    LAIFLSVFAPRSSAIPFIVLHGIGDQCANKGVSQFTKLLSKWSGSEGYCIEIGSGAWDSW  70

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
             +M + +Q    C+K+  M EL  GY++V LSQGN++GRGV+E CDG PPVK+FIS+ GP+
Sbjct  71    VMPLQEQTNIVCQKVKEMQELSMGYNIVGLSQGNLIGRGVVEFCDGGPPVKNFISLAGPH  130

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG +S   CG    C L+       +Y+   Q H  P+GY+KIPTD+  YL   +FLP +
Sbjct  131   AGTASVPLCGSGIICMLVDDLIKSQIYSDYIQAHLAPSGYLKIPTDIPAYLEGCRFLPKL  190

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNEI   +++  K RFSSL  LVLI+F  D++++P+ +S FGYYP+G+F+  +  QQT L
Sbjct  191   NNEIPSERNSTYKERFSSLQTLVLIMFEQDSVLIPRETSWFGYYPDGNFTPVLSPQQTTL  250

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             Y +D  G + LD+AG+VKF S  G HL I+  +++ YI+PY+ 
Sbjct  251   YIEDWIGLRALDEAGRVKFISVQGGHLRISDSDMQKYIVPYLN  293



>ref|XP_010524432.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=409

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/298 (44%), Positives = 188/298 (63%), Gaps = 2/298 (1%)
 Frame = -2

Query  1174  FMKIMASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLR  995
             + + MA   +F     ++  I + +PL+ S  FIVLHG+   C + G   +T  +S    
Sbjct  69    YHRKMAHLNAFLAVAAIVALISAFLPLAYSAPFIVLHGIGDKCSNRGVTQFTDLLSDWSG  128

Query  994   VKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC  815
              +G C+E+GNG   SW M + DQ A AC K+  M EL  GY +V LSQGNM+GRG+IE C
Sbjct  129   SQGYCLEIGNGSWDSWTMPLIDQTAVACEKVKNMPELSEGYSIVGLSQGNMIGRGLIELC  188

Query  814   D-GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIP  638
             D GPPVK+F+SV GP+AG +S   CG    C ++       +Y+   Q+H  P+G++KIP
Sbjct  189   DGGPPVKNFVSVAGPHAGTASIPFCGSSWVCIMLDSLIKTEIYSEYIQEHLAPSGFLKIP  248

Query  637   TDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYY  458
             TD+  Y+   +FLP +NNE+   +++  K RF SL  LVLI+F  DTI++P+ +S FGYY
Sbjct  249   TDVANYMEGCRFLPKLNNELP-VKNSTYKERFLSLDNLVLIMFDHDTILIPKETSWFGYY  307

Query  457   PNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             P+G F   +P Q+T LY +D  G + LD+AGKVKF + PG HL I+  +++ YI+PY+
Sbjct  308   PDGSFQTVLPPQKTKLYTEDWIGLRMLDEAGKVKFINVPGNHLQISHSDMKKYIVPYL  365



>ref|XP_006359268.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum tuberosum]
Length=280

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 177/261 (68%), Gaps = 1/261 (0%)
 Frame = -2

Query  1063  GVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGEL  884
             G+   C D GS +YT  +S + +  G C+E+G+G+ SS+ M + +QV  AC K+  M EL
Sbjct  5     GLGESCNDAGSTFYTSQLSLLSKSNGYCLEIGDGVYSSYYMPLENQVQIACEKVKGMKEL  64

Query  883   KGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHY  707
             + GY++V LSQGNMV RG+IE CD  PPV +FIS+GGPNAG +S   C   PWC   G  
Sbjct  65    QQGYNIVGLSQGNMVARGLIEFCDEAPPVNNFISIGGPNAGIASGPACTGNPWCDGAGGI  124

Query  706   YGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTM  527
              G+G+Y+   Q H+ P+GYIK+P D+ GYL   ++LP +NNEI +A +   K RF+SL  
Sbjct  125   SGIGIYSDYVQTHYAPSGYIKLPNDIAGYLRGCRYLPKLNNEIPNATNPIYKERFTSLQN  184

Query  526   LVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFS  347
             LVLI+F  D +I P+ SS FG+Y +G  S+ +P QQT+LY +DTFG +TLDKAGKVKF  
Sbjct  185   LVLIMFENDDVITPKESSWFGFYQDGTDSQILPPQQTNLYLEDTFGLQTLDKAGKVKFIK  244

Query  346   CPGQHLVITPPEIRMYIIPYM  284
              PG HLV+   E++  ++PY+
Sbjct  245   LPGYHLVMDIQEMQQNVVPYL  265



>ref|XP_002865126.1| hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41385.1| hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 187/293 (64%), Gaps = 2/293 (1%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             +  +V +A+ + + +S S  FI+LHG+S  C +     +T  ++ +    G C+E+GNG+
Sbjct  9     SCVVVAVALLAMVHVSVSVPFIMLHGISAQCSNARDANFTQLLTNLSGSPGFCLEIGNGV  68

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISV  782
               SW+M +  Q   AC K+ +M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+
Sbjct  69    GDSWLMPLARQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISL  128

Query  781   GGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKF  602
              GP+AG SS   CG   +C L        +Y+   Q H  P+GY+KIPTDM  YL  SK+
Sbjct  129   AGPHAGISSVPMCGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLENSKY  188

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ  422
             LP +NNEI + +++  K RF+SL  LVLI F+ D +I+P+ SS FG+YP+G+F   +  Q
Sbjct  189   LPKLNNEIPNQRNSTYKDRFTSLQNLVLIKFQDDKVIVPKDSSWFGFYPDGEFEPLLSAQ  248

Query  421   QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             QT LY +D  G KTLD AGKVKF S  G+H+ +   ++  +++PY++ D PSS
Sbjct  249   QTKLYTEDWIGLKTLDDAGKVKFVSVAGEHIRMADEDVVKHVVPYLQ-DQPSS  300



>ref|XP_010441474.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=314

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 182/283 (64%), Gaps = 1/283 (0%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +A+ + + +S S  F++ HG+S  C +     +T  ++ +    G CVE+GNG+  SW
Sbjct  13    VAVALLAMVHVSVSVPFVMFHGISAQCSNDRDANFTQLLTNLSGSPGFCVEIGNGVADSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
             +M +  QV  AC K+ +M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP+
Sbjct  73    LMPLTRQVEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG   +C L        +Y+   Q H  P+GY+KIPTDMK YL  SK+LP +
Sbjct  133   AGISSVPMCGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTDMKKYLESSKYLPRL  192

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNEI + +++  K RF+SL  LVL+ F+ D +I+P+ SS FG+YP+G+F   +  QQT L
Sbjct  193   NNEIPNQRNSTYKERFASLHNLVLVKFQDDKVIVPKDSSWFGFYPDGEFKPLLSAQQTKL  252

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             Y +D  G KTLD AGKVKF S  G+H+ +   ++  Y++PY++
Sbjct  253   YTEDWIGLKTLDVAGKVKFVSVAGEHIRMADEDVVKYVVPYLQ  295



>ref|XP_003572088.2| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Brachypodium 
distachyon]
Length=307

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 176/271 (65%), Gaps = 1/271 (0%)
 Frame = -2

Query  1090  SSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADAC  911
             S+  FIVLHG+   C + G   +T  +      KG C+E+G G   SW+M + +Q    C
Sbjct  21    SAVPFIVLHGIGDQCGNDGIASFTDELGKWSGSKGYCMEIGRGSWDSWIMPLQEQANAVC  80

Query  910   RKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKF  734
              K+  M +L  GY+++ LSQGN++GR VIE CD GPPVK+FIS+GGP+AG +S   CG  
Sbjct  81    NKVKEMKDLHEGYNIIGLSQGNLIGRAVIEYCDDGPPVKNFISIGGPHAGTASVPLCGSG  140

Query  733   PWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAER  554
               C L+     + +Y+   Q H  P+GY+KIPTDM  YL   KFLP +NNEI   ++A  
Sbjct  141   ILCILVDALIQLEIYSNYVQAHLAPSGYLKIPTDMAEYLKGCKFLPKLNNEIPSERNATY  200

Query  553   KRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLD  374
             K RFSSL  LVLI+F+ D +++P+ ++ FGYYP+G F+  +P Q+T LY +D  G +TLD
Sbjct  201   KERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGSFNPVLPPQKTKLYTEDWIGLRTLD  260

Query  373   KAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             + G+VKF S PG HL I+  +++ YI+PY+K
Sbjct  261   ETGRVKFVSVPGGHLRISRSDMKKYIVPYLK  291



>ref|XP_003559046.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Brachypodium 
distachyon]
Length=304

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 175/272 (64%), Gaps = 1/272 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             + +  F+VLHG+   C + G   +T  ++      G C+E+G G   SW+M +  Q    
Sbjct  23    AEAVPFVVLHGIGDQCANHGVAKFTRLLADWSAADGYCLEIGRGTWDSWVMPLQQQADII  82

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGK  737
             C K+  M EL GGY++V LSQGN++GR V++ CD GPPVK+FIS+GGP+AG +S   CG 
Sbjct  83    CNKVKEMKELSGGYNIVGLSQGNLIGRAVVQYCDDGPPVKNFISLGGPHAGTASVPLCGS  142

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
               +C ++     + +Y+   Q H  P+GY+KIPTDMK YL   +FLP +NNEI   ++A 
Sbjct  143   GIFCIIVDALIKLEIYSEYVQAHLAPSGYLKIPTDMKDYLEGCRFLPKLNNEIPGERNAT  202

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RFSSL  LVLI+F  D +++P+ +S FGYYP+G F + +P Q+T LY +D  G K+L
Sbjct  203   YKERFSSLENLVLIMFEDDIVLIPRETSWFGYYPDGAFDQVLPPQKTKLYMEDWIGLKSL  262

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             D  G+VKF S  G HL I+  ++R YI+PY+K
Sbjct  263   DDGGRVKFVSVAGGHLGISDSDMRKYIVPYLK  294



>ref|XP_008369436.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Malus domestica]
Length=353

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/284 (43%), Positives = 182/284 (64%), Gaps = 1/284 (0%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V +    SIP S S  FIVLHG+   C + G   +T  +S    V+G C+E+G+G   S
Sbjct  6     VVFIVALISIPTSLSVPFIVLHGIGDQCSNKGVKQFTEKLSNFSGVEGYCIEIGDGTWDS  65

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGP  773
             W + + +Q    C K+    EL+ GY++V LSQGN++GRGV+E C DGPPVK+F+S+GGP
Sbjct  66    WFLPLEEQTRIVCDKVKEKEELRQGYNIVGLSQGNLIGRGVVEFCVDGPPVKNFVSLGGP  125

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +S   CG   +C ++       +Y    Q+H  P+GY+K+P  M  YL + KFLP 
Sbjct  126   HAGTASVPLCGSGIFCIIVNKLLKSEIYTDYIQEHLAPSGYLKLPNAMSEYLGKCKFLPK  185

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE+ D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYY +  F   +  QQTD
Sbjct  186   LNNELPDERNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYQDDSFKSILSPQQTD  245

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LY +D  G +TLD+AG+VK+ S  G HL I+  +++ +++PY++
Sbjct  246   LYTEDWIGLRTLDEAGRVKYISVAGGHLGISTSDMKKHVVPYLQ  289



>ref|XP_007052292.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007052293.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007052294.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX96449.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX96450.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX96451.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma 
cacao]
Length=890

 Score =   271 bits (692),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 182/274 (66%), Gaps = 1/274 (0%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P++ +  FIVLHG+S  C + G   +T  +S     +G CVE+G+G   SW M + +Q +
Sbjct  23    PITQAIPFIVLHGISDKCSNRGITQFTELLSDWSDSQGYCVEIGDGAWDSWTMPLLEQTS  82

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPC  743
              AC K+  M EL  GY++V LSQGNM+GRG+IE CDG PPVK+FIS+ GP+AG +S   C
Sbjct  83    IACEKVKNMTELSEGYNIVGLSQGNMIGRGIIEFCDGGPPVKNFISLAGPHAGTASIPFC  142

Query  742   GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQS  563
             G    C L+       +Y+   Q+H  P+GY+KIPTD+  YL   +FLP +NNE+   ++
Sbjct  143   GSALICILLDSLIKSEIYSNYVQEHLAPSGYLKIPTDLTDYLKGCRFLPKLNNELNGTRN  202

Query  562   AERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFK  383
             +  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T LY++D  G K
Sbjct  203   STYKERFASLQNLVLIMFEDDTVLIPKETSWFGYYPDGSFDSVLPAQETKLYKEDWIGLK  262

Query  382   TLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             TLD+AGKVKF +  G HL I+  +++ YI+PY++
Sbjct  263   TLDEAGKVKFINVSGNHLQISKSDMKKYIVPYLE  296



>ref|XP_003517409.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max]
Length=367

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/286 (45%), Positives = 184/286 (64%), Gaps = 3/286 (1%)
 Frame = -2

Query  1129  IVLLAIFSS--IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
             +  L IF+S  + +S S  FIV+HG+   C + G   +T  +S     +G CVEVGNG  
Sbjct  6     LSFLFIFTSFIVSVSHSIPFIVIHGIGDQCSNRGVKKFTQQLSSFSGAEGYCVEVGNGSW  65

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW   + +Q    C K+ +M ELK GY++V LSQGN++GRGV+E C+G PPVK+FIS+ 
Sbjct  66    DSWFEPLKEQAEIVCEKVKQMKELKEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFISLA  125

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG   +C L        VY+   Q+H  P+GY+K+P  +  YL   +FL
Sbjct  126   GPHAGTASVPLCGSGIFCVLADTLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCRFL  185

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNEI D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q 
Sbjct  186   PVLNNEIPDKRNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFKPVLPPQS  245

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             T+LY +D  G +TLD+AGKV F S PG HL I+  +++ +++PY+K
Sbjct  246   TELYIEDWIGLRTLDEAGKVHFISVPGNHLGISQEDMKKHVVPYLK  291



>ref|XP_009342091.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
Length=353

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 183/284 (64%), Gaps = 1/284 (0%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +VL+    SIP S S  FIVLHG+   C + G   +T  +S    ++G C+E+G+G   S
Sbjct  6     VVLIVALISIPTSLSVPFIVLHGIGDQCSNKGVKQFTEQLSNFSGIEGYCIEIGDGTWDS  65

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGP  773
             W + + +Q    C K+    EL+ GY++V LSQGN++GRGV+E C DGPPVK+F+S+GGP
Sbjct  66    WFLPLEEQTRIVCDKVKEKEELRQGYNIVGLSQGNLIGRGVVEFCVDGPPVKNFVSLGGP  125

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +S   CG   +C ++       +Y    Q+H  P+GY+K+P  M  YL + KFLP 
Sbjct  126   HAGTASVPLCGSGIFCIIVNKLLKSEIYTDYIQEHLAPSGYLKLPNAMSEYLGKCKFLPK  185

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE+ D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYY +  F   +  Q+TD
Sbjct  186   LNNELPDERNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYQDDSFKSILSPQETD  245

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LY +D  G +TLD+AG+VK+ S  G HL I+  +++ +++PY++
Sbjct  246   LYTEDWIGLRTLDEAGRVKYISVAGGHLGISTSDMKKHVVPYLQ  289



>ref|XP_003552498.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max]
Length=330

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 179/271 (66%), Gaps = 1/271 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             + S  FIVLHG+   C+  G   +   +S      G C+E+GNG   SW   +  Q + A
Sbjct  17    AQSVPFIVLHGIGDACKHSGIRNFIKELSKWSGSPGYCLEIGNGSWDSWTKPLLKQTSIA  76

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGK  737
             C K+ +M +L  GY++V LSQGN++GRG+IE CDG PPVK+FIS+GGP+AG +S   CG 
Sbjct  77    CEKVKKMSDLGQGYNIVGLSQGNLIGRGIIEFCDGAPPVKNFISLGGPHAGTASIPLCGS  136

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
                C L+     +G+Y+  AQ++  P+GY+KIP D+ GY+   KFLP +NNEI + +++ 
Sbjct  137   ESLCTLIDVVLQLGIYSRFAQQNLAPSGYVKIPIDIAGYIRGCKFLPKLNNEIVNKRNST  196

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              ++RF+SL  L+LI+F  DTI++P+ ++ FGYYPNG     VPVQQT+LY  D  G + L
Sbjct  197   YRQRFASLQNLILIMFEQDTIVIPKETAWFGYYPNGALHPVVPVQQTELYIDDWIGLRAL  256

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             D+AGKVKF +  G HL I+  +++ YI+PY+
Sbjct  257   DEAGKVKFVNVSGDHLDISRSDMKTYIVPYL  287



>ref|XP_007210516.1| hypothetical protein PRUPE_ppa007666mg [Prunus persica]
 gb|EMJ11715.1| hypothetical protein PRUPE_ppa007666mg [Prunus persica]
Length=360

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 181/288 (63%), Gaps = 1/288 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             S  FI +LA   SIP S S  FIVLHG+   C + G   +T  +      +G C+EVG+G
Sbjct  7     SIDFIFILAFIISIPSSLSVPFIVLHGIGDQCSNRGVKQFTEELRNFAATEGYCIEVGDG  66

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFIS  785
                SW + + +Q    C K+  M EL+ GY++V LSQGN++GRGV+E C DGPPVK+FIS
Sbjct  67    TWDSWFLPLEEQTRIVCDKVKEMEELRQGYNIVGLSQGNLIGRGVVEFCIDGPPVKNFIS  126

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   CG   +C +        +Y+   Q H  P+GY+K+P  M  YL + K
Sbjct  127   LGGPHAGTASVPLCGSGIFCIIANQLLKSEIYSDYIQAHLAPSGYLKLPNAMADYLEKCK  186

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNE  D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYY +  F   +  
Sbjct  187   FLPKLNNERPDGKNSTLKERFSSLENLVLIMFEHDTVLIPKETSWFGYYQDDTFKSILSP  246

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +QT+LY++D  G + LD+AG+VK+ S PG HL I+  ++  +++PY+ 
Sbjct  247   RQTNLYKEDWIGLRALDEAGRVKYISVPGGHLGISTSDMMKHVVPYLN  294



>ref|XP_010529980.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Tarenaya hassleriana]
Length=290

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/288 (43%), Positives = 182/288 (63%), Gaps = 1/288 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             S    V   +F  IP+SSS  FI+LHG+   C + G   +T  +S +    G C+E+G+G
Sbjct  3     SAVVTVAALLFGLIPISSSLPFILLHGIGSQCSNGGVGNFTQLLSNLSGSPGFCLEIGDG  62

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFIS  785
                SW M +  Q + AC K+  + EL  GY++V+ SQGNMV RG+IE CD GPPV++++S
Sbjct  63    EDDSWFMPLPKQASVACEKVKLLKELSQGYNIVAQSQGNMVARGLIEFCDSGPPVRNYVS  122

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             + GP+AG +S   CG    C L      + +Y+   Q    P+GYIKIPTD+  YL  SK
Sbjct  123   LAGPHAGIASVPLCGSGEICRLADELIKLEIYSDYIQDRLAPSGYIKIPTDITSYLQHSK  182

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             +LP +NNE  D +++  K RF+SL  LVL++F  D +++P+ +S FG+YP+GDF R +  
Sbjct  183   YLPKLNNEKADDRNSTFKDRFTSLHNLVLVMFEDDKVLVPKETSWFGFYPDGDFHRLLSP  242

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             QQT LY++D  G KTLD AG+VKF S  G+H+ +   ++  Y++PY++
Sbjct  243   QQTKLYEEDWIGLKTLDDAGRVKFVSVAGEHIRMAHDDVLKYVVPYLR  290



>ref|XP_004229756.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Solanum 
lycopersicum]
Length=322

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/288 (45%), Positives = 176/288 (61%), Gaps = 3/288 (1%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F+  FI  L        + S  F+V HG+S  C + G  ++T  +S      G C+E+GN
Sbjct  3     FTLIFINFLLFTLHSITTYSLPFVVFHGISDKCSNGGITHFTELLSNWSGSSGHCIEIGN  62

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFI  788
             G   SW M    QV  AC+K+ +M EL  GY+M+ LSQGNMVGRGVIE C DGPPV++ I
Sbjct  63    GEWDSWFMPFAKQVDIACQKLKKMSELSEGYNMIGLSQGNMVGRGVIEFCDDGPPVRNLI  122

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+ GP+AG +S   CG   WC L      + +Y+   Q H  PAGYIKIPTD+  Y    
Sbjct  123   SLAGPHAGIASIPFCGSGIWCILEDSLLKLAIYSNFIQAHLAPAGYIKIPTDIANYRKGC  182

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             KFLP +NNE+   +++  K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G F+  +P
Sbjct  183   KFLPVLNNEVH--RNSTYKKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSFTTVLP  240

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
               +T LY +D  G K LD+AGKVK     G HL I+  E++  I+PY+
Sbjct  241   AHKTKLYTEDWIGLKKLDEAGKVKLLKVCGSHLEISTSEMKKNILPYL  288



>ref|XP_006280829.1| hypothetical protein CARUB_v10026804mg [Capsella rubella]
 gb|EOA13727.1| hypothetical protein CARUB_v10026804mg [Capsella rubella]
Length=316

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 190/302 (63%), Gaps = 8/302 (3%)
 Frame = -2

Query  1165  IMASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKG  986
             +  SC + +  F+ L+ +  S+P      FI+LHG+S  C +     +T  ++ +    G
Sbjct  7     VHVSCVAVAVAFLGLVHVSVSVP------FIMLHGISAQCSNARDANFTHLLTNLSGSPG  60

Query  985   SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-  809
              C+E+GNG+  SW+M +  Q   AC K+ +M EL  GY++V+ SQGN+V RG+IE CDG 
Sbjct  61    FCLEIGNGVGDSWLMPLTRQAEIACEKVKQMKELSQGYNIVARSQGNLVARGLIEFCDGG  120

Query  808   PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDM  629
             PPV ++IS+ GP+AG SS   CG   +C L        +Y+   Q H  P+GY+KIPTDM
Sbjct  121   PPVYNYISLAGPHAGISSVPMCGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTDM  180

Query  628   KGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNG  449
               YL  SK+LP +NNEI + +++  K RF+SL  LVL+ F+ D +I+P+ SS FG+YP+G
Sbjct  181   TKYLESSKYLPKLNNEIPNQRNSTYKDRFTSLHNLVLVKFQDDKVIVPKDSSWFGFYPDG  240

Query  448   DFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIP  269
             +F   +  QQT LY +D  G KTLD AGKVKF S  G+H+ +   ++  Y++PY++ + P
Sbjct  241   EFEPLLSAQQTKLYTEDWIGLKTLDVAGKVKFVSVAGEHIRMANEDVVKYVVPYLQ-NQP  299

Query  268   SS  263
             SS
Sbjct  300   SS  301



>ref|XP_010413568.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
 ref|XP_010413569.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=339

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/283 (45%), Positives = 181/283 (64%), Gaps = 2/283 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             IV L  F+ + ++SS  FIVLHG+   C + G   +T  +S     +G C+E+GNG   S
Sbjct  9     IVALIFFTFLSVASSVPFIVLHGIGDKCSNAGVKQFTELLSDWSGSQGYCLEIGNGSWDS  68

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
             W M + DQ +  C K+  M EL  GY +V LSQGNM+GR +IE C G PPVK+F+SV GP
Sbjct  69    WTMPLLDQTSAVCDKVKSMSELSDGYSIVGLSQGNMIGRALIEFCYGAPPVKNFVSVAGP  128

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+   +FLP 
Sbjct  129   HAGTASIPFCGATWICIMLDSMIKAEIYSDYLQEHLAPSGFLKIPTDIAGYMEGCRFLPK  188

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE    +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +P Q+T 
Sbjct  189   LNNEYP-VKNSTYKERFSSLETLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETK  247

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             LY +D  G KTLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  248   LYTEDWIGLKTLDEAGKVKFVNVSGNHLQISDADMKKHIVPYL  290



>gb|ABF93476.1| Palmitoyl protein thioesterase containing protein, expressed 
[Oryza sativa Japonica Group]
Length=321

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 175/274 (64%), Gaps = 1/274 (0%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P +S+  FIVLHG+   C + G   +T  ++      G C+E+G+G   SW+M +  Q  
Sbjct  20    PPASAVPFIVLHGIGDQCANHGVAKFTRLLADWSASHGYCLEIGSGTWDSWLMPLQKQAD  79

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPC  743
               C K+  M EL  GY++V LSQGN++GR V+E CD GPPVK+FIS+GGP+AG +S   C
Sbjct  80    IVCSKVKEMKELSNGYNIVGLSQGNLIGRAVVEFCDDGPPVKNFISLGGPHAGTASVPLC  139

Query  742   GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQS  563
             G   +C L      M +Y+   Q H  P+GY+KIPTD+  YL   +FLP +NNE+   ++
Sbjct  140   GSGIFCILADSLIKMEIYSDYVQAHLAPSGYMKIPTDISDYLKGCRFLPKLNNELPGERN  199

Query  562   AERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFK  383
             A  K RFSSL  LVLI+F+ D +++P+ ++ FGYYP+G F   +P Q+T LY +D  G K
Sbjct  200   ATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGGFDPVLPPQKTKLYMEDWIGLK  259

Query  382   TLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             TLD  G+VKF S PG HL I+  ++  YI+PY+K
Sbjct  260   TLDDEGRVKFVSVPGGHLGISKTDMMKYIVPYLK  293



>ref|XP_006649221.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Oryza brachyantha]
Length=320

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 176/272 (65%), Gaps = 1/272 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             +S+  FIVLHG+   C + G   +T  ++      G C+E+G+G   SW+M +  Q    
Sbjct  22    ASAVPFIVLHGIGDQCANHGVTKFTRLLADWSASDGYCLEIGSGTWDSWLMPLQKQADIV  81

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGK  737
             C K+  M EL  GY++V LSQGN++GR V+E CD GPPVK+FIS+GGP+AG +S   CG 
Sbjct  82    CTKVKEMKELSNGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFISLGGPHAGTASVPLCGS  141

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
               +C L      + +Y+   Q+H  P+GY+KIPTD++ Y    +FLP +NNEI   ++A 
Sbjct  142   GIFCMLADSLIKLEIYSDYVQEHLAPSGYMKIPTDIEDYFKGCRFLPKLNNEIPGERNAT  201

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RFS+L  LVLI+F+ D +++P+ ++ FGYYP+G F   +P Q+T LY +D  G KTL
Sbjct  202   YKERFSNLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPPQKTKLYIEDWIGLKTL  261

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             D  G+VKF S PG HL I+  ++R YI+PY+K
Sbjct  262   DDDGRVKFVSVPGGHLGISKSDMRKYIVPYLK  293



>gb|AAM65342.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=338

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/291 (45%), Positives = 188/291 (65%), Gaps = 6/291 (2%)
 Frame = -2

Query  1150  FSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEV  971
             F  +T  + L+  F+S  L+SS  FIVLHG+   C + G   +T  +S     +G C+E+
Sbjct  3     FLKATIIVALICNFAS--LASSVPFIVLHGIGDKCSNAGVTQFTELLSDWSGSQGYCLEI  60

Query  970   GNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKS  794
             GNG   SW M + DQ +  C K+  M EL  GY +V LSQGNM+GR +IE CDG PPVKS
Sbjct  61    GNGSWDSWTMPLLDQTSVVCEKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDGAPPVKS  120

Query  793   FISVGGPNAGHSSTIPCGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYL  617
             F+SV GP+AG +++IP     W C ++       +Y+   Q+H  P+G++KIPTD+ GY+
Sbjct  121   FVSVAGPHAG-TASIPFRGATWICIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYM  179

Query  616   AQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSR  437
                +FLP +NNE+   +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F  
Sbjct  180   EGCRFLPKLNNELP-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKT  238

Query  436   AVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              +P Q+T LY +D  G +TLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  239   ILPPQETKLYTEDWIGLRTLDEAGKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>ref|XP_009104259.1| PREDICTED: palmitoyl-protein thioesterase 1 [Brassica rapa]
Length=337

 Score =   256 bits (653),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/285 (46%), Positives = 184/285 (65%), Gaps = 3/285 (1%)
 Frame = -2

Query  1114  IFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGM  935
             I S I ++SS  FIVLHG+   C + G  ++T  +S     +G C+E+G G   SW M +
Sbjct  17    ICSFITIASSVPFIVLHGIGDKCSNSGVKHFTELLSDWSGSQGYCLEIGKGSWDSWTMPL  76

Query  934   NDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHS  758
              DQ A  C K+  M EL  GY +V LSQGNM+GR +IE CD  PPVKSF+SVGGP+AG +
Sbjct  77    LDQTAVVCDKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDDAPPVKSFVSVGGPHAGTA  136

Query  757   STIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEI  578
             S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+   +FLP +NNE+
Sbjct  137   SIPFCGVTWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYMEGCRFLPKLNNEL  196

Query  577   QDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKD  398
                +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +P Q+T LY +D
Sbjct  197   P-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTED  255

Query  397   TFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
               G +TLD+AGKVKF +  G HL I+  +++ +I+PY+  D PS+
Sbjct  256   WIGLRTLDEAGKVKFVNVSGNHLQISHEDMKKHIVPYLS-DKPST  299



>ref|XP_009334531.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
 ref|XP_009334538.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Pyrus x bretschneideri]
Length=353

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 182/284 (64%), Gaps = 1/284 (0%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V +    SIP S S  FIVLHG+   C + G   +T  +S    ++G C+E+G+G   S
Sbjct  6     VVFIVALISIPTSVSVPFIVLHGIGDQCSNKGVKQFTEQLSNFSGIEGYCIEIGDGTWDS  65

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGP  773
             W + + +Q    C K+    EL+ GY++V LSQGN++GRGV+E C DGPPVK+F+S+GGP
Sbjct  66    WFLPLEEQTRIVCDKVKEKEELRQGYNIVGLSQGNLIGRGVVEFCIDGPPVKNFVSLGGP  125

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +S   CG   +C ++       +Y    Q+H  P+GY+K+P  M  YL + KFLP 
Sbjct  126   HAGTASVPLCGSGIFCIIVNKLLKSEIYTDYIQEHLAPSGYLKLPNAMSEYLGKCKFLPK  185

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE+ D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYY +  F   +  Q+TD
Sbjct  186   LNNELPDERNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYQDDSFKSILSPQETD  245

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LY +D  G +TLD+AG+VK+ S  G HL I+  +++ +++PY++
Sbjct  246   LYTEDWIGLRTLDEAGRVKYISVAGGHLGISTSDMKKHVVPYLQ  289



>gb|AAK59537.1| putative palmitoyl-protein thioesterase precursor [Arabidopsis 
thaliana]
Length=338

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/290 (44%), Positives = 185/290 (64%), Gaps = 4/290 (1%)
 Frame = -2

Query  1150  FSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEV  971
             F  +T  + L+  F+S  L+SS  FIVLHG+   C + G   +T  +S     +G C+E+
Sbjct  3     FLKATIIVALICNFAS--LASSVPFIVLHGIGDKCSNAGVTQFTEFLSDWSGSQGYCLEI  60

Query  970   GNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKS  794
             GNG   SW M + DQ +  C K+  M EL  GY +V  SQGNM+GR +IE CDG PPVKS
Sbjct  61    GNGSWDSWTMPLLDQTSVVCEKVKSMPELSDGYSIVGPSQGNMIGRALIEFCDGAPPVKS  120

Query  793   FISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLA  614
             F+SV GP+AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+ 
Sbjct  121   FVSVAGPHAGTASIPFCGATWICIMLDSMIKAEIYSDYMQEHLAPSGFLKIPTDIAGYME  180

Query  613   QSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRA  434
               +FLP +NNE+   +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   
Sbjct  181   GCRFLPKLNNELP-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTI  239

Query  433   VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +P Q+T LY +D  G +TLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  240   LPPQETKLYTEDWIGLRTLDEAGKVKFVNVSGNHLQISHTDMKKHIVPYL  289



>gb|AAR92492.1| putative palmitoyl-protein thioesterase [Tropaeolum majus]
Length=339

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/281 (46%), Positives = 179/281 (64%), Gaps = 3/281 (1%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             + ++ S  FIVLHG+   C + G   +T  +      +G C+E+G+G   SW M + +Q 
Sbjct  22    VQVTHSVPFIVLHGIGDKCSNKGVTSFTELLGDWSGSQGYCIEIGDGSWDSWTMPLLEQT  81

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIP  746
             A AC K+  M EL  GY++V LSQGNMVGRG+IE CDG PPVK+FIS+ GP+AG +S   
Sbjct  82    AVACEKVKNMSELSEGYNIVGLSQGNMVGRGLIELCDGGPPVKNFISLAGPHAGTASIPF  141

Query  745   CGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQ  566
             CG    C  +     M +Y+   Q+H  P+GY+KIPTD+ GYL   +FLP +NNE     
Sbjct  142   CGSGWMCIFLDSLIKMEIYSNYIQEHLAPSGYLKIPTDINGYLQGCRFLPKVNNEA--PM  199

Query  565   SAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGF  386
             +   K RFS L  LVLI+F  DTI++P+ +S FGYYP+G F   +PVQQT LY +D  G 
Sbjct  200   NPIYKERFSKLENLVLIMFEQDTILIPKETSWFGYYPDGSFGSVLPVQQTPLYTEDWIGL  259

Query  385   KTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             KTLD+AG+VKF +  G HL I+  +++ +I+PY+    P++
Sbjct  260   KTLDEAGRVKFVNVTGNHLDISKSDMKKHIVPYLVEQAPTA  300



>ref|XP_006359249.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum tuberosum]
Length=356

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 182/287 (63%), Gaps = 1/287 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             S++ +  + I   +P+SSS  FIVLHG+   C   G   +T  +    + +G C+E+GNG
Sbjct  8     SSSLVFFILILIGVPISSSVPFIVLHGIGDQCSHRGVKRFTEELREWSKSEGYCLEIGNG  67

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFIS  785
                SW + + DQ    C K+ +M EL+ GY++V LSQGN++GR V+E C+G P VK+ IS
Sbjct  68    SWDSWFVTLEDQADVVCSKVKKMKELQDGYNIVGLSQGNLIGRAVVEYCEGGPQVKNLIS  127

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   CG   +C +  +     +Y+   Q H  P+GY+K+P ++ GY+   +
Sbjct  128   LGGPHAGTASVPLCGSGIFCIIADNLIKSEIYSDFVQAHLAPSGYLKLPNNIPGYMKSCR  187

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP  NNEI   +++  K+RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P 
Sbjct  188   FLPKFNNEIPSHRNSIYKKRFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFEPILPA  247

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             Q+T LY +D  G KTLD AGKVK+    G HL I+  +++ +++PY+
Sbjct  248   QKTQLYTEDWIGLKTLDDAGKVKYVKVAGNHLQISSSDMKKHVVPYL  294



>ref|XP_009591270.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=338

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/289 (45%), Positives = 179/289 (62%), Gaps = 5/289 (2%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             +F   FIV+L + S    + S  F+V HG+S  C + G  Y+T  +S      G C+E+G
Sbjct  2     NFMLIFIVILTLQSIT--TYSLPFVVFHGISDKCSNDGVSYFTELLSNWSGSPGYCIEIG  59

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSF  791
             NG   SW M    QV  AC K+  + EL  GYH++ LSQGNMVGRG++E C DGPPVK+ 
Sbjct  60    NGAWDSWFMPFTKQVHIACDKVKEIDELSEGYHIIGLSQGNMVGRGLVEFCSDGPPVKNL  119

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             IS+ GP+AG +S   CG    C L      + +Y+   Q+H  PAGYIKIPTD+  Y   
Sbjct  120   ISLAGPHAGIASVPFCGSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKG  179

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
              KFLP +NNE+    ++  K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G +S  +
Sbjct  180   CKFLPVVNNEVHG--NSTFKKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSWSTVL  237

Query  430   PVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             P  +T LY +D  G K LD+AGKVKF +  G HL I+  E++  I+PY+
Sbjct  238   PANETKLYTEDWIGLKILDEAGKVKFLNVSGSHLEISTSEMKKNILPYL  286



>ref|XP_008238428.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Prunus mume]
Length=360

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/288 (43%), Positives = 181/288 (63%), Gaps = 1/288 (0%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             S  FI +LA   SIP S S  FIVLHG+   C + G   +T  +      +G C+EVG+G
Sbjct  7     SIDFIFILAFIISIPSSLSVPFIVLHGIGDQCSNRGVKQFTEELRNFSATEGYCIEVGDG  66

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFIS  785
                SW + + +Q    C K+  M EL+ GY++V LSQGN++GRGV+E C  GPPVK+FIS
Sbjct  67    TWDSWFLPLEEQTRIVCDKVKEMEELRQGYNIVGLSQGNLIGRGVVEFCIGGPPVKNFIS  126

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   CG   +C +        +Y+   Q H  P+GY+K+P  M  YL + K
Sbjct  127   LGGPHAGTASVPLCGSGIFCIIANQLLKSEIYSDYIQAHLAPSGYLKLPNAMADYLEKCK  186

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNE  D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYY +  F   +  
Sbjct  187   FLPMLNNERPDGKNSTLKERFSSLENLVLIMFEHDTVLIPKETSWFGYYQDDTFKSILSP  246

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +QT+LY++D  G + LD+AG+VK+ S PG HL I+  +++ +++PY+ 
Sbjct  247   RQTNLYKEDWIGLRALDEAGRVKYISVPGGHLGISTSDMKKHVVPYLN  294



>ref|XP_010439999.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=305

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/288 (45%), Positives = 186/288 (65%), Gaps = 4/288 (1%)
 Frame = -2

Query  1132  FIVLLAIFS-SIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
              +V L +F  SIP+S S  F+V HG    C D      T ++  +    GSCVE+GNG +
Sbjct  10    LLVTLTLFCFSIPVSLSVPFVVFHGFLGACSDNKVSNLTKSLRNLSGYPGSCVEIGNGQV  69

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVG  779
              S +M +  Q + AC KI +M EL  GY++V+ SQGNMV RG+IE CD  PPV +++S+G
Sbjct  70    DSLLMPLRQQASIACEKIRQMPELSEGYNIVAESQGNMVARGLIEFCDNAPPVFNYVSLG  129

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG  + +P     +C ++   +   VYN + Q H GP+G++K+PT +  YL  SK+L
Sbjct  130   GPHAG-VAVVPNCTESFCSVLKALFPF-VYNDLVQDHAGPSGFVKVPTKITEYLEHSKYL  187

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNE    +++  K RF+SL  LVLI+F+ DT+++P+ +S FGYYP+G FS  +P Q+
Sbjct  188   PKLNNERPAEKNSTFKERFTSLKNLVLIMFQKDTVLIPRETSWFGYYPDGAFSPVLPHQK  247

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
             T LY +D  G KTLD AGKVKF S PG H+ IT  E+  Y++PY++ D
Sbjct  248   TKLYTEDWIGLKTLDDAGKVKFLSVPGGHIEITEEELLKYVVPYLQND  295



>gb|EMS55741.1| Palmitoyl-protein thioesterase 1 [Triticum urartu]
Length=322

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 177/273 (65%), Gaps = 9/273 (3%)
 Frame = -2

Query  1078  FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKIT  899
             F+VLHG+   C + G   +T  ++      G C+E+G+G   SW+M +  QV +      
Sbjct  28    FVVLHGIGDQCANRGVAEFTRLLADWSAADGHCLEIGSGTWDSWLMPLQQQVKE------  81

Query  898   RMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCG  722
              M EL GGY++V LSQGN++GR V++ CD GPPVK+FIS+ GP+AG +S   CG   +C 
Sbjct  82    -MKELSGGYNIVGLSQGNLIGRAVLQYCDDGPPVKNFISLAGPHAGTASVPLCGSGIFCV  140

Query  721   LMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRF  542
             +      + +Y+   Q H  P+GYIKIPTDM  YL   +FLP +NNEI   ++A  K RF
Sbjct  141   IADALIKLEIYSDYVQAHLAPSGYIKIPTDMDDYLKGCRFLPKLNNEIPGERNATYKERF  200

Query  541   SSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGK  362
             SSL  LVLI+F  D +++P+ +S FGYYP+G F   +P QQT LYQ+D  G KTLD+AG+
Sbjct  201   SSLENLVLIMFENDIVVIPRETSWFGYYPDGAFEPVLPPQQTKLYQEDWIGLKTLDEAGR  260

Query  361   VKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             VKF S PG HL I+  ++R +I+PY+K D PS+
Sbjct  261   VKFVSVPGGHLGISNSDMRKHIVPYLK-DKPSA  292



>ref|XP_010481340.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=314

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/289 (43%), Positives = 185/289 (64%), Gaps = 2/289 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +A+ + + +S S  F++ HG+S  C +     +T  ++ +    G CVE+GNG+  SW
Sbjct  13    VAVALLAMVHVSVSVPFVMFHGISAQCSNDRDANFTQLLTNLSGSPGFCVEIGNGVADSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
             +M +  Q   AC K+ +M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP+
Sbjct  73    LMPLTRQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG   +C L        +Y+   Q H  P+GY+KIPT+MK YL  SK+LP +
Sbjct  133   AGISSVPMCGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTNMKKYLESSKYLPRL  192

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNEI + +++  K RF+SL  LVL+ F+ D +I+P+ SS FG+YP+G+F   +  QQT L
Sbjct  193   NNEIPNQRNSTYKERFASLHNLVLVKFQDDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKL  252

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             Y +D  G KTLD AGKVKF S  G+H+ +   ++  +++PY++ + PSS
Sbjct  253   YTEDWIGLKTLDDAGKVKFVSVAGEHIRMADEDVVKHVVPYLQ-NKPSS  300



>ref|XP_010229362.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Brachypodium 
distachyon]
Length=307

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 175/275 (64%), Gaps = 4/275 (1%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             + +  F+VLHG+   C + G   +T  ++      G C+E+G G   SW+M +  Q    
Sbjct  23    AEAVPFVVLHGIGDQCANHGVAKFTRLLADWSAADGYCLEIGRGTWDSWVMPLQQQADII  82

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGK  737
             C K+  M EL GGY++V LSQGN++GR V++ CD GPPVK+FIS+GGP+AG +S   CG 
Sbjct  83    CNKVKEMKELSGGYNIVGLSQGNLIGRAVVQYCDDGPPVKNFISLGGPHAGTASVPLCGS  142

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
               +C ++     + +Y+   Q H  P+GY+KIPTDMK YL   +FLP +NNEI   ++A 
Sbjct  143   GIFCIIVDALIKLEIYSEYVQAHLAPSGYLKIPTDMKDYLEGCRFLPKLNNEIPGERNAT  202

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ---QTDLYQKDTFGF  386
              K RFSSL  LVLI+F  D +++P+ +S FGYYP+G F + +P Q   QT LY +D  G 
Sbjct  203   YKERFSSLENLVLIMFEDDIVLIPRETSWFGYYPDGAFDQVLPPQKDVQTKLYMEDWIGL  262

Query  385   KTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             K+LD  G+VKF S  G HL I+  ++R YI+PY+K
Sbjct  263   KSLDDGGRVKFVSVAGGHLGISDSDMRKYIVPYLK  297



>ref|XP_010494964.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=314

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/289 (44%), Positives = 184/289 (64%), Gaps = 2/289 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +A+ + + +S S  FI+ HG+S  C +     +T  ++ +    G CVE+GNG+  SW
Sbjct  13    VAVALLAMVHVSVSVPFIMFHGISAQCSNDRDANFTQLLTNLSGSPGFCVEIGNGVADSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
             +M +  Q   AC K+ +M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP+
Sbjct  73    LMPLTRQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG   +C L        +Y+   Q H  P+GY+KIPTDMK YL  SK+LP +
Sbjct  133   AGISSVPMCGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTDMKKYLESSKYLPRL  192

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNEI + +++  K RF+SL  LVL+ F+ D +I+P+ SS FG+YP+G+    +  QQT L
Sbjct  193   NNEIPNQRNSTYKERFASLHNLVLVKFQDDKVIVPKDSSWFGFYPDGESKPLLSAQQTKL  252

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             Y +D  G KTLD AGKVKF S  G+H+ +   ++  Y++PY++ + PSS
Sbjct  253   YTEDWIGLKTLDVAGKVKFVSVAGEHIRMADEDVVKYVVPYLQ-NKPSS  300



>ref|XP_009797089.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Nicotiana 
sylvestris]
Length=339

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 170/269 (63%), Gaps = 3/269 (1%)
 Frame = -2

Query  1087  STAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACR  908
             S  F+V HG+S  C + G  Y+T  +S      G C+E+GNG   SW M    QV  AC 
Sbjct  20    SLPFVVFHGISDKCSNEGVSYFTELLSNWSGSPGYCIEIGNGEWDSWFMPFTKQVDIACD  79

Query  907   KITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGPNAGHSSTIPCGKFP  731
             K+  + EL  GYH++ LSQGNMVGRG++E C DGPPVK+ IS+ GP+AG +S   CG   
Sbjct  80    KVKEIDELSEGYHIIGLSQGNMVGRGLVELCSDGPPVKNLISLAGPHAGIASVPFCGSGL  139

Query  730   WCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERK  551
              C L      + +Y+   Q+H  PAGYIKIPTD+  Y    KFLP +NNEI    ++  K
Sbjct  140   LCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEIHG--NSTFK  197

Query  550   RRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDK  371
             +RF+SL  LVLI+F  D I++P+ +S FGYYP+G +S  +P ++T LY +D  G K LD+
Sbjct  198   KRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKLYTEDWIGLKILDE  257

Query  370   AGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             AGKVKF +  G HL I+  E++  I+PY+
Sbjct  258   AGKVKFLNVSGNHLEISTSEMKKNILPYL  286



>ref|XP_002304295.2| hypothetical protein POPTR_0003s07790g [Populus trichocarpa]
 gb|EEE79274.2| hypothetical protein POPTR_0003s07790g [Populus trichocarpa]
Length=393

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 184/285 (65%), Gaps = 1/285 (0%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
              F+ ++ IF   P++ S  FIVLHG+   C++ G  ++T  ++ +    G C+E+G+G  
Sbjct  51    VFLFIVLIFVIRPVAHSLPFIVLHGIGDQCKNRGVKHFTEELTSISGSPGYCLEIGDGAW  110

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW M + +Q    C KI +M EL  GY++V LSQGN++GRGV+E CDG PPVK+FIS+G
Sbjct  111   DSWFMPLEEQTEIVCDKIKKMKELSKGYNIVGLSQGNLIGRGVVEFCDGGPPVKNFISLG  170

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG   +C L        +Y+   Q H  P+GY+K P D+  YL + +FL
Sbjct  171   GPHAGTASVPLCGSGIFCILADALMKSEIYSDYVQAHLAPSGYLKFPNDIPRYLEKCRFL  230

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNEI + ++   K RFSSL  LVLI+F  D+I++P+ +S FGYYP+G F   VP ++
Sbjct  231   PKLNNEIPEGRNTTYKERFSSLQNLVLIMFENDSILIPKETSWFGYYPDGAFKPIVPAKE  290

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             T LY +D  G +TLD+AG+V F +  G HL I+  +++ +++P++
Sbjct  291   TKLYTEDWIGLRTLDEAGRVHFVNVSGGHLGISKSDLKKHVVPFL  335



>gb|KHN42678.1| Palmitoyl-protein thioesterase 1 [Glycine soja]
Length=367

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 182/284 (64%), Gaps = 3/284 (1%)
 Frame = -2

Query  1123  LLAIFSS--IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
              L IF+S  + +S S  FIV+HG+   C + G   +T  +S     +G CVEVGNG   S
Sbjct  8     FLFIFTSFIVSVSHSIPFIVIHGIGDQCSNRGVKKFTQQLSSFSGAEGYCVEVGNGSWDS  67

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
             W   + +Q    C K+ +M ELK GY++V LSQGN++GRGV+E C+G PPVK+FIS+ GP
Sbjct  68    WFEPLKEQAEIVCEKVKQMKELKEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFISLAGP  127

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +S   CG   +C L        VY+   Q+H  P+GY+K+P  +  YL   +FLP 
Sbjct  128   HAGTASVPLCGSGIFCVLADTLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLENCRFLPV  187

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNEI D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q T+
Sbjct  188   LNNEIPDKRNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFKPVLPPQSTE  247

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LY +D  G +TLD+AGKV F S  G HL I+  +++ +++PY+K
Sbjct  248   LYIEDWIGLRTLDEAGKVHFISVLGNHLGISKEDMKKHVVPYLK  291



>ref|XP_010512353.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
 ref|XP_010512354.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=339

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/283 (45%), Positives = 181/283 (64%), Gaps = 2/283 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             IV L   S + ++SS  FIVLHG+   C + G   +T  +S     +G C+E+GNG   S
Sbjct  9     IVALIFCSYLSVASSVPFIVLHGIGDKCSNGGVKQFTELLSDWSGSQGYCLEIGNGSWDS  68

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
             W M + DQ +  C K+  M EL  GY +V LSQGNM+GR +IE CDG PPVK+F+SV GP
Sbjct  69    WTMPLLDQTSAVCDKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDGAPPVKNFVSVAGP  128

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +S   CG    C ++       +Y+   Q+H  P+G++KIPTD+ GY+   +FLP 
Sbjct  129   HAGTASIPFCGATWICIMLDSMIKAEIYSDYLQEHLAPSGFLKIPTDIAGYMEGCRFLPK  188

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE    +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +P Q+T 
Sbjct  189   LNNEYP-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETK  247

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             LY +D  G +TLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  248   LYTEDWIGLRTLDEAGKVKFVNVSGNHLQISQADMKKHIVPYL  290



>emb|CDY64763.1| BnaC06g42800D [Brassica napus]
Length=337

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 179/276 (65%), Gaps = 2/276 (1%)
 Frame = -2

Query  1108  SSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMND  929
             S I ++SS  FIVLHG+   C + G  ++T  +S     +G C+E+GNG   SW M + +
Sbjct  18    SFITIASSVPFIVLHGIGDKCSNSGVKHFTELLSDWSGSQGYCLEIGNGSWDSWTMPLLE  77

Query  928   QVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGPNAGHSST  752
             Q A  C K+  M EL  GY +V LSQGNM+GR +IE C D PPVKSF+SVGGP+AG +S 
Sbjct  78    QTAVVCEKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDDAPPVKSFVSVGGPHAGTASI  137

Query  751   IPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQD  572
               CG    C ++       +Y+   Q+H  P+G++KIPTD+ GYL   +FLP +NNE+  
Sbjct  138   PFCGVTWICIMLDSMIKTEIYSDYMQEHLAPSGFLKIPTDIAGYLEGCRFLPKLNNELP-  196

Query  571   AQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTF  392
              +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +P Q+T LY +D  
Sbjct  197   VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILPPQETKLYTEDWI  256

Query  391   GFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             G +TLD+AGKV F +  G HL I+  +++ +I+PY+
Sbjct  257   GLRTLDEAGKVMFVNVSGNHLQISHEDMKKHIVPYL  292



>gb|EMT04362.1| Palmitoyl-protein thioesterase 1 [Aegilops tauschii]
Length=322

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 176/272 (65%), Gaps = 9/272 (3%)
 Frame = -2

Query  1078  FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKIT  899
             F+VLHG+   C + G   +T  ++      G C+E+G+G   SW+M + +QV +      
Sbjct  28    FVVLHGIGDQCANRGVAEFTRLLADWSAADGHCLEIGSGTWDSWLMPLQEQVKE------  81

Query  898   RMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCG  722
              M EL GGY++V LSQGN++GR V++ CD GPPVK+FIS+ GP+AG +S   CG   +C 
Sbjct  82    -MKELSGGYNIVGLSQGNLIGRAVLQYCDDGPPVKNFISLAGPHAGTASVPLCGSGIFCV  140

Query  721   LMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRF  542
             +      + +Y+   Q H  P+GYIKIPTDM  YL   +FLP +NNEI   ++A  K RF
Sbjct  141   IADALIKLEIYSDYVQAHLAPSGYIKIPTDMDDYLKGCRFLPKLNNEIPGERNATYKERF  200

Query  541   SSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGK  362
             SSL  LVLI+F  D +++P+ +S FGYYP+G F   +P QQT LYQ+D  G K LD+AG+
Sbjct  201   SSLENLVLIMFENDIVVIPRETSWFGYYPDGAFEPVLPPQQTKLYQEDWIGLKALDEAGR  260

Query  361   VKFFSCPGQHLVITPPEIRMYIIPYMK*DIPS  266
             VKF S PG HL I+  ++R +I+PY+K D PS
Sbjct  261   VKFVSVPGGHLGISNSDMRKHIVPYLK-DKPS  291



>ref|XP_003611348.1| Palmitoyl-protein thioesterase [Medicago truncatula]
 gb|AES94306.1| palmitoyl protein thioesterase family protein [Medicago truncatula]
Length=327

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 177/269 (66%), Gaps = 1/269 (0%)
 Frame = -2

Query  1087  STAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACR  908
             S  FIVLHG+   C + G   +T  +     VKG CVEVGNG   SW M + +Q    C+
Sbjct  27    SIPFIVLHGIGDQCSNRGVKSFTQELITYSGVKGFCVEVGNGSWDSWFMPLKEQTDVVCQ  86

Query  907   KITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFP  731
             K+ +M ELKGGY++V LSQGN++GRGV+E C+G PPVK+FIS+ GP+AG +S   CG   
Sbjct  87    KVKKMKELKGGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFISLAGPHAGTASVPLCGTGI  146

Query  730   WCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERK  551
             +C L  +     VY+   Q+H  P+GY+K+P  +  YL   ++LP +NNE    +++  K
Sbjct  147   FCVLADNLIKGEVYSNYIQEHLAPSGYLKLPNAIPKYLENCRYLPKLNNEKPGQRNSTYK  206

Query  550   RRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDK  371
              RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T LY +D  G KTLD+
Sbjct  207   ERFSSLENLVLIMFEQDTVLIPRETSWFGYYPDGFFKPVLPPQETKLYTEDWIGLKTLDE  266

Query  370   AGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             AG+V F S PG+HL I+  +++ +++PY+
Sbjct  267   AGRVHFISVPGKHLGISEADMKKHVVPYL  295



>ref|XP_009591269.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=339

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/290 (45%), Positives = 180/290 (62%), Gaps = 6/290 (2%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             +F   FIV+L + S    + S  F+V HG+S  C + G  Y+T  +S      G C+E+G
Sbjct  2     NFMLIFIVILTLQSIT--TYSLPFVVFHGISDKCSNDGVSYFTELLSNWSGSPGYCIEIG  59

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSF  791
             NG   SW M    QV  AC K+  + EL  GYH++ LSQGNMVGRG++E C DGPPVK+ 
Sbjct  60    NGAWDSWFMPFTKQVHIACDKVKEIDELSEGYHIIGLSQGNMVGRGLVEFCSDGPPVKNL  119

Query  790   ISVGGPNAGHSSTIPCGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLA  614
             IS+ GP+AG +S   CG+    C L      + +Y+   Q+H  PAGYIKIPTD+  Y  
Sbjct  120   ISLAGPHAGIASVPFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRK  179

Query  613   QSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRA  434
               KFLP +NNE+    ++  K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G +S  
Sbjct  180   GCKFLPVVNNEVHG--NSTFKKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSWSTV  237

Query  433   VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +P  +T LY +D  G K LD+AGKVKF +  G HL I+  E++  I+PY+
Sbjct  238   LPANETKLYTEDWIGLKILDEAGKVKFLNVSGSHLEISTSEMKKNILPYL  287



>emb|CDP10012.1| unnamed protein product [Coffea canephora]
Length=389

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 191/317 (60%), Gaps = 21/317 (7%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             MA   +   ++I +      IPLSSS  F+VLHG+   C + G  ++T  ++      G 
Sbjct  1     MARYLASVVSYISITIAVYLIPLSSSLPFVVLHGIGDQCSNKGMKHFTEELTEWSNSTGY  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-P  806
             C+E+G+G   SW M + +Q    C K+ +M +L+ GY++V LSQGN++GR V+E CDG P
Sbjct  61    CIEIGDGAWDSWFMPLEEQTEVVCDKVKQMKDLQNGYNIVGLSQGNLIGRAVVEYCDGGP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQ----------------  674
             PVK+F+S+GGP+AG +S   CG    C +       G+Y+   Q                
Sbjct  121   PVKNFVSLGGPHAGIASVPLCGSGIMCIIADSLIKTGIYSDYIQACISLCLSLSHTHTHT  180

Query  673   ----KHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFR  506
                 +H  P+GY+K+P ++ GYL + +FLP +NNEI   +++  K RFSSL  LVLI+F 
Sbjct  181   FWSLEHLAPSGYLKLPNNIAGYLEKCRFLPKLNNEIPGERNSTYKARFSSLQNLVLIMFE  240

Query  505   ADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLV  326
              DT+++P+ +S FGYYP+G F+  +  QQT LY +D  G KTLD AG+VK+ +  G HL 
Sbjct  241   HDTVLVPKETSWFGYYPDGAFNPVLAPQQTQLYIEDWIGLKTLDDAGRVKYVTVSGNHLG  300

Query  325   ITPPEIRMYIIPYMK*D  275
             I+ P+++ Y++PY++ D
Sbjct  301   ISKPDMKKYVVPYLEDD  317



>ref|XP_006291453.1| hypothetical protein CARUB_v10017590mg [Capsella rubella]
 gb|EOA24351.1| hypothetical protein CARUB_v10017590mg [Capsella rubella]
Length=338

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 181/288 (63%), Gaps = 2/288 (1%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F    I++  I + + ++SS  FIVLHG+   C + G   +T  +      +G C+E+GN
Sbjct  3     FLKAAIIVALICTFLTVASSVPFIVLHGIGDKCSNAGVKQFTELLGDWSGSQGYCLEIGN  62

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFI  788
             G   SW M + DQ +  C K+  M EL  GY +V LSQGNM+GR +IE CDG PPVK+F+
Sbjct  63    GSWDSWTMPLLDQTSLVCDKVKSMPELSDGYSIVGLSQGNMIGRALIEFCDGAPPVKNFV  122

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             SV GP+AG +S   CG    C ++       +Y    Q+H  P+G++KIPTD+ GY+   
Sbjct  123   SVAGPHAGTASIPFCGATWICIMLDSMIKAEIYGDYLQEHLAPSGFLKIPTDIAGYMEGC  182

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             +FLP +NNE    +++  K RFSSL  LVLI+F  DTI++P+ +S FGYYP+G F   +P
Sbjct  183   RFLPKLNNEYS-VKNSTYKERFSSLENLVLIMFEHDTILIPKETSWFGYYPDGSFKTILP  241

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              Q+T LY +D  G +TLD+AGKVKF +  G HL I+  +++ +I+PY+
Sbjct  242   PQETKLYTEDWIGLRTLDEAGKVKFVNVSGNHLQISDTDMKKHIVPYL  289



>ref|XP_004158129.1| PREDICTED: LOW QUALITY PROTEIN: palmitoyl-protein thioesterase 
1-like [Cucumis sativus]
Length=316

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 173/270 (64%), Gaps = 1/270 (0%)
 Frame = -2

Query  1087  STAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACR  908
             S  FIVLHG+   C + G   +T  +S     KG C+E+GNG   SW M +  Q    C 
Sbjct  24    SLPFIVLHGIGDKCSNKGMKKFTKYLSDNSGAKGYCIEIGNGXWDSWFMTLEAQSQIVCN  83

Query  907   KITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFP  731
             K+ +M +LK G++ V LSQGN++GR V+E CDG PPV++FIS+GGP+AG SS   CG   
Sbjct  84    KVKKMKDLKEGFNFVGLSQGNLIGRAVVEFCDGAPPVQNFISLGGPHAGISSVPLCGSGI  143

Query  730   WCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERK  551
             WC L      + +Y+ + Q    P+G+IK+P D+  YL   KFLP +NNE  DA+++  K
Sbjct  144   WCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPDYLEHCKFLPKLNNERPDARNSTYK  203

Query  550   RRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDK  371
              RFSSL  LVLI+F  DT+++P+ +S FGYYP+G+F   +P QQT LY +D  G ++LD+
Sbjct  204   ERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGLRSLDE  263

Query  370   AGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              G+VKF    G HL I+  + + YI+PY++
Sbjct  264   GGRVKFIKVAGGHLGISYSDAKKYIVPYLE  293



>ref|XP_006398427.1| hypothetical protein EUTSA_v10000967mg [Eutrema salsugineum]
 gb|ESQ39880.1| hypothetical protein EUTSA_v10000967mg [Eutrema salsugineum]
Length=314

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 178/278 (64%), Gaps = 2/278 (1%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             S S  FI+LHG++  C D     +T  +S +    G C+EVGNG   SW M +  Q   A
Sbjct  24    SVSVPFILLHGIAAECSDGKEANFTQLLSNLSGSPGFCLEVGNGERDSWFMPLTKQAEIA  83

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGK  737
             C K+ +M EL+ GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP+AG SS   CG 
Sbjct  84    CEKVKQMKELRQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSVPMCGS  143

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
                C +        +Y+   Q+H  P+GY+KIPT++  YL +SK+LP +NNEI D +++ 
Sbjct  144   GLLCEIADELIKADIYSDFIQEHLAPSGYLKIPTELTKYLERSKYLPKLNNEIPDQRNST  203

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RF+SL  LVL+ F+ D +I+P+ SS FG+YP+G+F   +  QQT LY +D  G KTL
Sbjct  204   YKDRFTSLHNLVLVKFQDDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGLKTL  263

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             D AGKV+F S  G+H+ +   ++  YI+PY++ + PSS
Sbjct  264   DAAGKVRFVSVAGEHIKMANLDVVKYIVPYLQ-NQPSS  300



>ref|XP_008437041.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Cucumis 
melo]
Length=315

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 174/272 (64%), Gaps = 1/272 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             S S  FIVLHG+   C + G   +T  +S     KG C+E+GNG   SW M +  Q    
Sbjct  22    SHSLPFIVLHGIGDKCSNKGMRKFTKYLSDNSGSKGYCIEIGNGGWDSWFMTLEAQSQIV  81

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGK  737
             C K+ +M +LK G++ V LSQGN++GR V+E CDG PPV++FIS+GGP+AG SS   CG 
Sbjct  82    CNKVKKMKDLKEGFNFVGLSQGNLIGRAVVEFCDGAPPVQNFISLGGPHAGISSVPLCGS  141

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
               WC L      + +Y+ + Q    P+G+IK+P D+  YL   KFLP +NNE  DA+++ 
Sbjct  142   GIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDARNST  201

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G+F   +P QQT LY +D  G ++L
Sbjct  202   YKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGLRSL  261

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             D+ G+VKF    G HL I+  + + YI+PY++
Sbjct  262   DEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  293



>ref|XP_006368987.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
 gb|ERP65556.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
Length=341

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/285 (42%), Positives = 178/285 (62%), Gaps = 1/285 (0%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
              F+ ++ IF   P++ S  FIVLHG+   C++ G   +T  ++      G C+E+G+G  
Sbjct  9     AFLFVVFIFVIDPVAHSLPFIVLHGIGDQCKNRGVKQFTEELTNFSGSPGYCLEIGDGTW  68

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW M + +Q    C K+ +M EL  GY +V LSQGN++GRGV+E CDG PPVK+FIS+G
Sbjct  69    DSWFMPLEEQTEIVCDKVKKMKELSKGYSIVGLSQGNLIGRGVVEFCDGGPPVKNFISLG  128

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG   +C L        +Y+   Q H  P+GY+K P D+  Y+ + +FL
Sbjct  129   GPHAGTASVPLCGSGIFCKLADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFL  188

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNEI + ++   K RFSSL  LVLI+F  D +++P+ +S FGYYP+G F   VP  Q
Sbjct  189   PKLNNEIPEERNTTYKERFSSLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPAHQ  248

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             T LY +D  G K LD+AG+V F +  G HL I+  +++ +++P++
Sbjct  249   TALYTEDWIGLKALDEAGRVHFVNVSGGHLGISESDMKKHVVPFL  293



>ref|XP_006662607.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Oryza brachyantha]
Length=353

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 171/262 (65%), Gaps = 1/262 (0%)
 Frame = -2

Query  1063  GVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGEL  884
             G+   CQ+ G   +T  +      KG C+E+G G   SW+M + +Q    C+K+ +M EL
Sbjct  77    GIGDQCQNGGMASFTDMLGEWSGSKGYCIEIGRGAWDSWLMPLQEQADTVCKKVKKMKEL  136

Query  883   KGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHY  707
             + GY++V LSQGN++GR VIE CD  PPVK+FIS+GGP+AG +S   CG    C L+   
Sbjct  137   RKGYNIVGLSQGNLIGRAVIEYCDDAPPVKNFISIGGPHAGTASVPLCGSGIVCVLIDAL  196

Query  706   YGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTM  527
               + +Y+   Q H  P+GY+KIPTDM  YL   KFLP +NNEI   ++A  K+RFSSL  
Sbjct  197   IKLEIYSNYVQAHLAPSGYLKIPTDMTDYLKGCKFLPKLNNEIPSERNATYKQRFSSLEN  256

Query  526   LVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFS  347
             LVLI+F  D +++P+ ++ FGYYP+G F    P Q+T LY +D  G KTLD+AG+V+F S
Sbjct  257   LVLIMFEDDAVLIPRETAWFGYYPDGSFGPVQPPQKTKLYIEDWIGLKTLDEAGRVQFVS  316

Query  346   CPGQHLVITPPEIRMYIIPYMK  281
              PG HL I+  +++ YI+PY+K
Sbjct  317   VPGGHLSISRSDMKKYIVPYLK  338



>emb|CBI25849.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   249 bits (637),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 171/264 (65%), Gaps = 1/264 (0%)
 Frame = -2

Query  1069  LHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMG  890
             + G+   C + G   +T  +      +G CVEVG+G   SW + M +Q    C K+  M 
Sbjct  1     MAGIGDQCSNKGVKQFTELLRNFSNSEGYCVEVGDGTWDSWFIPMKEQAEIVCNKVKEME  60

Query  889   ELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMG  713
             EL+ GY++V LSQGN++GRGV+E CDG PPVK+F+S+ GP+AG +S   CG   +C +  
Sbjct  61    ELRDGYNIVGLSQGNLIGRGVVEFCDGGPPVKNFVSLAGPHAGTASVPLCGSGVFCIIAD  120

Query  712   HYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSL  533
             +     +Y+   Q H  P+GY+K+P D+  YL + +FLP +NNE+ D +++  K RFSSL
Sbjct  121   NLIKSQIYSDYVQTHLAPSGYLKLPNDIPKYLEKCRFLPKLNNELPDERNSTYKERFSSL  180

Query  532   TMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKF  353
               LVLI+F  DT+++P+ +S FGYYP+G F   +P QQT LY +D  G KTLD AG+VK+
Sbjct  181   ENLVLIMFEQDTVLIPKETSWFGYYPDGAFEPVLPPQQTKLYTEDWIGLKTLDDAGRVKY  240

Query  352   FSCPGQHLVITPPEIRMYIIPYMK  281
              S PG HL I+  +++ Y++PY++
Sbjct  241   ISVPGNHLGISHSDMKQYVVPYLE  264



>emb|CDY64683.1| BnaA06g40130D [Brassica napus]
Length=312

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 183/290 (63%), Gaps = 5/290 (2%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V LA+   + +S S  FIVLHG++  C +     +T  +S      G C+EVGNG + S
Sbjct  12    VVFLAL---VQVSVSVPFIVLHGIAAACSEGKEANFTQLLSNFSGSPGFCLEVGNGELDS  68

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
             W M +  Q   AC K+ +M EL+ GY++V  SQGN+V RG+IE CDG PPV +++S+ GP
Sbjct  69    WFMPLAKQAEIACEKVKQMKELRQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYVSLAGP  128

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG SS   CG   WC +        +Y+   Q H  P+GY+KIPT+MK YL  SK+LP 
Sbjct  129   HAGISSVPMCGSGLWCEIADELIKSDIYSDFIQDHLAPSGYLKIPTEMKKYLESSKYLPK  188

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNEI + +++  K RF+SL  LVLI F  D +I+P+ SS FG+YP+GDF   + V++T 
Sbjct  189   LNNEIPNQRNSTYKERFASLHNLVLIKFEDDKVIVPKDSSWFGFYPDGDFGPLLTVRETK  248

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             L+Q+D  G K L   GKV+F S  G HL I+  +I  Y++P+++ + PSS
Sbjct  249   LFQEDWIGLKPLIDTGKVEFVSIDGAHLKISNIDIVKYVVPHLQ-NRPSS  297



>emb|CDX77758.1| BnaC07g20120D [Brassica napus]
Length=312

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/288 (42%), Positives = 180/288 (63%), Gaps = 7/288 (2%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             +  F++L+ +  S+P      FIVLHG++  C +     +T  +S      G C+EVGNG
Sbjct  11    AVVFLILVQVSVSVP------FIVLHGIAAACSEGKEANFTQLLSNFSGSPGFCLEVGNG  64

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFIS  785
              + SW M +  Q   AC K+ +M EL+ GY++V  SQGN+V RG+IE CDG PPV +++S
Sbjct  65    ELDSWFMPLAKQAEIACEKVKQMKELRQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYVS  124

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             + GP+AG SS   CG   WC +        +Y+   Q H  P+GY+KIPT+MK YL  SK
Sbjct  125   LAGPHAGISSVPMCGSGLWCEIADELIKSDIYSDFIQDHLAPSGYLKIPTEMKKYLESSK  184

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             +LP +NNEI   +++  K RF+SL  LVLI+F  D +I+P+ SS FG+YP+GDF   + V
Sbjct  185   YLPKLNNEIPGQRNSTYKERFASLHNLVLIMFEDDKVIVPKDSSWFGFYPDGDFGPLLTV  244

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             ++T L+++D  G K L   GKV+F S  G HL ++  +I  Y++PY++
Sbjct  245   RETKLFKEDWIGLKPLVDTGKVEFVSIDGAHLRMSNVDIVKYVVPYLQ  292



>ref|XP_010481339.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X2 [Camelina 
sativa]
Length=305

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 180/283 (64%), Gaps = 1/283 (0%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V++A  + + +S S  FI+LHG+   C D  +  +TL +  +    G CVE+GNG+ +S 
Sbjct  12    VVVAFLAMVDVSVSVPFIMLHGIIAGCSDNTNANFTLLLRNLSGSPGFCVEIGNGVFTSM  71

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
              M +  Q   AC K+ +M EL  GY++V+ SQGN+V RG+IE CDG PPV ++IS+ GP+
Sbjct  72    FMPLAHQAEIACEKVKQMKELSKGYNIVARSQGNLVARGLIEFCDGGPPVYNYISLAGPH  131

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG S    C   P+C         G+Y+  AQ +  P+GY KIPTD+  YL  SK+LP +
Sbjct  132   AGISFIPMCNSSPYCKKFDEIIKRGLYSDFAQNNAAPSGYYKIPTDITMYLESSKYLPKL  191

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             +NEI + +++  K RF+SL  LVL+ F+ D +I+P  S+ FG+YP+GDF   +P QQT L
Sbjct  192   SNEIPNQRNSTYKDRFASLHNLVLVKFQDDKVIVPIESTWFGFYPDGDFKHVLPAQQTKL  251

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             Y +D  G KTLD AGKVKF S PG HL +   ++  +++PY+K
Sbjct  252   YTEDWIGLKTLDTAGKVKFVSVPGGHLDMAYQDVVTHVVPYLK  294



>ref|XP_009797088.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Nicotiana 
sylvestris]
Length=340

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 171/270 (63%), Gaps = 4/270 (1%)
 Frame = -2

Query  1087  STAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACR  908
             S  F+V HG+S  C + G  Y+T  +S      G C+E+GNG   SW M    QV  AC 
Sbjct  20    SLPFVVFHGISDKCSNEGVSYFTELLSNWSGSPGYCIEIGNGEWDSWFMPFTKQVDIACD  79

Query  907   KITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGPNAGHSSTIPCGKFP  731
             K+  + EL  GYH++ LSQGNMVGRG++E C DGPPVK+ IS+ GP+AG +S   CG+  
Sbjct  80    KVKEIDELSEGYHIIGLSQGNMVGRGLVELCSDGPPVKNLISLAGPHAGIASVPFCGQSG  139

Query  730   W-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAER  554
               C L      + +Y+   Q+H  PAGYIKIPTD+  Y    KFLP +NNEI    ++  
Sbjct  140   LLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEIHG--NSTF  197

Query  553   KRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLD  374
             K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G +S  +P ++T LY +D  G K LD
Sbjct  198   KKRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKLYTEDWIGLKILD  257

Query  373   KAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +AGKVKF +  G HL I+  E++  I+PY+
Sbjct  258   EAGKVKFLNVSGNHLEISTSEMKKNILPYL  287



>ref|XP_006368986.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
 gb|ABK93872.1| unknown [Populus trichocarpa]
 gb|ERP65555.1| hypothetical protein POPTR_0001s15440g [Populus trichocarpa]
Length=366

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/285 (42%), Positives = 178/285 (62%), Gaps = 1/285 (0%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
              F+ ++ IF   P++ S  FIVLHG+   C++ G   +T  ++      G C+E+G+G  
Sbjct  9     AFLFVVFIFVIDPVAHSLPFIVLHGIGDQCKNRGVKQFTEELTNFSGSPGYCLEIGDGTW  68

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW M + +Q    C K+ +M EL  GY +V LSQGN++GRGV+E CDG PPVK+FIS+G
Sbjct  69    DSWFMPLEEQTEIVCDKVKKMKELSKGYSIVGLSQGNLIGRGVVEFCDGGPPVKNFISLG  128

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG   +C L        +Y+   Q H  P+GY+K P D+  Y+ + +FL
Sbjct  129   GPHAGTASVPLCGSGIFCKLADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFL  188

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNEI + ++   K RFSSL  LVLI+F  D +++P+ +S FGYYP+G F   VP  Q
Sbjct  189   PKLNNEIPEERNTTYKERFSSLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPAHQ  248

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             T LY +D  G K LD+AG+V F +  G HL I+  +++ +++P++
Sbjct  249   TALYTEDWIGLKALDEAGRVHFVNVSGGHLGISESDMKKHVVPFL  293



>ref|XP_004152390.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Cucumis sativus]
Length=316

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 173/270 (64%), Gaps = 1/270 (0%)
 Frame = -2

Query  1087  STAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACR  908
             S  FIVLHG+   C + G   +T  +S     KG C+E+GNG   SW M +  Q    C 
Sbjct  24    SLPFIVLHGIGDKCSNKGMKKFTKYLSDNSGAKGYCIEIGNGGWDSWFMTLEAQSQIVCN  83

Query  907   KITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFP  731
             K+ +M +LK G++ V LSQGN++GR V+E CDG PPV++FIS+GGP+AG SS   CG   
Sbjct  84    KVKKMKDLKEGFNFVGLSQGNLIGRAVVEFCDGAPPVQNFISLGGPHAGISSVPLCGSGI  143

Query  730   WCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERK  551
             WC L      + +Y+ + Q    P+G+IK+P D+  YL   KFLP +NNE  DA+++  K
Sbjct  144   WCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPDYLEHCKFLPKLNNERPDARNSTYK  203

Query  550   RRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDK  371
              RFSSL  LVLI+F  DT+++P+ +S FGYYP+G+F   +P QQT LY +D  G ++LD+
Sbjct  204   ERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGLRSLDE  263

Query  370   AGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              G+VKF    G HL I+  + + YI+PY++
Sbjct  264   GGRVKFIKVAGGHLGISYSDAKKYIVPYLE  293



>ref|XP_010434661.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=309

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 182/296 (61%), Gaps = 4/296 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLA--IFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVK  989
             M  CF  S     ++A  +FS +P+S+S  FI+ HG+   C   G   +T  +S +    
Sbjct  1     MERCFRRSVLLHTVIAAVLFSFVPVSTSIPFILFHGIGDKCSG-GVSSFTQLLSNLSGSP  59

Query  988   GSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-  812
             GSC+E+GNG   SW M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD 
Sbjct  60    GSCLEIGNGENDSWFMPLTKQTSLACEKVKQMKELSQGYNIVAESQGNLVARGLIEFCDN  119

Query  811   GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTD  632
              PPV +++S+GGP+AG ++   C   P C ++       +YN   Q H  P+G++KIP  
Sbjct  120   APPVINYVSLGGPHAGIAAIPKCASGPLCAMVEALLKSAIYNDFIQDHLAPSGFVKIPGQ  179

Query  631   MKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPN  452
             +  YLA SK+LP +NNE  D +++  K RF+SL  LVL++F+ DT ++P+ ++ FGYY +
Sbjct  180   ISKYLAHSKYLPKLNNERPDERNSTFKDRFASLHNLVLVMFQKDTTLIPKETAWFGYYQD  239

Query  451   GDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             G     +  QQT LY++D  G K LD AGKVKF S  G HL I+  E+  Y++PY+
Sbjct  240   GGLDTLLSTQQTKLYKEDWIGLKALDVAGKVKFESVLGDHLDISDEEVEEYVVPYL  295



>gb|EYU31902.1| hypothetical protein MIMGU_mgv1a010171mg [Erythranthe guttata]
Length=320

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 178/283 (63%), Gaps = 3/283 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             I L A+F     ++S  F+V HG+S  C++ G  ++   +S     +G C+E+GNG+  S
Sbjct  14    ISLAALFLFPTTANSIPFVVFHGISDSCRNRGVTHFITVLSNWSGSEGYCIEIGNGVWDS  73

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGP  773
             W M    Q A AC K+ +M EL  GY+++ LSQGN+VGRGV+E CD GPPV++ IS+ GP
Sbjct  74    WTMPFMQQTAIACEKVKQMSELSDGYNIIGLSQGNLVGRGVVELCDGGPPVRNLISLAGP  133

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG ++   CG    C L+     + +Y    Q+H  PA YIKIPTD+  Y    KFLP 
Sbjct  134   HAGIAAVPLCGSGLVCILVDFLIELAIYGNYVQEHLAPASYIKIPTDLDQYKKGCKFLPK  193

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             INNEI   +++  K+RFSSL  LVLI+F  D I++P+ +S FGY+P+G +   +P  +T 
Sbjct  194   INNEIH--KNSTYKKRFSSLDNLVLIMFENDVILVPKETSWFGYFPDGSWETILPANETT  251

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             LY +D  G K LD+AGKVK+ +  G HL I+  E+  Y++PY+
Sbjct  252   LYTEDWIGLKALDEAGKVKYVNVSGGHLDISYDEMEKYVLPYL  294



>ref|XP_010439998.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=305

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 179/295 (61%), Gaps = 3/295 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M      S   + L   F SIP+  S  F+V HG++  C +      T  ++      GS
Sbjct  1     MEKSLQRSVLLVTLSLFFFSIPVLLSVPFVVFHGIAGECSNDEMTNLTKFLNNYSSSPGS  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             CVE+GNGL+ S  M +  Q + AC KI +M EL  GY++V +SQGN+V RG+IE CD  P
Sbjct  61    CVEIGNGLVDSLYMPLTQQASIACEKIKQMPELSDGYNIVGVSQGNLVARGLIEFCDNAP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PV +++S+GGP+AG  S +P      C L+  Y    VYN   Q H  P+G  KIPTD+K
Sbjct  121   PVFNYVSLGGPHAG-LSYLPKFNCSVCELLDIYLS-DVYNNFVQDHAAPSGCFKIPTDIK  178

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL  SK+LP +NNE    +++  K RF+SL  LVLI+F  D ++ P+ SS FGYYP+G 
Sbjct  179   NYLEHSKYLPKLNNERPGEKNSTYKDRFTSLHNLVLIMFEKDNVLTPKESSWFGYYPDGA  238

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             ++  +P Q+T LY KD  G KTLD AGKVKF S PG H+ IT  E+  Y++PY++
Sbjct  239   YTPILPPQKTKLYTKDWIGLKTLDDAGKVKFVSVPGGHIEITKEELVKYVVPYLQ  293



>gb|ABK93080.1| unknown [Populus trichocarpa]
Length=394

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/285 (42%), Positives = 181/285 (64%), Gaps = 1/285 (0%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLI  956
              F+ +  IF   P++ S  FIVLHG+   C++ G  ++T  ++ +    G C+E+G+G  
Sbjct  51    VFLFIFLIFVIKPVAHSLPFIVLHGIGDQCKNRGVKHFTEELTSISGSPGYCLEIGDGAW  110

Query  955   SSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVG  779
              SW M + +Q    C KI +M EL  GY++V LSQGN++GRGV+E CDG PPVK+FIS+G
Sbjct  111   DSWFMPLEEQTEIVCDKIKQMKELSKGYNIVGLSQGNLIGRGVVEFCDGGPPVKNFISLG  170

Query  778   GPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             GP+AG +S   CG   +C L        +Y+   Q H  P+GY+K P D+  YL + +FL
Sbjct  171   GPHAGTASVPLCGSGIFCILADALMKSEIYSDYVQAHLAPSGYLKFPNDIPRYLEKCRFL  230

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P +NNE  +  +   K RFSSL  LVLI+F  D+I++P+ +S FGYYP+G F   VP ++
Sbjct  231   PKLNNESPEGMNTTYKERFSSLQNLVLIMFENDSILIPKETSWFGYYPDGAFKPIVPAKE  290

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             T LY +D  G +TLD+AG+V F +  G HL I+  +++ +++P++
Sbjct  291   TKLYTEDWIGLRTLDEAGRVHFVNVSGGHLGISKSDLKKHVVPFL  335



>ref|XP_010440002.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Camelina 
sativa]
Length=306

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 179/289 (62%), Gaps = 7/289 (2%)
 Frame = -2

Query  1132  FIVLLAI----FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F++L+ +    F SIP S S  F++ HG+   C +      T  ++      GSCVE+GN
Sbjct  8     FVLLVTLSLFCFISIPFSLSVPFVLFHGIVSGCSNDKMSNLTKLLNSYSSSPGSCVEIGN  67

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFI  788
             GL  S  M +  Q + AC KI +M EL  GY++V +SQGN+V RG+IE CD  PPV +++
Sbjct  68    GLADSLYMPLTQQASIACEKIKQMPELSEGYNIVGVSQGNLVARGLIEFCDNAPPVFNYV  127

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+GGP+AG S  +P   FP C L+  Y    VYN   Q H  P+GY K+PT +  YL  S
Sbjct  128   SLGGPHAGLSD-LPKCTFPLCKLLELYLS-DVYNDFVQDHAAPSGYFKLPTKITEYLEHS  185

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             K+LP +NNE    +++  K RF+SL  LVLI+F  D ++ P+ SS FGYYP+G ++  +P
Sbjct  186   KYLPKLNNERPGEKNSTYKDRFTSLHNLVLIMFEKDDVLTPKESSWFGYYPDGTYTPILP  245

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              Q+T LY +D  G KTLD AGKV F S PG H+ IT  E+  Y++PY+K
Sbjct  246   PQKTKLYTEDWIGLKTLDDAGKVNFVSVPGGHIEITEEELVKYVVPYLK  294



>ref|XP_002967315.1| hypothetical protein SELMODRAFT_168809 [Selaginella moellendorffii]
 gb|EFJ31914.1| hypothetical protein SELMODRAFT_168809 [Selaginella moellendorffii]
Length=305

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/288 (40%), Positives = 182/288 (63%), Gaps = 4/288 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTA----FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F++L+A ++ + LS + +    F+VLHG+S  C+  G   +T  +  M    G C+E+GN
Sbjct  4     FLLLVASWAMLQLSPAASSVLPFVVLHGISDECKHHGITKFTTDLGTMSGAPGYCIEIGN  63

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPPVKSFIS  785
             G   SW + ++ QV  AC++I  + EL GGY++V LSQGN++GRG+IE CDGPPV + +S
Sbjct  64    GASDSWFLRLDKQVELACKEIKLIPELAGGYNIVGLSQGNLIGRGLIEWCDGPPVNNMVS  123

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   C  + +C L      MGVY+   Q H  P GYIK+P D+  Y     
Sbjct  124   LGGPHAGIASLPLCAAYSFCALADIILHMGVYSDFVQNHLAPTGYIKMPKDLSSYYRSCV  183

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNE+   ++A  K R S L  LVL+ F  DT+++PQ ++ FG++P  D ++ +P+
Sbjct  184   FLPKLNNELPQNRNATFKHRLSDLNQLVLVKFDKDTVLVPQETAWFGFFPPNDLTKVLPM  243

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             ++T LY++D  G K+L + G+++F +  G HL I+  E+  ++ PY+K
Sbjct  244   EETALYKEDWIGLKSLHEQGRIQFVTFSGDHLSISDQEMLDHVAPYLK  291



>ref|XP_002960405.1| hypothetical protein SELMODRAFT_74606 [Selaginella moellendorffii]
 gb|EFJ37944.1| hypothetical protein SELMODRAFT_74606 [Selaginella moellendorffii]
Length=304

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/288 (40%), Positives = 182/288 (63%), Gaps = 4/288 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTA----FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F++L+A ++ + LS + +    F+VLHG+S  C+  G   +T  +  M    G C+E+GN
Sbjct  3     FLLLVASWAMLQLSPAASSVLPFVVLHGISDECKHHGITKFTTDLGTMSGAPGYCIEIGN  62

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPPVKSFIS  785
             G   SW + ++ QV  AC++I  + EL GGY++V LSQGN++GRG+IE CDGPPV + +S
Sbjct  63    GASDSWFLRLDKQVELACKEIKLIPELAGGYNIVGLSQGNLIGRGLIEWCDGPPVNNMVS  122

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG +S   C  + +C L      MGVY+   Q H  P GYIK+P D+  Y     
Sbjct  123   LGGPHAGIASLPLCAAYSFCALADIILHMGVYSDFVQNHLAPTGYIKMPKDLSSYYRSCV  182

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNE+   ++A  K R S L  LVL+ F  DT+++PQ ++ FG++P  D ++ +P+
Sbjct  183   FLPKLNNELPQNRNATFKHRLSDLNQLVLVKFDKDTVLVPQETAWFGFFPPNDLTKVLPM  242

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             ++T LY++D  G K+L + G+++F +  G HL I+  E+  ++ PY+K
Sbjct  243   EETALYKEDWIGLKSLHEQGRIQFVTFSGDHLSISDQEMLDHVAPYLK  290



>gb|ABD64963.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
Length=328

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/284 (43%), Positives = 179/284 (63%), Gaps = 4/284 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V LA+   + +S S  FIVLHG++  C +     +T  +S      G C+EVGNG + S
Sbjct  12    VVFLAL---VQVSVSVPFIVLHGIAAACSEGKEANFTQLLSNFSGSPGFCLEVGNGELDS  68

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
             W M +  Q   AC K+ +M EL+ GY++V  SQGN+V RG+IE CDG PPV +++S+ GP
Sbjct  69    WFMPLAKQAEIACEKVKQMKELRQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYVSLAGP  128

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG SS   CG   WC +        +Y+   Q H  P+GY+KIPT+MK YL  SK+LP 
Sbjct  129   HAGISSVPMCGSGLWCEIADELIKSDIYSDFIQDHLAPSGYLKIPTEMKKYLESSKYLPK  188

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNEI   +++  K RF+SL  LVLI+F  D +I+P+ SS FG+YP+GDF   + V++T 
Sbjct  189   LNNEIPGQRNSTYKERFASLHNLVLIMFEDDKVIVPKDSSWFGFYPDGDFGPLLTVRETK  248

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             L+++D  G K L   GKV+F S  G HL ++  +I  Y++PY++
Sbjct  249   LFKEDWIGLKPLVDTGKVEFVSIDGAHLRMSNVDIVKYVVPYLQ  292



>ref|XP_010052812.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Eucalyptus 
grandis]
Length=354

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 185/305 (61%), Gaps = 17/305 (6%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +   +  P + S  F+V HG+S  C + G   +T  +S     +G C+E+G+G   SW
Sbjct  13    VAVLTLARAPATQSLPFVVFHGISDKCSNTGVARFTELLSNWSGSEGHCIEIGDGTWDSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQ---------------GNMVGRGVIENCD  812
              M + +Q A AC K+  M EL  G+++V LSQ               G M+GRGV+E CD
Sbjct  73    TMPLMEQTAIACEKVKNMSELSDGFNLVGLSQSYLSTIIATCLPVSQGTMIGRGVVEFCD  132

Query  811   GPP-VKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGM-GVYNPMAQKHFGPAGYIKIP  638
             G P VK+FIS+ G +AG SS   CG   +C L+ +   + GVY+   Q+H  P+ Y+KIP
Sbjct  133   GAPQVKNFISLAGIHAGISSIPFCGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIP  192

Query  637   TDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYY  458
             TD+  YL   KFLP +NNE+   +++  K RF+SL  LVLI+F  DT+++P+ +S FGYY
Sbjct  193   TDLANYLKGCKFLPKLNNELVHHRNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYY  252

Query  457   PNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*  278
             P+G F   +P Q+T+LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY+  
Sbjct  253   PDGTFDTLLPAQETELYIEDWIGLKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYLVD  312

Query  277   DIPSS  263
             D  S+
Sbjct  313   DEASA  317



>ref|XP_010052811.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Eucalyptus 
grandis]
Length=354

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 185/305 (61%), Gaps = 17/305 (6%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +   +  P + S  F+V HG+S  C + G   +T  +S     +G C+E+G+G   SW
Sbjct  13    VAVLTLARAPATQSLPFVVFHGISDKCSNTGVARFTELLSNWSGSEGHCIEIGDGTWDSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQ---------------GNMVGRGVIENCD  812
              M + +Q A AC K+  M EL  G+++V LSQ               G M+GRGV+E CD
Sbjct  73    TMPLMEQTAIACEKVKNMSELSDGFNLVGLSQSYLSTIIATCLPVSQGTMIGRGVVEFCD  132

Query  811   GPP-VKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGM-GVYNPMAQKHFGPAGYIKIP  638
             G P VK+FIS+ G +AG SS   CG   +C L+ +   + GVY+   Q+H  P+ Y+KIP
Sbjct  133   GAPSVKNFISLAGIHAGISSIPFCGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIP  192

Query  637   TDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYY  458
             TD+  YL   KFLP +NNE+   +++  K RF+SL  LVLI+F  DT+++P+ +S FGYY
Sbjct  193   TDLANYLKGCKFLPKLNNELVHHRNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYY  252

Query  457   PNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*  278
             P+G F   +P Q+T+LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY+  
Sbjct  253   PDGTFDTLLPAQETELYIEDWIGLKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYLVD  312

Query  277   DIPSS  263
             D  S+
Sbjct  313   DEASA  317



>ref|XP_006285186.1| hypothetical protein CARUB_v10006536mg [Capsella rubella]
 gb|EOA18084.1| hypothetical protein CARUB_v10006536mg [Capsella rubella]
Length=297

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 182/295 (62%), Gaps = 6/295 (2%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M   F  S  F+ L   F SIP+S S  FI+ HG+   C + G   +T  +S +    GS
Sbjct  1     MEKSFLRSALFVTLSLFFFSIPVSLSVPFILFHGIRDQCSNGGGSSFTQLLSNLSGSPGS  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             C+E+GNG   S  M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  P
Sbjct  61    CLEIGNGNQDSVSMPLMQQASVACEKVKKMKELSHGYNIVAQSQGNLVARGLIEFCDNAP  120

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PV ++IS+GGP+AG  S IP      C L+       VY    Q H  P+GYIKIPT+M 
Sbjct  121   PVFNYISLGGPHAG-ISDIPKCTSSLCKLLK----AEVYTDYIQDHIAPSGYIKIPTEMS  175

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL  SK+LP +NNE  + ++   K RF+SL  LVL++F+ DT+++P+ SS FG+YP+G 
Sbjct  176   KYLEHSKYLPKLNNERPNKRNPILKDRFTSLHNLVLVMFQGDTVVIPKESSWFGFYPDGA  235

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +  +  QQT LY +D  G KTLD AGKVKF S PG+HL +   E+  Y++PY+K
Sbjct  236   STPLLSPQQTKLYTEDWIGLKTLDAAGKVKFVSVPGEHLRMAQDEVVKYVVPYLK  290



>ref|NP_001048650.1| Os03g0101100 [Oryza sativa Japonica Group]
 gb|ABF93475.1| Palmitoyl protein thioesterase containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10564.1| Os03g0101100 [Oryza sativa Japonica Group]
 dbj|BAH00197.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74327.1| hypothetical protein OsI_09612 [Oryza sativa Indica Group]
 gb|EEE58142.1| hypothetical protein OsJ_09054 [Oryza sativa Japonica Group]
Length=313

 Score =   248 bits (632),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 173/274 (63%), Gaps = 9/274 (3%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P +S+  FIVLHG+   C + G   +T       R+   C E+G+G   SW+M +  Q  
Sbjct  20    PPASAVPFIVLHGIGDQCANHGVAKFT-------RLLADC-EIGSGTWDSWLMPLQKQAD  71

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPC  743
               C K+  M EL  GY++V LSQGN++GR V+E CD GPPVK+FIS+GGP+AG +S   C
Sbjct  72    IVCSKVKEMKELSNGYNIVGLSQGNLIGRAVVEFCDDGPPVKNFISLGGPHAGTASVPLC  131

Query  742   GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQS  563
             G   +C L      M +Y+   Q H  P+GY+KIPTD+  YL   +FLP +NNE+   ++
Sbjct  132   GSGIFCILADSLIKMEIYSDYVQAHLAPSGYMKIPTDISDYLKGCRFLPKLNNELPGERN  191

Query  562   AERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFK  383
             A  K RFSSL  LVLI+F+ D +++P+ ++ FGYYP+G F   +P Q+T LY +D  G K
Sbjct  192   ATYKERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGGFDPVLPPQKTKLYMEDWIGLK  251

Query  382   TLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             TLD  G+VKF S PG HL I+  ++  YI+PY+K
Sbjct  252   TLDDEGRVKFVSVPGGHLGISKTDMMKYIVPYLK  285



>ref|XP_010449608.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=316

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 178/283 (63%), Gaps = 2/283 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             ++   +FS +P+S+S  FI+ HG+   C   G   +T  +S +    GSC+E+GNG   S
Sbjct  14    VIAAVLFSFVPVSTSIPFILFHGIGDKCSG-GVSNFTQLLSNLSGSPGSCLEIGNGENDS  72

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGP  773
             W M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  PPV +++S+GGP
Sbjct  73    WFMPLTKQTSLACEKVKQMKELSQGYNIVAESQGNLVARGLIEFCDNAPPVINYVSLGGP  132

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG ++   C   P C +        +YN   Q H  P+G++KIP+ +  YLA SK+LP 
Sbjct  133   HAGIAAIPKCTSGPLCAIAEALLKSAIYNDFIQDHLAPSGFVKIPSQISKYLAHSKYLPK  192

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE  D +++    RF+SL  LVL++F+ DT ++P+ ++ FGYY +G F   +  QQT 
Sbjct  193   LNNERPDEKNSTFNDRFASLHNLVLVMFQNDTTLIPKETAWFGYYQDGGFDTLLSPQQTK  252

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             LY++D  G K LD AGKVKF S  G HLVI+  E+  Y++PY+
Sbjct  253   LYKEDWIGLKALDVAGKVKFESVLGDHLVISDEEVEEYVVPYL  295



>ref|XP_006282773.1| hypothetical protein CARUB_v10006201mg [Capsella rubella]
 gb|EOA15671.1| hypothetical protein CARUB_v10006201mg [Capsella rubella]
Length=300

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 182/296 (61%), Gaps = 4/296 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLA--IFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVK  989
             M  CF  S     ++A  +FS +P+S S  FI+ HG+   C   G   +T  +S +    
Sbjct  1     MEKCFRRSVLLYTVVAAVLFSFVPVSISIPFILFHGIGDKCSG-GVSNFTQLLSNLSGSP  59

Query  988   GSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-  812
             GSC+E+GNG   SW M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD 
Sbjct  60    GSCLEIGNGENDSWFMPLIKQTSLACEKVKQMEELSQGYNIVAESQGNLVARGLIEFCDN  119

Query  811   GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTD  632
              PPV +++S+GGP+AG ++   C   P+C +      + +YN   Q+H  P+GY+KIP  
Sbjct  120   APPVINYVSLGGPHAGIAAIPKCDAGPFCAIAEDLMKLAIYNDFVQEHIAPSGYVKIPGQ  179

Query  631   MKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPN  452
             M  YL  SK+LP +NNE  + +++  K RF+SL  LVL++F+ DT ++P+ ++ FGYY +
Sbjct  180   MSNYLEHSKYLPKLNNERPEERNSTFKERFASLHNLVLVMFQKDTTLIPKETAWFGYYQD  239

Query  451   GDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
               F   +  +QT LY++D  G K LD AGKVKF S  G HL I+  E+  Y++PY+
Sbjct  240   EGFDTLLSTKQTKLYREDWIGLKALDVAGKVKFESVLGDHLSISDEEVGEYVVPYL  295



>ref|XP_010055462.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Eucalyptus 
grandis]
 gb|KCW71935.1| hypothetical protein EUGRSUZ_E00394 [Eucalyptus grandis]
Length=346

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 178/278 (64%), Gaps = 1/278 (0%)
 Frame = -2

Query  1111  FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMN  932
             FS    S S  FIVLHG+   C + G   +T  +S     +G C+E+G+G   SW M ++
Sbjct  14    FSIFAASHSVPFIVLHGIGDQCSNRGVTQFTNLLSEYSGAEGFCIEIGDGAWDSWFMPLD  73

Query  931   DQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSS  755
             +Q    C ++  M EL  GY++V LSQGN++GRGVIE CDG PPVK+FIS+GGP+AG +S
Sbjct  74    EQAGVVCDQVKEMKELSQGYNIVGLSQGNLIGRGVIEFCDGGPPVKNFISLGGPHAGTAS  133

Query  754   TIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQ  575
                CG    C +        +Y+   Q H  P+GY+K+P  +  YLA+ +FLP +NNE+ 
Sbjct  134   VPLCGTGLLCIIADRLIKSHIYSDYIQAHLAPSGYLKLPNAISDYLAKCRFLPKLNNELP  193

Query  574   DAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDT  395
             D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F+  +   +T LY +D 
Sbjct  194   DERNSTYKERFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFNPIMFPNETQLYMEDW  253

Query  394   FGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              G ++LD+AG+V + S PG HL I+  +++ Y++PY++
Sbjct  254   IGLRSLDEAGRVHYVSVPGNHLGISRGDMKKYVVPYLE  291



>emb|CDY41045.1| BnaA09g18240D [Brassica napus]
Length=315

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 181/300 (60%), Gaps = 7/300 (2%)
 Frame = -2

Query  1177  FFMKIMASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGML  998
             F M+   S  + +  F+ L+ +  S+P      FIVLHG++  C       +T  ++ + 
Sbjct  2     FCMRKKRSGLAVALVFLALVQVSVSVP------FIVLHGIAASCSQGKEANFTQLLTNLS  55

Query  997   RVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIEN  818
                G C+EVGNG   SW M +  Q    C K+ +M EL+ GY++V  SQGN+V RG+IE 
Sbjct  56    GSPGYCIEVGNGKRDSWFMPLMKQTEIVCEKVKQMKELRQGYNIVGRSQGNLVARGLIEF  115

Query  817   CDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKI  641
             CDG PPV ++IS+ GP+AG SS   CG    C +        +Y+   Q H  P+ Y+KI
Sbjct  116   CDGGPPVFNYISLAGPHAGISSVPLCGNGSLCEIADKLIKSEIYSDFIQDHLAPSNYLKI  175

Query  640   PTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGY  461
             PT++  YL +SK+LP +NNEI + +++  K RF+SL  LVL+ F+ D +I+PQ SS FG+
Sbjct  176   PTEINKYLEKSKYLPKLNNEIPNQRNSTYKDRFTSLHNLVLVKFQDDKVIVPQDSSWFGF  235

Query  460   YPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             YP+G F   +  QQT LY +D  G KTLD AGKVKF S  G H+++   ++  Y++PY++
Sbjct  236   YPDGAFKPLLSAQQTKLYTEDWIGLKTLDDAGKVKFVSVKGAHIIMADLDVVKYVVPYLQ  295



>ref|XP_008658171.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X3 [Zea mays]
Length=282

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 158/232 (68%), Gaps = 1/232 (0%)
 Frame = -2

Query  976  EVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPV  800
            E+G G   SW+M + +Q    C+K+ +M EL  GY++V LSQGN++GR VIE CD GPPV
Sbjct  33   EIGRGAWDSWLMPLQEQANTVCKKVKKMKELSEGYNIVGLSQGNLIGRAVIEYCDCGPPV  92

Query  799  KSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGY  620
            K+FIS+GGP+AG +S   CG    C L+       +Y+   Q H  P+GY+KIPTDM+ Y
Sbjct  93   KNFISIGGPHAGTASVPLCGSGFLCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDY  152

Query  619  LAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFS  440
            L   KFLP +NNEI  A++   K RFSSL  LVLI+F  D +++P+ ++ FGYYP+G FS
Sbjct  153  LKGCKFLPKLNNEIPSARNTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFS  212

Query  439  RAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              +P Q+T LY +D  G KTLD+AG+VKF S PG HL IT  +++ YI+PY+
Sbjct  213  PVLPPQETKLYTEDWIGLKTLDEAGRVKFVSVPGGHLRITRSDMKKYIVPYL  264



>ref|XP_010449610.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=295

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 179/295 (61%), Gaps = 8/295 (3%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M   F  S   + L   F  IP+S S  FI+ HG+   C + G   +T  +S +    GS
Sbjct  1     MEKSFQRSVLLVTLSLFF--IPVSISVPFILFHGIRDQCSNGGVSSFTQLLSNLSSSPGS  58

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             C+E+GNG   S  M +  Q   AC K+ +M EL  GY++V+ SQGN+V RGVIE CD  P
Sbjct  59    CLEIGNGNQDSVSMPLMQQANVACEKVKKMKELSHGYNIVAQSQGNLVARGVIEFCDNAP  118

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PV ++IS+GGP+AG  S IP    P C L+       VY    Q H  P+GYIKIPT+M 
Sbjct  119   PVFNYISLGGPHAG-ISDIPTCTSPICKLLK----TRVYTDYIQDHIAPSGYIKIPTEMS  173

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL  SK+LP +NNE  + ++   K RF+SL  LVL++F+ DT+++P+ SS FGYYP G 
Sbjct  174   KYLEHSKYLPKLNNERPNKRNPIFKDRFTSLHNLVLVMFQGDTVVIPKESSWFGYYPEGA  233

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +  +  QQT LY +D  G KTLD AGKVKF S PG+HL +   E+  Y++PY+K
Sbjct  234   STPLLSPQQTKLYTEDWIGLKTLDAAGKVKFVSVPGEHLRMAQDEVVKYVVPYLK  288



>ref|XP_010434662.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X1 [Camelina 
sativa]
Length=296

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 179/295 (61%), Gaps = 8/295 (3%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M   F  S   + L   F  IP+S S  FI+ HG+   C + G   +T  +S +    GS
Sbjct  1     MEKSFQRSVLLVTLSLFF--IPVSISVPFILFHGIRDQCSNGGVSSFTQLLSNLSSSPGS  58

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             C+E+GNG   S  M +  Q   AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  P
Sbjct  59    CLEIGNGNQDSVSMPLTQQANVACEKVKKMKELSHGYNIVAQSQGNLVARGLIEFCDNAP  118

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PV ++IS+GGP+AG S    C   P C L+       VY    Q H  P+GYIKIPT+M 
Sbjct  119   PVFNYISLGGPHAGISDIPKCNS-PICKLLK----TRVYTDYIQNHIAPSGYIKIPTEMS  173

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL  SK+LP +NNE  + ++   K RF+SL  LVL++F+ DT+++P+ SS FGYYP+G 
Sbjct  174   KYLEHSKYLPKLNNERPNKRNPVFKDRFTSLHNLVLVMFQGDTVVIPKESSWFGYYPDGA  233

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +  +  QQT +Y +D  G KTLD AGKVKF S PG+HL I   E+  Y++PY+K
Sbjct  234   STPLLSPQQTKIYIEDWIGLKTLDAAGKVKFVSVPGEHLRIAQDEVVKYVVPYLK  288



>ref|XP_010494966.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=305

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 178/283 (63%), Gaps = 1/283 (0%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V++A  + + +S S  FI+LHG+   C D  +  +TL +  +    G CVE+GNG+ +S 
Sbjct  12    VVVAFLAMVDVSVSVPFIMLHGIIAGCSDKINANFTLLLHNLSGSPGFCVEIGNGVFTSM  71

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
              M +  Q   AC K+ +M EL  GY++V+ SQGNMV RG+IE CDG PPV ++IS+ GP+
Sbjct  72    FMPLAHQAEIACEKVKQMKELSKGYNIVARSQGNMVARGLIEFCDGGPPVYNYISLAGPH  131

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG S    C   P C         G+Y+  AQ +  P+GY KIPTD+  YL  SK+LP +
Sbjct  132   AGISFIPMCHSTPHCKKFDEIIKRGLYSDFAQNNAAPSGYYKIPTDITMYLESSKYLPKL  191

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             +NEI + +++  K RF+SL  LVL+ F+ D II+P  S+ FG+YP+GDF   +P QQT L
Sbjct  192   SNEIPNQRNSTYKDRFASLHNLVLVKFQDDKIIVPSESTWFGFYPDGDFKHVLPAQQTKL  251

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             Y +D  G K LD AGKVKF S PG HL +   ++  +++PY++
Sbjct  252   YTEDWIGLKKLDTAGKVKFVSVPGGHLDMAYQDVVTHVVPYLQ  294



>gb|KFK24549.1| hypothetical protein AALP_AAs62283U000300 [Arabis alpina]
Length=312

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/291 (43%), Positives = 181/291 (62%), Gaps = 6/291 (2%)
 Frame = -2

Query  1150  FSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEV  971
             F  S+  + L   F  IP+S S  FI+ HG+   C + G   +   +S +    GSC+E+
Sbjct  6     FQRSSLLVTLSIFFFFIPVSISVPFILFHGIQDQCSNGGVTSFIHLLSNLSSSPGSCLEI  65

Query  970   GNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKS  794
             GNG  +S  M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  PPV +
Sbjct  66    GNGEQNSVSMPLTQQASLACEKVKKMKELSQGYNIVAQSQGNLVARGLIEFCDNAPPVFN  125

Query  793   FISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLA  614
             ++S+GGP+AG  + IP   F  C L+       VY    Q H  P+G+IKIPTDMK YL 
Sbjct  126   YVSLGGPHAG-IADIPTCTFQICKLLKE----EVYTDYVQDHIAPSGFIKIPTDMKNYLE  180

Query  613   QSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRA  434
              SK+LP +NNE    +++  K+RF+SL  LVL++F+ D +++P+ S  FGYYP G     
Sbjct  181   HSKYLPKLNNERPKERNSTFKQRFTSLHNLVLVMFQGDKVVIPKESCWFGYYPEGASKPL  240

Query  433   VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +P Q+T LY++D  G KTLD AGKVKF S PG+HL +   ++  Y++PY++
Sbjct  241   LPPQKTKLYREDWIGLKTLDVAGKVKFVSVPGEHLQMAKDDVVKYVVPYLQ  291



>gb|AAG60184.1|AC084763_4 putative palmitoyl-protein thioesterase [Oryza sativa Japonica 
Group]
Length=295

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 169/265 (64%), Gaps = 8/265 (3%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCV-------EVGNGLISSWM  944
             +P++S+  FIVLHG+   C++ G   +T  +      KG C+       E+G G   SW+
Sbjct  24    VPVASAVPFIVLHGIGDQCENGGMASFTEMLGEWSGSKGYCILNVFLLSEIGRGAWDSWL  83

Query  943   MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNA  767
             M + +Q    C+K+ +M EL+ GY +V LSQGN++GR VIE CDG PPVK+FIS+GGP+A
Sbjct  84    MPLQEQADTVCKKVKKMKELRKGYSIVGLSQGNLIGRAVIEYCDGGPPVKNFISIGGPHA  143

Query  766   GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
             G +S   CG    C L+     + +Y+   Q H  P+GY+KIPTDM  YL   KFLP +N
Sbjct  144   GTASVPLCGSGIVCVLIDALIKLEIYSNYVQAHLAPSGYLKIPTDMTDYLKGCKFLPKLN  203

Query  586   NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLY  407
             NEI   ++A  K+RFSSL  LVLI+F  D +++P+ ++ FGYYP+G FS   P Q+T LY
Sbjct  204   NEIPSERNATYKQRFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVQPPQKTKLY  263

Query  406   QKDTFGFKTLDKAGKVKFFSCPGQH  332
              +D  G K L++AG+VKF S PG+ 
Sbjct  264   TEDWIGLKALEEAGRVKFVSVPGEE  288



>ref|XP_008437040.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Cucumis 
melo]
Length=316

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 174/273 (64%), Gaps = 2/273 (1%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             S S  FIVLHG+   C + G   +T  +S     KG C+E+GNG   SW M +  Q    
Sbjct  22    SHSLPFIVLHGIGDKCSNKGMRKFTKYLSDNSGSKGYCIEIGNGGWDSWFMTLEAQSQIV  81

Query  913   CRKITR-MGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCG  740
             C K+ + M +LK G++ V LSQGN++GR V+E CDG PPV++FIS+GGP+AG SS   CG
Sbjct  82    CNKVVKKMKDLKEGFNFVGLSQGNLIGRAVVEFCDGAPPVQNFISLGGPHAGISSVPLCG  141

Query  739   KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSA  560
                WC L      + +Y+ + Q    P+G+IK+P D+  YL   KFLP +NNE  DA+++
Sbjct  142   SGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDARNS  201

Query  559   ERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKT  380
               K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G+F   +P QQT LY +D  G ++
Sbjct  202   TYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGLRS  261

Query  379   LDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LD+ G+VKF    G HL I+  + + YI+PY++
Sbjct  262   LDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  294



>gb|KFK31386.1| hypothetical protein AALP_AA6G105200 [Arabis alpina]
Length=311

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/289 (43%), Positives = 177/289 (61%), Gaps = 2/289 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +   + + +S S  FI+LHG++  C       +T  +S +    G C+EVGNG   SW
Sbjct  10    VAVVFLAMVHVSVSVPFIMLHGIAAECSKDKETNFTQLLSNLSGSPGFCLEVGNGERDSW  69

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPN  770
              M +  Q   AC K+ +M EL+ GY++V  SQGN+V RG+IE CD GPPV ++IS+ GP+
Sbjct  70    FMPLTKQAEIACEKVKQMKELRQGYNIVGRSQGNLVARGLIEFCDDGPPVFNYISLAGPH  129

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG    C +        +Y+   Q H  P+GY+KIPTDM  YL  SK+LP +
Sbjct  130   AGISSVPMCGSGLLCEIADELIKSDIYSDFIQDHLAPSGYLKIPTDMTKYLESSKYLPKL  189

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNEI + +++  K RF+SL  L+L+ F  D +I+P+ SS FG+YP+G+F   +   QT L
Sbjct  190   NNEIPNQRNSTYKDRFTSLHNLILVKFEDDKVIVPKDSSWFGFYPDGEFEPLLSANQTKL  249

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             Y +D  G KTLD AGKVKF S  G H+ +   ++  Y++PY++ + PSS
Sbjct  250   YTEDWIGLKTLDVAGKVKFVSVAGAHIKMANLDVLKYVVPYLQ-NQPSS  297



>ref|XP_010677184.1| PREDICTED: uncharacterized protein LOC104892862 [Beta vulgaris 
subsp. vulgaris]
Length=703

 Score =   256 bits (653),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/298 (44%), Positives = 185/298 (62%), Gaps = 8/298 (3%)
 Frame = -2

Query  1171  MKIMASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRV  992
             MK  A+ F  +   I L       PLS    FIV+HG+   C   G   +T  +S     
Sbjct  1     MKSPATLFPLAFAIIFL-------PLSHCFPFIVIHGIGDQCSHRGMKQFTELLSEWSGS  53

Query  991   KGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD  812
             +G C+E+G+G   SW M + DQ    C K+ +M +L  GY++V LSQGN++GR V+E C+
Sbjct  54    EGYCIEIGDGSWDSWFMPLEDQAQVVCDKVKQMNKLSDGYNIVGLSQGNLIGRAVVEFCE  113

Query  811   G-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPT  635
             G PPVK+FIS+GGP+AG +S   CG   +C L        +Y    Q H  P+GY+KIP+
Sbjct  114   GVPPVKNFISLGGPHAGIASIPLCGTGIFCVLADALIKSEIYTDYIQAHLAPSGYLKIPS  173

Query  634   DMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYP  455
             +M GYL + +FLP +NNEI + +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP
Sbjct  174   NMDGYLEKCRFLPKLNNEIPEERNSTYKERFSSLETLVLIMFEHDTVLVPKETSWFGYYP  233

Query  454   NGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +G FS  +  Q+T LY +D  G KTLD AG+VKF S  G HL I+  +++ Y++PY+K
Sbjct  234   DGAFSPLLTPQETKLYTEDWIGLKTLDVAGRVKFVSVAGNHLGISHEDMKKYMVPYLK  291


 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 175/302 (58%), Gaps = 17/302 (6%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFS-SIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKG  986
             M S F    +FI +L + +   P S+S  FIV+HG+   C+          +S      G
Sbjct  372   MKSVF---VSFIFILTLITPHFPSSASLPFIVIHGIGQDCRVKKVSELIKQLSHWSATDG  428

Query  985   SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGP  806
              C+E  +G +SSW++ + DQ A AC K+ +M EL  GY+++ LSQGN++ R +IE CDG 
Sbjct  429   YCIESSHGKLSSWLLPLKDQAAIACSKVKQMKELSQGYNIIGLSQGNLIARSIIEFCDGA  488

Query  805   P-VKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYY------GMGVYNPMAQKHFGPAGYI  647
             P   +FIS+ GP+AG       G  P+    G ++        G+Y    QK+   +GYI
Sbjct  489   PKAYNFISLAGPHAG------IGSPPFSLFTGVHFVAVKLINFGIYRKFIQKNLAVSGYI  542

Query  646   KIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHF  467
             KIP ++  YL  SKFLP +NNEI + +S+  K RF SL  LVLI F  + +++P+ +S F
Sbjct  543   KIPNNIPSYLENSKFLPKLNNEIPNERSSIYKERFKSLENLVLIKFDNEHVLIPKETSWF  602

Query  466   GYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPY  287
             GYY +  F   +P ++T L+ +D  G K L++AGKV + + PG HL I+   ++ YI+P+
Sbjct  603   GYYQDHSFRSVLPARETKLFVEDWIGLKALEEAGKVTYVTLPGDHLAISDDGLKKYIVPF  662

Query  286   MK  281
             +K
Sbjct  663   LK  664



>ref|XP_011047609.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Populus euphratica]
 ref|XP_011047610.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Populus euphratica]
 ref|XP_011047611.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Populus euphratica]
Length=366

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 172/273 (63%), Gaps = 1/273 (0%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P++ S  FIVLHG+   C++ G   +T  ++      G C+E+G+G   SW M + +Q  
Sbjct  21    PVAHSLPFIVLHGIGDQCKNRGVKQFTEELTNFSGSPGYCLEIGDGTWDSWFMPLEEQTE  80

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPC  743
               C K+ +M EL  GY +V LSQGN++GRGV+E CDG PPVK+FIS+GGP+AG +S   C
Sbjct  81    IVCDKVKKMKELSKGYSIVGLSQGNLIGRGVVEFCDGGPPVKNFISLGGPHAGTASVPLC  140

Query  742   GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQS  563
             G   +C L        +Y+   Q H  P+GY+K P D+  Y+ + +FLP +NNEI + ++
Sbjct  141   GSGIFCKLADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFLPKLNNEIPEERN  200

Query  562   AERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFK  383
                K RFSSL  LVLI+F  D +++P+ +S FGYYP+G F   VP  QT LY +D  G K
Sbjct  201   TTYKERFSSLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPANQTALYTEDWIGLK  260

Query  382   TLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              LD+AG+V F +  G HL I+  +++ +++P++
Sbjct  261   ALDEAGRVHFVNVSGGHLGISESDMKKHVVPFL  293



>ref|XP_010451416.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=304

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 187/290 (64%), Gaps = 9/290 (3%)
 Frame = -2

Query  1138  TTFIVLLAIFS-SIPLSSSTAFIVLHGVSMFCQD--VGSIYYTLTISGMLRVKGSCVEVG  968
             +  +V L +F  SIP+S S  F+V HG    C D  V ++     +SG     GSCVE+G
Sbjct  8     SVLLVTLTLFCFSIPVSLSVPFVVFHGFLGACSDNKVSNLKSLRNLSGY---PGSCVEIG  64

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSF  791
             NG + S  M +  Q + AC KI +M EL  GY++V+ SQGNMV RG+IE CD  PPV ++
Sbjct  65    NGQVDSLFMPLTQQASIACEKIKQMPELSEGYNIVAESQGNMVARGLIEFCDNAPPVFNY  124

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             +S+GGP+AG ++   C +  +C ++   + +  Y  + Q +  P+GY+K+PT +  YL  
Sbjct  125   VSLGGPHAGVAAVPNCTE-SFCLVLKALFPL-FYTDLVQDNVAPSGYVKVPTKITEYLEH  182

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
             SK+LP +NNE    +++  K RF+SL  LVLI+F+ DT+++P+ +S FGYYP+GDF+  +
Sbjct  183   SKYLPKLNNERPGQKNSIFKDRFTSLHNLVLIMFQKDTVLIPRETSWFGYYPDGDFTPVL  242

Query  430   PVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             P Q+T LY KD  G KTLD AGKVKF S PG H+ IT  E+  Y++PY++
Sbjct  243   PPQKTKLYTKDWIGLKTLDDAGKVKFLSVPGGHIEITEEELLNYVVPYLQ  292



>ref|XP_010481338.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X1 [Camelina 
sativa]
Length=308

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/286 (43%), Positives = 180/286 (63%), Gaps = 4/286 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V++A  + + +S S  FI+LHG+   C D  +  +TL +  +    G CVE+GNG+ +S 
Sbjct  12    VVVAFLAMVDVSVSVPFIMLHGIIAGCSDNTNANFTLLLRNLSGSPGFCVEIGNGVFTSM  71

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
              M +  Q   AC K+ +M EL  GY++V+ SQGN+V RG+IE CDG PPV ++IS+ GP+
Sbjct  72    FMPLAHQAEIACEKVKQMKELSKGYNIVARSQGNLVARGLIEFCDGGPPVYNYISLAGPH  131

Query  769   AGHSSTIPCGKF---PWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFL  599
             AG S    C      P+C         G+Y+  AQ +  P+GY KIPTD+  YL  SK+L
Sbjct  132   AGISFIPMCNGLKSSPYCKKFDEIIKRGLYSDFAQNNAAPSGYYKIPTDITMYLESSKYL  191

Query  598   PYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQ  419
             P ++NEI + +++  K RF+SL  LVL+ F+ D +I+P  S+ FG+YP+GDF   +P QQ
Sbjct  192   PKLSNEIPNQRNSTYKDRFASLHNLVLVKFQDDKVIVPIESTWFGFYPDGDFKHVLPAQQ  251

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             T LY +D  G KTLD AGKVKF S PG HL +   ++  +++PY+K
Sbjct  252   TKLYTEDWIGLKTLDTAGKVKFVSVPGGHLDMAYQDVVTHVVPYLK  297



>ref|NP_193478.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 gb|AAO42200.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63889.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83898.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=304

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/287 (44%), Positives = 177/287 (62%), Gaps = 6/287 (2%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             +  +V L +F  IP+S S  FI+ HG+   C + G   +   +S +    GSC+E+GNG 
Sbjct  8     SALLVTLTLFFFIPVSISVPFILFHGIRDQCSNGGVSSFVQLLSNLSSSHGSCLEIGNGE  67

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISV  782
               S  M +  Q + AC K+ +M +L  GY++V+ SQGN+V RG+IE CD  PPV ++IS+
Sbjct  68    QDSVTMPLTQQASVACEKVKQMKDLSQGYNIVAQSQGNLVARGLIEFCDNAPPVFNYISL  127

Query  781   GGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKF  602
             GGP+AG  S IP      C L+       VY    Q H  P+GYIKIPTD+K YL  SK+
Sbjct  128   GGPHAG-ISDIPKCNSTLCELLK----TAVYTDFVQDHIAPSGYIKIPTDIKDYLEHSKY  182

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ  422
             LP INNE  + ++   K RF+SL  LVL++F  D +++P+ SS FGYYP+G  +  +  Q
Sbjct  183   LPKINNERPNERNTTFKDRFTSLHNLVLVMFEGDAVVIPKESSWFGYYPDGASTPLLSPQ  242

Query  421   QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             QT LY +D  G KTLD A KVKF S PG+HL I   ++  +++PY+K
Sbjct  243   QTKLYTEDWIGLKTLDAARKVKFVSVPGEHLRIAQDDVVKHVVPYLK  289



>ref|XP_004511714.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Cicer 
arietinum]
Length=327

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 174/271 (64%), Gaps = 1/271 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             S S  FIV+HG+   C + G   +T  +     V G CVEVGNG   SW M + +Q    
Sbjct  25    SHSLPFIVIHGIGDQCSNHGVKKFTDELISYSGVNGYCVEVGNGSWDSWFMPLQEQTDYV  84

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGK  737
             C+K+  M ELKGGY++V LSQGN++GRGV+E C+G PPVK+FIS+ GP+AG +S   CG 
Sbjct  85    CQKVREMNELKGGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFISLAGPHAGTASVPLCGV  144

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
                C L  +     VY+   Q+H  P+GY+K+P  +  YL   ++LP +NNE    +++ 
Sbjct  145   SILCVLADNLIKGEVYSTYIQEHLAPSGYLKLPNAIPKYLESCRYLPKLNNERPAERNST  204

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T LY +D  G +TL
Sbjct  205   YKERFSSLLNLVLIMFEQDTVLIPKETSWFGYYPDGYFKPILPPQETKLYTEDWIGLRTL  264

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             D+AG+V F S  G+HL I+  +++ +++PY+
Sbjct  265   DEAGRVHFVSIEGKHLGISETDMKKHVVPYL  295



>ref|XP_010439997.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=310

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 179/295 (61%), Gaps = 8/295 (3%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M   F  S   + L   F  IP+S S  FI+ HG+   C + G   +T  +S +    GS
Sbjct  1     MEKSFQRSVLLVTLSLFF--IPVSISVPFILFHGIRDQCSNGGVSSFTQLLSNLSSSPGS  58

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             C+E+GNG   S  M +  Q   AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  P
Sbjct  59    CLEIGNGNQDSVSMPLTQQANIACEKVKKMKELSHGYNIVAQSQGNLVARGLIEFCDDAP  118

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PV ++IS+GGP+AG  S IP    P C L+       VY    Q H  P+GYIKIPT+M 
Sbjct  119   PVFNYISLGGPHAG-ISDIPKCTSPICKLLK----TRVYTDYIQDHIAPSGYIKIPTEMS  173

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL  SK+LP +NNE  + ++   K RF+SL  LVL++F+ DT+++P+ SS FGYYP+G 
Sbjct  174   KYLEHSKYLPKLNNERPNKRNPVFKDRFTSLHNLVLVMFQGDTVVIPKESSWFGYYPDGA  233

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +  +  QQT LY +D  G K LD AGKVKF S PG+HL +   E+  Y++PY+K
Sbjct  234   STPLLSPQQTKLYTEDWIGLKALDAAGKVKFVSVPGEHLRMAQDEVVKYVVPYLK  288



>ref|XP_010449612.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
 ref|XP_010449613.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
 ref|XP_010449614.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=306

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 178/285 (62%), Gaps = 2/285 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
              + L   F S P+S S  F+V HG    C D   I  T ++S +    GSCVE+GNG   
Sbjct  11    LVTLSLFFFSFPVSLSVPFVVFHGFDNACSDEQFITVTQSLSNLSGHPGSCVEIGNGHQD  70

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGG  776
             S  M +  Q + AC KI +M EL  GY++V+ SQGNMV RG+IE CD  PPV +++S+ G
Sbjct  71    SLHMPLTQQASIACEKIKQMPELSDGYNIVAASQGNMVARGLIEFCDNAPPVFNYVSLAG  130

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG ++       P+C L+   +   VY+ +AQ    P+G++K+PT +  YL  SK+LP
Sbjct  131   PHAGIAAVPEPCNVPFCWLLKALFPF-VYSDLAQDLVAPSGFVKVPTKIAEYLEHSKYLP  189

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNE    +S+  K RF+SL  LVL++F  DT+++P+ +S FGYYP+G  +  +P Q+T
Sbjct  190   KLNNERPAEKSSTFKDRFTSLQNLVLVMFENDTMLIPRETSWFGYYPDGASTPVLPPQKT  249

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              LY +D  G KTLD AGKVKF S PG H+ IT  E+  Y++PY++
Sbjct  250   KLYTEDWIGLKTLDDAGKVKFISLPGGHVEITKEELVKYVVPYLQ  294



>ref|XP_004511713.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Cicer 
arietinum]
Length=327

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 174/271 (64%), Gaps = 1/271 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             S S  FIV+HG+   C + G   +T  +     V G CVEVGNG   SW M + +Q    
Sbjct  25    SHSLPFIVIHGIGDQCSNHGVKKFTDELISYSGVNGYCVEVGNGSWDSWFMPLQEQTDYV  84

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGK  737
             C+K+  M ELKGGY++V LSQGN++GRGV+E C+G PPVK+FIS+ GP+AG +S   CG 
Sbjct  85    CQKVREMNELKGGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFISLAGPHAGTASVPLCGT  144

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
                C L  +     VY+   Q+H  P+GY+K+P  +  YL   ++LP +NNE    +++ 
Sbjct  145   GILCVLADNLIKGEVYSTYIQEHLAPSGYLKLPNAIPKYLESCRYLPKLNNERPAERNST  204

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTL  377
              K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T LY +D  G +TL
Sbjct  205   YKERFSSLLNLVLIMFEQDTVLIPKETSWFGYYPDGYFKPILPPQETKLYTEDWIGLRTL  264

Query  376   DKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             D+AG+V F S  G+HL I+  +++ +++PY+
Sbjct  265   DEAGRVHFVSIEGKHLGISETDMKKHVVPYL  295



>ref|XP_004300365.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Fragaria vesca 
subsp. vesca]
Length=314

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 174/273 (64%), Gaps = 1/273 (0%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P S S  FIVLHG+   C + G   +T  +      +G C+EVG G   SW + + +Q  
Sbjct  21    PCSVSVPFIVLHGIGDQCANRGVKQFTEQLRDFSGAEGYCIEVGAGTWDSWFVPLEEQTR  80

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPC  743
               C K+  M EL+ GY++V LSQGN++GRGV+E C+ GP VK+F+S+GGP+AG +S   C
Sbjct  81    IVCEKVKEMEELRQGYNIVGLSQGNLIGRGVVEFCNNGPLVKNFVSLGGPHAGIASVPLC  140

Query  742   GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQS  563
             G   +C ++       +Y+   Q H  P+GYIK+P  M  YL + +FLP +NNE+ D ++
Sbjct  141   GSGIFCIIVNKLIKGEIYSDYIQAHLAPSGYIKLPNAMTDYLGRCRFLPKLNNELPDERN  200

Query  562   AERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFK  383
             +  K RFSSL  LVLI+F  D +++P+ +S FGYY +G F+  V  QQTDLY +D  G +
Sbjct  201   STYKERFSSLENLVLIMFEQDNVLVPRETSWFGYYQDGAFNSIVGPQQTDLYTEDWIGLR  260

Query  382   TLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             TLD+AG+VK+ S  G HL I+  +I+ +++PY+
Sbjct  261   TLDEAGRVKYVSVSGGHLGISESDIKKHVVPYL  293



>ref|XP_010089298.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
 gb|EXB37623.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
Length=308

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 171/264 (65%), Gaps = 2/264 (1%)
 Frame = -2

Query  1069  LHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITR-M  893
             + G+   C + G  ++T  +S     +G C+E+G G   SW M + +Q A  C K+ + M
Sbjct  1     MTGIGDKCTNRGITHFTEELSNWSSSQGYCIEIGKGPWDSWTMPLLEQTAIVCEKVVKQM  60

Query  892   GELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLM  716
              EL  GY++V LSQGN +GRGVIE CDG P VK+FIS+GGP+AG +S   CG    C L+
Sbjct  61    SELSEGYNIVGLSQGNAIGRGVIEFCDGGPAVKNFISLGGPHAGTASIPLCGSGWICILI  120

Query  715   GHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSS  536
                    +Y+   Q+H  P+GY+KIPTD+  YL+  KFLP +NNEI + ++A  K RF+S
Sbjct  121   DSLIKSEIYSNYIQEHLAPSGYLKIPTDIDDYLSGCKFLPKLNNEIPNERNATYKERFAS  180

Query  535   LTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVK  356
             +  LVLI+F  DTI++P+ ++ FGYYP+G F   +P Q+T LY +D  G +TLD+AGKVK
Sbjct  181   IENLVLIMFEQDTILIPKETAWFGYYPDGTFDSVLPPQETKLYIEDWIGLRTLDEAGKVK  240

Query  355   FFSCPGQHLVITPPEIRMYIIPYM  284
             F S  G HL I+  ++  YI+PY+
Sbjct  241   FVSVSGNHLEISRSDMAKYIVPYL  264



>gb|ABD65142.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
Length=314

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 180/297 (61%), Gaps = 3/297 (1%)
 Frame = -2

Query  1168  KIMASCFSFSTTFIVLLAI-FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRV  992
              +MA+        + + A+ FS++P S+S  FI+ HG+   C   G   +T  +S +   
Sbjct  17    NLMANILRRPVLLLTVAAVLFSTVPASNSIPFILFHGIGDKCSG-GVGNFTQLLSNLSGS  75

Query  991   KGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-  815
              GSC+E+GNG I +W M +  Q  +AC K+  M EL  GY++V+ SQGN+V RG+IE C 
Sbjct  76    PGSCLEIGNGEIDTWFMPLMHQANEACEKVKMMKELSQGYNIVAQSQGNLVARGLIEFCY  135

Query  814   DGPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPT  635
             D PPV +++S+GGP+AG ++   C   P+C +      + +YN   Q H  P+GY+KIP 
Sbjct  136   DAPPVVNYVSLGGPHAGVAAIPKCSSGPFCAIAEALMKLEIYNDFVQDHIAPSGYVKIPG  195

Query  634   DMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYP  455
             +M  YL  SK+LP +NNE  D +++  K RF SL  LVL++F+ DT ++P+ +S FGYY 
Sbjct  196   EMTKYLDHSKYLPKLNNERPDQRNSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYT  255

Query  454   NGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +  F   +  QQT LY +D  G K LD  GKVK+ S  G HL+I   ++  Y++PY+
Sbjct  256   DDGFDSLLSTQQTKLYTEDWIGLKALDDVGKVKYVSVSGDHLMIAYNDVVKYVVPYL  312



>gb|KCW71934.1| hypothetical protein EUGRSUZ_E00394 [Eucalyptus grandis]
Length=347

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 177/279 (63%), Gaps = 2/279 (1%)
 Frame = -2

Query  1111  FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMN  932
             FS    S S  FIVLHG+   C + G   +T  +S     +G C+E+G+G   SW M ++
Sbjct  14    FSIFAASHSVPFIVLHGIGDQCSNRGVTQFTNLLSEYSGAEGFCIEIGDGAWDSWFMPLD  73

Query  931   DQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG--PPVKSFISVGGPNAGHS  758
             +Q    C ++  M EL  GY++V LSQGN++GRGVIE CDG  P VK+FIS+GGP+AG +
Sbjct  74    EQAGVVCDQVKEMKELSQGYNIVGLSQGNLIGRGVIEFCDGGPPQVKNFISLGGPHAGTA  133

Query  757   STIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEI  578
             S   CG    C +        +Y+   Q H  P+GY+K+P  +  YLA+ +FLP +NNE+
Sbjct  134   SVPLCGTGLLCIIADRLIKSHIYSDYIQAHLAPSGYLKLPNAISDYLAKCRFLPKLNNEL  193

Query  577   QDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKD  398
              D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F+  +   +T LY +D
Sbjct  194   PDERNSTYKERFSSLENLVLIMFEHDTVLIPKETSWFGYYPDGAFNPIMFPNETQLYMED  253

Query  397   TFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
               G ++LD+AG+V + S PG HL I+  +++ Y++PY++
Sbjct  254   WIGLRSLDEAGRVHYVSVPGNHLGISRGDMKKYVVPYLE  292



>gb|AAM63476.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=304

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 177/287 (62%), Gaps = 6/287 (2%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             +  +V L +F  IP+S S  FI+ HG+   C + G   +   +S +    GSC+E+G+G 
Sbjct  8     SALLVTLTLFFCIPVSISVPFILFHGIRDQCSNGGVSSFVQLLSNLSSSHGSCLEIGDGE  67

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISV  782
               S  M +  Q + AC K+ ++ +L  GY++V+ SQGN+V RG+IE CD  PPV ++IS+
Sbjct  68    QDSVTMPLTQQASVACEKVKQLKDLSQGYNIVAQSQGNLVARGLIEFCDNAPPVFNYISL  127

Query  781   GGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKF  602
             GGP+AG  S IP      C L+       VY    Q H  P+GYIKIPTD+K YL  SK+
Sbjct  128   GGPHAG-ISDIPKCNSTLCELLK----TAVYTDFVQDHIAPSGYIKIPTDIKDYLEHSKY  182

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ  422
             LP INNE  + ++   K RF+SL  LVL++F  D +++P+ SS FGYYP+G  S  +  Q
Sbjct  183   LPKINNERPNERNTTFKDRFTSLHNLVLVMFEGDAVVIPKESSWFGYYPDGASSPLLSPQ  242

Query  421   QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             QT LY +D  G KTLD A KVKF S PG+HL I   ++  +++PY+K
Sbjct  243   QTKLYTEDWIGLKTLDAARKVKFVSVPGEHLRIAQDDVVKHVVPYLK  289



>gb|KFK44000.1| hypothetical protein AALP_AA1G201800 [Arabis alpina]
Length=303

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/284 (44%), Positives = 176/284 (62%), Gaps = 2/284 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +A  + I +S S  FI++HG+S  C D  +  +   ++ +    G C+E+GNG   SW
Sbjct  10    VAVAFLALIHVSVSIPFILIHGISAECSDHTNSNFPRLLTNLSGSPGFCIEIGNGKSDSW  69

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPN  770
             +M +  QV   C K+ ++  L+ GY++V+ SQGN+V RG+IE CD GPPV ++IS+ GP+
Sbjct  70    LMPLTKQVQIVCEKVKQIEVLRQGYNIVARSQGNLVARGLIEFCDDGPPVYNYISLAGPH  129

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG   WC          +Y    Q H  P+GYIKIP  +  YL +SK+LP +
Sbjct  130   AGISSVPWCGSGIWCEEADKLIEKDIYTDYVQDHLAPSGYIKIPNAITKYLERSKYLPKL  189

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYP-NGDFSRAVPVQQTD  413
             NNEI   ++A  K RF+SL  LVL++F+ DT+I+P+ SS FG+YP NG     +  QQT 
Sbjct  190   NNEIPTQRNATYKNRFTSLHNLVLVMFQNDTVIVPRDSSWFGFYPDNGANQPLLSAQQTK  249

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             LY +D  G KTLD AGKVKF S PG HL +   +I  Y++PY++
Sbjct  250   LYTEDWIGLKTLDVAGKVKFVSVPGGHLQMAIQDIVKYVVPYLQ  293



>ref|XP_006440242.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
 gb|ESR53482.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
Length=316

 Score =   243 bits (619),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 169/264 (64%), Gaps = 1/264 (0%)
 Frame = -2

Query  1069  LHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMG  890
             + G+   C + G   +T  +S     KG C+EVG+G   SW   + +Q    C K+ +M 
Sbjct  1     MAGIGDQCSNQGVKQFTENLSSFSGSKGYCIEVGDGTWDSWFKPLEEQTEIVCEKVKKMK  60

Query  889   ELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMG  713
             EL  GY++V LSQGN++GRGV+E C+G PPVK+F+S+GGP+AG +S   CG   +C +  
Sbjct  61    ELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIAN  120

Query  712   HYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSL  533
             +     VY+   Q H  P+GY+K P D+  YL + KFLP +NNE+ D +++  K RFS L
Sbjct  121   NLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKERFSCL  180

Query  532   TMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKF  353
               LVLI+F+ D +++P+ ++ FGYYP+G FS  +P Q+T LY +D  G KTLD AG+V F
Sbjct  181   QNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHF  240

Query  352   FSCPGQHLVITPPEIRMYIIPYMK  281
              S  G HL I+  +++ +IIPY+K
Sbjct  241   ISVAGGHLKISKADMKKHIIPYLK  264



>ref|XP_007039751.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY24252.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=364

 Score =   244 bits (623),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/290 (42%), Positives = 177/290 (61%), Gaps = 2/290 (1%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             S S  FI  L I +    S S  FIVLHG+   C + G   +T  ++     KG C+E+G
Sbjct  5     SKSIAFISFL-ILTITEASHSIPFIVLHGIGDQCSNRGVKQFTELLTNFSGSKGYCLEIG  63

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSF  791
             +G   SW M + +Q A  C K+  + EL  GY++V LSQGN++GRGV+E C+G PPVK+F
Sbjct  64    DGTWDSWFMPLEEQTAVVCEKVKHLKELSKGYNIVGLSQGNLIGRGVVEFCEGGPPVKNF  123

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             IS+GGP+AG +S   CG    C +        +Y    Q H  P+GY+K+P D+  YL +
Sbjct  124   ISLGGPHAGTASVPLCGSGFLCLIADKLIKSEIYTDYIQAHLAPSGYLKLPNDIVHYLEK  183

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
              +FLP +NNE+   +++  K RF+ L  LVLI+F  D +++P+ +S FGYYPNG F   +
Sbjct  184   CRFLPKLNNELPGERNSTYKERFTRLQNLVLIMFEQDNVLIPRETSWFGYYPNGGFKPVI  243

Query  430   PVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
               Q+T LY +D  G KTLD AG+V + S  G HL I+  +++ +++PY+K
Sbjct  244   RPQETKLYTEDWIGLKTLDDAGRVHYISVSGGHLGISRKDMKKHVVPYLK  293



>emb|CDY18971.1| BnaC01g20970D [Brassica napus]
Length=305

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/296 (42%), Positives = 184/296 (62%), Gaps = 7/296 (2%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSS-IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKG  986
             M   F      +  L++F   IP++ S  FI+LHG+   C + G+I +T  +S +    G
Sbjct  1     MMKSFQRCALLVRTLSVFVFFIPVTISVPFILLHGIRDQCSNGGTISFTQLLSNLSSSPG  60

Query  985   SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-G  809
             SC+E+GNG   S  M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  
Sbjct  61    SCLEIGNGEQDSVSMPLTQQASIACEKVKQMKELSQGYNIVAQSQGNLVARGLIEFCDNA  120

Query  808   PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDM  629
             PPV +++S+GGP+AG  + IP    P C L+       VY+   Q H  P+GYIK+P +M
Sbjct  121   PPVLNYVSLGGPHAG-IANIPKCTSPVCQLLR----TDVYSDYVQDHIAPSGYIKLPNEM  175

Query  628   KGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNG  449
               YL  SK+LP +NNE    +++  K RF+SL  LVL++F+ D +++P+ S  FGYYP+G
Sbjct  176   SKYLEHSKYLPKLNNERPTERNSIYKERFTSLHNLVLVMFQGDKVVMPKESCWFGYYPDG  235

Query  448   DFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
               +  +P QQT LY +D  G KTLD AGKVKF S PG+HL +   ++  +++PY++
Sbjct  236   ATTPLLPPQQTKLYTEDWIGLKTLDAAGKVKFVSVPGEHLQMAHDDVVKHVVPYLQ  291



>ref|XP_002868063.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44322.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=304

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 178/287 (62%), Gaps = 6/287 (2%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             +T +V L IF  +P+S S  FI+ HG+   C + G   +   +S +    GSC+E+G+G 
Sbjct  8     STLLVTLTIFFFLPVSISVPFILFHGIRDQCSNGGVSSFVQLLSNLSSSPGSCLEIGDGE  67

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISV  782
               S  M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  PPV ++IS+
Sbjct  68    QDSVTMPLTQQASVACEKVKQMKELSQGYNIVAQSQGNLVARGLIEFCDNAPPVFNYISL  127

Query  781   GGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKF  602
             GGP+AG S  IP      C L+       VY    Q H  P+GYIKIPTD+K YL  SK+
Sbjct  128   GGPHAGISD-IPKCNSTLCELLK----TEVYTDFVQDHIAPSGYIKIPTDIKNYLEHSKY  182

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ  422
             LP +NNE    ++A  K RF+SL  LVL++F  DT+++P+ SS FGYYP+G  +  +  Q
Sbjct  183   LPQLNNERPKERNATFKDRFTSLHNLVLVMFDGDTVVIPKESSWFGYYPDGASTPLLSPQ  242

Query  421   QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +T LY +D  G KTL+ AGKVKF S  G+HL I   ++  Y+ PY+K
Sbjct  243   ETKLYTEDWIGLKTLNTAGKVKFVSVHGEHLRIAQDDVVKYVAPYLK  289



>ref|XP_010235003.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Brachypodium 
distachyon]
Length=285

 Score =   241 bits (615),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 168/271 (62%), Gaps = 23/271 (8%)
 Frame = -2

Query  1090  SSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADAC  911
             S+  FIVLHG+   C + G   +T  +      KG C+E+G G   SW+M + +Q    C
Sbjct  21    SAVPFIVLHGIGDQCGNDGIASFTDELGKWSGSKGYCMEIGRGSWDSWIMPLQEQANAVC  80

Query  910   RKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKF  734
              K+  M +L  GY+++ LSQGN++GR VIE CD GPPVK+FIS+GGP+AG +S   CG  
Sbjct  81    NKVKEMKDLHEGYNIIGLSQGNLIGRAVIEYCDDGPPVKNFISIGGPHAGTASVPLCGA-  139

Query  733   PWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAER  554
                                  H  P+GY+KIPTDM  YL   KFLP +NNEI   ++A  
Sbjct  140   ---------------------HLAPSGYLKIPTDMAEYLKGCKFLPKLNNEIPSERNATY  178

Query  553   KRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLD  374
             K RFSSL  LVLI+F+ D +++P+ ++ FGYYP+G F+  +P Q+T LY +D  G +TLD
Sbjct  179   KERFSSLENLVLIMFQDDAVLIPRETAWFGYYPDGSFNPVLPPQKTKLYTEDWIGLRTLD  238

Query  373   KAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             + G+VKF S PG HL I+  +++ YI+PY+K
Sbjct  239   ETGRVKFVSVPGGHLRISRSDMKKYIVPYLK  269



>emb|CDX90472.1| BnaA03g43090D [Brassica napus]
Length=296

 Score =   241 bits (616),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/284 (42%), Positives = 173/284 (61%), Gaps = 2/284 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
               V   +FS+ P+S+S  FI+ HG+   C   G   +T  +S +    GSC+E+GNG I 
Sbjct  12    LTVAAVLFSTAPVSNSIPFILFHGIGDKCSG-GVSNFTQLLSNLSASPGSCLEIGNGEID  70

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGG  776
             +W M +  Q  +AC K+  M EL  GY++V+ SQGN+V RG+IE CD  PPV +++S+GG
Sbjct  71    TWFMPLMHQANEACEKVKMMKELSQGYNIVAQSQGNLVARGLIEFCDDAPPVINYVSLGG  130

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG ++   C   P C +      + +YN   Q H  P+GY+KIP +M  YL  SK+LP
Sbjct  131   PHAGIAAIPKCSSGPICAIAEDLMKLEIYNDFVQDHIAPSGYVKIPGEMTKYLDHSKYLP  190

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNE  D +++  K RF SL  LVL++F+ DT ++P+ +S FGYY +  F   +  QQT
Sbjct  191   KLNNERPDQRNSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYTDDGFDSLLSTQQT  250

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              LY +D  G K LD  GKVK+ S  G HL+I   ++  Y++PY+
Sbjct  251   KLYIEDWIGLKALDDVGKVKYVSVSGDHLMIAYNDVVKYVVPYL  294



>emb|CDY09625.1| BnaC07g34360D [Brassica napus]
Length=316

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 180/297 (61%), Gaps = 3/297 (1%)
 Frame = -2

Query  1168  KIMASCFSFSTTFIVLLAI-FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRV  992
              +MA+        + + A+ FS++P S+S  FI+ HG+   C   G   +T  +S +   
Sbjct  19    NLMANILRRPDLLLTVAAVLFSTVPASNSIPFILFHGIGDKCSG-GVGNFTQLVSNLSGS  77

Query  991   KGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD  812
              GSC+E+GNG I +W M +  Q  +AC K+  M EL  GY++V+ SQGN+V RG+IE CD
Sbjct  78    PGSCLEIGNGEIDTWFMPLMHQANEACEKVKMMKELSQGYNIVAQSQGNLVARGLIEFCD  137

Query  811   -GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPT  635
               PPV +++S+GGP+AG ++   C   P+C +      + +YN   Q H  P+GY+KIP 
Sbjct  138   DAPPVINYVSLGGPHAGIAAIPKCSSGPFCDIAEALMKLEIYNDFVQDHIAPSGYVKIPG  197

Query  634   DMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYP  455
             +M  YL  SK+LP +NNE  D +++  K RF SL  LVL++F+ DT ++P+ +S FGYY 
Sbjct  198   EMTKYLDHSKYLPKLNNERPDQRNSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYT  257

Query  454   NGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +  F   +  QQT LY +D  G K LD  GKVK+ +  G HL+I   ++  Y++PY+
Sbjct  258   DDGFDSLLSTQQTKLYTEDWIGLKALDDVGKVKYVTVSGDHLMIAYNDVVKYVVPYL  314



>ref|XP_007039750.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY24251.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 180/297 (61%), Gaps = 2/297 (1%)
 Frame = -2

Query  1168  KIMASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVK  989
             KI  +  S S  FI  L I +    S S  FIVLHG+   C + G   +T  ++     K
Sbjct  55    KIFMAFPSKSIAFISFL-ILTITEASHSIPFIVLHGIGDQCSNRGVKQFTELLTNFSGSK  113

Query  988   GSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG  809
             G C+E+G+G   SW M + +Q A  C K+  + EL  GY++V LSQGN++GRGV+E C+G
Sbjct  114   GYCLEIGDGTWDSWFMPLEEQTAVVCEKVKHLKELSKGYNIVGLSQGNLIGRGVVEFCEG  173

Query  808   -PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTD  632
              PPVK+FIS+GGP+AG +S   CG    C +        +Y    Q H  P+GY+K+P D
Sbjct  174   GPPVKNFISLGGPHAGTASVPLCGSGFLCLIADKLIKSEIYTDYIQAHLAPSGYLKLPND  233

Query  631   MKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPN  452
             +  YL + +FLP +NNE+   +++  K RF+ L  LVLI+F  D +++P+ +S FGYYPN
Sbjct  234   IVHYLEKCRFLPKLNNELPGERNSTYKERFTRLQNLVLIMFEQDNVLIPRETSWFGYYPN  293

Query  451   GDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             G F   +  Q+T LY +D  G KTLD AG+V + S  G HL I+  +++ +++PY+K
Sbjct  294   GGFKPVIRPQETKLYTEDWIGLKTLDDAGRVHYISVSGGHLGISRKDMKKHVVPYLK  350



>ref|XP_009136845.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Brassica 
rapa]
Length=296

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/284 (42%), Positives = 172/284 (61%), Gaps = 2/284 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
               V   +FS+ P+S+S  FI+ HG+   C   G   +T  +S +    GSC+E+GNG I 
Sbjct  12    LTVAAVLFSTAPVSNSIPFILFHGIGDKCSG-GVSNFTQLLSNLSASPGSCLEIGNGEID  70

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGG  776
             +W M +  Q  +AC K+  M EL  GY +V+ SQGN+V RG+IE CD  PPV +++S+GG
Sbjct  71    TWFMPLMHQANEACEKVKMMKELSQGYKIVAQSQGNLVARGLIEFCDDAPPVINYVSLGG  130

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG ++   C   P C +      + +YN   Q H  P+GY+KIP +M  YL  SK+LP
Sbjct  131   PHAGIAAIPKCSSGPICAIAEDLMKLEIYNDFVQDHIAPSGYVKIPGEMTKYLDHSKYLP  190

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNE  D +++  K RF SL  LVL++F+ DT ++P+ +S FGYY +  F   +  QQT
Sbjct  191   KLNNERPDQRNSTFKNRFMSLHNLVLVMFQNDTTLVPKETSWFGYYTDDGFDSLLSTQQT  250

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              LY +D  G K LD  GKVK+ S  G HL+I   ++  Y++PY+
Sbjct  251   KLYIEDWIGLKALDDVGKVKYVSVSGDHLMIAYNDVVKYVVPYL  294



>gb|ACO35364.1| palmitoyl protein thioesterase [Elaeis oleifera]
Length=332

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 183/285 (64%), Gaps = 5/285 (2%)
 Frame = -2

Query  1120  LAIFSSI--PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             LAIF S+  P SS+  FIVLHG+   C + G   +T  +S     +G C+E+G+G   SW
Sbjct  11    LAIFLSVFAPRSSAIPFIVLHGIGDQCANKGVSQFTKLLSKWSGSEGYCIEIGSGAWDSW  70

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
             +M + +Q    C+K+  M EL  GY++V LSQGN++GRGV+E CDG PPVK+FIS+ GP+
Sbjct  71    VMPLQEQTNIVCQKVKEMQELSMGYNIVGLSQGNLIGRGVVEFCDGGPPVKNFISLAGPH  130

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG +S   CG    C L+       +Y+   Q H  P+GY+KIPTD+  YL   +FLP +
Sbjct  131   AGTASVPLCGSGIICMLVDDLIKSQIYSDYIQAHLAPSGYLKIPTDIPAYLEGCRFLPKL  190

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV-PVQQTD  413
             NNEI   +++  K RFSSL  LVLI+F  +++++P+++S FGYYP+G+F+  + P+Q T 
Sbjct  191   NNEIPSERNSTYKERFSSLQTLVLIMFEQESVLIPRVTSWFGYYPDGNFTPVLSPLQTTL  250

Query  412   LYQKDTFGFKTL-DKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             L ++   G K L  K G+VKF S  G HL I+  +++ Y++PY+ 
Sbjct  251   LNRRTGIGLKKLWTKLGRVKFISVQGGHLRISDSDMQKYMVPYLN  295



>ref|XP_008658169.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Zea mays]
Length=427

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 158/232 (68%), Gaps = 1/232 (0%)
 Frame = -2

Query  976  EVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPV  800
            E+G G   SW+M + +Q    C+K+ +M EL  GY++V LSQGN++GR VIE CD GPPV
Sbjct  178  EIGRGAWDSWLMPLQEQANTVCKKVKKMKELSEGYNIVGLSQGNLIGRAVIEYCDCGPPV  237

Query  799  KSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGY  620
            K+FIS+GGP+AG +S   CG    C L+       +Y+   Q H  P+GY+KIPTDM+ Y
Sbjct  238  KNFISIGGPHAGTASVPLCGSGFLCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDY  297

Query  619  LAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFS  440
            L   KFLP +NNEI  A++   K RFSSL  LVLI+F  D +++P+ ++ FGYYP+G FS
Sbjct  298  LKGCKFLPKLNNEIPSARNTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFS  357

Query  439  RAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              +P Q+T LY +D  G KTLD+AG+VKF S PG HL IT  +++ YI+PY+
Sbjct  358  PVLPPQETKLYTEDWIGLKTLDEAGRVKFVSVPGGHLRITRSDMKKYIVPYL  409



>ref|XP_002863365.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39624.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=304

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 181/291 (62%), Gaps = 7/291 (2%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
             ++ ++A+   I +S S  F+VLHG++  C D  +  +T  +  +   +GSC+E+G+G  +
Sbjct  11    WVAVVAVALLIHVSVSVPFVVLHGITAACSDPTNANFTQLLMNLSGSQGSCLEIGDGFFA  70

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMV---SLSQGNMVGRGVIENCDG-PPVKSFIS  785
             S +M +  Q   AC K+ +M EL  GY++V    + QGN+V RG+IE CDG PPV ++IS
Sbjct  71    SMLMPLTQQAEIACEKVKQMKELSQGYNIVGRSQMEQGNLVARGLIEFCDGGPPVYNYIS  130

Query  784   VGGPNAGHSSTIPCG-KFP--WCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLA  614
             +GGP+AG SS   CG + P   C          VY+   Q HF P+GY K P DMK YL 
Sbjct  131   LGGPHAGISSVPTCGAQMPGLVCDAFDALVKADVYSEFVQDHFAPSGYFKNPMDMKRYLE  190

Query  613   QSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRA  434
              SK+LP ++NEI + +++  K RF+SL  LVL+ F+ +TII+P  S+ FG+YP+G     
Sbjct  191   NSKYLPKLSNEIPNQRNSTYKDRFTSLHNLVLVKFQNETIIIPNDSTWFGFYPDGQVEPV  250

Query  433   VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +P  +T LY +D  G KTLD AGKVKF S PG HL +   ++  YI+PY++
Sbjct  251   LPANKTALYTEDWIGLKTLDAAGKVKFVSVPGGHLEMADHDVLKYIVPYLQ  301



>ref|NP_199545.2| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
 gb|AED95500.1| palmitoyl protein thioesterase family protein [Arabidopsis thaliana]
Length=317

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 181/295 (61%), Gaps = 7/295 (2%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V++A  + + +S S  FI+LHG++  C D  +  +T  ++ +    G C+E+GNG+I+S
Sbjct  11    MVVVAFLAKVDISVSVPFIMLHGIASQCSDDTNANFTQLLTNLSGSPGFCLEIGNGVINS  70

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
               + +  Q   AC  +  M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP
Sbjct  71    MFLPLTQQAEIACENVKEMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVFNYISLAGP  130

Query  772   NAGHSSTIP---CG--KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             +AG SS +P   CG    P C          +Y+   Q H  P+GY KIP DMK YL +S
Sbjct  131   HAGISS-LPRGLCGLTSDPACKKFNELIKGALYSETIQDHLAPSGYYKIPNDMKQYLERS  189

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             K+LP +NNEI + ++   K RF+SL  LVL+ F+ D +I P  S+ FG+YP+G+F   + 
Sbjct  190   KYLPKLNNEIPNQRNQTYKDRFTSLHNLVLVKFQDDEVITPNDSTWFGFYPDGEFETLLS  249

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
               QT LY +D  G KTLD AGKVKF S PG H+ +   ++  Y++PY++   P++
Sbjct  250   ANQTKLYTEDWIGLKTLDDAGKVKFVSVPGGHVRMAEEDVVKYVVPYLQNQQPAA  304



>gb|ABD65081.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
 emb|CDY27920.1| BnaCnng05050D [Brassica napus]
Length=298

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/282 (42%), Positives = 173/282 (61%), Gaps = 2/282 (1%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V   +FS++  S++  FIV HG+   C   G   +T  +S +    GSC+E+GNG   SW
Sbjct  14    VAAVLFSTVSFSNAIPFIVFHGIGDQCSG-GVSNFTQLLSSVSGSPGSCLEIGNGEKDSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPN  770
              M +  Q + AC K+ +M EL  GY++V+ SQGNMV RG+IE CD  PPV +++S+GGP+
Sbjct  73    FMPLVQQASVACEKVKQMKELSQGYNIVAESQGNMVARGLIEFCDDAPPVVNYVSLGGPH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG ++   CG  P C +      + +YN   Q H  P+GY+KIP +M  YL  S++LP +
Sbjct  133   AGIAAVPKCGDGPKCAIAEDILKLEIYNDFVQDHIAPSGYVKIPGEMTKYLEHSQYLPKL  192

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             NNE  D +++  K RF+SL  LVL++F+ DT ++P+ +S FGY+ +  F   +  QQT L
Sbjct  193   NNERPDERNSTFKDRFTSLHNLVLVMFQNDTTLIPKETSWFGYFTDEGFGTLLLTQQTKL  252

Query  409   YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             Y +D  G K LD  GKVKF S  G HL+I   ++  Y+ PY+
Sbjct  253   YTEDWIGLKALDDVGKVKFVSVSGDHLMIAFQDVVKYVAPYL  294



>gb|EPS59624.1| hypothetical protein M569_15181, partial [Genlisea aurea]
Length=286

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/285 (42%), Positives = 181/285 (64%), Gaps = 8/285 (3%)
 Frame = -2

Query  1114  IFSSIPLSSSTA-----FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             IFSSI  S S A     FIVLHG+   C   G  ++T  +S     +G C+E+G+G   S
Sbjct  2     IFSSIAFSFSPASLALPFIVLHGIGNQCSSRGIQHFTQQLSNWSNSQGYCLEIGDGSWDS  61

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
             W   + +Q    C+K+ +M EL+ GY++V LSQGN++GRGV+E CDG P V++FIS+ GP
Sbjct  62    WFKPLQEQTEIVCKKVKQMPELRDGYNIVGLSQGNLIGRGVVEMCDGGPRVQNFISLAGP  121

Query  772   NAGHSSTIPCGKF-PWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             +AG +S   CG     C +        +Y+   Q H  P+GY+K+P D+ GYL++ +FLP
Sbjct  122   HAGTASVPLCGSGGALCVVADALIKSEIYSNFVQDHLAPSGYLKLPNDISGYLSKCRFLP  181

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV-PVQQ  419
              +NNEI + ++A  + RFS L  LVLI+F  DT+++P+ +S FGYYP G+F  A+   ++
Sbjct  182   KLNNEIPNGRNATYRERFSGLRNLVLIMFDRDTVVIPKETSWFGYYPEGEFGPAILGPRE  241

Query  418   TDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             T LY++D  G K LD AG+VK+ +  G HL I+  +++ +++PY+
Sbjct  242   TRLYREDWIGLKALDDAGRVKYVAVAGNHLGISEADMKKHVVPYL  286



>ref|XP_002868061.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44320.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=300

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 176/296 (59%), Gaps = 4/296 (1%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLA--IFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVK  989
             M  CF  S     ++A  +FS IP+S S  FI+ HG+   C   G   +T  ++ +    
Sbjct  1     MEKCFRRSVLLSTVIAAMLFSFIPVSISIPFILFHGIGDKCSG-GVSNFTQLLTNLSGSP  59

Query  988   GSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-  812
             G C+E+GNG   SW M +  Q + AC K+  M EL  GY++V+ SQGN+V RG+IE CD 
Sbjct  60    GFCLEIGNGEKDSWFMPLIKQTSLACEKVKTMKELSQGYNIVAESQGNLVARGLIEFCDN  119

Query  811   GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTD  632
              PPV ++IS+GGP+AG +    C   P C +      + VY    Q H  P+GYIKIP +
Sbjct  120   APPVINYISLGGPHAGIAKIPKCASGPICDIGEAMLKLEVYTDFVQDHIAPSGYIKIPGE  179

Query  631   MKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPN  452
             +  YL  SK+LP +NNE  D +++  K RF+ L  LVL++F +DT ++P+ ++ FGYY +
Sbjct  180   ISKYLEHSKYLPKVNNERPDERNSTFKDRFTKLHNLVLVMFESDTTLIPKETAWFGYYED  239

Query  451   GDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
               F   +  QQT LY++D  G K LD AGKVKF S  G HL I+  E+  Y++PY+
Sbjct  240   EGFDTLLSTQQTKLYREDWIGLKALDVAGKVKFESVLGDHLSISDEEVVEYVVPYL  295



>ref|XP_009591271.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=332

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 177/290 (61%), Gaps = 13/290 (4%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             +F   FIV+L + S    + S  F+V HG+S  C + G  Y+T  +S      G C+E+G
Sbjct  2     NFMLIFIVILTLQSIT--TYSLPFVVFHGISDKCSNDGVSYFTELLSNWSGSPGYCIEIG  59

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSF  791
             NG   SW M    QV +       + EL  GYH++ LSQGNMVGRG++E C DGPPVK+ 
Sbjct  60    NGAWDSWFMPFTKQVKE-------IDELSEGYHIIGLSQGNMVGRGLVEFCSDGPPVKNL  112

Query  790   ISVGGPNAGHSSTIPCGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLA  614
             IS+ GP+AG +S   CG+    C L      + +Y+   Q+H  PAGYIKIPTD+  Y  
Sbjct  113   ISLAGPHAGIASVPFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRK  172

Query  613   QSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRA  434
               KFLP +NNE+    ++  K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G +S  
Sbjct  173   GCKFLPVVNNEVHG--NSTFKKRFASLENLVLIMFEKDEILVPKQTSWFGYYPDGSWSTV  230

Query  433   VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +P  +T LY +D  G K LD+AGKVKF +  G HL I+  E++  I+PY+
Sbjct  231   LPANETKLYTEDWIGLKILDEAGKVKFLNVSGSHLEISTSEMKKNILPYL  280



>ref|XP_002877170.1| hypothetical protein ARALYDRAFT_323005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53429.1| hypothetical protein ARALYDRAFT_323005 [Arabidopsis lyrata subsp. 
lyrata]
Length=294

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/293 (41%), Positives = 181/293 (62%), Gaps = 15/293 (5%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             + + TF+ L+ I  S+P      FI+LHG+S  C D  +  +   +S +   +GSCVE+G
Sbjct  9     AVAATFLSLVHIVVSVP------FIMLHGISAECSDHTNSNFPRLLSNLSGSRGSCVEIG  62

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSF  791
             NG   SW+M +  QV   C K+ +M EL+ GY++V+ SQGN+V RG+IE C DGPPV ++
Sbjct  63    NGKSDSWLMPLTKQVEIVCDKVKQMKELRLGYNIVARSQGNLVARGLIEFCDDGPPVYNY  122

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             +S+ GP+AG SS   CG + WC +        +Y+   Q+         +  D+  Y+  
Sbjct  123   VSLAGPHAGESSVPFCGCYEWCDIADKLMEKNIYSDFVQESL-----FLVSQDISEYMKS  177

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
             SK+LP +NNEI + +++  K RF+ L  LVLI+F+ DT+I+P+ SS FG+Y +G+++   
Sbjct  178   SKYLPKLNNEIPNERNSTYKERFTRLKNLVLIMFQNDTVIVPKESSWFGFYQDGNYTSQP  237

Query  430   PV---QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             P+   QQT LY +D  G KTLD AGKVKF S PG HL I   ++  Y++PY++
Sbjct  238   PLLSAQQTKLYTEDWIGLKTLDVAGKVKFVSLPGGHLQIATTDVIKYVVPYLQ  290



>ref|XP_010434663.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X2 [Camelina 
sativa]
Length=294

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 178/295 (60%), Gaps = 10/295 (3%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M   F  S   + L   F  IP+S S  FI+ HG+   C + G   +T  +S +    GS
Sbjct  1     MEKSFQRSVLLVTLSLFF--IPVSISVPFILFHGIRDQCSNGGVSSFTQLLSNLSSSPGS  58

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             C+E+GNG   S  M +  Q   AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  P
Sbjct  59    CLEIGNGNQDSVSMPLTQQANVACEKVKKMKELSHGYNIVAQSQGNLVARGLIEFCDNAP  118

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PV ++IS+GGP+AG  S IP    P C L+       VY    Q H  P+GYIKIPT+M 
Sbjct  119   PVFNYISLGGPHAG-ISDIPKCNSPICKLL----KTRVYTDYIQNHIAPSGYIKIPTEMS  173

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL  SK+LP +NNE  + ++   K RF+SL  LVL++   DT+++P+ SS FGYYP+G 
Sbjct  174   KYLEHSKYLPKLNNERPNKRNPVFKDRFTSLHNLVLVM--GDTVVIPKESSWFGYYPDGA  231

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +  +  QQT +Y +D  G KTLD AGKVKF S PG+HL I   E+  Y++PY+K
Sbjct  232   STPLLSPQQTKIYIEDWIGLKTLDAAGKVKFVSVPGEHLRIAQDEVVKYVVPYLK  286



>ref|XP_010518714.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Tarenaya hassleriana]
Length=288

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 174/280 (62%), Gaps = 8/280 (3%)
 Frame = -2

Query  1114  IFSSIPLSSSTAFIVLHGVSMFC-QDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMG  938
             +F +IP+S S  F++ HGV+  C  D GS  +T  +  +    G CVE+GNG   SW M 
Sbjct  13    LFLTIPVSLSIPFLLFHGVNDECPDDKGS--FTELLRNLSGSPGYCVEIGNGKDDSWSMP  70

Query  937   MNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGH  761
             + +Q   AC+ + +M EL  GY++V+ SQGNMV RG+IE C+G PPV++++S+GGP+AG 
Sbjct  71    LTEQATLACQTVKQMKELSQGYNIVAQSQGNMVARGLIEFCEGGPPVRNYVSLGGPHAGV  130

Query  760   SSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNE  581
             SS   C     C L        VY    Q    P+ Y+KIPTD+  YL  S++LP +NNE
Sbjct  131   SSIPNCPSALICKLAEK----SVYADNVQNTLAPSNYVKIPTDIANYLEHSRYLPLLNNE  186

Query  580   IQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQK  401
               D ++   K RFSSL  L L++F  DT+++P+ ++ FGYYP+GD       QQT LY +
Sbjct  187   KPDEKNPSFKDRFSSLQNLALLMFEEDTVLIPKETAWFGYYPDGDSQTLQSPQQTKLYTE  246

Query  400   DTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             D  G KTLD AGKVKF S  G+HL ++  ++  Y++PY++
Sbjct  247   DWIGLKTLDTAGKVKFISVAGKHLQLSHDDVVKYVVPYLQ  286



>ref|XP_010325388.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Solanum 
lycopersicum]
Length=311

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 169/288 (59%), Gaps = 14/288 (5%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F+  FI  L        + S  F+V HG+S  C + G  ++T  +S      G C+E+GN
Sbjct  3     FTLIFINFLLFTLHSITTYSLPFVVFHGISDKCSNGGITHFTELLSNWSGSSGHCIEIGN  62

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFI  788
             G   SW M    QV  AC+K+ +M EL  GY+M+ LSQGNMVGRGVIE C DGPPV++ I
Sbjct  63    GEWDSWFMPFAKQVDIACQKLKKMSELSEGYNMIGLSQGNMVGRGVIEFCDDGPPVRNLI  122

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+ GP+AG +S   CG   WC L      + +Y+   Q H  PAGYIKIPTD+  Y    
Sbjct  123   SLAGPHAGIASIPFCGSGIWCILEDSLLKLAIYSNFIQAHLAPAGYIKIPTDIANYRKGC  182

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             KFLP +NNE+   +++  K+RF+SL  LVLI+           +S FGYYP+G F+  +P
Sbjct  183   KFLPVLNNEVH--RNSTYKKRFASLENLVLIM-----------TSWFGYYPDGSFTTVLP  229

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
               +T LY +D  G K LD+AGKVK     G HL I+  E++  I+PY+
Sbjct  230   AHKTKLYTEDWIGLKKLDEAGKVKLLKVCGSHLEISTSEMKKNILPYL  277



>gb|EMS65899.1| Palmitoyl-protein thioesterase 1 [Triticum urartu]
Length=331

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 173/301 (57%), Gaps = 30/301 (10%)
 Frame = -2

Query  1078  FIVLHGVSM--FCQDVGSIYYTLTISGMLRVKGSCV------------------------  977
             F+VLHG  +   C D     +T  ++      G C+                        
Sbjct  32    FVVLHGAGIGGQCTDSSVAEFTRLLADWSAADGHCLYVLRYASSTYALPPLEFDSLCSLV  91

Query  976   --EVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
               E+GNG   SW M + +Q    C K+  M EL GGY++V LSQGN+VGR V+E CD GP
Sbjct  92    FREIGNGARDSWHMPLQEQADIMCNKVKEMKELSGGYNIVGLSQGNLVGRAVVEYCDDGP  151

Query  805   PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             PVK+FIS+ GP+AG +S   CG   +C ++       +Y+   Q H  P+GYIKIPTD+ 
Sbjct  152   PVKNFISLAGPHAGTASAPHCGSGFFCVIVDALIKSEIYSDYVQAHLAPSGYIKIPTDID  211

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL   +FLP +NNEI   ++A  K RFS+L  LVLI+F  DT+++P+ +S FGYYP+G 
Sbjct  212   DYLKGCRFLPKLNNEILGERNAAHKERFSNLENLVLIMFENDTVLIPRETSWFGYYPDGA  271

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPS  266
             F   +P QQT LYQ+D  G K LD  G+VKF S  G HL I+  ++  +I+PY+K D PS
Sbjct  272   FDPVLPPQQTKLYQEDWIGLKALDDVGRVKFVSVAGDHLDISNTDMTKHILPYLK-DKPS  330

Query  265   S  263
             +
Sbjct  331   A  331



>ref|XP_006285486.1| hypothetical protein CARUB_v10006914mg [Capsella rubella]
 gb|EOA18384.1| hypothetical protein CARUB_v10006914mg [Capsella rubella]
Length=287

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 183/288 (64%), Gaps = 23/288 (8%)
 Frame = -2

Query  1138  TTFIVLLAIFS-SIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             +  ++ L++FS SIP+S S  F+V HG    C +      TL++  +    GSCVE+GNG
Sbjct  9     SLLVITLSLFSFSIPVSLSLPFVVFHGFGGECSNNKVSNLTLSLRTLSGHPGSCVEIGNG  68

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFIS  785
             L+ S  M +  Q ++AC+KI +M EL  GY++V+ SQGN+V RG+IE CD  PPV +++S
Sbjct  69    LLDSLFMPIRQQASEACKKIKQMPELSEGYNIVAESQGNLVARGLIEFCDNAPPVINYVS  128

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +GGP+AG ++ IP G                       H  P+GY+KIPTD++ YL  SK
Sbjct  129   LGGPHAGIAA-IPEG--------------------CTDHVAPSGYVKIPTDIEKYLEYSK  167

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             +LP +NNE    +++  K RF+SL  LVLI+++ DT+++P+ +S FGYYP+G FS  +P 
Sbjct  168   YLPELNNERPGEKNSTFKDRFTSLHNLVLIMYQNDTMLVPRETSWFGYYPDGAFSPVLPP  227

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             Q+T LY +D  G KTLD AGKVKF S PG H+ I   ++  Y++PY++
Sbjct  228   QKTKLYTEDWIGLKTLDDAGKVKFVSVPGGHIEIRDEDLVKYVVPYLQ  275



>gb|KFK30318.1| hypothetical protein AALP_AA7G246200 [Arabis alpina]
Length=318

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 126/299 (42%), Positives = 184/299 (62%), Gaps = 9/299 (3%)
 Frame = -2

Query  1135  TFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQ-DVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             + +V + + + + +S S  FIVLHG+   C  D  +  +T  +  +    GSCVEVGNG+
Sbjct  7     SVVVAITLLALVHVSVSVPFIVLHGIQADCSYDSFNGNFTELLRNLSGSPGSCVEVGNGI  66

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISV  782
             + SW+M +  QV   C K+  M EL+ GY++V  SQGN+V RG+IE CD GPPV ++IS+
Sbjct  67    LDSWIMPLTKQVEIVCEKVKNMEELRQGYNIVGRSQGNLVARGLIEFCDDGPPVYNYISL  126

Query  781   GGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKF  602
              GP+AG  S   C    WC  +      G+Y    Q H  P+GY KIP+D+  YL  +K+
Sbjct  127   AGPHAGICSIPWCTYGKWCNEVNTLIEKGLYTDFVQDHLAPSGYYKIPSDIPKYLESAKY  186

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNG----DFSRA  434
             LP +NNE  + +++  K RF+SL  LVL++F+ D+ I+P+ SS FG +P+G    D S  
Sbjct  187   LPILNNEKPNQRNSTYKDRFTSLNNLVLVMFQNDSAIIPKESSWFGVFPDGTNPNDTSPP  246

Query  433   --VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
               +  QQT LY +D  G KTLD AGKV+F S PGQH+ +  P+I  Y++P ++ + PSS
Sbjct  247   PLLSAQQTPLYIEDWIGLKTLDVAGKVQFVSVPGQHVEMATPDIIKYVVPLLQ-NKPSS  304



>ref|XP_010439996.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Camelina sativa]
Length=318

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/287 (42%), Positives = 175/287 (61%), Gaps = 3/287 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             I    +FS +P+S+S  FI+ HG+   C   G   +T  +S +    GSC+E+GNG   S
Sbjct  15    IAAAVLFSFVPVSTSIPFILFHGIGDKCSG-GVSNFTQLLSNLSGSPGSCLEIGNGENDS  73

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGP  773
             W M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  PPV +++S+GGP
Sbjct  74    WFMPLTKQTSLACEKVKQMKELSQGYNIVAESQGNLVARGLIEFCDNAPPVINYVSLGGP  133

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYN-PMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             +AG ++   C   P C +        +YN    Q H  P+G++KIP  +  YLA SK+LP
Sbjct  134   HAGIAAIPKCASGPLCAMAEALLKSAIYNNDFIQDHLAPSGFVKIPGQISKYLAHSKYLP  193

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNE  D +++  K RF+SL  LVL++F+ DT + P+ ++ FGYY +G     +  QQT
Sbjct  194   KLNNERPDERNSTFKDRFASLHNLVLVMFQNDTTLTPKETAWFGYYQDGGLDTLLSTQQT  253

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
              LY++D  G K LD AGKVKF S  G HL I+  E+  Y++PY+  D
Sbjct  254   KLYKEDWIGLKALDIAGKVKFESVLGDHLDISDEEVVEYVVPYLMQD  300



>gb|EYU19274.1| hypothetical protein MIMGU_mgv1a010471mg [Erythranthe guttata]
 gb|EYU19275.1| hypothetical protein MIMGU_mgv1a010471mg [Erythranthe guttata]
Length=311

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 168/249 (67%), Gaps = 1/249 (0%)
 Frame = -2

Query  1024  YTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGN  845
             +T  ++     KG C+EVG+G   SW   + +Q    C K+ +M EL+ GY++V LSQGN
Sbjct  4     FTQELNDWSNSKGYCLEVGDGSWDSWFKPLQEQTEIVCNKVKQMKELQEGYNIVGLSQGN  63

Query  844   MVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKH  668
             ++GRGVIE C+G PPV++F+S+GGP+AG +S   CG   +C +  +     +Y+   Q H
Sbjct  64    LIGRGVIELCEGGPPVRNFVSLGGPHAGTASVPLCGTGIFCIIADNLIKSEIYSDYIQAH  123

Query  667   FGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIIL  488
               P+GY+K+P D++GYL++ +FLP +NNE  D ++A  K RF+SL  LVLI+F  DT+++
Sbjct  124   LAPSGYLKMPNDIEGYLSKCRFLPKLNNEHADEKNATYKERFTSLQNLVLIMFEHDTVLI  183

Query  487   PQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEI  308
             P+ +S FGYYP+G F+  +P QQT LY++D  G K L +AG+VK+    G HL I+  ++
Sbjct  184   PKETSWFGYYPDGAFNPILPPQQTKLYKEDWIGLKELTEAGRVKYIKVAGNHLGISKDDM  243

Query  307   RMYIIPYMK  281
             + Y++PY++
Sbjct  244   KKYVVPYLE  252



>ref|XP_009797090.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X3 [Nicotiana 
sylvestris]
Length=333

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 168/270 (62%), Gaps = 11/270 (4%)
 Frame = -2

Query  1087  STAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACR  908
             S  F+V HG+S  C + G  Y+T  +S      G C+E+GNG   SW M    QV +   
Sbjct  20    SLPFVVFHGISDKCSNEGVSYFTELLSNWSGSPGYCIEIGNGEWDSWFMPFTKQVKE---  76

Query  907   KITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGPNAGHSSTIPCGKFP  731
                 + EL  GYH++ LSQGNMVGRG++E C DGPPVK+ IS+ GP+AG +S   CG+  
Sbjct  77    ----IDELSEGYHIIGLSQGNMVGRGLVELCSDGPPVKNLISLAGPHAGIASVPFCGQSG  132

Query  730   W-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAER  554
               C L      + +Y+   Q+H  PAGYIKIPTD+  Y    KFLP +NNEI    ++  
Sbjct  133   LLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVVNNEIHG--NSTF  190

Query  553   KRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLD  374
             K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G +S  +P ++T LY +D  G K LD
Sbjct  191   KKRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKLYTEDWIGLKILD  250

Query  373   KAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +AGKVKF +  G HL I+  E++  I+PY+
Sbjct  251   EAGKVKFLNVSGNHLEISTSEMKKNILPYL  280



>gb|AFW87849.1| hypothetical protein ZEAMMB73_061678 [Zea mays]
Length=288

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 168/283 (59%), Gaps = 22/283 (8%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
              ++LL + +  P++S   F+VLHG+   C + G   +T  +      KG C+E+G G   
Sbjct  10    LLILLPVLA--PVASGVPFVVLHGIGDECGNDGLSSFTKMLGEWSGSKGYCIEIGRGAWD  67

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPPVKSFISVGGP  773
             SW+M + +Q    C+K+ +M EL  GY++V LSQGN++GR VIE CD  P   F+     
Sbjct  68    SWLMPLQEQANTVCKKVKKMKELSEGYNIVGLSQGNLIGRAVIEYCDCGPPSGFL-----  122

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
                            C L+       +Y+   Q H  P+GY+KIPTDM+ YL   KFLP 
Sbjct  123   ---------------CILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCKFLPK  167

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNEI  A++   K RFSSL  LVLI+F  D +++P+ ++ FGYYP+G FS  +P Q+T 
Sbjct  168   LNNEIPSARNTTYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQETK  227

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             LY +D  G KTLD+AG+VKF S PG HL IT  +++ YI+PY+
Sbjct  228   LYTEDWIGLKTLDEAGRVKFVSVPGGHLRITRSDMKKYIVPYL  270



>gb|KDP39913.1| hypothetical protein JCGZ_03444 [Jatropha curcas]
Length=351

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/305 (39%), Positives = 185/305 (61%), Gaps = 7/305 (2%)
 Frame = -2

Query  1141  STTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG  962
             S    +++  F  +  +SS  FIVLHG+   C++ G   +T  ++      G C+EVG+G
Sbjct  7     SIAISLIVVAFFLVSFASSIPFIVLHGIGDQCKNRGVKQFTDLLTNFSGSPGYCLEVGDG  66

Query  961   LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFIS  785
             L +SW + +  Q+   C K+  M EL+ GY++V LSQGN++ RGVIE CDG PPVK+FIS
Sbjct  67    LWNSWFLPLQKQMGLVCDKVKEMKELREGYNIVGLSQGNLIARGVIEFCDGGPPVKNFIS  126

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             + GP+AG +S   CG    C +  +     +Y+   Q H  PAGY+K P D+  YL + K
Sbjct  127   LAGPHAGTASVPLCGTGILCIIANNLLKSEIYSDYVQDHLAPAGYLKFPNDIPNYLKKCK  186

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             FLP +NNE+   +++  K R +SL  LVLI+F  D +++P+ ++ FGYY +G F   +P 
Sbjct  187   FLPKLNNELPGERNSIYKERLTSLQNLVLIMFENDKVLIPKETAWFGYYADGSFETILPA  246

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS*LGP--  251
             +QT LY +D  G K L++AG+V F +  G HL I+  +++ +++P++   +  S + P  
Sbjct  247   EQTKLYTEDWIGLKALNEAGRVHFVNVSGGHLGISRSDMKKHVVPFL---VDRSRIAPTN  303

Query  250   -RDKD  239
              R+KD
Sbjct  304   QREKD  308



>ref|XP_009108322.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Brassica rapa]
Length=298

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/284 (42%), Positives = 175/284 (62%), Gaps = 2/284 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
               V   +FS+ P S++  FIV HG+   C   G   +T  +S +    GSC+E+GNG   
Sbjct  12    LTVATVLFSTAPFSNAIPFIVFHGIGDQCSG-GVSNFTQLLSSVSGSPGSCLEIGNGEED  70

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGG  776
             SW M +  Q ++AC+K+  M EL  GY++V+ SQGNMV RG+IE C D PPV +++S+GG
Sbjct  71    SWFMPLVLQASEACKKVKLMNELSQGYNIVAESQGNMVARGLIEFCHDAPPVINYVSLGG  130

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG +    C     C +      + +YN   Q H  P+GYIKIP +M  YL  S++LP
Sbjct  131   PHAGIARVPKCPSGLKCDIAEAILKLEIYNDFVQDHIAPSGYIKIPGEMTKYLEHSQYLP  190

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNE  D +++  K RF+SL  LVL++F+ DT+++P+ +S FGYY +  F   +  Q+T
Sbjct  191   KLNNERPDDRNSIFKDRFASLHNLVLVMFQDDTVLIPKETSWFGYYTDEGFGTLLSTQET  250

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              LY +D  G K LD AGKVK+ S  G+HL+I+  ++  Y+ PY+
Sbjct  251   KLYTEDWIGLKALDDAGKVKYVSVSGEHLMISFQDVVKYVAPYL  294



>ref|NP_193477.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 ref|NP_001190752.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 ref|NP_001190753.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 gb|AAY25412.1| At4g17470 [Arabidopsis thaliana]
 gb|AEE83895.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 gb|AEE83896.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
 gb|AEE83897.1| putative palmitoyl-protein thioesterase [Arabidopsis thaliana]
Length=308

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 184/298 (62%), Gaps = 6/298 (2%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M   F  S   + L   F SIP+S S  F++ HG    C +      T  +       G+
Sbjct  1     MEKSFQRSALLVTLSLFFFSIPVSLSVPFVLFHGFGGECSNDKVSNLTQFLINHSGYPGT  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
             CVE+G+G+  S  M +  Q + AC KI +M EL  GY++V+ SQGN+V RG+IE CD  P
Sbjct  61    CVEIGDGVKDSLFMPLRQQASIACEKIKQMPELSEGYNIVAESQGNLVARGLIEFCDNAP  120

Query  805   PVKSFISVGGPNAGHSSTIPCG-KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDM  629
             PV +++S+GGP+AG  + IP G    +C LM  ++ + +Y+  AQ H  P+GY+K P ++
Sbjct  121   PVINYVSLGGPHAG-VAAIPEGCDSAFCILMKAFFAV-IYSDFAQDHTAPSGYVKKPMEI  178

Query  628   KGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNG  449
             K YL  SK+LP +NNE    +++  K RF+SL  LVLI+F+ DTI++P+ +S FGYYP+G
Sbjct  179   KNYLEHSKYLPKLNNERPGEKNSTFKDRFTSLQNLVLIMFQNDTILVPRETSWFGYYPDG  238

Query  448   DFSRA--VPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
               S    +P Q+T LY +D  G KTLD AGKV+F S PG H+ IT  ++  Y++PY++
Sbjct  239   ASSSTPVLPPQKTKLYTEDWIGLKTLDDAGKVRFISVPGGHIEITEEDLVKYVVPYLQ  296



>ref|XP_004246162.2| PREDICTED: palmitoyl-protein thioesterase 1-like [Solanum lycopersicum]
Length=270

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -2

Query  982  CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
            C E+G+G+ SS+ M + +QV  AC K+  M EL+ GY++V LSQGNMV RG+IE CD  P
Sbjct  22   CTEIGDGVYSSYYMPLENQVQIACEKVKGMEELQQGYNIVGLSQGNMVARGLIEFCDEAP  81

Query  805  PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
             V +FIS+GGPNAG +    C   PWC   G  +G+G+Y+   Q H+ P+GYIK+P D+ 
Sbjct  82   RVNNFISIGGPNAGIAYAPACTGNPWCDGAGGIFGIGIYSDYVQTHYAPSGYIKLPNDIA  141

Query  625  GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
            GYL   ++LP +NNEI +A +   K RF+SL  LVLI+F  D +I P+ SS FG+Y +G 
Sbjct  142  GYLRGCRYLPKLNNEIPNATNPIYKERFTSLQNLVLIMFEHDGVITPKESSWFGFYQDGT  201

Query  445  FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             S+ +P QQT+LY +DTFG +TLDKAGKVKF   PG HLV+   E++  ++PY+
Sbjct  202  NSQILPPQQTNLYLEDTFGLQTLDKAGKVKFIKLPGYHLVMDIQEMQQNVVPYL  255



>ref|NP_193479.1| putative palmitoyl-(protein) hydrolase [Arabidopsis thaliana]
 gb|AAM91633.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83899.1| putative palmitoyl-(protein) hydrolase [Arabidopsis thaliana]
Length=300

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 172/283 (61%), Gaps = 2/283 (1%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V   +FS IP+S S  FI+ HG+   C   G   +T  ++ +    G C+E+GNG   S
Sbjct  14    VVAAVLFSLIPVSISIPFILFHGIGDKCSG-GVSNFTQLLTNLSGSPGYCLEIGNGEKDS  72

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGP  773
             W M +  Q + AC K+  M  L  GY++V+ SQGN+V RG+IE CD  PPV ++IS+GGP
Sbjct  73    WFMPLRKQTSVACEKVKAMKVLSQGYNIVAESQGNLVARGLIEFCDNAPPVINYISLGGP  132

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG +    C   P C +      + VY    Q H  P+GYIKIP ++  YL  SK+LP 
Sbjct  133   HAGIAKIPKCNSGPICAIGEALLKLEVYTDFVQDHIAPSGYIKIPGEISKYLEHSKYLPK  192

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNE  D +++  K RF++L  LVL++F +DT+++P+ ++ FGYY +  F   +  QQT 
Sbjct  193   LNNERPDERNSTFKDRFTNLHNLVLVMFESDTMLIPKETAWFGYYEDEGFDTLLSAQQTK  252

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             LY++D  G K LD AGKVKF S  G HL I+  E+  +++PY+
Sbjct  253   LYREDWIGLKALDAAGKVKFESVLGDHLSISDEEVVEFVVPYL  295



>emb|CDY25974.1| BnaC09g20130D [Brassica napus]
Length=315

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 165/267 (62%), Gaps = 1/267 (0%)
 Frame = -2

Query  1078  FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKIT  899
             FIVLHG++  C       +T  ++ +    G C+EVGNG   SW M +  Q    C K+ 
Sbjct  29    FIVLHGIAASCSQGKEANFTQLLTNLSGSPGYCIEVGNGKRDSWFMPLMKQTEIVCEKVK  88

Query  898   RMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCG  722
             +M EL+ GY++V  SQGN+V RG+IE C G PPV ++IS+ GP+AG SS   CG    C 
Sbjct  89    QMKELRKGYNIVGRSQGNLVARGLIEFCHGGPPVFNYISLAGPHAGISSVPLCGNGSLCE  148

Query  721   LMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRF  542
             +        +Y+   Q H  P+ Y+KIPT++  YL +SK+LP +NNEI + +++  K RF
Sbjct  149   IADKLIKSEIYSDFIQNHLAPSNYLKIPTEINKYLEKSKYLPKLNNEIPNQRNSTYKERF  208

Query  541   SSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGK  362
             +SL  LVL+ F+ D +I+PQ SS FG+Y +G F   +  QQT LY +D  G KTLD AGK
Sbjct  209   TSLHNLVLVKFQDDKVIVPQDSSWFGFYRDGAFKPLLSAQQTKLYTEDWIGLKTLDDAGK  268

Query  361   VKFFSCPGQHLVITPPEIRMYIIPYMK  281
             VKF S  G H+++   ++  Y++PY++
Sbjct  269   VKFVSVKGAHIIMADLDVVKYVVPYLQ  295



>emb|CDP10011.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/296 (43%), Positives = 183/296 (62%), Gaps = 8/296 (3%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHG-VSMFCQDVGSIYYTLTISGMLRVKGSCVEV  971
             ++S   I +++ FS + L SS  FI+LHG +   C + G + YT  +  +    G C+EV
Sbjct  55    TYSPFIIFIVSAFSLVSLCSSIPFILLHGRLGDSCSNPGPVLYTQQLRYLSGSVGFCLEV  114

Query  970   GNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKS  794
             GNG I+SW   +  QV + CRK+    EL+ GY++V  SQGN+VGRG++E CD  PP  +
Sbjct  115   GNGAITSWDTPLEAQVEEVCRKVKATPELQNGYNIVGQSQGNLVGRGLVELCDDAPPAIN  174

Query  793   FISVGGPNAGHSSTIPCGKFPWCGLMGHY---YGMGVYNPMAQKHFGPAGYIKIPTDMKG  623
             FIS+GGP+AG +S   C +F    L  HY    G GVY    Q H  P+GY K+P D   
Sbjct  175   FISLGGPHAGVASIPNCSQFD--ALCNHYTALLGRGVYTNYVQAHVAPSGYTKLPYDYLV  232

Query  622   YLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDF  443
             YLA+  FLP +NNE+   ++A  K+R ++L  LVLI+F+ D ++ P+ SS FGYY +G  
Sbjct  233   YLAKCSFLPKLNNELLQ-KNATYKQRITNLKNLVLIMFQEDGVVKPKESSLFGYYADGIP  291

Query  442   SRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
                +P+QQT LY +D  G +TLD+ G++K  S PG HL+I+  +   Y++PY+K D
Sbjct  292   GPVLPLQQTRLYTEDWIGLRTLDETGRLKLISVPGVHLLISLSDTMRYVVPYLKDD  347



>ref|XP_002865125.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41384.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 177/294 (60%), Gaps = 6/294 (2%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V++A  + + +S S  FI+LHG++  C D  +  +T  ++ +    G CVE+GNG+++S
Sbjct  11    MVVVAFLAMVHVSLSVPFIMLHGIASHCSDATNANFTQLLTNLSGSPGFCVEIGNGVVTS  70

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGP  773
               + +  Q   AC  + +M EL  GY++V  SQGN+V RG+IE CD GPPV ++IS+ GP
Sbjct  71    LFLPLTQQAEIACENVKQMKELSQGYNIVGRSQGNLVARGLIEFCDDGPPVYNYISLAGP  130

Query  772   NAGHSSTIP--CG--KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             +AG SS  P  CG    P C          +Y+   Q H  P+GY KIP D+  YL  SK
Sbjct  131   HAGISSIPPAICGLKSDPACKKFDELIKGALYSEFIQDHLAPSGYYKIPNDINEYLESSK  190

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             +LP +NNEI D ++   K RF+ L  LVL+ F+ D II P  S+ FG+YP G+F   +  
Sbjct  191   YLPKLNNEIPDQRNQTYKDRFTILQNLVLVKFQDDEIITPNDSTWFGFYPEGEFEPLLSP  250

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
              QT LY +D  G KTLD AGKVKF S  G HL +   ++  +++PY++ + PSS
Sbjct  251   NQTKLYTEDWIGLKTLDDAGKVKFVSVAGGHLNMADQDVVKHVVPYLQ-NQPSS  303



>gb|KFK24041.1| hypothetical protein AALP_AAs42697U000100 [Arabis alpina]
Length=300

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 176/296 (59%), Gaps = 4/296 (1%)
 Frame = -2

Query  1168  KIMASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVK  989
              I+   F F  T   +L   S +P+  S  FI+ HG+   C   G   +T  +S +    
Sbjct  3     NILRRRFGFFLTVTAVL--LSMVPVIKSIPFILFHGIGDKCSG-GVGNFTQLLSNLSGSS  59

Query  988   GSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-  812
             GSC+E+GNG   SW M + +Q   AC K+  M EL  GY++V+ SQGN+V RG+IE CD 
Sbjct  60    GSCLEIGNGEPDSWFMPLKEQAIVACEKVKEMKELSQGYNIVAQSQGNLVARGLIEFCDN  119

Query  811   GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTD  632
              PPV +++S+GGP+AG ++   C   P C +      + VYN   Q H  P+G++KIP +
Sbjct  120   APPVFNYVSLGGPHAGIAAIPKCASGPICDIAEAMMKLEVYNDFVQDHIAPSGFVKIPGE  179

Query  631   MKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPN  452
             M  YL  SK+LP +NNE  D +++  K RF+SL  LVL++F  DT ++P+ +S FGYYP+
Sbjct  180   MSKYLKHSKYLPKLNNERPDERNSTFKDRFASLHNLVLVMFEDDTTLIPKETSWFGYYPD  239

Query  451   GDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
               F   +  QQT LY +D  G KTLD AGKVK+ S  G HL I   ++  Y++PY+
Sbjct  240   DGFDILLSTQQTKLYIEDWIGLKTLDDAGKVKYVSVSGDHLNIAYEDVVKYVVPYL  295



>ref|XP_006386541.1| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
 gb|ERP64338.1| hypothetical protein POPTR_0002s13810g [Populus trichocarpa]
Length=291

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 158/238 (66%), Gaps = 1/238 (0%)
 Frame = -2

Query  976  EVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPV  800
            E+G+G   SW M + DQ   AC K+  M EL  GY+++ LSQG+++ RGVIE C+G PPV
Sbjct  15   EIGDGAWDSWTMPLQDQTEIACEKVKSMSELSDGYNLIGLSQGSLIARGVIEFCEGGPPV  74

Query  799  KSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGY  620
            K+ I++ G +AG +S   CG    C L+       +Y+   Q+H  P+GYIKIPTD+  Y
Sbjct  75   KNLITLAGIHAGIASIPFCGSTIICALLDDLIKSEIYSSYVQEHLAPSGYIKIPTDIPAY  134

Query  619  LAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFS  440
            +   +FLP +NNEI++ +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F 
Sbjct  135  IKGCRFLPKLNNEIKNTRNSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFD  194

Query  439  RAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPS  266
              +P Q+T LY +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY++   PS
Sbjct  195  TVLPAQETLLYTEDWIGLKTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLEEQAPS  252



>ref|XP_002865123.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41382.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=313

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 174/287 (61%), Gaps = 1/287 (0%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             +  +V++A  + + +S S  FI+LH +   C D  +  +T  ++ +    G C+E+GNG+
Sbjct  8     SCVMVVVAFLAMVHVSLSVPFIILHEIGTQCSDATNANFTQLLTNLSGSPGFCLEIGNGI  67

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISV  782
               SW+M +  Q   AC  + +M EL  GY++V  +QGN+V RG+IE CDG PPV ++IS+
Sbjct  68    SDSWLMPLTRQAEIACDNVKQMEELSLGYNIVGRAQGNLVARGLIEFCDGGPPVYNYISL  127

Query  781   GGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKF  602
              GP+AG ++  PC     C +        VY+  AQ +  P+GY K P ++  YL   K+
Sbjct  128   AGPHAGIAAFPPCNSGGICNITNEIINGDVYSDFAQDNLAPSGYYKNPHNVTEYLKGCKY  187

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ  422
             LP +NNE  D ++   K RF+SL  LV +LF+ DT+I+P+ SS FG+YP+GD +  +PV 
Sbjct  188   LPKLNNERPDQRNQTYKDRFTSLQKLVFVLFQNDTVIVPKESSWFGFYPDGDLTHVLPVS  247

Query  421   QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             QT LY +D  G K L +AGKV+F   P  HL+I   ++  Y++P ++
Sbjct  248   QTKLYIEDWIGLKALARAGKVQFVIVPSAHLIIADEDLVNYVVPLLE  294



>gb|EYU19278.1| hypothetical protein MIMGU_mgv1a023056mg, partial [Erythranthe 
guttata]
Length=292

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 177/292 (61%), Gaps = 12/292 (4%)
 Frame = -2

Query  1141  STTFIVLLAIFSSI----PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVE  974
             S  FI+L+ I  ++      S+   FI+LHGV+  C +     Y   ++     KGSC+E
Sbjct  5     SQKFILLVLILQALCWQTSFSAQLPFILLHGVNSQCTNDRPTSYMKRLTQWSGAKGSCLE  64

Query  973   VGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVK  797
             +GNG  SSW + ++ QV         M EL  GY++V +SQGN+VGRG++E C+G PPV 
Sbjct  65    IGNGTWSSWFIPLDKQVKG-------MKELANGYNIVGISQGNLVGRGIVEFCEGSPPVN  117

Query  796   SFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYL  617
             + IS+G P AG +S    G  P   L  +    G+Y+  AQK F P+GY K+P ++KGYL
Sbjct  118   NLISIGAPQAGIASVPRAGGVPVITLANNILKAGIYSDYAQKRFAPSGYTKLPKNIKGYL  177

Query  616   AQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSR  437
                KFLP +NNE  + ++   K+R +SL  LVLI+   +T++ P+ SS FGYY +G+  +
Sbjct  178   KNCKFLPKLNNERPNDRNPNYKKRLTSLNNLVLIMHENETVVKPKESSWFGYYEDGNDKK  237

Query  436   AVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +  ++T LY++D  G KTLDKAG+VKF    G H+ +   +I+ Y+IPY++
Sbjct  238   VLQPRETKLYKEDWIGLKTLDKAGRVKFIKVGGPHVQMLDEDIKKYVIPYLQ  289



>ref|XP_006414226.1| hypothetical protein EUTSA_v10025854mg [Eutrema salsugineum]
 gb|ESQ55679.1| hypothetical protein EUTSA_v10025854mg [Eutrema salsugineum]
Length=297

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/288 (43%), Positives = 175/288 (61%), Gaps = 7/288 (2%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGL  959
             +  +V L+IF  IP++ S  FI+ HGV   C       +T  +S +    GSC+E+GNG 
Sbjct  8     SALLVTLSIFFFIPVAISVPFILFHGVQEQCSYATVSSFTQLLSNLSGSPGSCLEIGNGE  67

Query  958   ISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISV  782
               S  M +  Q + AC K+ +M EL  GY++V  SQGN+V RG+IE CD  PPV ++IS+
Sbjct  68    EDSVSMPLTQQASVACEKVKQMKELSQGYNIVGQSQGNLVARGLIEFCDNAPPVFNYISL  127

Query  781   GGPNAGHSSTIPCGKFPWCG-LMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSK  605
             GGP+AG S  IP     +C  L         Y+   Q H  P+GYIKIPT+M  YL  SK
Sbjct  128   GGPHAGISD-IP----EYCSSLACQLLITETYSDYVQDHIAPSGYIKIPTEMSEYLEHSK  182

Query  604   FLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPV  425
             +LP +NNE  + +++  K RF+SL  LVL++F+ D +++P+ S  FGYYP+G  +  +  
Sbjct  183   YLPMLNNERANERNSTFKDRFTSLQNLVLVMFQGDKVVIPKESCWFGYYPDGASTPLLSP  242

Query  424   QQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             QQT LY +D  G KTLD AGKVKF S PG+H  +   +   Y++PY++
Sbjct  243   QQTKLYTEDWIGLKTLDDAGKVKFVSVPGEHNQMAQDDAVRYVVPYLQ  290



>ref|XP_002531468.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
 gb|EEF30918.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus 
communis]
Length=327

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/261 (42%), Positives = 166/261 (64%), Gaps = 1/261 (0%)
 Frame = -2

Query  1063  GVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGEL  884
             G+   C++ G   +T  ++      G C+E+G+G   SW + +  Q    C K+  M EL
Sbjct  3     GIGDQCKNRGVKEFTDLLTNFSGSPGFCLEIGDGTWDSWFLPLEKQTEIVCDKVKEMKEL  62

Query  883   KGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHY  707
               GY++V LSQGN++GRGV+E C+G PPVK+FIS+GGP+AG +S   CG   +C +  + 
Sbjct  63    SNGYNIVGLSQGNLIGRGVLEFCEGAPPVKNFISLGGPHAGTASVPLCGSGIFCIIADNL  122

Query  706   YGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTM  527
                 +Y+   Q H  PAGY+K+P D+  YL + KFLP +NNEI D +++  K RF+SL  
Sbjct  123   IKGEIYSDFIQDHLAPAGYLKLPNDIPHYLDKCKFLPKLNNEIPDERNSTYKERFTSLEN  182

Query  526   LVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFS  347
             LVLI+   D +++P+ +S FGYYP+G F   +PVQQT LY +D  G KTLD+AG+V F +
Sbjct  183   LVLIMSEDDNVLIPKETSWFGYYPDGSFKTILPVQQTKLYVEDWIGLKTLDEAGRVHFVN  242

Query  346   CPGQHLVITPPEIRMYIIPYM  284
               G HL I+  ++  +++P++
Sbjct  243   VSGGHLGISRSDMEKHVVPFL  263



>ref|XP_008437042.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Cucumis 
melo]
Length=275

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 162/250 (65%), Gaps = 2/250 (1%)
 Frame = -2

Query  1024  YTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITR-MGELKGGYHMVSLSQG  848
             +T  +S     KG C+E+GNG   SW M +  Q    C K+ + M +LK G++ V LSQG
Sbjct  4     FTKYLSDNSGSKGYCIEIGNGGWDSWFMTLEAQSQIVCNKVVKKMKDLKEGFNFVGLSQG  63

Query  847   NMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQK  671
             N++GR V+E CDG PPV++FIS+GGP+AG SS   CG   WC L      + +Y+ + Q 
Sbjct  64    NLIGRAVVEFCDGAPPVQNFISLGGPHAGISSVPLCGSGIWCLLADDLLKLAIYSDVVQN  123

Query  670   HFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTII  491
                P+G+IK+P D+  YL   KFLP +NNE  DA+++  K RFSSL  LVLI+F  DT++
Sbjct  124   SLAPSGFIKLPNDIPNYLEHCKFLPKLNNERPDARNSTYKERFSSLKNLVLIMFEDDTVL  183

Query  490   LPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPE  311
             +P+ +S FGYYP+G+F   +P QQT LY +D  G ++LD+ G+VKF    G HL I+  +
Sbjct  184   VPKETSWFGYYPDGEFEPILPPQQTKLYIEDWIGLRSLDEGGRVKFIKVAGGHLGISYSD  243

Query  310   IRMYIIPYMK  281
              + YI+PY++
Sbjct  244   AKKYIVPYLE  253



>dbj|BAA97168.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=293

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 176/290 (61%), Gaps = 21/290 (7%)
 Frame = -2

Query  1129  IVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISS  950
             +V++A  + + +S S  FI+LHG++  C D  +  +T  ++ +    G C+E+GNG+I+S
Sbjct  11    MVVVAFLAKVDISVSVPFIMLHGIASQCSDDTNANFTQLLTNLSGSPGFCLEIGNGVINS  70

Query  949   WMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGP  773
               + +  Q   AC  +  M EL  GY++V  SQGN+V RG+IE CDG PPV ++IS+ GP
Sbjct  71    MFLPLTQQAEIACENVKEMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVFNYISLAGP  130

Query  772   NAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPY  593
             +AG SS +P G    CG                 H  P+GY KIP DMK YL +SK+LP 
Sbjct  131   HAGISS-LPRG---LCG----------------DHLAPSGYYKIPNDMKQYLERSKYLPK  170

Query  592   INNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTD  413
             +NNEI + ++   K RF+SL  LVL+ F+ D +I P  S+ FG+YP+G+F   +   QT 
Sbjct  171   LNNEIPNQRNQTYKDRFTSLHNLVLVKFQDDEVITPNDSTWFGFYPDGEFETLLSANQTK  230

Query  412   LYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
             LY +D  G KTLD AGKVKF S PG H+ +   ++  Y++PY++   P++
Sbjct  231   LYTEDWIGLKTLDDAGKVKFVSVPGGHVRMAEEDVVKYVVPYLQNQQPAA  280



>ref|XP_010449611.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=295

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 175/297 (59%), Gaps = 9/297 (3%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGS  983
             M      S   + L   F SIP+S S  F++ HG++  C +      T  ++      GS
Sbjct  1     MEKSLQRSVLLVTLSLFFFSIPVSLSVPFVLFHGIAGECSNDEVSNLTKFLNNYSSSPGS  60

Query  982   CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP  803
             CVE+GNGL+ S  M +  Q + AC KI +M EL  GY++V LSQGN V RG+IE CD  P
Sbjct  61    CVEIGNGLVDSLYMPLTQQASIACEKIKQMPELSEGYNIVGLSQGNFVARGLIEFCDNAP  120

Query  802   -VKSFISVGGPNAGHS--STIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTD  632
              V +++S+GGP+AG S  S   C     C L+  Y    VYN   Q H  P+G  KIPTD
Sbjct  121   LVFNYVSLGGPHAGLSDLSKFNCSV---CELLDIYLS-DVYNDFVQDHAAPSGCFKIPTD  176

Query  631   MKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPN  452
             +K YL  SK+LP +NNE    +++  K RF+SL  LVLI+F+ D +++P+  S FGYYP 
Sbjct  177   IKNYLEHSKYLPKLNNERPGEKNSTYKDRFTSLHNLVLIMFQGDIVVIPKEISWFGYYPE  236

Query  451   GDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             G  +  +  Q+  LY +D  G KTLD AGKVKF S PG+HL +   E+  Y++PY+K
Sbjct  237   GASTPLLSPQK--LYLEDWIGLKTLDAAGKVKFVSVPGEHLRMAQDEVVNYVVPYLK  291



>ref|XP_009144465.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Brassica rapa]
Length=300

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 170/277 (61%), Gaps = 8/277 (3%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P+S S  FI LHG++  C  V +  +T  +  +    G C+E+GNG   S  M +  Q +
Sbjct  21    PVSISVPFIHLHGINDQCSSVEARSFTQLLRNLSSSPGYCLEIGNGEKDSMYMPLMQQAS  80

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPC  743
              AC K+ +M EL  GY++V+ SQGNMV RG+IE CD  PPV +++S+GGP+AG S    C
Sbjct  81    IACEKVKQMKELSQGYNIVAQSQGNMVARGLIEFCDDAPPVLNYVSLGGPHAGISIIPKC  140

Query  742   ---GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQD  572
                  +P C L        VY+  AQ H  P GYIK+ T++  Y+  SKFLP +NNE  +
Sbjct  141   PAGASYPLCQLQE----TEVYSDSAQDHIAPCGYIKLATEISEYMEHSKFLPKLNNERPN  196

Query  571   AQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTF  392
              +++  K RF+SL  LVL++F  DTI++P+ +  FG+YP+G  +  +P Q+T LY +D  
Sbjct  197   ERNSTYKERFTSLHNLVLVMFEGDTIVVPRETCWFGFYPDGATAPLLPPQKTKLYIEDWI  256

Query  391   GFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             G KTLD AGKVKF   PG HL +   ++  Y++PY++
Sbjct  257   GLKTLDDAGKVKFVGVPGDHLEMAHDDVVKYVVPYLQ  293



>emb|CDX76572.1| BnaA08g08280D [Brassica napus]
Length=461

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 174/284 (61%), Gaps = 2/284 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
               V   +FS+ P S++  FIV HG+   C   G   +T  +S +    GSC+E+GNG   
Sbjct  12    LTVATVLFSTAPFSNAIPFIVFHGIGDQCSG-GVSNFTQLLSSVSGSPGSCLEIGNGEED  70

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGG  776
             SW M +  Q ++AC+K+  M EL  GY++V+ SQGNMV RG+IE CD  PPV +++S+GG
Sbjct  71    SWFMPLVLQASEACKKVKLMQELSQGYNIVAESQGNMVARGLIEFCDDAPPVINYVSLGG  130

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG +    C     C +      + +YN   Q H  P+GYIKIP +M  YL  S++LP
Sbjct  131   PHAGIARVPKCPSGLKCDIAEAILKLEIYNDFVQDHIAPSGYIKIPGEMTKYLEHSQYLP  190

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              +NNE  D +++  K RF+SL  LVL++F+ DT+++P+ +S FGYY +  F   +  Q+T
Sbjct  191   KLNNERPDDRNSIFKDRFASLHNLVLVMFQDDTVLIPKETSWFGYYTDEGFGTLLSTQET  250

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
              LY +D  G K LD  GKVK+ S  G+HL+I+  ++  Y+ PY+
Sbjct  251   KLYTEDWIGLKALDDVGKVKYVSVSGEHLMISFQDVVKYVAPYL  294



>ref|XP_010449616.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=305

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/304 (42%), Positives = 181/304 (60%), Gaps = 9/304 (3%)
 Frame = -2

Query  1162  MASCFSFSTTFIVL-LAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKG  986
             M   F  S     L L  F SIP+S S  F+  HG+   C +      T  ++      G
Sbjct  1     MEKSFQRSVLLATLSLFFFISIPVSLSVPFVFFHGIGAGCSNDQMRNLTKLLNNY--STG  58

Query  985   SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-G  809
             SCVE+GNG   S  M +  Q + AC KI +M EL  GY++V +SQGN+V RG+IE CD  
Sbjct  59    SCVEIGNGKQDSVFMPLTKQASIACEKIKQMPELSDGYNIVGVSQGNLVARGLIEFCDNA  118

Query  808   PPVKSFISVGGPNAGHSSTIP--CGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPT  635
             PPV +++S+GGP+AG  + IP  C  F +C ++  ++   VYN   Q    P+ ++KIPT
Sbjct  119   PPVFNYVSLGGPHAG-VAAIPEWCTNF-FCTILKAFFSQ-VYNDGVQAFIAPSNFVKIPT  175

Query  634   DMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYP  455
              +  YL  S +LP ++NE    +++  K RF+SL  LVLI+F  D +++P+ SS FGYYP
Sbjct  176   KITEYLEHSTYLPKLSNERPGEKNSTYKDRFTSLHNLVLIMFEKDDVLIPKESSWFGYYP  235

Query  454   NGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*D  275
             +GD S  +P Q+T LY +D  G KTLD AGK++F S PG H+ IT  E+  Y++PY++  
Sbjct  236   DGDNSTILPPQKTKLYTEDWIGLKTLDAAGKLRFVSLPGVHIQITDEEVIEYVVPYLQNK  295

Query  274   IPSS  263
              P S
Sbjct  296   YPLS  299



>ref|XP_010440003.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Camelina 
sativa]
Length=286

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/289 (42%), Positives = 168/289 (58%), Gaps = 27/289 (9%)
 Frame = -2

Query  1132  FIVLLAI----FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F++L+ +    F SIP S S  F++ HG+   C +      T  ++      GSCVE+GN
Sbjct  8     FVLLVTLSLFCFISIPFSLSVPFVLFHGIVSGCSNDKMSNLTKLLNSYSSSPGSCVEIGN  67

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFI  788
             GL  S  M +  Q + AC KI +M EL  GY++V +SQGN+V RG+IE CD  PPV +++
Sbjct  68    GLADSLYMPLTQQASIACEKIKQMPELSEGYNIVGVSQGNLVARGLIEFCDNAPPVFNYV  127

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+GGP+AG S                        P    H  P+GY K+PT +  YL  S
Sbjct  128   SLGGPHAGLSDL----------------------PKCTDHAAPSGYFKLPTKITEYLEHS  165

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             K+LP +NNE    +++  K RF+SL  LVLI+F  D ++ P+ SS FGYYP+G ++  +P
Sbjct  166   KYLPKLNNERPGEKNSTYKDRFTSLHNLVLIMFEKDDVLTPKESSWFGYYPDGTYTPILP  225

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              Q+T LY +D  G KTLD AGKV F S PG H+ IT  E+  Y++PY+K
Sbjct  226   PQKTKLYTEDWIGLKTLDDAGKVNFVSVPGGHIEITEEELVKYVVPYLK  274



>ref|XP_001763636.1| predicted protein [Physcomitrella patens]
 gb|EDQ71526.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/302 (38%), Positives = 176/302 (58%), Gaps = 8/302 (3%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSSIPLSSSTA-----FIVLHGVSMFCQDVGSIYYTLTISGML  998
             MA  ++    F+ +L    +  L  +TA     FIVLHG+   C + G   +T  +  + 
Sbjct  1     MAQRWNPQLGFVTILCCLIAAELEVATAAGPLPFIVLHGLDDQCGNDGVTEFTKALRDLS  60

Query  997   RVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIEN  818
               +G C+ +GNG I SW++ ++ Q A  C KI  +  L+ GY++V LSQGNMV R VIE 
Sbjct  61    GAEGRCLSIGNGRIDSWLLRIDKQAAMVCNKIKSIPSLRNGYNIVGLSQGNMVARAVIEW  120

Query  817   CDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKI  641
             C G PPV ++IS+GGP+AG ++   C   P C  +       +Y+P+ Q +F P+GY KI
Sbjct  121   CHGGPPVHNYISLGGPHAGIAAIPYCTFLPLCRFLNEGIAPLIYSPIVQSNFAPSGYFKI  180

Query  640   PTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGY  461
             P+++  Y  ++  LP INNEI   Q+   K+RF  L  LVLI F  D +++P  S+ F Y
Sbjct  181   PSELSTYYKRAYLLPRINNEIPHVQNKSFKKRFQQLNHLVLIQFDEDLVLVPPQSAWFQY  240

Query  460   YPNGDFS--RAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPY  287
             YP+ D +    +P+ ++ LY++D  G ++L++ GKV F S P  HL I+  ++  YI+PY
Sbjct  241   YPDNDVTLCEVLPLNESALYKEDWIGLRSLNEEGKVSFISLPSDHLSISSHQMEKYIVPY  300

Query  286   MK  281
             + 
Sbjct  301   IN  302



>gb|ABD65098.1| palmitoyl protein thioesterase family protein [Brassica oleracea]
Length=300

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 168/277 (61%), Gaps = 8/277 (3%)
 Frame = -2

Query  1099  PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVA  920
             P+S S  FI  HG++  C  V +  +T  +  +    G C+E+GNG   S  M +  Q +
Sbjct  21    PVSISVPFIHFHGINDQCSSVEARSFTQLLRNLSSSPGYCLEIGNGEHDSMYMPLMQQAS  80

Query  919   DACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPC  743
              AC K+ +M EL  GY++V+ SQGNMV RG+IE CD  PPV +++S+GGP+AG S    C
Sbjct  81    IACEKVKQMKELSQGYNIVAQSQGNMVARGLIEFCDDAPPVLNYVSLGGPHAGISIIPKC  140

Query  742   ---GKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQD  572
                  +P C L        VY+  AQ H  P GYIK+ +++  Y+  SKFLP +NNE  +
Sbjct  141   PAGASYPLCQLQE----TEVYSDSAQDHIAPCGYIKLASEISEYMEHSKFLPKLNNERPN  196

Query  571   AQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTF  392
              +++  K RF+SL  LVL++F  DTI++P+ +  FG+YP G  +  +P Q+T LY +D  
Sbjct  197   ERNSTYKERFTSLHNLVLVMFEGDTIVVPRETCWFGFYPEGATAPLLPPQKTKLYIEDWI  256

Query  391   GFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             G KTLD AGKVKF   PG HL +   ++  Y++PY++
Sbjct  257   GLKTLDDAGKVKFVGVPGDHLEMAHDDVVKYVVPYLQ  293



>ref|NP_001132014.1| hypothetical protein [Zea mays]
 gb|ACF80685.1| unknown [Zea mays]
 tpg|DAA42789.1| TPA: hypothetical protein ZEAMMB73_946813 [Zea mays]
Length=239

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 148/205 (72%), Gaps = 1/205 (0%)
 Frame = -2

Query  895  MGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCGL  719
            M +L+GGY++V LSQGN++GR V+E CD GPPVK+FIS+GGP+AG +S   CG   +C +
Sbjct  1    MKQLRGGYNIVGLSQGNLIGRAVVEYCDDGPPVKNFISLGGPHAGTASVPLCGSGFFCII  60

Query  718  MGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFS  539
            +     + +Y+   Q+H  P+GY+KIPTDM  YL   +FLP +NNEI D ++A  K RFS
Sbjct  61   VDALIKLEIYSDYVQEHLAPSGYLKIPTDMADYLKSCRFLPKLNNEIPDKRNATYKERFS  120

Query  538  SLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKV  359
            SL  LVLI+F+ D +++P+ ++ FGYYP+G F   +P Q+T LY++D  G KTLD+AG+V
Sbjct  121  SLENLVLIMFQDDAVLIPRETAWFGYYPDGAFDPVLPPQKTKLYEEDWIGLKTLDEAGRV  180

Query  358  KFFSCPGQHLVITPPEIRMYIIPYM  284
            KF S PG HL I+  +++ YI+PY+
Sbjct  181  KFVSVPGGHLGISKGDMKKYIVPYL  205



>ref|XP_010440001.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X2 [Camelina 
sativa]
Length=305

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/282 (43%), Positives = 173/282 (61%), Gaps = 6/282 (2%)
 Frame = -2

Query  1120  LAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMM  941
             L  F SI +S S  F+  HG+   C D      T  ++      GSCVE+GNG   S  M
Sbjct  16    LFFFISIAVSLSVPFVFFHGIGGGCSDDQMRNLTKLLNNY--STGSCVEIGNGKQDSVFM  73

Query  940   GMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAG  764
              +  Q + AC KI +M EL  GY++V +SQGN+V RG+IE CD  PPV +++S+GGP+AG
Sbjct  74    PLTQQASIACEKIKQMPELSDGYNIVGVSQGNLVARGLIEFCDNAPPVFNYVSLGGPHAG  133

Query  763   HSSTIPCGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
               + IP     W C ++  ++   VY+   Q    P+ ++KIPT +  YL  SK+LP +N
Sbjct  134   -VAAIPEWCNNWFCKILKAFFSQ-VYDDHVQGFIAPSNFVKIPTKITEYLEHSKYLPKLN  191

Query  586   NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLY  407
             NE    +++  K RF+SL  LVLI+F  D +++P+ SS FGYYP+GD +  +P ++T LY
Sbjct  192   NERPGEKNSTYKERFTSLHNLVLIMFEKDDVLIPKESSWFGYYPDGDNTTILPPRKTKLY  251

Query  406   QKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +D  G KTLD AGK+KF S PG H+ IT  E+  Y++PY++
Sbjct  252   TEDWIGLKTLDAAGKLKFVSLPGAHIQITDDEVVEYVVPYLQ  293



>ref|XP_011017335.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Populus 
euphratica]
 ref|XP_011017336.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Populus 
euphratica]
 ref|XP_011017337.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Populus 
euphratica]
Length=266

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 152/227 (67%), Gaps = 1/227 (0%)
 Frame = -2

Query  943  MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNA  767
            M + DQ   AC K+  M EL  GY+++ LSQG+++ RGVIE CDG PPVK+ I++ G +A
Sbjct  1    MPLQDQTEIACEKVKSMSELSDGYNLIGLSQGSLIARGVIEFCDGGPPVKNLITLAGIHA  60

Query  766  GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
            G +S   CG    C L+ +     +Y+   Q+H  P+GYIKIPTD+  YL   +FLP +N
Sbjct  61   GIASIPFCGCTIVCVLLDNLIKSEIYSSYVQEHLAPSGYIKIPTDIPAYLKGCRFLPKLN  120

Query  586  NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLY  407
            NEI++ +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T LY
Sbjct  121  NEIKNTRNSTYKERFASLENLVLIMFEQDTVLVPKETSWFGYYPDGSFDTVLPAQETLLY  180

Query  406  QKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPS  266
             +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY++   PS
Sbjct  181  TEDWIGLKTLDEAGKVKFINVSGGHLDISQTDMKKYILPYLEEQAPS  227



>ref|XP_009144453.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Brassica rapa]
Length=306

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 182/306 (59%), Gaps = 19/306 (6%)
 Frame = -2

Query  1162  MASCFSFSTTFIVLLAIFSS-IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKG  986
             M   F      +  L++F   IP++ S  FI+LHG+   C + G+I +T  +S +    G
Sbjct  1     MMKSFQRCALLVRTLSVFVFFIPVTISVPFILLHGIRDQCSNGGTISFTQLLSNLSSSPG  60

Query  985   SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSL----------SQGNMVG  836
             SC+E+GNG   S  M +  Q + AC K+ +M +L   Y ++ L          SQGN+V 
Sbjct  61    SCLEIGNGEQDSVSMPLTQQASIACEKVKQMKDLV--YCLMGLEVECKSTPNKSQGNLVA  118

Query  835   RGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGP  659
             RG+IE CD  PPV +++S+GGP+AG  + IP    P C L+       VY+   Q H  P
Sbjct  119   RGLIEFCDNAPPVLNYVSLGGPHAG-IANIPKCTSPVCQLLR----TDVYSDYVQDHIAP  173

Query  658   AGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQI  479
             +GYIK+P +M  YL  SK+LP +NNE  + +++  K RF+SL  L+L++F+ D +++P+ 
Sbjct  174   SGYIKLPNEMSKYLEHSKYLPKLNNERPNERNSIYKERFTSLHNLILVMFQGDKVVMPKE  233

Query  478   SSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMY  299
             S  FGYYP+G  +  +P QQT LY +D  G KTLD AGKVKF   PG+HL +   ++  +
Sbjct  234   SCWFGYYPDGATTPLLPPQQTKLYTEDWIGLKTLDAAGKVKFVGVPGEHLQMAHDDVVKH  293

Query  298   IIPYMK  281
             ++PY++
Sbjct  294   VVPYLQ  299



>gb|KCW76895.1| hypothetical protein EUGRSUZ_D01239 [Eucalyptus grandis]
Length=266

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 154/229 (67%), Gaps = 2/229 (1%)
 Frame = -2

Query  943  MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFISVGGPNA  767
            M + +Q A AC K+  M EL  G+++V LSQG M+GRGV+E CDG P VK+FIS+ G +A
Sbjct  1    MPLMEQTAIACEKVKNMSELSDGFNLVGLSQGTMIGRGVVEFCDGAPSVKNFISLAGIHA  60

Query  766  GHSSTIPCGKFPWCGLMGHYYGM-GVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
            G SS   CG   +C L+ +   + GVY+   Q+H  P+ Y+KIPTD+  YL   KFLP +
Sbjct  61   GISSIPFCGSGVFCVLVDYLIELLGVYSAYVQEHLAPSNYVKIPTDLANYLKGCKFLPKL  120

Query  589  NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
            NNE+   +++  K RF+SL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T+L
Sbjct  121  NNELVHHRNSTYKERFASLQNLVLIMFEQDTVLIPKETSWFGYYPDGTFDTLLPAQETEL  180

Query  409  YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK*DIPSS  263
            Y +D  G KTLD+AGKVKF +  G HL I+  +++ YI+PY+  D  S+
Sbjct  181  YIEDWIGLKTLDEAGKVKFINVSGNHLQISLADMQKYIVPYLVDDEASA  229



>ref|XP_010275410.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Nelumbo 
nucifera]
Length=298

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 162/282 (57%), Gaps = 32/282 (11%)
 Frame = -2

Query  1123  LLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWM  944
             ++  F  IP+S S  FIVLHG+   C + G   +T  +S     KG C+E+G+G   SW+
Sbjct  8     IIVAFLLIPISYSLPFIVLHGIGDKCSNRGISEFTEILSNWSGSKGYCIEIGDGAWDSWV  67

Query  943   MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNA  767
             M + +Q    C K+ +M EL GGY++V LSQGNM+ RGVIE CD GPPVK+F+S+GGP+A
Sbjct  68    MPLQEQTGIVCDKVKKMKELSGGYNIVGLSQGNMIARGVIEFCDGGPPVKNFVSLGGPHA  127

Query  766   GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
             G +S   CG    C L+       +Y+   Q H  P+GY+KIPTD+  YL   KFLP +N
Sbjct  128   GTASVPLCGSSFICILVDSLIKSEIYSDYVQAHLAPSGYLKIPTDIPAYLEGCKFLPKLN  187

Query  586   NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLY  407
             NE+ + +++  K RFSSL  L+LI+                               T LY
Sbjct  188   NELPNERNSTYKERFSSLENLILIM-------------------------------TKLY  216

Query  406   QKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              +D  G KTLD AG+VK+ S PG HL I+   ++ YI+PY++
Sbjct  217   TEDWIGLKTLDDAGRVKYISVPGNHLAISKAGMKKYIVPYLE  258



>gb|KDO85536.1| hypothetical protein CISIN_1g016717mg [Citrus sinensis]
Length=300

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 150/235 (64%), Gaps = 1/235 (0%)
 Frame = -2

Query  1111  FSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMN  932
             F  IPLS S  FIVLHG+S  C + G   +T  +S     +G C+E+G+G   SW M + 
Sbjct  63    FCLIPLSYSLPFIVLHGISDKCTNRGVTQFTELLSSWSGSQGYCIEIGDGAWDSWTMPLF  122

Query  931   DQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSS  755
              Q A AC K+  M +L  GY+++ LSQGNM+GRG+IE C+G PPVK+ IS+ GP+AG ++
Sbjct  123   QQTAIACEKVKNMSQLSDGYNIIGLSQGNMIGRGIIEFCEGGPPVKNLISLAGPHAGIAA  182

Query  754   TIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQ  575
                CG  P C L+     + +Y+   Q H  P+GY KIPTD+  YL   KFLP +NNEI 
Sbjct  183   IPLCGFLPICILLDALVKLEIYSDFLQDHLAPSGYYKIPTDIPEYLKGCKFLPKLNNEIV  242

Query  574   DAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
             + +++  K RF+SL  LVLI+F  D++++P+ +S FGYYP+G F   +P QQ  L
Sbjct  243   NERNSTYKERFASLENLVLIMFEQDSVLVPKETSWFGYYPDGSFDPLLPAQQVVL  297



>emb|CAN68811.1| hypothetical protein VITISV_001083 [Vitis vinifera]
Length=282

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 162/273 (59%), Gaps = 25/273 (9%)
 Frame = -2

Query  1069  LHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMG  890
             + G+   C + G   +T  +      +G CVEVG+G   SW + M +QV +       M 
Sbjct  1     MAGIGDQCSNKGVKQFTELLRNFSNSEGYCVEVGDGTWDSWFIPMKEQVKE-------ME  53

Query  889   ELKGGYHMVSLSQGNMVGRGVIENCDGPP------------------VKSFISVGGPNAG  764
             EL+ GY++V LSQGN++GRGV+E CDG P                  VK+F+S+ GP+AG
Sbjct  54    ELRDGYNIVGLSQGNLIGRGVVEFCDGGPPVFTELIVXILEGSIKLQVKNFVSLAGPHAG  113

Query  763   HSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINN  584
              +S   CG   +C +  +     +Y+   Q H  P+GY+K+P D+  YL + +FLP +NN
Sbjct  114   TASVPLCGSGVFCIIADNLIKSQIYSDYVQTHLAPSGYLKLPNDIPKYLEKCRFLPKLNN  173

Query  583   EIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQ  404
             E+ D +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P QQT LY 
Sbjct  174   ELPDERNSTYKERFSSLENLVLIMFEQDTVLIPKETSWFGYYPDGAFEPVLPPQQTKLYT  233

Query  403   KDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIR  305
             +D  G KTLD AG+VK+ S PG HL I+  +++
Sbjct  234   EDWIGLKTLDDAGRVKYISVPGNHLGISHSDMK  266



>ref|XP_008798849.1| PREDICTED: palmitoyl-protein thioesterase 1 [Phoenix dactylifera]
Length=343

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/312 (39%), Positives = 178/312 (57%), Gaps = 24/312 (8%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSI--PLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVE  974
             SF   FI L AIF S+  P SS+  FIVLHG+   C + G   +T  +S     +G C+E
Sbjct  3     SFLLKFISL-AIFVSVLAPSSSAIPFIVLHGIGDQCANKGVSQFTELLSKWSGSEGYCIE  61

Query  973   VGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIEN--------  818
             +G+G   SW+M ++ Q    C+K+  M EL  GY++V LSQ +   R  +++        
Sbjct  62    IGSGTWDSWVMPLHQQTNLVCQKVKEMKELSMGYNIVGLSQVSYNYRNFMQSLKDSSDSA  121

Query  817   -------------CDGPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMA  677
                          C    VK+FIS+ GP+AG +S   CG    C L+       +Y+   
Sbjct  122   YILLLCWFVQTSYCPHAMVKNFISLAGPHAGTASVPLCGSGIICMLVDDLIKSEIYSDYI  181

Query  676   QKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADT  497
             Q H  P+GY+KIPT++  YL   +FLP +NNEI   +++  K RFSSL  LVLI+F  D 
Sbjct  182   QAHLAPSGYLKIPTEIPAYLEGCRFLPKLNNEIPGERNSTYKERFSSLQTLVLIMFEQDN  241

Query  496   IILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITP  317
             +++P+ +S FGYYP+G FS  +P QQT LY +D  G + LD+AG+V+F +  G HL I+ 
Sbjct  242   VLIPRETSWFGYYPDGAFSPVLPPQQTALYMEDWIGLRALDEAGRVQFITVQGGHLRISE  301

Query  316   PEIRMYIIPYMK  281
              +++ YI+PY+ 
Sbjct  302   SDMQKYIVPYLN  313



>ref|XP_006440240.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
 gb|ESR53480.1| hypothetical protein CICLE_v10020946mg [Citrus clementina]
Length=262

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 155/247 (63%), Gaps = 2/247 (1%)
 Frame = -2

Query  1147  SFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVG  968
             S   +FI +L +F   P+S S  FIVLHG+   C + G   +T  +S     KG C+EVG
Sbjct  5     SVPISFITVLLLFF-FPVSRSIPFIVLHGIGDQCSNQGVKQFTENLSSFSGSKGYCIEVG  63

Query  967   NGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSF  791
             +G   SW   + +Q    C K+ +M EL  GY++V LSQGN++GRGV+E C+G PPVK+F
Sbjct  64    DGTWDSWFKPLEEQTEIVCEKVKKMKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNF  123

Query  790   ISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             +S+GGP+AG +S   CG   +C +  +     VY+   Q H  P+GY+K P D+  YL +
Sbjct  124   VSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEK  183

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
              KFLP +NNE+ D +++  K RFS L  LVLI+F+ D +++P+ ++ FGYYP+G FS  +
Sbjct  184   CKFLPKLNNELPDKRNSTYKERFSCLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVL  243

Query  430   PVQQTDL  410
             P Q+  L
Sbjct  244   PPQKMML  250



>ref|XP_001765759.1| predicted protein [Physcomitrella patens]
 gb|EDQ69350.1| predicted protein [Physcomitrella patens]
Length=270

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/262 (39%), Positives = 160/262 (61%), Gaps = 6/262 (2%)
 Frame = -2

Query  1063  GVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKITRMGEL  884
             G+   C++ G   +T  +       G C+E+GNG   S+ M ++ Q    C ++ ++ EL
Sbjct  1     GIGDECRNQGLYEFTNFLINESGAFGFCIEIGNGASDSFFMRLDKQADLVCEQVKKIPEL  60

Query  883   KGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHY  707
             +GGY++     GN+V R VIE CDG PPV +F+S+GGP+AG +S   C     C L    
Sbjct  61    RGGYNV-----GNVVARAVIEFCDGGPPVHNFVSLGGPHAGTASIPGCSIMSLCKLADAL  115

Query  706   YGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTM  527
               +GVY+   Q H  P+GY+KIP D+  Y   S FLP +NNEI   ++   K+RF S+  
Sbjct  116   IRLGVYSSFVQNHLAPSGYVKIPNDLAAYYKGSMFLPKLNNEIASTRNETYKKRFESINH  175

Query  526   LVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFS  347
             LVLI+F+ D I++P  ++ FGYY   DF+  +P ++TDLY++D  G +TLD+AG+V + +
Sbjct  176   LVLIMFQEDAILVPPQTAWFGYYGENDFTTVLPPERTDLYKEDWIGLRTLDEAGRVTYIA  235

Query  346   CPGQHLVITPPEIRMYIIPYMK  281
              PG HL I   +++ +++PY++
Sbjct  236   FPGDHLSINDVQLKKFVVPYLR  257



>ref|XP_002464925.1| hypothetical protein SORBIDRAFT_01g028940 [Sorghum bicolor]
 gb|EER91923.1| hypothetical protein SORBIDRAFT_01g028940 [Sorghum bicolor]
Length=269

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 144/209 (69%), Gaps = 1/209 (0%)
 Frame = -2

Query  907  KITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFISVGGPNAGHSSTIPCGKFP  731
            ++ +M EL  GY++V LSQGN++GR VIE CDG P VK+FIS+GGP+AG +S   CG   
Sbjct  45   QVKKMKELSEGYNIVGLSQGNLIGRAVIEYCDGGPLVKNFISIGGPHAGTASVPLCGSGF  104

Query  730  WCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERK  551
             C L+       +Y+   Q H  P+GY+KIPTDM+ YL   +FLP +NNEI  A++   K
Sbjct  105  VCILIDDLIKSEIYSDYVQAHLAPSGYLKIPTDMEDYLKGCRFLPKLNNEIPSARNTTYK  164

Query  550  RRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDK  371
             RFSSL  LVLI+F  D +++P+ ++ FGYYP+G FS  +P Q+T LY +D  G +TLD+
Sbjct  165  ERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFSPVLPPQETKLYTEDWIGLRTLDE  224

Query  370  AGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
            AG+VKF S PG HL I+  +++ YI+PY+
Sbjct  225  AGRVKFVSVPGGHLRISRSDMKKYIVPYL  253



>ref|XP_008437044.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X5 [Cucumis 
melo]
Length=244

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 147/222 (66%), Gaps = 1/222 (0%)
 Frame = -2

Query  943  MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNA  767
            M +  Q    C K+ +M +LK G++ V LSQGN++GR V+E CDG PPV++FIS+GGP+A
Sbjct  1    MTLEAQSQIVCNKVKKMKDLKEGFNFVGLSQGNLIGRAVVEFCDGAPPVQNFISLGGPHA  60

Query  766  GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
            G SS   CG   WC L      + +Y+ + Q    P+G+IK+P D+  YL   KFLP +N
Sbjct  61   GISSVPLCGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKLN  120

Query  586  NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLY  407
            NE  DA+++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G+F   +P QQT LY
Sbjct  121  NERPDARNSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKLY  180

Query  406  QKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +D  G ++LD+ G+VKF    G HL I+  + + YI+PY++
Sbjct  181  IEDWIGLRSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  222



>ref|XP_010677096.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=332

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 169/295 (57%), Gaps = 13/295 (4%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F +   VL  I    P S S  F+V+HG+   C+          +S      G C+E  +
Sbjct  5     FLSFMFVLTLITPHFPSSVSLPFVVIHGIGQDCRVKKVSELINQLSHWSATDGYCIESSH  64

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFI  788
             G +S W++ + DQ A AC K+ +M EL  GY+++ LSQGN++ R +IE CDG P   +FI
Sbjct  65    GKLSFWLLPLKDQAAIACSKVKQMKELNQGYNIIGLSQGNLIARSIIEFCDGAPKANNFI  124

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYY------GMGVYNPMAQKHFGPAGYIKIPTDMK  626
             S+ GP+AG       G  P+    G ++        G+Y    QK+   +GYIKIP ++ 
Sbjct  125   SLAGPHAG------IGSPPFSLFRGMHFVATKLINFGIYRKFTQKNLAVSGYIKIPNNIP  178

Query  625   GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
              YL  SKFLP +NNEI + +S+  K RF SL  LVLI F  + +++P+ +S FGYY +  
Sbjct  179   TYLENSKFLPKLNNEIPNERSSIYKERFKSLENLVLIKFDNEHVLIPKETSWFGYYQDHS  238

Query  445   FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             F   +PV++T L+ +D  G K L++AGKV + + PG HL I+   ++ YI+P++K
Sbjct  239   FRSVLPVRETKLFVEDWIGLKALEEAGKVTYVTLPGDHLAISDDGLKKYIVPFLK  293



>ref|XP_009797091.1| PREDICTED: palmitoyl-protein thioesterase 1 isoform X4 [Nicotiana 
sylvestris]
Length=273

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 145/222 (65%), Gaps = 4/222 (2%)
 Frame = -2

Query  943  MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENC-DGPPVKSFISVGGPNA  767
            M    QV  AC K+  + EL  GYH++ LSQGNMVGRG++E C DGPPVK+ IS+ GP+A
Sbjct  1    MPFTKQVDIACDKVKEIDELSEGYHIIGLSQGNMVGRGLVELCSDGPPVKNLISLAGPHA  60

Query  766  GHSSTIPCGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
            G +S   CG+    C L      + +Y+   Q+H  PAGYIKIPTD+  Y    KFLP +
Sbjct  61   GIASVPFCGQSGLLCILADSLLKLAIYSNFVQEHLAPAGYIKIPTDIADYRKGCKFLPVV  120

Query  589  NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
            NNEI    ++  K+RF+SL  LVLI+F  D I++P+ +S FGYYP+G +S  +P ++T L
Sbjct  121  NNEIHG--NSTFKKRFASLENLVLIMFEKDQILVPKQTSWFGYYPDGSWSTVLPAKETKL  178

Query  409  YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
            Y +D  G K LD+AGKVKF +  G HL I+  E++  I+PY+
Sbjct  179  YTEDWIGLKILDEAGKVKFLNVSGNHLEISTSEMKKNILPYL  220



>ref|XP_010440000.1| PREDICTED: palmitoyl-protein thioesterase 3-like isoform X1 [Camelina 
sativa]
Length=339

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 175/316 (55%), Gaps = 40/316 (13%)
 Frame = -2

Query  1120  LAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMM  941
             L  F SI +S S  F+  HG+   C D      T  ++      GSCVE+GNG   S  M
Sbjct  16    LFFFISIAVSLSVPFVFFHGIGGGCSDDQMRNLTKLLNNY--STGSCVEIGNGKQDSVFM  73

Query  940   GMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAG  764
              +  Q + AC KI +M EL  GY++V +SQGN+V RG+IE CD  PPV +++S+GGP+AG
Sbjct  74    PLTQQASIACEKIKQMPELSDGYNIVGVSQGNLVARGLIEFCDNAPPVFNYVSLGGPHAG  133

Query  763   HSSTIP-----------------------------------CGKFPWCGLMGHYYGMGVY  689
               + IP                                   C +  +C ++  ++   VY
Sbjct  134   -VAAIPEWCNVSSLFVCVCQPCTITFFFTITITITTTMRFLCLQNWFCKILKAFFSQ-VY  191

Query  688   NPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILF  509
             +   Q    P+ ++KIPT +  YL  SK+LP +NNE    +++  K RF+SL  LVLI+F
Sbjct  192   DDHVQGFIAPSNFVKIPTKITEYLEHSKYLPKLNNERPGEKNSTYKERFTSLHNLVLIMF  251

Query  508   RADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHL  329
               D +++P+ SS FGYYP+GD +  +P ++T LY +D  G KTLD AGK+KF S PG H+
Sbjct  252   EKDDVLIPKESSWFGYYPDGDNTTILPPRKTKLYTEDWIGLKTLDAAGKLKFVSLPGAHI  311

Query  328   VITPPEIRMYIIPYMK  281
              IT  E+  Y++PY++
Sbjct  312   QITDDEVVEYVVPYLQ  327



>ref|XP_008437043.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X4 [Cucumis 
melo]
Length=245

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 147/223 (66%), Gaps = 2/223 (1%)
 Frame = -2

Query  943  MGMNDQVADACRKITR-MGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPN  770
            M +  Q    C K+ + M +LK G++ V LSQGN++GR V+E CDG PPV++FIS+GGP+
Sbjct  1    MTLEAQSQIVCNKVVKKMKDLKEGFNFVGLSQGNLIGRAVVEFCDGAPPVQNFISLGGPH  60

Query  769  AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
            AG SS   CG   WC L      + +Y+ + Q    P+G+IK+P D+  YL   KFLP +
Sbjct  61   AGISSVPLCGSGIWCLLADDLLKLAIYSDVVQNSLAPSGFIKLPNDIPNYLEHCKFLPKL  120

Query  589  NNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDL  410
            NNE  DA+++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G+F   +P QQT L
Sbjct  121  NNERPDARNSTYKERFSSLKNLVLIMFEDDTVLVPKETSWFGYYPDGEFEPILPPQQTKL  180

Query  409  YQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
            Y +D  G ++LD+ G+VKF    G HL I+  + + YI+PY++
Sbjct  181  YIEDWIGLRSLDEGGRVKFIKVAGGHLGISYSDAKKYIVPYLE  223



>gb|KDO61326.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
Length=264

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = -2

Query  904  ITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPW  728
            + +M EL  GY++V LSQGN++GRGV+E C+G PPVK+F+S+GGP+AG +S   CG   +
Sbjct  4    VKKMKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIF  63

Query  727  CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKR  548
            C +  +     VY+   Q H  P+GY+K P D+  YL + KFLP +NNE+ D +++  K 
Sbjct  64   CIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKE  123

Query  547  RFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKA  368
             FSSL  LVLI+F+ D +++P+ ++ FGYYP+G FS  +P Q+T LY +D  G KTLD A
Sbjct  124  CFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDA  183

Query  367  GKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
            G+V F S  G HL I+  +++ +IIPY+K
Sbjct  184  GRVHFISVAGGHLKISKADMKKHIIPYLK  212



>ref|XP_006282269.1| hypothetical protein CARUB_v10028547mg [Capsella rubella]
 gb|EOA15167.1| hypothetical protein CARUB_v10028547mg [Capsella rubella]
Length=275

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 162/293 (55%), Gaps = 45/293 (15%)
 Frame = -2

Query  1156  SCFSFSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCV  977
             SC +    F+ ++ +  S+P      FI+LHG++  C D  +  +T  ++ +    GSC+
Sbjct  8     SCVTVVVAFLCMVHVSVSVP------FIMLHGIAAQCADGTNDNFTHLLTNLSGSPGSCI  61

Query  976   EVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPV  800
             E+G+G   SW M +  Q   AC K                 QGN+V RG+IE CDG PPV
Sbjct  62    EIGDGRHDSWFMPLTRQAEIACEK----------------EQGNLVARGLIEFCDGGPPV  105

Query  799   KSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGY  620
              ++IS+ GP+AG SS                       P       P+GY K P D+  Y
Sbjct  106   YNYISLAGPHAGISSV----------------------PKCLDRLAPSGYFKDPMDVAKY  143

Query  619   LAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFS  440
             L  SK+LP ++NEI + +++  K RF+SL  LVL+ F+ DTII+P  S+ FG+YP+GDF 
Sbjct  144   LESSKYLPKLSNEIPEQRNSTYKERFASLHNLVLVKFQDDTIIVPNDSTWFGFYPDGDFE  203

Query  439   RAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
               +P Q+T LY +D  G KTLD AGKVKF S PG+H+ +   ++  Y++PY++
Sbjct  204   HVLPAQKTKLYTEDWIGLKTLDVAGKVKFVSVPGEHVKMAKEDVVKYVVPYLQ  256



>emb|CAB10529.1| thioesterase like protein [Arabidopsis thaliana]
 emb|CAB78751.1| thioesterase like protein [Arabidopsis thaliana]
Length=555

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 147/234 (63%), Gaps = 1/234 (0%)
 Frame = -2

Query  982  CVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GP  806
            C E+GNG   SW M +  Q + AC K+  M  L  GY++V+ SQGN+V RG+IE CD  P
Sbjct  28   CREIGNGEKDSWFMPLRKQTSVACEKVKAMKVLSQGYNIVAESQGNLVARGLIEFCDNAP  87

Query  805  PVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMK  626
            PV ++IS+GGP+AG +    C   P C +      + VY    Q H  P+GYIKIP ++ 
Sbjct  88   PVINYISLGGPHAGIAKIPKCNSGPICAIGEALLKLEVYTDFVQDHIAPSGYIKIPGEIS  147

Query  625  GYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGD  446
             YL  SK+LP +NNE  D +++  K RF++L  LVL++F +DT+++P+ ++ FGYY +  
Sbjct  148  KYLEHSKYLPKLNNERPDERNSTFKDRFTNLHNLVLVMFESDTMLIPKETAWFGYYEDEG  207

Query  445  FSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
            F   +  QQT LY++D  G K LD AGKVKF S  G HL I+  E+  +++PY+
Sbjct  208  FDTLLSAQQTKLYREDWIGLKALDAAGKVKFESVLGDHLSISDEEVVEFVVPYL  261


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  511  FRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQH  332
            F  D +++P+ SS FGYYP+G  +  +  QQT LY +D  G KTLD A KVKF S PG+H
Sbjct  464  FEGDAVVIPKESSWFGYYPDGASTPLLSPQQTKLYTEDWIGLKTLDAARKVKFVSVPGEH  523

Query  331  LVITPPEIRMYIIPYMK  281
            L I   ++  +++PY+K
Sbjct  524  LRIAQDDVVKHVVPYLK  540


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 18/126 (14%)
 Frame = -2

Query  1063  GVSMFCQDVGSIYYTLTISGMLRVKGSCV-----------------EVGNGLISSWMMGM  935
             G+   C + G   +   +S +    GSC+                 E+GNG   S  M +
Sbjct  338   GIRDQCSNGGVSSFVQLLSNLSSSHGSCLYRTNSFFFLFHSDLVKGEIGNGEQDSVTMPL  397

Query  934   NDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHS  758
               Q + AC K+ +M +L  GY++V+ SQGN+V RG+IE CD  PPV ++IS+GGP+AG S
Sbjct  398   TQQASVACEKVKQMKDLSQGYNIVAQSQGNLVARGLIEFCDNAPPVFNYISLGGPHAGIS  457

Query  757   STIPCG  740
                 C 
Sbjct  458   DIPKCN  463



>ref|XP_004511715.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Cicer 
arietinum]
 ref|XP_004511716.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X4 [Cicer 
arietinum]
Length=269

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 145/216 (67%), Gaps = 1/216 (0%)
 Frame = -2

Query  928  QVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSST  752
            Q    C+K+  M ELKGGY++V LSQGN++GRGV+E C+G PPVK+FIS+ GP+AG +S 
Sbjct  22   QTDYVCQKVREMNELKGGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFISLAGPHAGTASV  81

Query  751  IPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQD  572
              CG    C L  +     VY+   Q+H  P+GY+K+P  +  YL   ++LP +NNE   
Sbjct  82   PLCGTGILCVLADNLIKGEVYSTYIQEHLAPSGYLKLPNAIPKYLESCRYLPKLNNERPA  141

Query  571  AQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTF  392
             +++  K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+T LY +D  
Sbjct  142  ERNSTYKERFSSLLNLVLIMFEQDTVLIPKETSWFGYYPDGYFKPILPPQETKLYTEDWI  201

Query  391  GFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
            G +TLD+AG+V F S  G+HL I+  +++ +++PY+
Sbjct  202  GLRTLDEAGRVHFVSIEGKHLGISETDMKKHVVPYL  237



>gb|KDO61327.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
 gb|KDO61328.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
 gb|KDO61329.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
Length=258

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 141/206 (68%), Gaps = 1/206 (0%)
 Frame = -2

Query  895  MGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGL  719
            M EL  GY++V LSQGN++GRGV+E C+G PPVK+F+S+GGP+AG +S   CG   +C +
Sbjct  1    MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCII  60

Query  718  MGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFS  539
              +     VY+   Q H  P+GY+K P D+  YL + KFLP +NNE+ D +++  K  FS
Sbjct  61   ANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFS  120

Query  538  SLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKV  359
            SL  LVLI+F+ D +++P+ ++ FGYYP+G FS  +P Q+T LY +D  G KTLD AG+V
Sbjct  121  SLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRV  180

Query  358  KFFSCPGQHLVITPPEIRMYIIPYMK  281
             F S  G HL I+  +++ +IIPY+K
Sbjct  181  HFISVAGGHLKISKADMKKHIIPYLK  206



>ref|XP_002865124.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41383.1| palmitoyl protein thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=316

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 170/290 (59%), Gaps = 4/290 (1%)
 Frame = -2

Query  1138  TTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNG-  962
             +  +V++A  + + +S S  F++L  +   C D     +T  ++ +    G C+ +G+G 
Sbjct  8     SCVMVVVAFLAMVHVSVSVPFLILPEIGTQCSDDTVGNFTQLLTNLSGSPGFCLVIGDGN  67

Query  961   -LISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFI  788
              +  SW++ +  Q   AC K+ +M EL  GY++V  +QGN+V RG+IE CDG PPV ++I
Sbjct  68    EIAGSWLIPLTQQAEIACEKVKQMEELSHGYNIVGRAQGNLVARGLIEFCDGGPPVYNYI  127

Query  787   SVGGPNAGHSSTIPCGKFPW-CGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQ  611
             S+ GP+AG +    C      CG+        VY+   Q    P+GY K P ++  YL  
Sbjct  128   SLAGPHAGIAVLPRCTTSDLLCGIANGIGNGDVYSDFVQDSLAPSGYFKDPKNVTEYLKG  187

Query  610   SKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAV  431
              K+LP +NNE  D ++   K RF+SL  +VL+LF+ DT+I+P+ SS FG+YP+GD +  +
Sbjct  188   CKYLPKLNNERPDQRNQTYKDRFTSLHNVVLVLFQNDTVIVPKESSWFGFYPDGDLTHVL  247

Query  430   PVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
              V +T LY +D  G K L  AGKV+F + PG HL+I   ++  Y++P ++
Sbjct  248   SVDKTKLYIEDWIGLKALVVAGKVQFVNVPGNHLIIADEDLVKYVVPLLQ  297



>ref|XP_004511717.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X5 [Cicer 
arietinum]
Length=251

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 142/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  1093  SSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADA  914
             S S  FIV+HG+   C + G   +T  +     V G CVEVGNG   SW M + +Q    
Sbjct  25    SHSLPFIVIHGIGDQCSNHGVKKFTDELISYSGVNGYCVEVGNGSWDSWFMPLQEQTDYV  84

Query  913   CRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGK  737
             C+K+  M ELKGGY++V LSQGN++GRGV+E C+G PPVK+FIS+ GP+AG +S   CG 
Sbjct  85    CQKVREMNELKGGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFISLAGPHAGTASVPLCGT  144

Query  736   FPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAE  557
                C L  +     VY+   Q+H  P+GY+K+P  +  YL   ++LP +NNE    +++ 
Sbjct  145   GILCVLADNLIKGEVYSTYIQEHLAPSGYLKLPNAIPKYLESCRYLPKLNNERPAERNST  204

Query  556   RKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQT  416
              K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G F   +P Q+ 
Sbjct  205   YKERFSSLLNLVLIMFEQDTVLIPKETSWFGYYPDGYFKPILPPQEV  251



>ref|XP_009144476.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Brassica rapa]
Length=224

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 145/222 (65%), Gaps = 6/222 (3%)
 Frame = -2

Query  943  MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNA  767
            M +  Q + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  PPV +++S+GGP+A
Sbjct  1    MPLTQQASIACEKVKQMKELSQGYNIVAQSQGNLVARGLIEFCDNAPPVLNYVSLGGPHA  60

Query  766  GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
            G  + IP    P C L+       VY+   Q H  P+GYIK+P +M  YL  SK+LP +N
Sbjct  61   G-IANIPKCTSPVCQLLR----TDVYSDYVQDHIAPSGYIKLPNEMSKYLEHSKYLPKLN  115

Query  586  NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLY  407
            NE  + +++  K RF+SL  L+L++F+ D +++P+ S  FGYYP+G  +  +P QQT LY
Sbjct  116  NERPNERNSIYKERFTSLHNLILVMFQGDKVVMPKESCWFGYYPDGATTPLLPPQQTKLY  175

Query  406  QKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +D  G KTLD AGKVKF   PG+HL +   ++  +++PY++
Sbjct  176  TEDWIGLKTLDAAGKVKFVGVPGEHLQMAHDDVVKHVVPYLQ  217



>emb|CAN78143.1| hypothetical protein VITISV_032028 [Vitis vinifera]
Length=387

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 176/345 (51%), Gaps = 74/345 (21%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
             FI+L+ +F+  P++ S  FIVLHG+   C + G  ++T  +      +G C+   + L +
Sbjct  14    FIILVTVFALTPIAHSIPFIVLHGIGDKCSNRGITHFTELLGNWSSSQGYCMYALSFLRN  73

Query  952   -SWMMGM--------------NDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIEN  818
               W MG                +  A  C K+  M EL  GY++V LSQGN++ RGVIE 
Sbjct  74    WRWNMGFLGSAPSGTGETCSTVNTTAIVCEKVKEMTELSEGYNIVGLSQGNVIARGVIEF  133

Query  817   CDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKI  641
             CDG PPVK+FIS+GGP+AG +S   CG    C L+ +    G+Y+   Q           
Sbjct  134   CDGGPPVKNFISLGGPHAGTASVPLCGSGFICILVDNLIKSGIYSDYVQ-----------  182

Query  640   PTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGY  461
               D+  YL   +FLP +NNEI D +++  K RFSSL  LVLI+F  DTI++P+ ++ FGY
Sbjct  183   --DIISYLEGCRFLPKLNNEIIDKRNSTYKERFSSLQNLVLIMFEHDTILIPKETAWFGY  240

Query  460   YPNGDFSRAVPVQ---------------------------------------------QT  416
             YP+G FS   P                                               +T
Sbjct  241   YPDGSFSSVXPANELHQYRKRIEESAVQGLSRTSNPEQIDPQIEXWTFDFGFGLIETSET  300

Query  415   DLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             +LY +D  G KTLD+AGKVKF S PG HL I+  +++ Y++PY++
Sbjct  301   ELYXEDWIGLKTLDEAGKVKFISVPGNHLAISRSDMKTYMVPYLE  345



>gb|AAM61704.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
Length=316

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/263 (39%), Positives = 161/263 (61%), Gaps = 10/263 (4%)
 Frame = -2

Query  1048  CQDVGSIYYTLTISGMLRVKGSCVEVGNG--LISSWMMGMNDQVADACRKITRMGELKGG  875
             C D  +  +T  +S +    G C+E+G G  + +SW++ +  Q   AC K+T+M EL  G
Sbjct  38    CSDAPNANFTQLLSNLSSSPGFCIEIGEGNPIGASWLIPLTQQAEAACDKVTQMEELSQG  97

Query  874   YHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYY-G  701
             Y++V  SQGN+V RG+IE C+G P V ++IS+ GP+AG ++ + C      GL+     G
Sbjct  98    YNIVGRSQGNLVARGLIEFCEGGPSVHNYISLAGPHAGTANLLRCNT---SGLICDIANG  154

Query  700   MGVYNPMA---QKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLT  530
             +G  NP +   Q +  P+GY K P ++ GYL   ++LP +NNE    ++   K RF+SL 
Sbjct  155   IGKENPYSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPYERNTTYKDRFASLQ  214

Query  529   MLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFF  350
              LV +LF  DT+I+P+ SS FG+YP+GD +  +PVQ+T LY +D  G K L  AGKV+F 
Sbjct  215   NLVFVLFENDTVIVPKESSWFGFYPDGDLTHVLPVQETKLYIEDWIGLKALVVAGKVQFV  274

Query  349   SCPGQHLVITPPEIRMYIIPYMK  281
             +  G HL++   ++  Y++P ++
Sbjct  275   NVTGDHLIMADEDLVKYVVPLLQ  297



>ref|XP_006414225.1| hypothetical protein EUTSA_v10026142mg [Eutrema salsugineum]
 gb|ESQ55678.1| hypothetical protein EUTSA_v10026142mg [Eutrema salsugineum]
Length=233

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 142/232 (61%), Gaps = 11/232 (5%)
 Frame = -2

Query  943  MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNA  767
            M + DQ + AC K+ +M EL  GY++V+ SQGN+V RG+IE CD  PPV +++S+GGP+A
Sbjct  1    MPLIDQASLACEKVKKMKELSQGYNIVAQSQGNLVARGLIEFCDNAPPVINYVSLGGPHA  60

Query  766  GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
            G ++   C   P C +      + VYN   Q H  P+ Y+KIP +M  YL  SK+LP +N
Sbjct  61   GIAAIPKCSFGPICDIGEAMMKLEVYNDFVQDHIAPSNYVKIPGEMTKYLKHSKYLPKLN  120

Query  586  NEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ-----  422
            NE  D +++  K RF+SL  LVL++F+ DT ++P+ ++ FGYY +  F   +  Q     
Sbjct  121  NERPDERNSTFKDRFASLHNLVLVMFQNDTTLIPKETAWFGYYTDEGFESFLSTQQNCFL  180

Query  421  -----QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
                 QT LY++D  G K LD  GKVKF S  G HL IT  ++  Y++PY+K
Sbjct  181  KNLYVQTKLYREDWIGLKALDDVGKVKFVSVSGDHLSITDEDVEKYVVPYLK  232



>ref|XP_011081401.1| PREDICTED: palmitoyl-protein thioesterase 3 [Sesamum indicum]
Length=259

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 147/236 (62%), Gaps = 9/236 (4%)
 Frame = -2

Query  985  SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGP  806
            +C E+GNG  SSW + +  QV         M EL GGY++V LSQGN++GRG++E C+G 
Sbjct  4    TCREIGNGTWSSWFIPLEKQVKS-------MKELSGGYNIVGLSQGNLIGRGIVEFCEGA  56

Query  805  P-VKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDM  629
            P V++FIS+G P AG +S +P    P   +       G+Y+   Q  F P+GY K+P ++
Sbjct  57   PQVQNFISIGAPQAGIAS-VPRYTGPSRAIADKIMRAGIYSDYVQNRFAPSGYTKLPHNI  115

Query  628  KGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNG  449
              YL + +FLP +NNE  D ++   K+RFSSL  LVLI+   DT+I P+ SS FGYY +G
Sbjct  116  PDYLEKCRFLPKLNNERPDQRNPIYKKRFSSLKNLVLIMNANDTVIKPKESSWFGYYADG  175

Query  448  DFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
                 +  Q+T LY +D  G K+LDKAG+VKF    G H+ ++  +I+ Y++PY++
Sbjct  176  GLGTILQPQETKLYTEDWIGLKSLDKAGRVKFIKAAGAHIDMSDADIKKYVVPYLR  231



>ref|NP_199546.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 dbj|BAA97169.1| palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
 gb|AAM13072.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91172.1| unknown protein [Arabidopsis thaliana]
 gb|AED95501.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=316

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 161/263 (61%), Gaps = 10/263 (4%)
 Frame = -2

Query  1048  CQDVGSIYYTLTISGMLRVKGSCVEVGNG--LISSWMMGMNDQVADACRKITRMGELKGG  875
             C D  +  +T  +S +    G C+E+G G  + +SW++ +  Q   AC K+T+M EL  G
Sbjct  38    CSDAPNANFTQLLSNLSSSPGFCIEIGEGNPIGASWLIPLTQQAEVACDKVTQMEELSQG  97

Query  874   YHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYY-G  701
             Y++V  +QG++V RG+IE C+G PPV ++IS+ GP+AG +  + C      GL+     G
Sbjct  98    YNIVGRAQGSLVARGLIEFCEGGPPVHNYISLAGPHAGTADLLRCNT---SGLICDIANG  154

Query  700   MGVYNPMA---QKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLT  530
             +G  NP +   Q +  P+GY K P ++ GYL   ++LP +NNE    ++   K RF+SL 
Sbjct  155   IGKENPYSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPYERNTTYKDRFASLQ  214

Query  529   MLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFF  350
              LV +LF  DT+I+P+ SS FG+YP+GD +  +PVQ+T LY +D  G K L  AGKV+F 
Sbjct  215   NLVFVLFENDTVIVPKESSWFGFYPDGDLTHVLPVQETKLYIEDWIGLKALVVAGKVQFV  274

Query  349   SCPGQHLVITPPEIRMYIIPYMK  281
             +  G HL++   ++  Y++P ++
Sbjct  275   NVTGDHLIMADEDLVKYVVPLLQ  297



>gb|EMS63343.1| Palmitoyl-protein thioesterase 1 [Triticum urartu]
Length=310

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/286 (39%), Positives = 157/286 (55%), Gaps = 44/286 (15%)
 Frame = -2

Query  1078  FIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKIT  899
             FIVLHG+   C + G   +T  ++     KG C+E+G G   SW+M + DQV +      
Sbjct  31    FIVLHGIGDQCGNDGIASFTDELAEWSGSKGYCMEIGRGSWDSWLMPLQDQVKE------  84

Query  898   RMGELKGGYHMVSLSQGNMVGRGVIENCDGPPVKSFISVGGPNAGHSSTIPCGKFPWCGL  719
              M EL+ GY ++ LSQ                VK+FIS+GGP+AG +S   CG    C L
Sbjct  85    -MEELREGYSIIGLSQ----------------VKNFISIGGPHAGTASVPLCGSGFLCVL  127

Query  718   MGHYYGMGVYNPMAQ---------------------KHFGPAGYIKIPTDMKGYLAQSKF  602
             +     + +Y+   Q                      H  P+GY+KIPTDM  YL   KF
Sbjct  128   VDVLIQLEIYSNYVQLSLLDMTHNVSLNNLRLVKLQAHLAPSGYLKIPTDMTDYLKGCKF  187

Query  601   LPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQ  422
             LP +NNEI   ++   K RFSSL  LVLI+F  D +++P+ ++ FGYYP+G F+  +P Q
Sbjct  188   LPKLNNEIPSERNITYKERFSSLENLVLIMFEDDAVLIPRETAWFGYYPDGAFNPVLPPQ  247

Query  421   QTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +T LY +D  G +TLD+AG+VKF S PG HL I+   ++ YI+PY+
Sbjct  248   ETKLYTEDWIGLRTLDEAGRVKFVSVPGGHLRISRSNMKKYIVPYL  293



>ref|XP_010677097.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=319

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/289 (37%), Positives = 161/289 (56%), Gaps = 14/289 (5%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F +   VL  I    P S S  F+V+HG+   C+          +S      G C+E  +
Sbjct  5     FLSFMFVLTLITPHFPSSVSLPFVVIHGIGQDCRVKKVSELINQLSHWSATDGYCIESSH  64

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFI  788
             G +S W++ + DQ A AC K+ +M EL  GY+++ LSQGN++ R +IE CDG P   +FI
Sbjct  65    GKLSFWLLPLKDQAAIACSKVKQMKELNQGYNIIGLSQGNLIARSIIEFCDGAPKANNFI  124

Query  787   SVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQS  608
             S+ GP+AG       G  P+    G ++       +A K      Y K   ++  YL  S
Sbjct  125   SLAGPHAG------IGSPPFSLFRGMHF-------VATKLINFGIYRKFTQNIPTYLENS  171

Query  607   KFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVP  428
             KFLP +NNEI + +S+  K RF SL  LVLI F  + +++P+ +S FGYY +  F   +P
Sbjct  172   KFLPKLNNEIPNERSSIYKERFKSLENLVLIKFDNEHVLIPKETSWFGYYQDHSFRSVLP  231

Query  427   VQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
             V++T L+ +D  G K L++AGKV + + PG HL I+   ++ YI+P++K
Sbjct  232   VRETKLFVEDWIGLKALEEAGKVTYVTLPGDHLAISDDGLKKYIVPFLK  280



>gb|KDO61330.1| hypothetical protein CISIN_1g024701mg [Citrus sinensis]
Length=236

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 23/206 (11%)
 Frame = -2

Query  895  MGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKFPWCGL  719
            M EL  GY++V LSQGN++GRGV+E C+G PPVK+F+S+GGP+AG +S       P CG 
Sbjct  1    MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASV------PLCG-  53

Query  718  MGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFS  539
                            H  P+GY+K P D+  YL + KFLP +NNE+ D +++  K  FS
Sbjct  54   ---------------DHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFS  98

Query  538  SLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKV  359
            SL  LVLI+F+ D +++P+ ++ FGYYP+G FS  +P Q+T LY +D  G KTLD AG+V
Sbjct  99   SLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRV  158

Query  358  KFFSCPGQHLVITPPEIRMYIIPYMK  281
             F S  G HL I+  +++ +IIPY+K
Sbjct  159  HFISVAGGHLKISKADMKKHIIPYLK  184



>ref|XP_010677098.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=315

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 158/294 (54%), Gaps = 28/294 (10%)
 Frame = -2

Query  1144  FSTTFIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGN  965
             F +   VL  I    P S S  F+V+HG+   C+          +S      G C+E  +
Sbjct  5     FLSFMFVLTLITPHFPSSVSLPFVVIHGIGQDCRVKKVSELINQLSHWSATDGYCIESSH  64

Query  964   GLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPPVKSFIS  785
             G +S W++ + DQ A AC K+ +M EL  GY+++ LSQ N                +FIS
Sbjct  65    GKLSFWLLPLKDQAAIACSKVKQMKELNQGYNIIGLSQAN----------------NFIS  108

Query  784   VGGPNAGHSSTIPCGKFPWCGLMGHYY------GMGVYNPMAQKHFGPAGYIKIPTDMKG  623
             + GP+AG       G  P+    G ++        G+Y    QK+   +GYIKIP ++  
Sbjct  109   LAGPHAG------IGSPPFSLFRGMHFVATKLINFGIYRKFTQKNLAVSGYIKIPNNIPT  162

Query  622   YLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDF  443
             YL  SKFLP +NNEI + +S+  K RF SL  LVLI F  + +++P+ +S FGYY +  F
Sbjct  163   YLENSKFLPKLNNEIPNERSSIYKERFKSLENLVLIKFDNEHVLIPKETSWFGYYQDHSF  222

Query  442   SRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
                +PV++T L+ +D  G K L++AGKV + + PG HL I+   ++ YI+P++K
Sbjct  223   RSVLPVRETKLFVEDWIGLKALEEAGKVTYVTLPGDHLAISDDGLKKYIVPFLK  276



>gb|EYU19279.1| hypothetical protein MIMGU_mgv1a021288mg, partial [Erythranthe 
guttata]
Length=206

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 129/206 (63%), Gaps = 2/206 (1%)
 Frame = -2

Query  895  MGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSST-IPCGKFPWCG  722
            M EL  GY++V LSQG+++GRG++E C+G PPV++ ISV  P AG +S  +  G      
Sbjct  1    MKELSKGYNIVGLSQGSLIGRGIVEFCEGAPPVRNLISVAAPQAGVASIPLNAGGTTVRT  60

Query  721  LMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRF  542
            +       G Y+  AQK F P GYIK+P ++KGYL   KFLP +NNE  + ++   K+RF
Sbjct  61   IANSIMKAGAYSDYAQKRFAPTGYIKLPKNIKGYLKSCKFLPKLNNERPNDRNPAYKKRF  120

Query  541  SSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGK  362
            SSL  LVLI+   DT I P+ SS FGYY +G   + +  ++T LY +D  G K LDKAG+
Sbjct  121  SSLKNLVLIMNENDTTIRPKESSWFGYYEDGSTKKVLQPRETKLYMEDWIGLKKLDKAGR  180

Query  361  VKFFSCPGQHLVITPPEIRMYIIPYM  284
            VKF    G HL I+  E+  YIIPY+
Sbjct  181  VKFIKVEGNHLQISGAELLHYIIPYL  206



>ref|XP_010104856.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
 gb|EXC02092.1| Palmitoyl-protein thioesterase 1 [Morus notabilis]
Length=328

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 151/270 (56%), Gaps = 21/270 (8%)
 Frame = -2

Query  1069  LHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVADACRKIT---  899
             + G+S  C   G   +T  +      +G C+EVGNG   SW + +  Q    C K+    
Sbjct  1     MAGISDQCTSKGVNQFTEQLLQFSGAEGFCIEVGNGAWDSWFLPLEQQTEIVCNKVVSFL  60

Query  898   ----RMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVKSFISVGGPNAGHSSTIPCGKF  734
                 ++  L     +     GN++GRG++E CDG PPVK+F+S+ GP+AG +S   CG  
Sbjct  61    DHCPQIAGLAFQNFLTFNMLGNLIGRGILEFCDGGPPVKNFVSLAGPHAGTASVPLCGSS  120

Query  733   PWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAER  554
              +C +        +Y+   Q          IP     YL   KFLP +NNEI + +++  
Sbjct  121   VFCIIADTLIKSEIYSDFIQA---------IPD----YLEHCKFLPKLNNEIPEKRNSTY  167

Query  553   KRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLD  374
             K RFSSL  LVLI+F  DT+++P+ +S FGYYP+G ++  +P QQT LY +D  G K LD
Sbjct  168   KERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGAYNPILPPQQTKLYIEDWIGLKALD  227

Query  373   KAGKVKFFSCPGQHLVITPPEIRMYIIPYM  284
             +AG+VK+ + PG HL I+  +++ +++PY+
Sbjct  228   EAGRVKYIAVPGNHLGISKSDMKKHVVPYL  257



>ref|XP_006590575.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Glycine 
max]
Length=198

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 120/185 (65%), Gaps = 1/185 (1%)
 Frame = -2

Query  973  VGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCDG-PPVK  797
            VGNG   SW   + +Q    C K+ ++ ELK GY++V LSQGN++GRG++E C+G PPVK
Sbjct  12   VGNGSWDSWFKPLKEQAEIVCEKVKQVKELKEGYNIVGLSQGNLIGRGIVEFCEGGPPVK  71

Query  796  SFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYL  617
            +FIS+GGP+ G +S   CG   +C L        VY+   Q+H  P+GY+K+P  +  YL
Sbjct  72   NFISLGGPHTGTASVPICGVSIFCVLADTLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYL  131

Query  616  AQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSR  437
               +FLP +NNEI D +++  K RFSSL  LVLI+   DT+++P+ +S FGYYP+G F  
Sbjct  132  ENCRFLPVLNNEIPDKRNSTYKERFSSLQNLVLIMLEHDTVLIPRETSWFGYYPDGYFKP  191

Query  436  AVPVQ  422
             +P Q
Sbjct  192  VLPPQ  196



>gb|AFK37690.1| unknown [Medicago truncatula]
Length=221

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 125/196 (64%), Gaps = 1/196 (1%)
 Frame = -2

Query  1102  IPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQV  923
             IP++ S  FIVLHG+   C++ G   +   +S     +G C+ +GNG+ +SW   +  Q 
Sbjct  23    IPVTQSLPFIVLHGIGDQCKNGGVTNFVKLLSDWSGSQGYCLGIGNGMWTSWTKPLLKQT  82

Query  922   ADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIP  746
             A AC K+ +M EL  GY++V LSQGN++GRG+IE CD GPPVK+FIS+GGP+AG +S   
Sbjct  83    AIACEKVKKMSELNQGYNIVGLSQGNVIGRGIIEFCDGGPPVKNFISLGGPHAGTASIPL  142

Query  745   CGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQ  566
             CG    C L+      GVY+ + Q    P GY+K+P D+ GYL   KFLP +NNEI + +
Sbjct  143   CGSEKVCTLIDSVIKFGVYSSIVQNSLAPTGYVKMPIDIAGYLKGCKFLPKLNNEIINKR  202

Query  565   SAERKRRFSSLTMLVL  518
             ++   +RF+SL  LVL
Sbjct  203   NSTYSKRFASLENLVL  218



>ref|XP_002868064.1| hypothetical protein ARALYDRAFT_493131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44323.1| hypothetical protein ARALYDRAFT_493131 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/303 (36%), Positives = 162/303 (53%), Gaps = 11/303 (4%)
 Frame = -2

Query  1162  MASCFSFSTTFIVL-LAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKG  986
             M   F  S   + L L  F SIP+S S  F++ HG    C +      T  +       G
Sbjct  1     MEKSFQRSALLVTLSLFFFFSIPVSLSVPFVLFHGFGGECSNNKVSNLTQFLINHSGYPG  60

Query  985   SCVEVGNGLISSWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-G  809
             +CVE+GNG+  S  M +  Q + AC KI +M EL  GY++V+ SQGN+V RG+IE CD  
Sbjct  61    TCVEIGNGVQDSLFMPLRQQASIACEKIKQMKELSEGYNIVAESQGNLVARGLIEFCDNA  120

Query  808   PPVKSFISVGGPNAGHSSTIPCG-KFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTD  632
             PPV +++S+GGP+AG  + IP G   P+C L+   + + +Y  +AQ H  P+GY+K P +
Sbjct  121   PPVINYVSLGGPHAG-VAAIPKGCTSPFCMLLKAVFAV-IYTDLAQDHTAPSGYVKKPME  178

Query  631   MKGYLAQSKFLPYINNE----IQDAQSAERKRRFSSLTMLVLILFRADTI--ILPQISSH  470
             +  YL  SK+LP +NNE    +    S   K  FSS + ++   F+   +   + ++  H
Sbjct  179   IANYLEHSKYLPKLNNERPGPLLKTVSPACKTWFSSCSEMIQYWFQEKLLGSDITRVELH  238

Query  469   FGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIP  290
               +              T LY +D  G KTLD AGKVKF S P  H+ I   ++  Y++P
Sbjct  239   LQHLFCLLKRSTRQKSSTKLYTEDWIGLKTLDDAGKVKFISVPCGHIEIAEEDLVKYVVP  298

Query  289   YMK  281
             Y++
Sbjct  299   YLQ  301



>ref|XP_010484736.1| PREDICTED: palmitoyl-protein thioesterase 3-like [Camelina sativa]
Length=227

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 130/211 (62%), Gaps = 1/211 (0%)
 Frame = -2

Query  1126  VLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSW  947
             V +A+ + + +S S  F++ HG+S  C +     +T  ++ +    G CVE+GNG+  SW
Sbjct  13    VAVALLAMVHVSVSVPFVMFHGISAQCSNDRDANFTQLLTNLSGSPGFCVEIGNGVADSW  72

Query  946   MMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPN  770
             +M +  Q   AC K+ +M EL  GY++V  SQGN+V RG+IE CD GPP+ ++IS+ GP+
Sbjct  73    LMPLTRQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGPPIYNYISLAGPH  132

Query  769   AGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYI  590
             AG SS   CG   +C L        +Y+   Q H  P+GY+KIPTDMK YL  SK+LP +
Sbjct  133   AGISSVPMCGSGLFCKLADDLIKGDIYSDFIQDHLAPSGYLKIPTDMKKYLESSKYLPRL  192

Query  589   NNEIQDAQSAERKRRFSSLTMLVLILFRADT  497
             NNEI + +++  K RF+SL +L L +   D+
Sbjct  193   NNEIPNQRNSTYKERFASLHVLWLRICYVDS  223



>ref|XP_009136846.1| PREDICTED: palmitoyl-protein thioesterase-dolichyl pyrophosphate 
phosphatase fusion 1 isoform X2 [Brassica rapa]
Length=234

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 127/214 (59%), Gaps = 2/214 (1%)
 Frame = -2

Query  1132  FIVLLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLIS  953
               V   +FS+ P+S+S  FI+ HG+   C   G   +T  +S +    GSC+E+GNG I 
Sbjct  12    LTVAAVLFSTAPVSNSIPFILFHGIGDKCSG-GVSNFTQLLSNLSASPGSCLEIGNGEID  70

Query  952   SWMMGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGG  776
             +W M +  Q  +AC K+  M EL  GY +V+ SQGN+V RG+IE CD  PPV +++S+GG
Sbjct  71    TWFMPLMHQANEACEKVKMMKELSQGYKIVAQSQGNLVARGLIEFCDDAPPVINYVSLGG  130

Query  775   PNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLP  596
             P+AG ++   C   P C +      + +YN   Q H  P+GY+KIP +M  YL  SK+LP
Sbjct  131   PHAGIAAIPKCSSGPICAIAEDLMKLEIYNDFVQDHIAPSGYVKIPGEMTKYLDHSKYLP  190

Query  595   YINNEIQDAQSAERKRRFSSLTMLVLILFRADTI  494
              +NNE  D +++  K RF SL  LVL++  A  +
Sbjct  191   KLNNERPDQRNSTFKNRFMSLHNLVLVMMMASIL  224



>gb|AFK40085.1| unknown [Lotus japonicus]
Length=214

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 133/207 (64%), Gaps = 1/207 (0%)
 Frame = -2

Query  1123  LLAIFSSIPLSSSTAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWM  944
              L IF+  P+S S  FIVLHG+   C + G   +T  +S     KG C+E+G+G   SW 
Sbjct  8     FLFIFTFFPISHSIPFIVLHGIGDQCSNHGVKRFTEELSTYSGAKGYCIEIGSGSWDSWF  67

Query  943   MGMNDQVADACRKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNA  767
             + + +Q    C+K+ +M +LK GY++V LSQGN++GRGV+E C+ GPPVK+ IS+GGP+A
Sbjct  68    LPLQEQTEIVCKKVKKMKDLKKGYNIVGLSQGNLIGRGVVEFCEGGPPVKNLISLGGPHA  127

Query  766   GHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYIN  587
             G +S   CG+  +C L  +    GVYN   Q+H  P+GY+K+P  +  YL   +FLP +N
Sbjct  128   GTASVPLCGRGIFCVLADNLIKGGVYNAYVQEHLAPSGYLKLPNAIPEYLENCRFLPKLN  187

Query  586   NEIQDAQSAERKRRFSSLTMLVLILFR  506
             NEI D +++  K RFS+L  LVLI+F 
Sbjct  188   NEIPDQRNSTYKERFSNLENLVLIMFE  214



>ref|XP_010696246.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=258

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 131/211 (62%), Gaps = 3/211 (1%)
 Frame = -2

Query  907  KITRMGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFISVGGPNAGHSSTIPCGKF-  734
            ++ RM EL  GY++V LSQGN++ R +IE CDG P  K+FIS+ GP+ G ++  P G F 
Sbjct  10   QVKRMKELDQGYNIVGLSQGNLIARSIIEFCDGAPRAKNFISLAGPHVGIAAP-PFGLFR  68

Query  733  PWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAER  554
                    +   G+Y    QK+   +GYIKIP ++  YL  SKFLP +NNE+ + +++  
Sbjct  69   ELYSAAAKFINFGIYGKFIQKNLAASGYIKIPYNIPSYLRNSKFLPKLNNELSNERNSTY  128

Query  553  KRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLD  374
            K RF SL  LVLI F  + ++ P+ +S FGY+P+  FS  +  Q+T L+ +D  G K L+
Sbjct  129  KERFESLENLVLIKFDNENVLQPKETSWFGYHPDCSFSSVLSTQETKLFIEDWIGLKALE  188

Query  373  KAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
            +AG V + + PG HL I+   ++ YI+PY+K
Sbjct  189  EAGNVTYITLPGVHLEISDDGLKKYIVPYLK  219



>gb|EPS61619.1| hypothetical protein M569_13177, partial [Genlisea aurea]
Length=204

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 119/193 (62%), Gaps = 4/193 (2%)
 Frame = -2

Query  1087  STAFIVLHGVSMFCQDVGSIYYTLTISGMLRVKGSCVEVGNGLISSWMMGMNDQVAD-AC  911
             S  F+V HG+   C+  G   +T  +S     +G C+E+GNG + SW M  + Q  + AC
Sbjct  14    SIPFVVFHGIGDKCKHKGVTRFTNLLSNWSDSEGFCLEIGNGALDSWTMPFDKQQTEIAC  73

Query  910   RKITRMGELKGGYHMVSLSQGNMVGRGVIENCD-GPPVKSFISVGGPNAGHSSTIPCGKF  734
              K+  M ELK GY+++ LSQGN+VGRGV+E CD  PPV++FIS+ GP+AG +S   C   
Sbjct  74    EKVKGMSELKDGYNIIGLSQGNLVGRGVLELCDDSPPVRNFISLAGPHAGIASVPLCKTE  133

Query  733   PWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAER  554
              WC  +     + VY+   Q H  PAGYIKIPTD+ GY    +FLP INNEI   ++A  
Sbjct  134   RWCVFVDLLLDLAVYSKYVQDHLAPAGYIKIPTDIDGYKKGCRFLPKINNEI--CRNATY  191

Query  553   KRRFSSLTMLVLI  515
             K RFSSL  LVL+
Sbjct  192   KDRFSSLENLVLL  204



>ref|XP_010696248.1| PREDICTED: palmitoyl-protein thioesterase 1-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=245

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 128/207 (62%), Gaps = 3/207 (1%)
 Frame = -2

Query  895  MGELKGGYHMVSLSQGNMVGRGVIENCDGPP-VKSFISVGGPNAGHSSTIPCGKF-PWCG  722
            M EL  GY++V LSQGN++ R +IE CDG P  K+FIS+ GP+ G ++  P G F     
Sbjct  1    MKELDQGYNIVGLSQGNLIARSIIEFCDGAPRAKNFISLAGPHVGIAAP-PFGLFRELYS  59

Query  721  LMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRF  542
                +   G+Y    QK+   +GYIKIP ++  YL  SKFLP +NNE+ + +++  K RF
Sbjct  60   AAAKFINFGIYGKFIQKNLAASGYIKIPYNIPSYLRNSKFLPKLNNELSNERNSTYKERF  119

Query  541  SSLTMLVLILFRADTIILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGK  362
             SL  LVLI F  + ++ P+ +S FGY+P+  FS  +  Q+T L+ +D  G K L++AG 
Sbjct  120  ESLENLVLIKFDNENVLQPKETSWFGYHPDCSFSSVLSTQETKLFIEDWIGLKALEEAGN  179

Query  361  VKFFSCPGQHLVITPPEIRMYIIPYMK  281
            V + + PG HL I+   ++ YI+PY+K
Sbjct  180  VTYITLPGVHLEISDDGLKKYIVPYLK  206



>gb|EYU19286.1| hypothetical protein MIMGU_mgv1a021282mg, partial [Erythranthe 
guttata]
Length=214

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 123/192 (64%), Gaps = 6/192 (3%)
 Frame = -2

Query  850  GNMVGRGVIENCDG-PPVKSFISVGGPNAGHSST-IPCGKFPWCGLMGHYYGMGVYNPMA  677
            G ++GRG++E C+G PPV +FIS+GGP AG +ST I   +     +  +    GVY+  A
Sbjct  1    GTLIGRGIVEFCEGAPPVNNFISIGGPQAGIASTNISAVR----AIANNILRAGVYSEYA  56

Query  676  QKHFGPAGYIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADT  497
            Q  F P+GY KIP +MKGYL   KFLP +NNE  + ++   K+RF+SL  L+LI+   +T
Sbjct  57   QNQFAPSGYTKIPENMKGYLKSCKFLPKLNNERPNDRNPVYKKRFTSLKNLILIMSENET  116

Query  496  IILPQISSHFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITP  317
            +I P+ SS FGYY  G   + +  +QT LY +D  G K LDKAG+VKF   PG H+ ++ 
Sbjct  117  VIKPKESSWFGYYEEGITKKILQPRQTKLYIEDWIGLKALDKAGRVKFIKVPGTHIEVSD  176

Query  316  PEIRMYIIPYMK  281
             + + Y++PY++
Sbjct  177  VDTKKYVVPYLQ  188



>ref|XP_006285286.1| hypothetical protein CARUB_v10006663mg, partial [Capsella rubella]
 gb|EOA18184.1| hypothetical protein CARUB_v10006663mg, partial [Capsella rubella]
Length=196

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = -2

Query  829  VIENCD-GPPVKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAG  653
            +IE CD  PPV +++SVGGP+A  S+        +C ++   +   VY  +AQ H  P+G
Sbjct  2    LIEFCDNAPPVFNYVSVGGPHASVSAIPDWCTSLFCLILKAVFSQ-VYTDLAQDHIAPSG  60

Query  652  YIKIPTDMKGYLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISS  473
            Y+KIPTD+K YL  SK+LP +NNE    +++  K RF+SL  LVLI+F  + +++P+ +S
Sbjct  61   YVKIPTDIKNYLENSKYLPKLNNERPLEKNSTYKDRFTSLHHLVLIMFEKENVMIPKETS  120

Query  472  HFGYYPNGDFSRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYII  293
             FGYYP+G  +  +P Q+T LY +D  G KTLD AGKVKF S PG H+ IT  E+  Y++
Sbjct  121  WFGYYPDGASTPVLPPQKTKLYTEDWIGLKTLDAAGKVKFLSVPGAHIEITDDEVVEYVV  180

Query  292  PYMK  281
            PY++
Sbjct  181  PYLQ  184



>gb|KGN55843.1| hypothetical protein Csa_3G019340 [Cucumis sativus]
Length=199

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 114/174 (66%), Gaps = 0/174 (0%)
 Frame = -2

Query  802  VKSFISVGGPNAGHSSTIPCGKFPWCGLMGHYYGMGVYNPMAQKHFGPAGYIKIPTDMKG  623
            VK++IS+GGP+AG +S   CG   +C L        +Y+   Q H  P+GYIK+P  +  
Sbjct  25   VKNYISLGGPHAGIASVPLCGSAIFCRLADELIKSEIYSDYVQDHLAPSGYIKLPNAIPK  84

Query  622  YLAQSKFLPYINNEIQDAQSAERKRRFSSLTMLVLILFRADTIILPQISSHFGYYPNGDF  443
            YL + KFLP +NNE+  A+++  K RFSSL  L+LI+F  DT+++P+ +S FGYY +   
Sbjct  85   YLEKCKFLPKLNNELPQAKNSTYKERFSSLQNLILIMFEHDTVLVPKETSLFGYYSDRAL  144

Query  442  SRAVPVQQTDLYQKDTFGFKTLDKAGKVKFFSCPGQHLVITPPEIRMYIIPYMK  281
            +  +P QQT LY +D  G KTLD+AG+VK+ S  G H+ I+  ++R Y+IPY++
Sbjct  145  NSTIPAQQTKLYTEDWIGLKTLDEAGRVKYISVAGDHVKISNSDMRKYVIPYLQ  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3145178720708