BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77796_g1_i1 len=2325 path=[64:0-2324]

Length=2325
                                                                      Score     E

ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like               946   0.0      
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like               944   0.0      
emb|CDP09364.1|  unnamed protein product                                874   0.0      
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like               840   0.0      
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1       835   0.0      
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like               828   0.0      
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg             828   0.0      
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like               825   0.0      Vitis vinifera
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like               823   0.0      
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like               823   0.0      
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like               822   0.0      
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like               822   0.0      
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like               821   0.0      
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg                820   0.0      
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like               818   0.0      
emb|CBI16761.3|  unnamed protein product                                818   0.0      
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                    816   0.0      Vitis vinifera
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    815   0.0      
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like               815   0.0      
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    813   0.0      
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g             813   0.0      
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    813   0.0      
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like               813   0.0      
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like               812   0.0      
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    810   0.0      
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like               809   0.0      Vitis vinifera
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein              809   0.0      
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg                807   0.0      
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg             808   0.0      
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg                806   0.0      
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                    801   0.0      Vitis vinifera
ref|XP_002320584.1|  ECERIFERUM 1 family protein                        801   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                    800   0.0      Vitis vinifera
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like               799   0.0      
ref|XP_010097746.1|  Protein WAX2                                       798   0.0      
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like               807   0.0      
ref|XP_002526512.1|  sterol desaturase, putative                        796   0.0      Ricinus communis
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like               796   0.0      
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like               795   0.0      
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg                795   0.0      
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like               794   0.0      
emb|CDP09363.1|  unnamed protein product                                793   0.0      
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg             794   0.0      
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like               793   0.0      
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    792   0.0      
gb|KHN30013.1|  Protein WAX2                                            791   0.0      
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like               791   0.0      
gb|KHN40120.1|  Protein WAX2                                            791   0.0      
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    791   0.0      
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like               791   0.0      
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g             789   0.0      
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2       789   0.0      
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg             788   0.0      
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like               790   0.0      
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like               788   0.0      
ref|XP_011085187.1|  PREDICTED: protein ECERIFERUM 1-like               787   0.0      
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g             787   0.0      
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like               787   0.0      
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like               786   0.0      
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like               786   0.0      
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like               786   0.0      
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like               785   0.0      
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like               785   0.0      
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    782   0.0      
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like               783   0.0      
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg             783   0.0      
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    783   0.0      
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like               781   0.0      
gb|KHG03871.1|  Protein WAX2 -like protein                              779   0.0      
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1       780   0.0      
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like               780   0.0      
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    779   0.0      
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like               779   0.0      
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like               777   0.0      
gb|AAB87721.1|  maize gl1 homolog                                       776   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    776   0.0      
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like               775   0.0      
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg             775   0.0      
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    774   0.0      
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like               774   0.0      
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like               774   0.0      
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    773   0.0      
ref|XP_003626834.1|  gl1-like protein                                   773   0.0      
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    773   0.0      
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg             773   0.0      
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    772   0.0      
ref|XP_003521032.2|  PREDICTED: protein ECERIFERUM 1-like               773   0.0      
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    769   0.0      
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like               766   0.0      
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like               765   0.0      
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g             763   0.0      
ref|XP_009760059.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    763   0.0      
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like               763   0.0      
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g             761   0.0      
ref|NP_171723.2|  protein ECERIFERUM 1                                  763   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184890.1|  protein ECERIFERUM 1                               761   0.0      
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    761   0.0      
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    759   0.0      
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                    758   0.0      
gb|KHN40121.1|  Protein WAX2                                            758   0.0      
gb|AHD24918.1|  CER1                                                    757   0.0      
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    756   0.0      
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg             758   0.0      
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                   756   0.0      
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like               756   0.0      
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    753   0.0      
ref|XP_007041196.1|  CER1 protein                                       753   0.0      
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    752   0.0      
gb|EPS65064.1|  hypothetical protein M569_09713                         751   0.0      
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like               751   0.0      
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg                750   0.0      
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1         749   0.0      
emb|CDY38059.1|  BnaCnng09200D                                          756   0.0      
gb|KGN56664.1|  hypothetical protein Csa_3G127750                       749   0.0      
gb|AIE57503.1|  CER1                                                    748   0.0      
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like               747   0.0      
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    747   0.0      
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2         745   0.0      
gb|KHG15491.1|  Protein WAX2 -like protein                              744   0.0      
emb|CBI16760.3|  unnamed protein product                                803   0.0      
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like               744   0.0      
ref|XP_008460068.1|  PREDICTED: protein ECERIFERUM 1-like               744   0.0      
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    744   0.0      
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like               744   0.0      
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                    742   0.0      
gb|KGN56666.1|  hypothetical protein Csa_3G127770                       740   0.0      
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                   741   0.0      
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like               737   0.0      
ref|XP_007015842.1|  CER1 protein isoform 1                             737   0.0      
ref|XP_004145021.1|  PREDICTED: protein ECERIFERUM 1-like               736   0.0      
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    734   0.0      
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg             734   0.0      
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like               734   0.0      
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like               733   0.0      
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like               732   0.0      
gb|KDP28917.1|  hypothetical protein JCGZ_14688                         731   0.0      
ref|XP_002526511.1|  sterol desaturase, putative                        732   0.0      Ricinus communis
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    729   0.0      
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like               730   0.0      
ref|XP_007015845.1|  CER1 protein                                       729   0.0      
gb|EPS71900.1|  hypothetical protein M569_02856                         729   0.0      
ref|XP_003625022.1|  Protein WAX2                                       729   0.0      
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like               737   0.0      
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    729   0.0      
ref|XP_004302222.1|  PREDICTED: protein ECERIFERUM 1-like               726   0.0      
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like               728   0.0      
gb|EPS60467.1|  hypothetical protein M569_14337                         726   0.0      
ref|XP_008361247.1|  PREDICTED: protein ECERIFERUM 1-like               723   0.0      
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    729   0.0      
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    721   0.0      
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                    722   0.0      
ref|XP_003625020.1|  Protein WAX2                                       721   0.0      
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like               720   0.0      
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    719   0.0      
gb|ACG35856.1|  CER1                                                    716   0.0      Zea mays [maize]
ref|NP_001146661.1|  uncharacterized protein LOC100280261               715   0.0      Zea mays [maize]
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590          714   0.0      Sorghum bicolor [broomcorn]
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily                 739   0.0      
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like               712   0.0      
gb|KHG12604.1|  Protein WAX2 -like protein                              711   0.0      
gb|AES88391.2|  fatty acid hydroxylase superfamily protein              711   0.0      
ref|XP_007041187.1|  Fatty acid hydroxylase superfamily isoform 3       708   0.0      
ref|XP_004493412.1|  PREDICTED: protein ECERIFERUM 1-like               709   0.0      
ref|XP_003625024.1|  Protein WAX2                                       705   0.0      
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like               702   0.0      
ref|XP_004168237.1|  PREDICTED: protein ECERIFERUM 1-like               702   0.0      
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like               701   0.0      
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                     703   0.0      
gb|EEC67150.1|  hypothetical protein OsI_33995                          699   0.0      Oryza sativa Indica Group [Indian rice]
emb|CAN60676.1|  hypothetical protein VITISV_029045                     696   0.0      Vitis vinifera
ref|NP_001064826.1|  Os10g0471100                                       697   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    697   0.0      
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                   693   0.0      
ref|XP_006661851.1|  PREDICTED: protein ECERIFERUM 1-like               692   0.0      
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                     685   0.0      
gb|EMT06855.1|  Protein WAX2                                            686   0.0      
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    684   0.0      
gb|AAC24374.1|  CER1 protein                                            680   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like               677   0.0      
gb|EEC73617.1|  hypothetical protein OsI_08114                          674   0.0      Oryza sativa Indica Group [Indian rice]
gb|ACR38546.1|  unknown                                                 673   0.0      Zea mays [maize]
ref|NP_001047459.1|  Os02g0621300                                       673   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABG66132.1|  CER1 protein, putative, expressed                       671   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AES88379.2|  fatty acid hydroxylase superfamily protein              671   0.0      
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                     672   0.0      
gb|EMT33049.1|  Protein WAX2                                            671   0.0      
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like               671   0.0      
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg             670   0.0      
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like               669   0.0      
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650          669   0.0      
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320          667   0.0      Sorghum bicolor [broomcorn]
dbj|BAA11024.1|  possible aldehyde decarbonylase                        664   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like               665   0.0      
ref|XP_003606182.1|  Protein WAX2                                       663   0.0      
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                     664   0.0      
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like               663   0.0      
gb|EEE57393.1|  hypothetical protein OsJ_07566                          662   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1          663   0.0      
gb|ACA14353.1|  TCER1                                                   662   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                     662   0.0      
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320          659   0.0      Sorghum bicolor [broomcorn]
ref|NP_171721.3|  protein CER1-like 1                                   659   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMS58604.1|  Protein WAX2                                            658   0.0      
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like               657   0.0      
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2          656   0.0      
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1          656   0.0      
dbj|BAK00236.1|  predicted protein                                      654   0.0      
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                     654   0.0      
ref|NP_973742.1|  protein CER1-like 1                                   652   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                    651   0.0      
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2          649   0.0      
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1           648   0.0      Hordeum vulgare [barley]
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                     647   0.0      
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                    647   0.0      
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    644   0.0      
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898    689   0.0      
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg             645   0.0      
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg             646   0.0      
emb|CAA65200.1|  CER1-like                                              645   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg             645   0.0      
ref|XP_009777506.1|  PREDICTED: protein ECERIFERUM 1-like               641   0.0      
ref|XP_003606194.1|  Protein WAX2                                       643   0.0      
emb|CDX74937.1|  BnaA05g06830D                                          644   0.0      
emb|CDX91381.1|  BnaC04g07690D                                          643   0.0      
emb|CAN81825.1|  hypothetical protein VITISV_014168                     685   0.0      Vitis vinifera
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                     639   0.0      
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                     638   0.0      
gb|ACN31737.1|  unknown                                                 637   0.0      Zea mays [maize]
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2          638   0.0      
gb|EAY87991.1|  hypothetical protein OsI_09413                          637   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg             636   0.0      
ref|NP_001048490.1|  Os02g0814200                                       634   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1          634   0.0      
emb|CDY55894.1|  BnaA04g29150D                                          633   0.0      
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like               633   0.0      
emb|CAA65199.1|  CER1-like                                              633   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041189.1|  Fatty acid hydroxylase superfamily isoform 5       628   0.0      
ref|NP_181306.3|  protein CER1-like 2                                   632   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX93353.1|  BnaC04g45430D                                          632   0.0      
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                     632   0.0      
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478             631   0.0      
emb|CDX79754.1|  BnaC03g20900D                                          631   0.0      
ref|XP_004510148.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    625   0.0      
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                     629   0.0      
gb|AAC23640.1|  CER1-like protein                                       629   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004170720.1|  PREDICTED: protein ECERIFERUM 1-like               624   0.0      
gb|EMT07276.1|  Protein WAX2                                            626   0.0      
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1          627   0.0      
emb|CDY55893.1|  BnaA04g29140D                                          626   0.0      
emb|CDX93352.1|  BnaC04g45440D                                          625   0.0      
ref|XP_003580122.1|  PREDICTED: protein ECERIFERUM 1-like               621   0.0      
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                     620   0.0      
gb|EMS68717.1|  Protein WAX2                                            621   0.0      
ref|XP_007041192.1|  CER1 protein                                       616   0.0      
gb|KDO85384.1|  hypothetical protein CISIN_1g006590mg                   613   0.0      
ref|XP_006445498.1|  hypothetical protein CICLE_v10019265mg             613   0.0      
gb|KDO85388.1|  hypothetical protein CISIN_1g006590mg                   613   0.0      
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3          614   0.0      
gb|AAC24373.1|  CER1-like protein                                       613   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAE03390.2|  OSJNBa0004N05.14                                       613   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABG47420.1|  putative CER1                                           612   0.0      Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ85488.1|  predicted protein                                      612   0.0      
gb|EMS48098.1|  Protein WAX2                                            612   0.0      
gb|EMS58051.1|  Protein WAX2                                            610   0.0      
ref|XP_006857475.1|  hypothetical protein AMTR_s00067p00190600          608   0.0      
ref|XP_010054532.1|  PREDICTED: protein ECERIFERUM 1-like               605   0.0      
ref|XP_007041188.1|  Fatty acid hydroxylase superfamily isoform 4       598   0.0      
ref|XP_003570374.1|  PREDICTED: protein ECERIFERUM 1-like               602   0.0      
ref|XP_009612940.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    595   0.0      
gb|AAD29719.1|AF143746_1  CER1                                          601   0.0      Oryza sativa [red rice]
ref|XP_010255639.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    601   0.0      
gb|EMS48099.1|  Protein WAX2                                            597   0.0      
gb|EMT04955.1|  Protein WAX2                                            597   0.0      
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...    597   0.0      
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940          598   0.0      Sorghum bicolor [broomcorn]
ref|XP_010054526.1|  PREDICTED: protein ECERIFERUM 1-like               589   0.0      
gb|ACG47659.1|  CER1                                                    592   0.0      Zea mays [maize]
gb|KDO85386.1|  hypothetical protein CISIN_1g006590mg                   586   0.0      
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048             583   0.0      
ref|XP_007008730.1|  Fatty acid hydroxylase superfamily isoform 2       578   0.0      
ref|XP_007041194.1|  CER1 protein                                       580   0.0      
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                    583   0.0      
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...    583   0.0      
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2          579   0.0      
ref|XP_008438264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    575   0.0      
ref|XP_008369652.1|  PREDICTED: protein ECERIFERUM 1-like               572   0.0      
gb|KEH23596.1|  fatty acid hydroxylase superfamily protein              572   0.0      
gb|ABD28319.2|  Sterol desaturase                                       568   0.0      
gb|KDO85389.1|  hypothetical protein CISIN_1g006590mg                   558   0.0      
ref|XP_010920377.1|  PREDICTED: protein ECERIFERUM 1-like               557   0.0      
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like               555   0.0      
ref|NP_850932.2|  protein ECERIFERUM 1                                  551   0.0      
ref|XP_004510149.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    545   0.0      
ref|XP_009339872.1|  PREDICTED: protein ECERIFERUM 1-like               539   0.0      
ref|XP_004171948.1|  PREDICTED: protein ECERIFERUM 1-like               529   2e-177   
ref|XP_008356893.1|  PREDICTED: protein ECERIFERUM 1-like               521   2e-175   
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    520   9e-173   
emb|CAN63491.1|  hypothetical protein VITISV_032726                     508   5e-170   
ref|XP_002892018.1|  hypothetical protein ARALYDRAFT_887207             503   2e-167   
gb|KHN13741.1|  Protein WAX2                                            500   6e-167   
ref|XP_010097743.1|  Protein WAX2                                       509   8e-166   
ref|NP_001118464.1|  protein CER1-like 2                                497   2e-164   
dbj|BAJ85405.1|  predicted protein                                      493   7e-164   
ref|NP_001141595.1|  uncharacterized protein LOC100273712               497   1e-163   
gb|ACJ85705.1|  unknown                                                 490   3e-163   
ref|XP_007220698.1|  hypothetical protein PRUPE_ppa020996mg             481   6e-160   
gb|AFW64026.1|  hypothetical protein ZEAMMB73_844277                    491   2e-159   
gb|AFW68611.1|  hypothetical protein ZEAMMB73_227989                    474   8e-157   
gb|EMS51792.1|  Protein WAX2                                            473   5e-156   
gb|EMS58603.1|  hypothetical protein TRIUR3_05201                       470   4e-155   
ref|XP_010041339.1|  PREDICTED: protein ECERIFERUM 1-like               466   1e-154   
gb|KCW44429.1|  hypothetical protein EUGRSUZ_L02074                     468   1e-154   
ref|XP_010097741.1|  Protein WAX2                                       468   2e-153   
gb|EEC77626.1|  hypothetical protein OsI_16615                          470   5e-153   
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    464   8e-152   
emb|CDY07774.1|  BnaA03g17370D                                          466   1e-151   
gb|KCW76791.1|  hypothetical protein EUGRSUZ_D011442                    460   1e-151   
gb|EMT15822.1|  Protein WAX2                                            449   4e-147   
dbj|BAK01778.1|  predicted protein                                      446   2e-145   
gb|EEE61327.1|  hypothetical protein OsJ_15439                          448   5e-145   
ref|XP_009614891.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    433   2e-142   
ref|XP_010496698.1|  PREDICTED: protein ECERIFERUM 1-like               436   3e-142   
dbj|BAF01865.1|  CER1 protein                                           434   2e-141   
ref|XP_001783415.1|  predicted protein                                  439   5e-140   
gb|EMT04858.1|  Protein WAX2                                            435   1e-139   
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422             423   5e-134   
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942             412   6e-130   
gb|KDO85390.1|  hypothetical protein CISIN_1g006590mg                   403   1e-129   
gb|EMT15793.1|  Protein WAX2                                            400   4e-127   
gb|AFW64032.1|  hypothetical protein ZEAMMB73_844277                    399   6e-127   
gb|KDP34470.1|  hypothetical protein JCGZ_12753                         380   5e-122   
emb|CAN83072.1|  hypothetical protein VITISV_026148                     381   5e-122   
ref|XP_010041960.1|  PREDICTED: protein ECERIFERUM 1-like               365   2e-116   
ref|XP_002509294.1|  predicted protein                                  376   4e-116   
ref|XP_001420263.1|  predicted protein                                  375   8e-116   
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal                375   1e-115   
ref|XP_003081883.1|  faceless pollen-1 (ISS)                            375   4e-115   
emb|CBI16759.3|  unnamed protein product                                358   3e-114   
ref|XP_002443045.1|  hypothetical protein SORBIDRAFT_08g006850          363   1e-113   
emb|CDX79752.1|  BnaC03g20880D                                          361   2e-113   
ref|XP_008364781.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    357   4e-113   
ref|XP_001756318.1|  predicted protein                                  361   2e-110   
ref|XP_009339873.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    344   1e-108   
ref|XP_010661477.1|  PREDICTED: protein ECERIFERUM 1-like               347   2e-108   
ref|XP_003061467.1|  predicted protein                                  357   2e-108   
emb|CBI16764.3|  unnamed protein product                                338   9e-107   
gb|ABC87808.1|  TCER1                                                   337   1e-105   
gb|KHN33999.1|  Protein WAX2                                            335   3e-105   
ref|XP_001781794.1|  predicted protein                                  348   3e-105   
ref|XP_010512796.1|  PREDICTED: protein ECERIFERUM 1-like               335   2e-104   
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like               336   4e-103   
ref|XP_007015843.1|  CER1 protein isoform 2                             337   2e-102   
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680             338   1e-101   
ref|XP_007509665.1|  predicted protein                                  340   1e-101   
ref|XP_010496479.1|  PREDICTED: protein CER1-like 1                     330   1e-101   
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167             337   2e-101   
gb|KHG04939.1|  Protein WAX2                                            337   3e-101   
ref|XP_001782380.1|  predicted protein                                  335   2e-100   
emb|CBI16758.3|  unnamed protein product                                322   6e-100   
gb|KHG27245.1|  Protein WAX2                                            333   1e-99    
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    333   1e-99    
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               332   2e-99    
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like               332   3e-99    
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982             332   4e-99    
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like               331   5e-99    
gb|ADE75704.1|  unknown                                                 331   6e-99    
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily                 331   1e-98    
ref|XP_010479259.1|  PREDICTED: protein ECERIFERUM 1-like               316   4e-98    
emb|CBI25242.3|  unnamed protein product                                327   2e-97    
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like               327   2e-97    
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              327   3e-97    
emb|CBI25244.3|  unnamed protein product                                326   4e-97    
gb|KHG27244.1|  Protein WAX2                                            327   4e-97    
ref|XP_010496699.1|  PREDICTED: protein ECERIFERUM 1-like               313   5e-97    
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             325   9e-97    
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like               317   9e-97    
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               325   2e-96    
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               324   4e-96    
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like               324   4e-96    
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg                323   5e-96    
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    323   6e-96    
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         323   7e-96    
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg                322   2e-95    
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         322   2e-95    
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    322   2e-95    
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    321   4e-95    
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               321   4e-95    
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    320   5e-95    
ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like               320   9e-95    
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               320   9e-95    
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         320   1e-94    
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    319   2e-94    
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3-like               317   9e-94    
emb|CDP02895.1|  unnamed protein product                                317   1e-93    
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    317   2e-93    
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    317   2e-93    
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448             317   2e-93    
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343             316   2e-93    
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like               316   3e-93    
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like               315   7e-93    
gb|KHN17538.1|  Protein WAX2                                            315   9e-93    
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like               315   9e-93    
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                    314   2e-92    
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    313   4e-92    
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like               312   8e-92    
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like               312   9e-92    
gb|KDP38762.1|  hypothetical protein JCGZ_04115                         311   1e-91    
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                   311   3e-91    
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g             311   3e-91    
emb|CDO98263.1|  unnamed protein product                                311   4e-91    
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like               310   5e-91    
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g             310   6e-91    
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                    309   2e-90    
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg             308   2e-90    
dbj|BAK02959.1|  predicted protein                                      308   3e-90    
ref|NP_001063227.1|  Os09g0426800                                       307   5e-90    
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                    307   5e-90    
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like               307   8e-90    
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         306   8e-90    
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         306   1e-89    
ref|NP_200588.2|  protein ECERIFERUM 3                                  306   2e-89    
ref|XP_008375708.1|  PREDICTED: protein ECERIFERUM 1-like               291   3e-89    
gb|KHG30512.1|  Protein WAX2 -like protein                              305   3e-89    
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876             305   7e-89    
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like               303   2e-88    
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg             303   2e-88    
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                    302   3e-88    
ref|XP_003563334.1|  PREDICTED: protein ECERIFERUM 3-like               303   3e-88    
ref|XP_010054530.1|  PREDICTED: protein ECERIFERUM 1-like               294   3e-88    
gb|EAZ44800.1|  hypothetical protein OsJ_29433                          302   4e-88    
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like               301   5e-88    
emb|CDX88639.1|  BnaA03g10100D                                          301   2e-87    
emb|CDY02769.1|  BnaC02g11200D                                          301   2e-87    
gb|KHG04940.1|  Protein WAX2                                            299   2e-87    
ref|XP_009126813.1|  PREDICTED: protein ECERIFERUM 3                    301   2e-87    
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like               298   8e-87    
emb|CDY11848.1|  BnaC03g12740D                                          298   1e-86    
emb|CDY11847.1|  BnaC03g12730D                                          298   1e-86    
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like               297   3e-86    
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg             297   5e-86    
emb|CDY32747.1|  BnaA02g08090D                                          296   6e-86    
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3         295   8e-86    
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                    295   2e-85    
gb|KCW76795.1|  hypothetical protein EUGRSUZ_D01146                     282   2e-85    
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like               294   3e-85    
emb|CDY51280.1|  BnaA10g11680D                                          294   4e-85    
emb|CDY50795.1|  BnaCnng19590D                                          294   5e-85    
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like               292   2e-84    
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4    291   4e-84    
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like               291   6e-84    
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    291   6e-84    
ref|XP_007219469.1|  hypothetical protein PRUPE_ppa021389mg             277   9e-84    
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like               290   9e-84    
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like               290   1e-83    
emb|CBI16766.3|  unnamed protein product                                279   2e-83    
gb|AGT16346.1|  glossy1 protein                                         290   2e-83    
dbj|BAJ85064.1|  predicted protein                                      290   3e-83    
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg                288   8e-83    
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like               288   9e-83    
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like               288   1e-82    
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...    287   2e-82    
ref|NP_001266321.1|  gl1 protein                                        285   7e-82    
ref|XP_006845484.1|  hypothetical protein AMTR_s00019p00142280          283   7e-82    
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         284   1e-81    
gb|AAR90847.1|  glossy1 protein                                         283   4e-81    
tpg|DAA61563.1|  TPA: glossy1                                           282   1e-80    
ref|XP_009758897.1|  PREDICTED: uncharacterized protein LOC104211529    290   1e-80    
ref|NP_001105247.1|  glossy1                                            282   1e-80    
ref|XP_008443806.1|  PREDICTED: protein ECERIFERUM 3                    281   2e-80    
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    281   2e-80    
ref|XP_010661476.1|  PREDICTED: protein ECERIFERUM 1-like               271   2e-80    
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920          280   6e-80    
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like               280   8e-80    
dbj|BAJ85039.1|  predicted protein                                      279   2e-79    
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    277   2e-79    
ref|XP_006646964.1|  PREDICTED: protein ECERIFERUM 3-like               279   2e-79    
gb|KDO62363.1|  hypothetical protein CISIN_1g006768mg                   276   3e-79    
dbj|BAJ87617.1|  predicted protein                                      278   4e-79    
emb|CDX88642.1|  BnaA03g10070D                                          278   7e-79    
dbj|BAB08850.1|  lipid transfer protein; glossy1 homolog                275   1e-78    
gb|ACN25689.1|  unknown                                                 276   2e-78    
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    276   2e-78    
gb|KDO47517.1|  hypothetical protein CISIN_1g039554mg                   261   5e-78    
ref|NP_001046080.1|  Os02g0178800                                       274   1e-77    
ref|XP_004515455.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    261   2e-77    
gb|KDO42773.1|  hypothetical protein CISIN_1g041887mg                   259   6e-77    
gb|EEC72610.1|  hypothetical protein OsI_06088                          272   6e-77    
ref|NP_001058237.1|  Os06g0653000                                       271   1e-76    
emb|CDX88640.1|  BnaA03g10090D                                          268   1e-75    
gb|ACN25333.1|  unknown                                                 268   1e-75    
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330          268   1e-75    
ref|XP_010103144.1|  Protein WAX2                                       267   3e-75    
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    267   3e-75    
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...    269   7e-75    
ref|XP_004253517.1|  PREDICTED: protein CER1-like 1                     252   3e-74    
gb|KHG12333.1|  Protein WAX2                                            249   5e-73    
gb|EEC73226.1|  hypothetical protein OsI_07314                          254   3e-72    
gb|KDO42776.1|  hypothetical protein CISIN_1g0165311mg                  244   2e-70    
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    252   4e-70    
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    251   4e-70    



>ref|XP_009586962.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=617

 Score =   946 bits (2444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/614 (76%), Positives = 543/614 (88%), Gaps = 1/614 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPGFLTDWPWK LG+FKYV+L+PW+AHS+Y   T E+ E D TN LILPFLLSRMLH
Sbjct  1     MATTPGFLTDWPWKHLGSFKYVILAPWIAHSVYCLATKEQHETDSTNLLILPFLLSRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS+SR+RTA G NRIVDK IEF+QVDRESNWDDQ++LNG+L Y+FNT+ +  S LP
Sbjct  61    NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGILLYVFNTMSSAASNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR+DGV+M++ +H GPVEF+YYWLHR+LHHH+LYSRYHSHHHSSI TEPITSVIHPF E
Sbjct  121   LWRSDGVIMSIFLHAGPVEFLYYWLHRSLHHHYLYSRYHSHHHSSIATEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYFLLF IP L+T+FTG AS +SL GY+TYIDLMNNMGHCNFEFIPKW+FSIFPPLKY
Sbjct  181   HIAYFLLFGIPTLSTVFTGAASLASLFGYITYIDLMNNMGHCNFEFIPKWIFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPS+HSLHHTQFRTNYSLFMP YDYIYGT+DKSTD++YE SLKR E+SPDVVHLTHL
Sbjct  241   FMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTLDKSTDSIYEKSLKRQEDSPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGFS+ A++PQ+  WY+W MWP+TLWTMI NCIYG+TFIL+RN LEK + 
Sbjct  301   TTPESIYHLRLGFSSLASMPQNKKWYIWFMWPLTLWTMITNCIYGRTFILERNNLEKFQF  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY +QYLL WQSQAIN+LIE+AI++AE KG KVLSLGLLNQ EELNRNGE YI+
Sbjct  361   QSWSIPRYNLQYLLNWQSQAINNLIEDAILQAEEKGAKVLSLGLLNQGEELNRNGEIYIE  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++PK+KIK+VDGSSLAVA+ + N+IPKGTT+V LR NL K++ SIAS+L QRGI+V T  
Sbjct  421   RHPKIKIKVVDGSSLAVAVAL-NSIPKGTTQVFLRGNLTKIAFSIASSLCQRGIQVATLY  479

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             E DYEKLKLAT+ +GNFVLS++F QK+W+VG+GLT+EEQMKA KGTLF P SQ+PPKK R
Sbjct  480   ESDYEKLKLATSCQGNFVLSKTFDQKIWVVGDGLTEEEQMKAAKGTLFFPFSQLPPKKAR  539

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
              DC YHHPPAMLAPPSL NLHACENWLPRRAMSA RV+GIVHALEGW+VHECG+ M DID
Sbjct  540   HDCFYHHPPAMLAPPSLQNLHACENWLPRRAMSAPRVAGIVHALEGWDVHECGDNMIDID  599

Query  421   KVWEAALSHGFRPL  380
             K+WEA+L HGF+PL
Sbjct  600   KIWEASLKHGFKPL  613



>ref|XP_009797701.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=617

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/614 (76%), Positives = 545/614 (89%), Gaps = 1/614 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPGFLTDWPWK LG+FKYV+L+PW+AHS Y   T E+ ERD TN LI+PFLLSRM+H
Sbjct  1     MATTPGFLTDWPWKHLGSFKYVILAPWIAHSFYCLATKEQEERDSTNLLIVPFLLSRMVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS+SR+RTA G NRIVDK IEF+QVDRESNWDDQ++LNG+L Y+FNT+ +  + LP
Sbjct  61    NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGILLYVFNTMTSAATNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W+++GV+M++ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWKSEGVIMSIFLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YFLLF IP L+T+FTGTAS +SL GY+TYIDLMNNMGHCNFEFIPKW+FSIFPPLKY
Sbjct  181   HISYFLLFGIPTLSTVFTGTASLASLFGYITYIDLMNNMGHCNFEFIPKWIFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIYGT+DKSTD+LYE SLKR E+S DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTLDKSTDSLYEKSLKRQEDSTDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGFS+ A++PQ+  WY+W MWPVTLWTMI NCIYG+TFIL+RN LEK K 
Sbjct  301   TTPESIYHLRLGFSSLASMPQNKKWYIWFMWPVTLWTMITNCIYGRTFILERNNLEKFKF  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY +QYLL WQSQAINSLIE+AI++AE KG KVLSLGLLNQ EELNRNGE YI+
Sbjct  361   QSWSIPRYNLQYLLNWQSQAINSLIEDAILQAEEKGTKVLSLGLLNQGEELNRNGEIYIE  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++PK+KIK+VDGSSLAVA+++ N+IP GTT+VLLR NL KV+ISIAS+L QRGI+V    
Sbjct  421   RHPKIKIKVVDGSSLAVAVVL-NSIPTGTTKVLLRGNLTKVAISIASSLCQRGIQVAAMY  479

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             + DYEKLKLAT+ + NFVLS++F QK+W+VG+GLT EEQMKA KGTLF P SQ+PPKK R
Sbjct  480   KSDYEKLKLATSCQVNFVLSKTFDQKIWVVGDGLTVEEQMKAAKGTLFFPFSQLPPKKAR  539

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
              DC YHHPPAMLAP SL NLHACENWLPRRAMSA RV+GIVHALEGW+VHECG+KM DID
Sbjct  540   HDCFYHHPPAMLAPSSLQNLHACENWLPRRAMSAPRVAGIVHALEGWDVHECGDKMIDID  599

Query  421   KVWEAALSHGFRPL  380
             K+WEA+L HGF+PL
Sbjct  600   KIWEASLKHGFKPL  613



>emb|CDP09364.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/620 (70%), Positives = 514/620 (83%), Gaps = 12/620 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LTDWPW PLG FKYVVL+PWVAHS+YS  T  ESERD TN LILPFLL RMLH
Sbjct  1     MATTPGLLTDWPWTPLGRFKYVVLAPWVAHSIYSNATKGESERDLTNLLILPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SRHRTANGKNRIVDK IEFEQVDRESNWDDQ++LNG+LFY+FN +L+  SRLP
Sbjct  61    DQIWISISRHRTANGKNRIVDKTIEFEQVDRESNWDDQIILNGILFYIFNNLLSNASRLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGE
Sbjct  121   LWRTDGVILTSLLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYFLLFAIP+L T +TGTAS +S+ GY+TYIDLMNNMGHCNFE IPK LFSIFPPLKY
Sbjct  181   HIAYFLLFAIPILATWYTGTASLASMFGYITYIDLMNNMGHCNFELIPKRLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTD+L+ETSL+R E++PDVVHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDSLHETSLQREEDAPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y IRLGF++ A+ P+   WY+ LMWPVTLW+ IIN IYG+TFIL+RN LEK+KL
Sbjct  301   TTPQSIYHIRLGFASVASKPEGSTWYILLMWPVTLWSAIINSIYGRTFILERNKLEKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY VQYL +W+S+AIN L          +   + +     + +ELN+NGEF+++
Sbjct  361   QSWAIPRYNVQYLKKWRSRAINGL---------IEKAILDAEAKGTKRKELNKNGEFFMR  411

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YPK+K+++VDGSSLAVA ++ N IPKGTTEVLL  NL KV+ S+A AL +RGI+V  S 
Sbjct  412   RYPKLKLRVVDGSSLAVATVL-NNIPKGTTEVLLVGNLTKVARSVALALCERGIQVNISS  470

Query  781   EDDYEKLKLATNSKGNF-VLSRSFTQ-KVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + ++EKLK +  S+ N  VLS+S    K WLVG+GLT+++Q+ A KG LFIP S  PPKK
Sbjct  471   QYEFEKLKQSVASQSNLVVLSKSVAAYKTWLVGDGLTEKQQLNAPKGALFIPFSTFPPKK  530

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R DCSY H PAMLAP SL NL +CENWLPRRA+SA R +GIVHALEGW  HECGE M +
Sbjct  531   VRSDCSYLHTPAMLAPASLQNLDSCENWLPRRALSAVRAAGIVHALEGWTEHECGENMLN  590

Query  427   IDKVWEAALSHGFRPLPLPN  368
             +++VW+AAL HGFRPL  P+
Sbjct  591   VEEVWQAALKHGFRPLGSPS  610



>ref|XP_011085147.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=623

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/616 (69%), Positives = 519/616 (84%), Gaps = 3/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW  LG+FKYVVL+PWV HS YS++  ++SERD++ F+I PFLLSRMLH
Sbjct  1     MASKPGILTDWPWTWLGSFKYVVLAPWVIHSTYSYMVKDKSERDFSQFVIFPFLLSRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G NRIVDK IEFEQVDRE NWDDQ++ NG+LFY+    + +   +P
Sbjct  61    NQIWISLSRYRTAKGNNRIVDKNIEFEQVDRERNWDDQIIFNGILFYVGQKYITQAHHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGE
Sbjct  121   WWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL+TGTAS  S  GY+TYID MNNMGHCNFE IPKWLFSIFPPLKY
Sbjct  181   HIAYFMLFAIPLLTTLWTGTASLLSFAGYITYIDFMNNMGHCNFEHIPKWLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKS+D LYE+SL R EE+PDVVHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSSDALYESSLLRKEEAPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF+  A+ P    WY+WLMWPVT W+M++  IYG+TFI++RNI + +KL
Sbjct  301   TTPESIYHLRLGFAYLASEPHKSKWYLWLMWPVTFWSMMVTWIYGRTFIVERNIFKHLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P+Y +QY ++WQ ++IN+LIE+AI+EAE KGVKVLSLGLLNQ E LNRNGE +++
Sbjct  361   QTWAVPKYSIQYYMQWQRESINNLIEDAILEAEEKGVKVLSLGLLNQEEGLNRNGELFLR  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P++K+KLVDGSSLAVAI++ N+IPKGTT+V+LR NL KV+ SIA AL + GI+V T  
Sbjct  421   RQPQLKVKLVDGSSLAVAIVL-NSIPKGTTQVVLRGNLTKVAYSIALALCKGGIQVFTLH  479

Query  781   EDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++Y+KL  KL+ ++  N VLS+    K WLVG+GL ++EQ+KA+KGT+FIP SQ PPKK
Sbjct  480   ENEYKKLKEKLSCDAGNNLVLSKHNLSKTWLVGDGLREDEQLKASKGTVFIPFSQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC Y++ PAMLAP  L N+ +CENWLPRR MSA R++GI+H +E WNVHECG  M D
Sbjct  540   MRKDCLYNNTPAMLAPKHLENVDSCENWLPRRVMSAWRIAGILHGIEEWNVHECGNMMFD  599

Query  427   IDKVWEAALSHGFRPL  380
             I+K+W+A+L HGFRPL
Sbjct  600   IEKIWQASLEHGFRPL  615



>ref|XP_007008729.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOY17539.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=623

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/619 (67%), Positives = 514/619 (83%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY++L PW+  S+YSF+ ++E+ERD++N  I PF+L RM H
Sbjct  1     MASKPGILTDWPWTPLGSFKYIILVPWITESIYSFIANDENERDFSNLSIFPFMLWRMFH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G NRIVDK +EF+QVDRE NWDDQ++ N +LFYL N  +   S LP
Sbjct  61    NQIWISLSRYRTATGSNRIVDKGLEFDQVDRERNWDDQILFNAILFYLGNKYVPGSSHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF LFAIP+ T   +GTAS +++ GY+TY+DLMNNMGHCNFE IP WLFS+FPPLKY
Sbjct  181   HIAYFALFAIPLSTIALSGTASIAAIAGYITYVDLMNNMGHCNFELIPNWLFSVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNY+LFMPFYDYIYGTMDKS+DTLYE SL+R EESPDVVHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYALFMPFYDYIYGTMDKSSDTLYENSLERKEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ P S  WY+ L+WP+T W MI+ C YG+TF+++R+  +KI+L
Sbjct  301   TTPESIYHLRLGFASLASKPYSSTWYLCLLWPLTFWFMILTCFYGRTFVVERSRFDKIRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+YK+QY L+WQ ++IN+LI+EAI+EA+ KG +VLSLGLLNQ EELNR GE Y+ 
Sbjct  361   QTWAIPKYKIQYHLKWQKESINNLIQEAILEAKEKGARVLSLGLLNQVEELNRYGELYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++K+KLVDGSSLAVA+++ N+IPKGTT+VLLR NL+KV+ ++A AL Q+GI+V    
Sbjct  421   KHPQLKVKLVDGSSLAVAVVL-NSIPKGTTQVLLRGNLSKVAYAVAFALCQKGIQVAVLR  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             ED+YEKL   L T S+GN V+S+ +  K WLVG+ L++EEQ KATKGTLFIP SQ PPKK
Sbjct  480   EDEYEKLNKSLGTKSEGNLVISKGYFYKTWLVGDDLSEEEQRKATKGTLFIPFSQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM  P SL N+ +CENWLPRR MS  R++GIVHALEGW  HECG  M +
Sbjct  540   LRKDCFYHTTPAMQTPMSLENVDSCENWLPRRVMSVWRIAGIVHALEGWEEHECGYTMSN  599

Query  427   IDKVWEAALSHGFRPLPLP  371
             I+KVWEA++ HGF+PL +P
Sbjct  600   IEKVWEASVKHGFQPLRVP  618



>ref|XP_010054531.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76798.1| hypothetical protein EUGRSUZ_D01149 [Eucalyptus grandis]
Length=620

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/619 (68%), Positives = 513/619 (83%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+FKY++L+PW  H  Y F++    ERD + FL+LPFLL+R+LH
Sbjct  1     MASKPGILTEWPWKPLGSFKYMILAPWAIHGTYQFISKGAGERDSSYFLVLPFLLARLLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WISYSRHR A G NRIVD+ IEFEQVDRESNWDDQ++LNG+LFY+ + ++ + S LP
Sbjct  61    NQIWISYSRHRIAKGNNRIVDRGIEFEQVDRESNWDDQILLNGILFYVSHMIIPQASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++TV IH   VEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPI+SVIHPF E
Sbjct  121   LWRTDGVIITVLIHASVVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYF+LFAIP+ TTLF  TAS  SL GY+  ID MNN+GHCNFE IP WLF+IFPPLKY
Sbjct  181   HMAYFMLFAIPMFTTLFVRTASMVSLTGYILCIDFMNNLGHCNFELIPYWLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+D++ D+ YETSL+R E+SPDVVHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTVDQALDSTYETSLRREEDSPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ P S  WY+W+MWP+TL +++   IYG +FIL+RN  +K+KL
Sbjct  301   TTPESIYHLRLGFASLASHPHSPKWYMWIMWPLTLASVVWTWIYGHSFILERNAFKKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY  QYLL+W+ +AIN+LIEEAI++A  KGVKVL+LGLLNQ EELN NGE YIQ
Sbjct  361   QSWVIPRYNFQYLLQWRREAINALIEEAILDANKKGVKVLTLGLLNQGEELNTNGELYIQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+  ++ KLVDGSSLAVA+++ ++IPKGT +VLL+ NLNK+S +IA AL  R I+V  + 
Sbjct  421   KHKDLRTKLVDGSSLAVAVVL-HSIPKGTGQVLLKGNLNKLSYAIAHALCARDIQVNVAS  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +D++EKLK + N K  GN +LSR+F+Q++WLVG+G+ +EEQ KA KGTLFIP SQ PPK+
Sbjct  480   KDEHEKLKRSLNGKYRGNLILSRTFSQEIWLVGDGIAEEEQKKAPKGTLFIPFSQFPPKQ  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM  P S  NLH+CENWLPRR MSA RV+GIVHALEGWNV+ECG  M D
Sbjct  540   IRKDCLYHSTPAMTIPRSFDNLHSCENWLPRRVMSAWRVAGIVHALEGWNVNECGIMMFD  599

Query  427   IDKVWEAALSHGFRPLPLP  371
             I+K WEA+L HGFRPL LP
Sbjct  600   IEKAWEASLQHGFRPLALP  618



>ref|XP_007218863.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
 gb|EMJ20062.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
Length=623

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/615 (68%), Positives = 512/615 (83%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLGNFK+V+L+PW+ H  YSFV ++  E+D + FLI PF+L RM+H
Sbjct  1     MASTPGILTDWPWTPLGNFKHVILAPWIIHGAYSFVVNDGKEKDLSYFLIFPFMLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR++TA G  RIVDKP+EFEQVDRE NWDDQ+V NG+LF L +  +     LP
Sbjct  61    NQIWITLSRYQTAKGNGRIVDKPLEFEQVDRERNWDDQIVFNGILFCLGSRHMPGAQNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T+ +H GPVE++YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLLTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTT  TGTAS  S  GYVTYID MNNMGHCNFE IP WLFSIFPPLKY
Sbjct  181   HIAYFVLFAIPMLTTTLTGTASIISFAGYVTYIDFMNNMGHCNFELIPNWLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMDKS+D+LYETSLKR EE+PDV+HLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDSLYETSLKRKEETPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ ++ P + +WY+WLMWPVTLW+ ++  IYG+TF+++R   +K++L
Sbjct  301   TTPESIYHLPLGFASLSSKPHTSHWYLWLMWPVTLWSAMLTWIYGRTFVVERQRFDKLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y +QY L+WQ++AIN LIEEAI+EAE KGVKVLSLGLLNQ EELNR G  Y+ 
Sbjct  361   QAWVIPKYSLQYFLQWQNEAINGLIEEAILEAEEKGVKVLSLGLLNQGEELNRYGGLYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YP++K+K+VDGSSLAVA+I+ N+IPKGTTEVLLR NL KV+ + A AL Q+GI+V T  
Sbjct  421   RYPELKMKVVDGSSLAVAVIL-NSIPKGTTEVLLRGNLTKVAYATAFALCQKGIQVATLN  479

Query  781   EDDYEKLKLATN-SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + +Y KL  + N +    VL+RS+ QK+WLVG+GL++EEQ++A KGTLF+P SQ P KK 
Sbjct  480   QTEYLKLTKSLNVTDSRLVLARSYAQKIWLVGDGLSEEEQLRAPKGTLFVPFSQFPQKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  PPSL N+HACENWLPRR MSA R++GIVHALEGW  HECG  M +I
Sbjct  540   RKDCFYHYTPAMKTPPSLENVHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNI  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A L HGF+PL
Sbjct  600   DKVWQATLQHGFQPL  614



>ref|XP_002263787.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/620 (68%), Positives = 508/620 (82%), Gaps = 3/620 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLGNFKYVVL+PW  H++YSF+  +E ERD  +FLI PFLL RMLH
Sbjct  1     MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SRHRTA G NRIVDK IEFEQVDRE NWDDQ++ NG++FY+    L   S +P
Sbjct  61    NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGASHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T+ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRADGVVVTILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF+IP+LT +FTGT S  S +GY++YID MNNMGHCNFE +PKWLFSIFP LKY
Sbjct  181   HIGYFLLFSIPLLTVIFTGTRSIVSFVGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+YGTMDKS+D LYE SL R EESPDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYMYGTMDKSSDVLYEKSLTRPEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y IRLGF++ A+ P    WY+ LMWP+T   M++  I  +TF+L+RN   K+KL
Sbjct  301   TTPDSIYHIRLGFASVASKPYISKWYLRLMWPLTSSYMMLIWICSRTFVLERNHFNKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y++QY L+WQ++ INSLIEEAI++AE +GV VLSLGLLNQ EELN  GE YI 
Sbjct  361   QTWVIPKYRIQYFLKWQNEPINSLIEEAILDAEQRGVNVLSLGLLNQGEELNIYGELYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R  L+KV+   A AL Q+GI+V T  
Sbjct  421   RNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFH  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++Y K+ +  N+K  G   LS+++  K+WLVG+GLTKEEQ+KA KGTLFIP SQ PPK+
Sbjct  480   EEEYAKINMKLNTKLGGKLALSKNYAHKIWLVGDGLTKEEQLKAPKGTLFIPFSQFPPKR  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM++P S  N+ +CENWLPRRAMSA RV+GI+HALEGWNVHECG  + D
Sbjct  540   MRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHAIFD  599

Query  427   IDKVWEAALSHGFRPLPLPN  368
             I+K+WEA+L HGFRPL +P+
Sbjct  600   IEKIWEASLQHGFRPLMIPS  619



>ref|XP_008232261.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/615 (68%), Positives = 512/615 (83%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLGNFK+V+L+PW+ H  YSFV ++  E+D + FLI PF+L RM+H
Sbjct  1     MASTPGILTDWPWTPLGNFKHVILAPWIIHGAYSFVVNDGKEKDLSYFLIFPFMLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR++TA G  RIVDKP+EFEQVDRE NWDDQ+V NG+LFYL +  +    +LP
Sbjct  61    NQIWITLSRYQTAKGNGRIVDKPLEFEQVDRERNWDDQIVFNGILFYLGSRHMPGAQQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T+ +H GPVE++YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLLTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF LFAIP+LTT+ TGTAS  S  GYVTYID MNNMGHCNFE IP WLFSIFPPLKY
Sbjct  181   HIAYFTLFAIPMLTTILTGTASIISFAGYVTYIDFMNNMGHCNFELIPNWLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YD IYGTMDKS DTLYETSLKR EE+PDV++LTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPIYDCIYGTMDKSLDTLYETSLKRKEETPDVLYLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ ++ P + +WY+WLMWPVTLW++++  IYG+TF+++R   +K++L
Sbjct  301   TTPESIYHLPLGFASLSSKPHTSHWYLWLMWPVTLWSVMLTWIYGRTFVVERQRFDKLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY L+WQ++AIN LIEEAI+EAE KGVKVLSLGLLNQ EELNR G  Y+ 
Sbjct  361   QTWAIPKYSLQYFLQWQNEAINDLIEEAILEAEEKGVKVLSLGLLNQGEELNRYGGLYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++K+K+VDGSSLAVA+I+ N+IPKGTTEVLLR  L KV+ + A AL Q+GI+V T  
Sbjct  421   RHPELKMKVVDGSSLAVAVIL-NSIPKGTTEVLLRGKLTKVAYATALALCQKGIQVATLH  479

Query  781   EDDYEKLKLATN-SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + +Y KL  + N ++  FVL+RS+ QK+WLVG+GL++EEQ++A KGTLF P SQ PPKK 
Sbjct  480   QTEYLKLTKSLNVTESRFVLTRSYAQKIWLVGDGLSEEEQLRAPKGTLFFPFSQFPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  P SL N+HACENWLPRR MSA R++GIVHALEGW  HECG  M +I
Sbjct  540   RKDCFYHYTPAMKTPTSLENVHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNI  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A L HGF+PL
Sbjct  600   DKVWQATLQHGFQPL  614



>ref|XP_004307281.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=625

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/615 (68%), Positives = 509/615 (83%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLG+FKYVVL+PWV HS YSF+ +E  +RD + FLILP +L RMLH
Sbjct  1     MASTPGILTDWPWTPLGSFKYVVLAPWVVHSTYSFMVNEGPDRDLSYFLILPLMLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA GK RIVDK +EFEQVDRE NWDDQ++ NG+LFYL +  L  GS LP
Sbjct  61    NQLWISLSRYRTAKGKGRIVDKGLEFEQVDRERNWDDQIIFNGILFYLGSRHLPGGSNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W+ DG+++T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPI+SVIHPF E
Sbjct  121   MWKADGLVITFLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP +T   TGT S +S L Y+TYIDLMNNMGHCNFE IP W+FSIFPPLKY
Sbjct  181   HIAYFILFAIPQVTIALTGTGSVASYLIYLTYIDLMNNMGHCNFELIPNWIFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKSTD+LYE+SLKR EESPDV+HLTHL
Sbjct  241   FMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKSTDSLYESSLKREEESPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + +GF++ A+ P +  WY+WLMWPVTLW+M++  IYG+TF+++R   EK+KL
Sbjct  301   TTPESIYQLPVGFASLASKPHTSTWYLWLMWPVTLWSMLLTWIYGRTFVVERQRFEKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY LEWQ++AIN LIE AI+EAE KGVKVL+LGLLNQSEELNR G  Y+ 
Sbjct  361   QTWAIPKYSLQYFLEWQNEAINGLIEGAILEAEEKGVKVLTLGLLNQSEELNRYGGLYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P++KIK+VDGSSLAVA+I+ N+IPKGTTEVLLR NL KV+ ++A +L Q+GI+V T  
Sbjct  421   RNPQLKIKVVDGSSLAVAVIL-NSIPKGTTEVLLRGNLTKVAYALAFSLCQKGIQVATLH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + DY KL K  + ++   VL++S+  K+WLVG+GL+KEEQ+ A KGT+F+P SQ+PPKK 
Sbjct  480   QSDYLKLTKSFSATESKLVLAKSYAAKIWLVGDGLSKEEQLNAPKGTIFVPFSQLPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  PAM  P SL N+++CENWLPRR MS  R++GIVHALEGWN HECG  M DI
Sbjct  540   RKDCYYHCTPAMKTPTSLENIYSCENWLPRRVMSVWRIAGIVHALEGWNKHECGYTMSDI  599

Query  424   DKVWEAALSHGFRPL  380
             +KVW+A L HGF+PL
Sbjct  600   NKVWQATLRHGFQPL  614



>ref|XP_009337262.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/616 (66%), Positives = 512/616 (83%), Gaps = 1/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LTDWPW PLG+FK+VV++PW+ H  YS+  +++ ++D + FLI PF+L R LH
Sbjct  1     MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDKKDKDLSYFLIFPFMLWRFLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ NG+LFYL +  L   + LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGAANLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++T+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   YWRTDGIILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YF LFAIP++TT+ TGT+S  S  GY TYID MNNMGHCNFE IPKWLF+IFPPLKY
Sbjct  181   HILYFTLFAIPLMTTILTGTSSIVSFAGYATYIDFMNNMGHCNFELIPKWLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHTQFRTNY LFMP YDY+YGTMDKS+D+LY+TSLKR EESPDV+HLTHL
Sbjct  241   LLYTPSYHSLHHTQFRTNYCLFMPIYDYVYGTMDKSSDSLYDTSLKREEESPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF+  A+ P +  WY+WLMWPVTLW+M+I  I+G+TF++DR+  +K++L
Sbjct  301   TTPESMYHLPLGFAALASRPYTRTWYLWLMWPVTLWSMMITWIHGRTFVIDRHRFDKLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++WQ++AIN LIE+AI+EAE KGVKVLSLGLLNQ EELNR G  Y+Q
Sbjct  361   QTWAIPKYSLQYFMQWQNEAINGLIEDAILEAEEKGVKVLSLGLLNQGEELNRYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KI++VDGSSLAVA+I+ N+IPKGTT+V+LR  L KV+ +IA AL+Q+G++V T  
Sbjct  421   RHPHLKIQVVDGSSLAVAVIL-NSIPKGTTQVVLRGKLTKVAYAIAHALSQKGVQVATLY  479

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             + +Y KL  +  ++ N V+++S+ QK+WLVG+GLT++EQM A KG LF+P SQ PPKK R
Sbjct  480   QTEYLKLTKSLGTESNLVVAKSYAQKIWLVGDGLTEKEQMSAPKGALFVPFSQFPPKKLR  539

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             RDC YH+ PAM  P SL N+HACENWLPRR MSA+RV+GIVHALEGW  H+CG  M +ID
Sbjct  540   RDCFYHYTPAMKTPTSLENVHACENWLPRRVMSASRVAGIVHALEGWKEHDCGYTMSNID  599

Query  421   KVWEAALSHGFRPLPL  374
             KVW+A+L HGF+PL +
Sbjct  600   KVWQASLVHGFQPLTI  615



>ref|XP_004510150.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=626

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/620 (67%), Positives = 510/620 (82%), Gaps = 4/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKYV+L+PWV HS YS +  +++ERD + FLI PFLL RMLH
Sbjct  1     MASRPGILTDWPWKPLGSFKYVILAPWVVHSTYSVLVKDKNERDISTFLIFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS+SR+RTA G NRIVDK IEF+QVDRE +WDDQ++ NGLL+YL    L   SR+P
Sbjct  61    NQIWISFSRYRTAKGNNRIVDKGIEFDQVDRERDWDDQILFNGLLYYLACYTLKGASRVP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W T+GV++T+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWNTEGVIITILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YFLLFAIP LT +FT  AS  +++GYVTYIDLMNN+GHCNFE IP WLF IFPPLKY
Sbjct  181   HISYFLLFAIPKLTLVFTNRASVIAMVGYVTYIDLMNNLGHCNFEVIPTWLFDIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYD IYGTMDK++D L+ETSLKR EE+P+VVHLTH 
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDLIYGTMDKASDELHETSLKRKEETPNVVHLTHF  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNIL-EKIK  1145
             TTPES+Y +R+GF+  AA P +  WY+WLMWPVT W+M++  +YG+TFI++RN   +K+ 
Sbjct  301   TTPESIYHLRIGFAYLAAKPYTSKWYLWLMWPVTAWSMLLTWVYGRTFIVERNRFDDKLN  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W +P+Y VQY LEWQ  AIN +IEEAI++A+ KG+KV+SLGL+NQ EELN  G  Y+
Sbjct  361   LQTWALPKYSVQYFLEWQKVAINKMIEEAILDADKKGIKVVSLGLMNQGEELNMYGGLYV  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
              K+PK+ +K+VDGSSL VA+++ NTIPKGTT+VLLR  L KV+ +IA  L Q+GI+V T 
Sbjct  421   SKHPKLNVKVVDGSSLVVAVVL-NTIPKGTTQVLLRGKLTKVAYAIAFTLCQQGIQVATM  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              EDDY  LK  L  +S  N V  ++ TQ VWLVG+G T+EEQMKA KGTLFIP SQ PPK
Sbjct  480   HEDDYVNLKKSLTNSSDENLVKEKNCTQTVWLVGDGFTEEEQMKAPKGTLFIPYSQFPPK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             KHR+DCSYH+ P+ML P S+ N+H+CE+WLPRR MSA R++GI+H+LEGW+ HECG KM 
Sbjct  540   KHRKDCSYHYTPSMLTPTSIENVHSCEDWLPRRVMSACRIAGILHSLEGWSEHECGYKMN  599

Query  430   DIDKVWEAALSHGFRPLPLP  371
             ++DKVW +AL HGF+PL +P
Sbjct  600   NVDKVWHSALQHGFQPLTVP  619



>ref|XP_008364777.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/616 (67%), Positives = 513/616 (83%), Gaps = 1/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LTDWPW PLG+FK+VV++PW+ H  YS+  ++E ++D + FLI PF+L R LH
Sbjct  1     MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ NG+LFYL +  L   + LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF+LFAIP+LTT++TGT+S  S  GYVTYID MNNMGHCNFE IPKWLF+IFPPLKY
Sbjct  181   HISYFVLFAIPMLTTIYTGTSSIVSFAGYVTYIDFMNNMGHCNFELIPKWLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS HSLHHTQFRTNY LFMP YDY+YGTMDKS+D+LYETSLKR EESPDV+HLTHL
Sbjct  241   LLYTPSXHSLHHTQFRTNYCLFMPIYDYVYGTMDKSSDSLYETSLKREEESPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF+  A+ P +  WY+WLMWPVTLW+M+   I+G+TF++DR+  +K++L
Sbjct  301   TTPESIYHLXLGFAALASRPHTRTWYLWLMWPVTLWSMMXTWIHGRTFVVDRHRFDKLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QYL++WQ++AIN LIE+AI++AE KGVKVLSLGLLNQ EELNR G  Y+Q
Sbjct  361   QTWAIPKYTLQYLMQWQNEAINGLIEDAILDAEEKGVKVLSLGLLNQGEELNRYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P + IK+VDGSSLAVA+I+ N+IPKGTT+V+LR  L KV+ +IA AL+Q+G+++ T  
Sbjct  421   RHPHLNIKVVDGSSLAVAVIL-NSIPKGTTQVVLRGKLTKVAYAIAYALSQKGVQIXTLY  479

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             + +Y KL  + +++ N V+++S+ QKVWLVG+GLT++EQ  A KGTLF+P SQ PPKK R
Sbjct  480   QXEYLKLTKSLDTESNLVVAKSYAQKVWLVGDGLTEKEQXSAPKGTLFVPFSQFPPKKLR  539

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC YH+ PAM  P SL N+HACENWLPRR MSA RV+GI HALEGW  H+CG  M +ID
Sbjct  540   KDCFYHYTPAMKTPTSLENVHACENWLPRRVMSAWRVAGIXHALEGWKEHDCGYTMSNID  599

Query  421   KVWEAALSHGFRPLPL  374
             KVW+A+L HGF+PL +
Sbjct  600   KVWQASLVHGFQPLTI  615



>gb|EYU40309.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=612

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/617 (66%), Positives = 512/617 (83%), Gaps = 9/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSE--ESERDYTNFLILPFLLSRM  2048
             MAT PG LTDWPWK LG+FKY++L+PW   S+YS   ++  E ERDY N L++PF++SR+
Sbjct  1     MATKPGVLTDWPWKHLGSFKYMILAPWAMQSIYSIAKNKNGEKERDYINLLVIPFMVSRI  60

Query  2047  LHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSR  1868
             LHNQ+WIS SRHRTA G NRI+D+ IEFEQVDRESNWDD ++L+G+LFY FN+ L   S 
Sbjct  61    LHNQIWISISRHRTAKGNNRILDRTIEFEQVDRESNWDDNILLSGILFYFFNSTLRSASF  120

Query  1867  LPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPF  1688
             LP WR DG+++T+ +H GPVE++YYWLHR LHHHFLY+RYHSHHHSSIVTEPITSVIHPF
Sbjct  121   LPIWRNDGIIITILLHAGPVEYLYYWLHRGLHHHFLYTRYHSHHHSSIVTEPITSVIHPF  180

Query  1687  GEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPL  1508
              EH++YF LFAIP+  T+ T TAS  SL GY+TYIDLMNNMGHCNFE +PKW+FSIFPPL
Sbjct  181   AEHLSYFALFAIPMFATILTRTASIISLFGYITYIDLMNNMGHCNFELVPKWIFSIFPPL  240

Query  1507  KYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLT  1328
             KYLMYTPS+HSLHHTQFRTNYSLFMPFYDY++GTMDKSTD LYETSL+R E+SPDVVH+T
Sbjct  241   KYLMYTPSFHSLHHTQFRTNYSLFMPFYDYVHGTMDKSTDALYETSLERKEDSPDVVHIT  300

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLTTP+S++ +++GF+++A+ PQ   WY   MWP+T W++  N IYG+TFI++RN+ EK+
Sbjct  301   HLTTPDSIFHLQVGFASFASKPQKSKWY---MWPLTFWSVTFNYIYGKTFIVERNLFEKL  357

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQSW IPRY +QY L+WQ +AIN LIEEAI+EA+ +G KV+SLGLLNQSEELNR GE +
Sbjct  358   KLQSWAIPRYSIQYSLKWQGKAINGLIEEAILEADARGAKVISLGLLNQSEELNRRGELF  417

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             ++K+PKMK K+VDGSSLAVA+++ N+IPKGTTE+L R +L+K++ +I SAL Q+GIKV T
Sbjct  418   VEKHPKMKTKIVDGSSLAVAVVL-NSIPKGTTEILFRGSLSKIAFAIVSALCQQGIKVAT  476

Query  787   SCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               E+  EKLKL+T       V S ++TQ +W+VG+G T++EQ KA KGTLFIP SQ PPK
Sbjct  477   FYEN--EKLKLSTMPHATKVVTSENYTQMIWIVGDGFTEDEQKKAPKGTLFIPFSQFPPK  534

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R D  Y   P+++APPSL NL++CENWLPRRAMSA RV+GI+HALEGWNVHECG+ + 
Sbjct  535   KARNDVVYRQTPSLIAPPSLKNLNSCENWLPRRAMSAWRVAGILHALEGWNVHECGDDIF  594

Query  430   DIDKVWEAALSHGFRPL  380
             +  K+WEAAL HGFRP+
Sbjct  595   EFKKIWEAALKHGFRPI  611



>ref|XP_008375723.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/616 (66%), Positives = 510/616 (83%), Gaps = 1/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LTDWPW PLG+FK+VV++PW+ H  YS+  ++E ++D + FLI PF+L R LH
Sbjct  1     MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ NG+LFYL +  L   + LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF+LFAIP+LTT++TGT+S  S  GYVTYID MNNMGHCNFE IPKWLF+IFPPLKY
Sbjct  181   HISYFVLFAIPMLTTIYTGTSSIVSFAGYVTYIDFMNNMGHCNFELIPKWLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS HSLHHTQFRTNY LFMP YDY+YGTMDKS+D+LYETSLKR EESPDV+HLTHL
Sbjct  241   LLYTPSXHSLHHTQFRTNYCLFMPIYDYVYGTMDKSSDSLYETSLKREEESPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF+  A+ P +  WY+WLMWPVTLW+M+   I+G+TF++DR+  +K++L
Sbjct  301   TTPESIYHLXLGFAALASRPHTRTWYLWLMWPVTLWSMMXTWIHGRTFVVDRHRFDKLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QYL++WQ++AIN LIE+AI++AE KGVKVLSLGLLNQ  ELNR G  Y+Q
Sbjct  361   QTWAIPKYTLQYLMQWQNEAINGLIEDAILDAEEKGVKVLSLGLLNQGXELNRYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P + IK+VDGSSLAVA+I+ N+IPKGTT+V+LR  L KV+ +IA AL+Q+G+++ T  
Sbjct  421   RHPXLXIKVVDGSSLAVAVIL-NSIPKGTTQVVLRGKLTKVAYAIAYALSQKGVQIXTLY  479

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
               +Y KL  +  ++ N V+++S  QK+WLVG+GLT++EQM A KGTLF+P SQ PPKK R
Sbjct  480   XAEYLKLTXSLXTESNLVVAKSXAQKIWLVGDGLTEKEQMSAPKGTLFVPFSQFPPKKLR  539

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC YH+ PAM  P SL N+HACENWLPRR MSA RV+GIVHALEGW  H+CG  M +ID
Sbjct  540   KDCXYHYTPAMKTPTSLENVHACENWLPRRVMSAWRVAGIVHALEGWKEHDCGYTMSNID  599

Query  421   KVWEAALSHGFRPLPL  374
             K W+A+L HGF+PL +
Sbjct  600   KFWQASLVHGFQPLTI  615



>emb|CBI16761.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/614 (68%), Positives = 503/614 (82%), Gaps = 3/614 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLGNFKYVVL+PW  H++YSF+  +E ERD  +FLI PFLL RMLH
Sbjct  1     MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SRHRTA G NRIVDK IEFEQVDRE NWDDQ++ NG++FY+    L   S +P
Sbjct  61    NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGASHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T+ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRADGVVVTILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF+IP+LT +FTGT S  S +GY++YID MNNMGHCNFE +PKWLFSIFP LKY
Sbjct  181   HIGYFLLFSIPLLTVIFTGTRSIVSFVGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+YGTMDKS+D LYE SL R EESPDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYMYGTMDKSSDVLYEKSLTRPEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y IRLGF++ A+ P    WY+ LMWP+T   M++  I  +TF+L+RN   K+KL
Sbjct  301   TTPDSIYHIRLGFASVASKPYISKWYLRLMWPLTSSYMMLIWICSRTFVLERNHFNKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y++QY L+WQ++ INSLIEEAI++AE +GV VLSLGLLNQ EELN  GE YI 
Sbjct  361   QTWVIPKYRIQYFLKWQNEPINSLIEEAILDAEQRGVNVLSLGLLNQGEELNIYGELYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R  L+KV+   A AL Q+GI+V T  
Sbjct  421   RNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFH  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++Y K+ +  N+K  G   LS+++  K+WLVG+GLTKEEQ+KA KGTLFIP SQ PPK+
Sbjct  480   EEEYAKINMKLNTKLGGKLALSKNYAHKIWLVGDGLTKEEQLKAPKGTLFIPFSQFPPKR  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM++P S  N+ +CENWLPRRAMSA RV+GI+HALEGWNVHECG  + D
Sbjct  540   MRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHAIFD  599

Query  427   IDKVWEAALSHGFR  386
             I+K+WEA+L HGF+
Sbjct  600   IEKIWEASLQHGFQ  613



>ref|XP_002265189.2| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI16762.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/620 (66%), Positives = 510/620 (82%), Gaps = 3/620 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLGNFKYVVL+PW  H++YSFV  +E ERD ++FLI PFLL RMLH
Sbjct  1     MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIYSFVVKDEKERDISHFLIFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SRHRTA G NRIVDK IEFEQVDRE NWDDQ++ NG++FY+    +  G+ +P
Sbjct  61    NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYITYFTVPGGTHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T+ +H+GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   FWRADGVVITILLHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF+IP+LT +FTGT S  S +GY++YID MNNMGHCNFE +PKWLFSIFP LKY
Sbjct  181   HIGYFLLFSIPLLTVIFTGTRSIVSFVGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIYGT+DKS+D LYE SL R EESPDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTVDKSSDVLYEKSLTRPEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLGF++ A+ P    WY+ LMWP+T W M++  I  +TF+L+RN   K+KL
Sbjct  301   TTPDSIYHMRLGFASVASKPYISKWYLRLMWPLTSWYMMLIWICSRTFVLERNHFNKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y++QY L+ Q++ INSLIEEAI++A+ +GVKVLSLG+LNQ EELN  GE YI 
Sbjct  361   QTWVIPKYRIQYFLKGQNEPINSLIEEAILDADQRGVKVLSLGILNQGEELNIYGELYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R  L+KV+   A AL Q+GI+V T  
Sbjct  421   RNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQVATFH  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++Y  + +  N+K  G   LS+++  K+WLVG+GLT+EEQ+KA KGTLFIP SQ PPK+
Sbjct  480   EEEYANINMKLNTKLGGKLALSKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKR  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM++P S  ++ +CENWLPRRAMSA RV+GI+HALEGWNVHECG  + +
Sbjct  540   MRKDCFYHTTPAMMSPTSFEDMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFN  599

Query  427   IDKVWEAALSHGFRPLPLPN  368
             I+K+WEA+L HGFRPL +P+
Sbjct  600   IEKIWEASLQHGFRPLMIPS  619



>ref|XP_009337263.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Pyrus x bretschneideri]
Length=622

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/616 (67%), Positives = 511/616 (83%), Gaps = 2/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LTDWPW PLG+FK+VV++PW+ H  YS+  ++E ++D + FLI PF+L R LH
Sbjct  1     MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ N +LFYL    L     LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYL-GRHLPGAVNLP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWL RALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  120   FWRTDGVILTILLHAGPVEFLYYWLPRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF++FAIP+LTT++TGT+S  S  GYVTYID MNNMGHCNFE IPKWLF+IFPP+KY
Sbjct  180   HISYFIIFAIPMLTTIYTGTSSIVSFAGYVTYIDFMNNMGHCNFELIPKWLFTIFPPVKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHTQFRTNY LFMP YDY+YGTMDKS+D+LY+TSLKR EESPDV+HLTHL
Sbjct  240   LLYTPSYHSLHHTQFRTNYCLFMPIYDYVYGTMDKSSDSLYDTSLKREEESPDVLHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF+  A+ P +  WY+WLMWPVTLW+MII  IYG+TF++DR+  +K++L
Sbjct  300   TTPESIYHLPLGFAALASRPYTRTWYLWLMWPVTLWSMIITWIYGRTFVVDRHRFDKLRL  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P+Y +QY ++WQ++AIN LIE+AI+EAE KGVKVLSLGLLNQ EELNRNG  Y+Q
Sbjct  360   QTWAVPKYSLQYFVQWQNEAINGLIEDAILEAEEKGVKVLSLGLLNQGEELNRNGGLYVQ  419

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KIK+VDGSSLAVA+I+ N+IPKGTT+V+LR  L KV+ +IA AL+Q+G++V    
Sbjct  420   RHPHLKIKVVDGSSLAVAVIL-NSIPKGTTQVVLRGKLTKVAYAIAFALSQKGVQVGVLY  478

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             + +Y KL  +  ++ N V+++S+ QK+WLV +GLT++EQM A KGTLF+P SQ PPKK R
Sbjct  479   QVEYLKLTKSLGTESNLVVAKSYAQKIWLVDDGLTEKEQMSAPKGTLFVPFSQFPPKKLR  538

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC YH+ PAM  P SL N+HACENWLPRR MSA RV+GIVHALEGW  H+CG  M +ID
Sbjct  539   KDCFYHYTPAMKTPTSLENVHACENWLPRRVMSAWRVAGIVHALEGWKEHDCGYTMSNID  598

Query  421   KVWEAALSHGFRPLPL  374
             KVW+A+L HGF+PL +
Sbjct  599   KVWQASLVHGFQPLTI  614



>ref|XP_003633900.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/620 (67%), Positives = 506/620 (82%), Gaps = 3/620 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLGNFKYVVL+PW  H+++SF+  +E ERD  +FLI PFLLSRMLH
Sbjct  1     MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SRHRTA G NRIVDK IEFEQVDRE NWDDQ++ NG++FY+   +L   S +P
Sbjct  61    NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T+ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRADGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF+IP+LT +FT T+S  +  GY++YID MNNMGHCNFE +PKWLFSIFP LKY
Sbjct  181   HIGYFLLFSIPLLTMIFTRTSSVVAFFGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYD++YGTMDKS+D LYE SL R EESPDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDFMYGTMDKSSDVLYEKSLTRPEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP S+Y IRLGF++ A+ P    WY+ LMWP+T   M++  I  +TF+L+RN   K+K 
Sbjct  301   TTPNSIYHIRLGFASVASKPYISKWYLRLMWPLTSSYMMLIWICSRTFVLERNHFNKLKS  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y+VQY L+WQ++ INSLIEEAI+ AE +GVKVLSLGLLNQ EELN  G+ YI 
Sbjct  361   QTWVIPKYRVQYFLKWQNEPINSLIEEAILHAEERGVKVLSLGLLNQGEELNLYGKLYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
               PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R  L+KV+   A AL Q+GI+V T C
Sbjct  421   LNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFC  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++++K+K+  N+K      LS+++  K+WLVG+GLT+EEQ+KA KGTLFIP SQ PPK+
Sbjct  480   EEEHKKIKMKLNTKLGDKLALSKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKR  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM++P S  N+ +CENWLPRRAMSA RV+GI+HALEGWNVHECG  + D
Sbjct  540   MRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFD  599

Query  427   IDKVWEAALSHGFRPLPLPN  368
             I+K+WEA+  HGFR L +P+
Sbjct  600   IEKIWEASFQHGFRSLMIPS  619



>ref|XP_009787251.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=626

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/617 (67%), Positives = 509/617 (82%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSE-ESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+V HSL SF  SE ES+RD T  +I PFLL RML
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPYVTHSLNSFFMSEDESKRDMTYLIIFPFLLFRML  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVDK IEF+Q+DRE NWDDQ++LNGLLFY   T L +   +
Sbjct  61    HNQIWISVSRYRTAKGDNRIVDKTIEFDQIDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG++MT  +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSS+ TEPITSVIHPF 
Sbjct  121   PIWRTDGIIMTALLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSVATEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYFLLFAIP+LTT+ TGTAS  S  GY+TYID MNNMGHCNFE IPKW+FS FPPLK
Sbjct  181   EHIAYFLLFAIPLLTTVLTGTASIVSFGGYITYIDFMNNMGHCNFEIIPKWMFSSFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLYE SL+R  +SPD+VHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYIYDTLDKSSDTLYEKSLERQGKSPDMVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF+++A+ P +  WY WLMWPVTLW+M++  IYG TF ++RN+ + + 
Sbjct  301   LTTPESIYHLRLGFASFASEPYTSKWYFWLMWPVTLWSMMVTWIYGHTFTVERNVFKSLN  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++QY ++WQ + IN+LIEEAI+EA+ KG+KVLSLGLLNQ E+LN NGE YI
Sbjct  361   LQTWAIPKYRIQYFMQWQRETINNLIEEAIMEADRKGIKVLSLGLLNQEEQLNNNGELYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSLAVA+++ N+IPKGTT+V+L  +L+KV+ +IA AL Q G+KVVT 
Sbjct  421   RRHPELKVKVVDGSSLAVAVVL-NSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTL  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y+KLK  L      N V S+++  K+WLVG+GL+++EQ+KA KGTLFIP SQ PP+
Sbjct  480   REEEYKKLKSSLTPEVAANLVPSKTYASKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y H PAM+ P    N+ +CENWLPRR MSA RV+GI+HALEGWN HECG  M 
Sbjct  540   KARKDCLYFHTPAMITPKHFENVDSCENWLPRRVMSAWRVAGILHALEGWNEHECGNMMF  599

Query  430   DIDKVWEAALSHGFRPL  380
             DI+KVW+A+L HGF PL
Sbjct  600   DIEKVWKASLDHGFSPL  616



>ref|XP_006375527.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
 gb|ERP53324.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
Length=622

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/617 (67%), Positives = 511/617 (83%), Gaps = 6/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK+V+L+P V H++Y+F+  +E  +D ++FLI P LL R+LH
Sbjct  1     MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVKDE--KDLSSFLIFPILLWRVLH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G NRI+DK IEF+QVDRE NWDDQ++ NG+LFY+ + ++   S LP
Sbjct  59    NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRERNWDDQILFNGILFYVSSKIIPGASYLP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  IH GPVEF+YYWLHR LHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  119   MWRLDGVILTALIHTGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+Y +LFAIP++TT+ TGTAS +S  GYVTYIDLMNNMGHCNFE IP+WLF IFPPLKY
Sbjct  179   HISYSMLFAIPLITTIVTGTASLTSFAGYVTYIDLMNNMGHCNFELIPRWLFIIFPPLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD S+ TLYE SLKR EE+PDVVHLTHL
Sbjct  239   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDTSSVTLYEDSLKRLEEAPDVVHLTHL  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLG +  A+ PQ   WY+WLMWPVTLWTM++  IYG+TF+++RN   K++L
Sbjct  299   TTPDSIYHLRLGLACLASTPQESKWYLWLMWPVTLWTMMLTWIYGRTFVVERNRFRKLRL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P+Y +QY L WQ  +IN+LIEEA++EAE KGVKVLSLGLLNQ EELNR GE Y+Q
Sbjct  359   QTWTLPKYNIQYNLRWQKVSINTLIEEAVLEAEEKGVKVLSLGLLNQGEELNRYGELYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++K K+VDGSSLAVA ++ N+IPKGTT VL R NL+KV+ ++A  L +RGI+VV  C
Sbjct  419   RHPRLKTKVVDGSSLAVAAVL-NSIPKGTTHVLHRGNLSKVAYAVALNLCRRGIQVVVPC  477

Query  781   EDDYEKLKLA---TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             EDDY+KLK +   T+ + N +LS+S++ K WLVG+GLT+E+Q KA +GTLFIP SQ PPK
Sbjct  478   EDDYQKLKKSFGITSDQNNMILSKSYSIKTWLVGDGLTEEDQKKAAEGTLFIPFSQFPPK  537

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC YH  PAM AP SL N+ +CENWLPRR MSA RV+GIVHALEGW+ HECG  M 
Sbjct  538   KLRKDCFYHSIPAMAAPASLENVDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMA  597

Query  430   DIDKVWEAALSHGFRPL  380
             DIDKVW+A++ HGF+PL
Sbjct  598   DIDKVWQASIQHGFKPL  614



>ref|XP_009612939.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana tomentosiformis]
Length=626

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/619 (67%), Positives = 510/619 (82%), Gaps = 4/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSE-ESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+VAHSL+SF  SE ES+RD T  +I PFLL RML
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPYVAHSLHSFFMSEDESKRDITYLIIFPFLLFRML  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVDK IEF+QVDRE NWDDQ++LNGLLFY   T L +   +
Sbjct  61    HNQIWISLSRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG++MT  +  GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PIWRTDGIIMTALLQTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYFLLFAIP+LTT+ TGTAS  S  GY+TYID MNNMGHCNFE IPKW+FS FPPLK
Sbjct  181   EHIAYFLLFAIPLLTTVLTGTASIVSFGGYITYIDFMNNMGHCNFEIIPKWMFSSFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLYE SL+R  +SPDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYIYDTLDKSSDTLYEKSLERQGKSPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF+++A+ P +  WY WLMWPVTLW+M+I  IYG TF ++RN+ + + 
Sbjct  301   LTTPESIYHLRLGFASFASEPYTSKWYFWLMWPVTLWSMMITWIYGHTFTVERNVFKSLN  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++QY ++WQ + IN+ IEEAI+EA+ KG+KVLSLGLLNQ E+LN NGE YI
Sbjct  361   LQTWAIPKYRIQYFMQWQRETINNFIEEAIMEADRKGIKVLSLGLLNQEEQLNNNGELYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSLAVA+++ N+IPKGTT+V+L  +L+KV+ +IA AL Q G+KVVT 
Sbjct  421   RRHPQLKVKVVDGSSLAVAVVL-NSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTL  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y+KLK  L      N V S+++  K+WLVG+GL+++EQ+KA KGTLFIP SQ PP+
Sbjct  480   REEEYKKLKSSLTPEVAINLVPSKTYASKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y H PAM+ P    N+ +CENWLPRR MSA RV+GI+HAL+GWN HECG  M 
Sbjct  540   KARKDCLYFHTPAMITPKHFENVDSCENWLPRRVMSAWRVAGILHALKGWNEHECGNMMF  599

Query  430   DIDKVWEAALSHGFRPLPL  374
             DI+KVW+A+L HGF PL +
Sbjct  600   DIEKVWKASLDHGFSPLTM  618



>ref|XP_008338420.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/617 (66%), Positives = 509/617 (82%), Gaps = 2/617 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LT+WPW PLG+FK+VV++PW+ H  YS+  ++E ++D + FLI P +L R +H
Sbjct  1     MATTPGILTEWPWTPLGSFKHVVVAPWIIHGTYSYFANDEEDKDLSYFLIFPLILWRFVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ N +LFYL +  L   S LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKSLEFEQVDRERNWDDQILFNSILFYLGSRHLPGASNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   MWRTDGVILTILLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTLFTGT S +   GY+TYID MNNMGHCNFE IP WLF+IFPPLKY
Sbjct  181   HIAYFILFAIPMLTTLFTGTTSVAVYAGYLTYIDFMNNMGHCNFELIPNWLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPSYHSLHHTQFRTNYSLFMP YDY+YGTMDKS D+LY+TSLKRGEE PDV+HLTHL
Sbjct  241   FMYTPSYHSLHHTQFRTNYSLFMPIYDYMYGTMDKSNDSLYDTSLKRGEELPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF + A+ P +  WY+WLMWP+TLW+M+I  IYG+TF+++R+   + +L
Sbjct  301   TTPESIYYLPLGFVSLASRPHTRTWYLWLMWPLTLWSMMITWIYGRTFVVERHRFHEFRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++WQS+AIN LIEEAI++AE KGVKVLSLGLLNQ EELNR G  Y+Q
Sbjct  361   QTWAIPKYTLQYFMKWQSEAINGLIEEAILDAEEKGVKVLSLGLLNQGEELNRYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KIK+VDGSSL VA+I+ N+IPKGTT+V+LR NL KV+ +IA AL+Q+GI++ T  
Sbjct  421   RHPHLKIKVVDGSSLVVAVIL-NSIPKGTTQVVLRGNLTKVAYAIAHALSQKGIQIATLH  479

Query  781   EDDYEKLKLATN-SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + ++ KL  + N ++ N ++++S+ QK+WLVG+GLT++EQM+A KGTLF+P SQ PPKK 
Sbjct  480   QAEHLKLTKSLNGTESNLIVAKSYAQKIWLVGDGLTEKEQMRAPKGTLFVPFSQFPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  P SL N+H+CENWLPRR MSA RV+GIVHALEGW  HECG  M + 
Sbjct  540   RKDCFYHYTPAMKTPASLENVHSCENWLPRRVMSAWRVAGIVHALEGWKEHECGYTMSNS  599

Query  424   DKVWEAALSHGFRPLPL  374
             DKVW+A+L HGF+PL +
Sbjct  600   DKVWQASLVHGFQPLTI  616



>ref|XP_009376851.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/617 (66%), Positives = 511/617 (83%), Gaps = 2/617 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LT+WPW PLG+FK+VV++PW+ HS YS+  ++E ++D + FLI P +L R +H
Sbjct  1     MATTPGILTEWPWTPLGSFKHVVVAPWIIHSTYSYFANDEEDKDLSYFLIFPLILWRFVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ N +LFYL +  L   S LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNSILFYLGSRHLPGASNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   MWRTDGVILTILLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTLFTGT S +   GY+TYID MNNMGHCNFE IP WLF+IFPPLKY
Sbjct  181   HIAYFILFAIPMLTTLFTGTTSVAVYAGYLTYIDFMNNMGHCNFELIPNWLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPSYHSLHHTQFRTNYSLFMP YD +YGTMDKS+D+LY+TSL RGEESPDV+HLTHL
Sbjct  241   FMYTPSYHSLHHTQFRTNYSLFMPIYDCMYGTMDKSSDSLYQTSLTRGEESPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +  GF + A+ P +  WY+WLMWP+TLW+M+I  IYG+TF+++R+   ++KL
Sbjct  301   TTPESIYYLPQGFVSLASRPHTSTWYLWLMWPLTLWSMMITWIYGRTFVVERHRFVELKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++ QS+AIN LIEEAI++AE KGVKVLSLGLLNQ EELNRNG  Y+Q
Sbjct  361   QTWAIPKYSLQYFMKLQSEAINGLIEEAILDAEEKGVKVLSLGLLNQGEELNRNGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +K+K+VDGSSLAVA+I+ N+IPKGTT+V+LR NL KV+ +IA AL+Q+GI+V T  
Sbjct  421   RHPHLKVKVVDGSSLAVAVIL-NSIPKGTTQVVLRGNLTKVAYAIAYALSQKGIQVATLY  479

Query  781   EDDYEKLKLATN-SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + ++ KL  + N +K N ++++S+ QK+WLVG+GLT++EQM+A KGTLF+P SQ PPKK 
Sbjct  480   QAEHLKLTKSLNGTKSNLIVAKSYAQKIWLVGDGLTEKEQMRAPKGTLFVPFSQFPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  P SL N+H+CENWLPRR MSA RV+GIVHALEGW  HECG  M + 
Sbjct  540   RKDCFYHYTPAMKTPASLENVHSCENWLPRRVMSAWRVAGIVHALEGWKEHECGYTMSNS  599

Query  424   DKVWEAALSHGFRPLPL  374
             DKVW+A+L HGF+PL +
Sbjct  600   DKVWQASLVHGFQPLTI  616



>ref|XP_009337264.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Pyrus x bretschneideri]
Length=616

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/616 (67%), Positives = 510/616 (83%), Gaps = 8/616 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LTDWPW PLG+FK+VV++PW+ H  YS+  ++E ++D + FLI PF+L R LH
Sbjct  1     MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ N +LFYL    L     LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYL-GRHLPGAVNLP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWL RALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  120   FWRTDGVILTILLHAGPVEFLYYWLPRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF++FAIP+LTT++TGT+S  S  GYVTYID MNNMGHCNFE IPKWLF+IFPP+KY
Sbjct  180   HISYFIIFAIPMLTTIYTGTSSIVSFAGYVTYIDFMNNMGHCNFELIPKWLFTIFPPVKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHTQFRTNY LFMP YDY+YGTMDKS+D+LY+TSLKR EESPDV+HLTHL
Sbjct  240   LLYTPSYHSLHHTQFRTNYCLFMPIYDYVYGTMDKSSDSLYDTSLKREEESPDVLHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF+  A+ P +  WY+WLMWPVTLW+MII  IYG+TF++DR+  +K++L
Sbjct  300   TTPESIYHLPLGFAALASRPYTRTWYLWLMWPVTLWSMIITWIYGRTFVVDRHRFDKLRL  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P+Y +QY ++WQ++AIN LIE+AI+EAE KGVKVLSLGLLNQ EELNRNG  Y+Q
Sbjct  360   QTWAVPKYSLQYFVQWQNEAINGLIEDAILEAEEKGVKVLSLGLLNQGEELNRNGGLYVQ  419

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KIK+VDGSSLAVA+I+ N+IPKGTT+V+LR  L KV+ +IA AL+Q+G++V    
Sbjct  420   RHPHLKIKVVDGSSLAVAVIL-NSIPKGTTQVVLRGKLTKVAYAIAFALSQKGVQV----  474

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
               +Y KL  +  ++ N V+++S+ QK+WLV +GLT++EQM A KGTLF+P SQ PPKK R
Sbjct  475   --EYLKLTKSLGTESNLVVAKSYAQKIWLVDDGLTEKEQMSAPKGTLFVPFSQFPPKKLR  532

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC YH+ PAM  P SL N+HACENWLPRR MSA RV+GIVHALEGW  H+CG  M +ID
Sbjct  533   KDCFYHYTPAMKTPTSLENVHACENWLPRRVMSAWRVAGIVHALEGWKEHDCGYTMSNID  592

Query  421   KVWEAALSHGFRPLPL  374
             KVW+A+L HGF+PL +
Sbjct  593   KVWQASLVHGFQPLTI  608



>ref|XP_002265685.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/620 (66%), Positives = 505/620 (81%), Gaps = 3/620 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLGNFKYVVL+PW  H+++SF+  +E ERD  +FLI PFLL RMLH
Sbjct  1     MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SRHRTA G NRIVDK IEFEQVDRE NWDDQ++ NG++FY+   +L   S +P
Sbjct  61    NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T+ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRVDGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF+IP+LT +FTGT+   +  GY++YID MNNMGHCNFE +PKWLFSIFP LKY
Sbjct  181   HIGYFLLFSIPLLTMIFTGTSCIVAFFGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSY +LHHTQFRTNYSLFMPFYDY+YGTMD+S+D LYE SL R EESPDVVHLTHL
Sbjct  241   LMYTPSYFTLHHTQFRTNYSLFMPFYDYMYGTMDRSSDVLYEKSLTRPEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y IRLGF+  A+ P    WY+ LMWP+T   M++  I  +TF+L+RN   K+KL
Sbjct  301   TTPDSIYHIRLGFAFVASKPYISKWYLRLMWPLTSSYMMLIWICSRTFVLERNHFNKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y++QY L+WQ++ INSLIEEAI+ AE +GVKVLSLGLLNQ EELN  G+ YI 
Sbjct  361   QTWVIPKYRIQYFLKWQNEPINSLIEEAILHAEERGVKVLSLGLLNQGEELNLYGKLYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
               PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R  L+KV+   A AL Q+GI+V T  
Sbjct  421   LNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFR  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++++K+K+  N+K      LS+++  K+WLVG+GLT+EEQ+KA KGTLFIP SQ PPK+
Sbjct  480   EEEHKKIKMKLNTKLRDKLALSKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKR  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM++P S  N+ +CENWLPRRAMSA RV+GI+HALEGWNVHECG  + D
Sbjct  540   MRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFD  599

Query  427   IDKVWEAALSHGFRPLPLPN  368
             I+K+WEA+  HGFRPL +P+
Sbjct  600   IEKIWEASFQHGFRPLMIPS  619



>gb|KEH17984.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=658

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/620 (65%), Positives = 505/620 (81%), Gaps = 4/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKYVVL+PWV HS YS +  ++SERD + FLI PFLL R+LH
Sbjct  37    MASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSLIVKDKSERDVSTFLIFPFLLWRVLH  96

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RT+ G NRI+DK IEF+QVDRE +WDDQ++ NGLL+YL    L   SRLP
Sbjct  97    NQIWISLSRYRTSKGNNRILDKGIEFDQVDREKDWDDQILFNGLLYYLACYTLEGASRLP  156

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++ + +H G VEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  157   LWRTDGVIIAILLHAGAVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  216

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YFLLFAIP LT +FT  AS  +++GYVTYID MNN+GHCNFE +PKWLF IFPPLKY
Sbjct  217   HISYFLLFAIPKLTLVFTNRASIGAMVGYVTYIDFMNNLGHCNFEIVPKWLFDIFPPLKY  276

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMDK++D L+E++LKR EE+P+VVHLTHL
Sbjct  277   LMYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDKASDELHESTLKRKEETPNVVHLTHL  336

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNIL-EKIK  1145
             TTPES+Y +R GF+  A+ P +  WY+WLMWP T W+M +  +YG+TFI++RN   +K+ 
Sbjct  337   TTPESIYHLRFGFAALASKPYTSKWYLWLMWPFTAWSMFLTWVYGRTFIVERNRFDDKLN  396

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y VQY  +WQ  +IN +IEEAI++A+ KG+KV+SLGL+NQ EELN  G  Y+
Sbjct  397   LQTWAIPKYSVQYSRQWQKVSINKMIEEAILDADKKGIKVVSLGLMNQEEELNIYGGLYV  456

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
              ++PK+ +K+VDGSSLAVA ++ N+IPKGTT+VLLR  L KV+ ++A  L Q+G+++ T 
Sbjct  457   SRHPKLNVKVVDGSSLAVAAVI-NSIPKGTTQVLLRGKLTKVAYALAYTLCQQGVQIATM  515

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              +DDY KLK  L  +S  N V ++SFTQ +WLVG+GLT+EEQ+KA KGTLFIP SQ PPK
Sbjct  516   NDDDYVKLKKALMHSSHSNIVNAKSFTQMIWLVGDGLTEEEQLKAPKGTLFIPYSQFPPK  575

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             KHR+DC YH+ PAML P S+ N+H+CE+WLPRR MSA RV+GIVH LE WN HECG  M 
Sbjct  576   KHRKDCLYHYTPAMLTPTSIENVHSCEDWLPRRVMSAWRVAGIVHCLEEWNEHECGYNMI  635

Query  430   DIDKVWEAALSHGFRPLPLP  371
             ++DKVW +AL HGF+PL +P
Sbjct  636   NMDKVWPSALKHGFKPLTVP  655



>gb|EYU40308.1| hypothetical protein MIMGU_mgv1a002952mg [Erythranthe guttata]
Length=622

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/617 (66%), Positives = 511/617 (83%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LGNFKY+V++PWV HS YS++  +++ERD T F+I PFL+SRM+H
Sbjct  1     MASKPGILTEWPWTFLGNFKYLVIAPWVIHSTYSYMVKDKNERDLTQFIIFPFLISRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS+SR+RTA G NRIVDK IEF+QVDRE NWDDQ++ NG+LFY+    + +   LP
Sbjct  61    NQVWISFSRYRTAKGANRIVDKNIEFDQVDRERNWDDQIIFNGILFYVGQMYIKEAHNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRT GV+ T+ +H GPVE++YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPFGE
Sbjct  121   WWRTMGVVWTILLHAGPVEYLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL++GTAS  S  GY+TY+D MNNMGHCNFE IP  LFS+FPPLKY
Sbjct  181   HIAYFVLFAIPLLTTLYSGTASMISFAGYITYVDFMNNMGHCNFEHIPNRLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMPFYDY+YGTMDKS+DTLY+ SL R E+SPD VHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDTLYKRSLVRDEDSPDAVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             TTPES+Y +RLGF+  A+ P +S N Y+WLMWP+TLW+M++  IYG TFI++RNI + +K
Sbjct  301   TTPESIYHLRLGFAHLASEPHKSSNGYLWLMWPITLWSMMVTWIYGCTFIVERNIFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W +P+Y VQY +EWQ ++IN +IEEAI+EA+ KG+KVLSLGLLNQ   LNRNG+ ++
Sbjct  361   LQTWAVPKYSVQYYMEWQRESINGMIEEAILEADEKGIKVLSLGLLNQEAGLNRNGDLFL  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P +K+KLVDGSSLAVAI+V N+IPKGT  V +R NL+KV+ SIA AL + GI+V T 
Sbjct  421   KRHPNLKVKLVDGSSLAVAIVV-NSIPKGTNRVAIRGNLSKVAYSIALALCRGGIEVFTL  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y+KLK  L + +  N +LS+    K WLVG+GL++ EQMKA+KGT+FIP SQ PPK
Sbjct  480   HENEYKKLKANLGSEAGNNLILSKHNLPKTWLVGDGLSENEQMKASKGTIFIPYSQFPPK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DCSY++ PAML P  L N+ +CENWLPRR MSA R++GIVHA+EGW VHECG+ M 
Sbjct  540   KIRKDCSYNNTPAMLVPKHLENVDSCENWLPRRVMSAWRIAGIVHAMEGWGVHECGDMMF  599

Query  430   DIDKVWEAALSHGFRPL  380
             DI+K+W+A L  GFRPL
Sbjct  600   DIEKIWQACLEQGFRPL  616



>ref|XP_006445500.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 ref|XP_006464360.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
 gb|ESR58740.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 gb|KDO85379.1| hypothetical protein CISIN_1g006722mg [Citrus sinensis]
Length=633

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/623 (66%), Positives = 506/623 (81%), Gaps = 10/623 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLGNFKYVVL+PW+ HS YSF+  +E ER+   F+I P +L RMLH
Sbjct  1     MASKPGFLTDWPWTPLGNFKYVVLAPWIIHSTYSFIVKDEKERELAYFVIFPLMLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS+SR+RTA G NRIVDK IEFEQVDRE NWDDQ++ NG+LFY+F  +L   S++P
Sbjct  61    NQIWISFSRYRTAKGSNRIVDKAIEFEQVDRERNWDDQIIFNGVLFYVFVKILPGASQMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   IWRLDGVILTALLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF LFAIP++T L +G  S +S+LGYVTYID MNNMGHCNFE +P  L + FPPLKY
Sbjct  181   HIAYFALFAIPLITPLLSGMGSIASVLGYVTYIDFMNNMGHCNFELMPSCLLTNFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YT S+HSLHHTQFRTNYSLFMP YDYIYGT+DK++DTLYETSLKR E+SPDVVHLTHL
Sbjct  241   LAYTASFHSLHHTQFRTNYSLFMPVYDYIYGTVDKTSDTLYETSLKRQEDSPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN----WYVWLMWPVTLWTMIINCIYGQTFILDRNILE  1154
             TTPES+Y +RLGF++ A+ P  H+    WY+WLMWPVTLW+M+   IYG+TF+++RN L 
Sbjct  301   TTPESIYHMRLGFASMASKPHDHHTSSKWYMWLMWPVTLWSMMFTWIYGRTFVVERNHLN  360

Query  1153  KIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGE  974
             K +LQ+W IPRY  QYL + Q+++IN LIEEAI+EAE KG KV+SLGL+NQ EELNR G 
Sbjct  361   KFRLQTWAIPRYNFQYLFQRQNESINRLIEEAILEAEEKGAKVISLGLMNQGEELNRYGG  420

Query  973   FYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKV  794
              ++ K+P++K+K+VDGSSLAVA+++ N+IPKGTT+V+LR  L KV+ +IA AL Q+GI+V
Sbjct  421   VFVHKHPQLKMKVVDGSSLAVAVVI-NSIPKGTTQVVLRGALTKVAYAIAFALCQKGIQV  479

Query  793   VTSCEDDYEKLKLATNSKG---NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQ  623
             VT  ED++EKL+ +  +K    N +LSRS++QK+WLVG+GLT+EEQ KA KGT+FIP SQ
Sbjct  480   VTLREDEHEKLRKSFGAKSECNNLLLSRSYSQKIWLVGKGLTEEEQSKAKKGTIFIPFSQ  539

Query  622   IPP--KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHE  449
              PP  KK R+DC YH  PAM  P +  N+ +CENWLPRR MSA R+ GIVHALEGWN HE
Sbjct  540   FPPNDKKIRKDCMYHLTPAMAVPAAFENVDSCENWLPRRVMSAWRIGGIVHALEGWNEHE  599

Query  448   CGEKMCDIDKVWEAALSHGFRPL  380
             CG  + +I  VWEAAL HGF PL
Sbjct  600   CGYAISNIHNVWEAALRHGFHPL  622



>gb|EYU40310.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=608

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/617 (66%), Positives = 508/617 (82%), Gaps = 13/617 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSE--ESERDYTNFLILPFLLSRM  2048
             MAT PG LTDWPWK LG+FKY++L+PW   S+YS   ++  E ERDY N L++PF++SR+
Sbjct  1     MATKPGVLTDWPWKHLGSFKYMILAPWAMQSIYSIAKNKNGEKERDYINLLVIPFMVSRI  60

Query  2047  LHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSR  1868
             LHNQ+WIS SRHRTA G NRI+D+ IEFEQVDRESNWDD ++L+G+LFY FN+ L   S 
Sbjct  61    LHNQIWISISRHRTAKGNNRILDRTIEFEQVDRESNWDDNILLSGILFYFFNSTLRSASF  120

Query  1867  LPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPF  1688
             LP WR DG+++T+ +H GPVE++YYWLHR LHHHFLY+RYHSHHHSSIVTEPITSVIHPF
Sbjct  121   LPIWRNDGIIITILLHAGPVEYLYYWLHRGLHHHFLYTRYHSHHHSSIVTEPITSVIHPF  180

Query  1687  GEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPL  1508
              EH++YF LFAIP+  T+ T TAS  SL GY+TYIDLMNNMGHCNFE +PKW+FSIFPPL
Sbjct  181   AEHLSYFALFAIPMFATILTRTASIISLFGYITYIDLMNNMGHCNFELVPKWIFSIFPPL  240

Query  1507  KYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLT  1328
             KYLM+    HSLHHTQFRTNYSLFMPFYDY++GTMDKSTD LYETSL+R E+SPDVVH+T
Sbjct  241   KYLMF----HSLHHTQFRTNYSLFMPFYDYVHGTMDKSTDALYETSLERKEDSPDVVHIT  296

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLTTP+S++ +++GF+++A+ PQ   WY   MWP+T W++  N IYG+TFI++RN+ EK+
Sbjct  297   HLTTPDSIFHLQVGFASFASKPQKSKWY---MWPLTFWSVTFNYIYGKTFIVERNLFEKL  353

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQSW IPRY +QY L+WQ +AIN LIEEAI+EA+ +G KV+SLGLLNQSEELNR GE +
Sbjct  354   KLQSWAIPRYSIQYSLKWQGKAINGLIEEAILEADARGAKVISLGLLNQSEELNRRGELF  413

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             ++K+PKMK K+VDGSSLAVA+++ N+IPKGTTE+L R +L+K++ +I SAL Q+GIKV T
Sbjct  414   VEKHPKMKTKIVDGSSLAVAVVL-NSIPKGTTEILFRGSLSKIAFAIVSALCQQGIKVAT  472

Query  787   SCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               E+  EKLKL+T       V S ++TQ +W+VG+G T++EQ KA KGTLFIP SQ PPK
Sbjct  473   FYEN--EKLKLSTMPHATKVVTSENYTQMIWIVGDGFTEDEQKKAPKGTLFIPFSQFPPK  530

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R D  Y   P+++APPSL NL++CENWLPRRAMSA RV+GI+HALEGWNVHECG+ + 
Sbjct  531   KARNDVVYRQTPSLIAPPSLKNLNSCENWLPRRAMSAWRVAGILHALEGWNVHECGDDIF  590

Query  430   DIDKVWEAALSHGFRPL  380
             +  K+WEAAL HGFRP+
Sbjct  591   EFKKIWEAALKHGFRPI  607



>ref|XP_002262785.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38118.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/620 (65%), Positives = 503/620 (81%), Gaps = 4/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWK LG+FKYV+L+PWV HS+Y+ +  +  ERD    L  PFLL R LH
Sbjct  1     MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R+RTA G NRIVDK IEFEQVDRESNWDDQ++LNG+LFY+   +L   + +P
Sbjct  61    NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T+ +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYFLLF IP+L   F   +S +++ GY++YID MNNMGHCNFE IPK LFSIFPPLKY
Sbjct  181   HLAYFLLFLIPLLAGFFMRKSSMAAVFGYISYIDFMNNMGHCNFELIPKMLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGTMDKS+D LYE SL R E+ P VVHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDALYEKSLIRPEQLPHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
              TP+S+Y +RLGF++ A+ P ++ WYVW MWPVT  ++++   YG+TFIL+RN   K+ +
Sbjct  301   VTPQSIYHLRLGFASLASKPYTYKWYVWAMWPVTCCSIMLTWTYGRTFILERNQFNKVNV  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WV+P++K+QYLL+  +++I+SLIEEAI++A+ +G+KVLSLGLLNQ +E N  GE YI 
Sbjct  361   QTWVVPKFKIQYLLKLGNESIDSLIEEAILKADKRGIKVLSLGLLNQGDEFNSYGELYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
               PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R NL KV+  IASAL Q  I+V TS 
Sbjct  421   NNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGNLTKVAYFIASALCQMDIQVATSR  479

Query  781   EDDYEKLKLA---TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             +D+YE+L         +   +LS+SFT+K+W+VG+GLTKEEQMKA+ GTLFIP SQ PPK
Sbjct  480   KDEYEQLNTKLKNVECESKLLLSKSFTEKIWVVGDGLTKEEQMKASTGTLFIPFSQFPPK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             + R+DC YH  PAM+ P S  N+ +CENWLPRRAMSA+RV+G++HALEGWNVHECG  M 
Sbjct  540   RLRKDCLYHTTPAMMPPKSFQNIDSCENWLPRRAMSASRVAGVIHALEGWNVHECGNTMF  599

Query  430   DIDKVWEAALSHGFRPLPLP  371
             +++K+WEA+L HGFRPL +P
Sbjct  600   NVEKIWEASLQHGFRPLTVP  619



>ref|XP_002320584.1| ECERIFERUM 1 family protein [Populus trichocarpa]
 gb|EEE98899.1| ECERIFERUM 1 family protein [Populus trichocarpa]
Length=622

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/617 (67%), Positives = 506/617 (82%), Gaps = 6/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK+V+L+PWV HS YSF+  +   +D + FL  P LL RMLH
Sbjct  1     MASRPGILTDWPWKPLGSFKHVILAPWVIHSTYSFMIKDG--KDLSTFLAFPLLLWRMLH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G NRI+DK IEF+QVDRES+WDDQ++ NG+LFY+    +   S LP
Sbjct  59    NQLWISLSRYRTAKGNNRIIDKAIEFDQVDRESSWDDQILFNGILFYVGIHTIPGASHLP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  IH+GPVEF+YYWLHR LHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  119   MWRLDGVIITALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF+LFAIP++TT+ TGTAS +SL GY+TYID+MNNMGHCNFE +PKWLF+IF PLKY
Sbjct  179   HISYFILFAIPLITTILTGTASVASLAGYITYIDVMNNMGHCNFELVPKWLFTIFRPLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMDKS+DTLYE SLKR EE+PDVVHLTHL
Sbjct  239   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEDSLKRPEEAPDVVHLTHL  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y  RLG +  A+ PQ   WY+ LMWPVTLWTM++  IYG+ F+++RN   K++L
Sbjct  299   TTPDSIYHSRLGLAYLASNPQKSKWYLSLMWPVTLWTMMLTWIYGRAFVVERNRFHKLRL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY L W + +IN+LIEEA++EAE KGVKVLSLGLLNQ++ELNR GE Y+Q
Sbjct  359   QTWTIPKYNIQYNLRWHTASINTLIEEAVLEAEEKGVKVLSLGLLNQAKELNRYGELYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YP++K K+VDGSSLAVA ++ N+IPKGTT+VL R NL+KV+ ++   L +RGI+V    
Sbjct  419   RYPRLKTKVVDGSSLAVAAVL-NSIPKGTTQVLHRGNLSKVAYAVVLNLCRRGIQVAVPY  477

Query  781   EDDYEKLKLATNSKG---NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             EDDY++LK +  S+    N +LS++++ K WLVG+GL  E+Q KAT+GTLFIP SQ PPK
Sbjct  478   EDDYKRLKKSFGSRSDQNNLILSKNYSIKTWLVGDGLKGEDQKKATEGTLFIPFSQFPPK  537

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC YH  PAM AP SL N+ +CENWLPRR MSA RV+GIVHALEGWN HECG  M 
Sbjct  538   KLRKDCFYHSTPAMAAPASLENVDSCENWLPRRVMSAWRVAGIVHALEGWNEHECGYTMS  597

Query  430   DIDKVWEAALSHGFRPL  380
             DIDKVW+A++ HGF+PL
Sbjct  598   DIDKVWQASIQHGFKPL  614



>ref|XP_002262647.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38119.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/620 (65%), Positives = 504/620 (81%), Gaps = 4/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWK LG+FKYV+L+PWV HS+Y+ +  +  ERD    L  PFLL R LH
Sbjct  1     MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R+RTA G NRIVDK IEFEQVDRESNWDDQ++LNG+LFY+   +L   + +P
Sbjct  61    NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T+ +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYFLLF+IP+L  +F    S ++L GY++YID MNNMGHCNFE IPK LFSIFPPLKY
Sbjct  181   HLAYFLLFSIPLLAGIFMRKNSIAALFGYISYIDFMNNMGHCNFELIPKMLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHT+FRTNYSLFMP YDYIYGTMDKS+D LYE SL R EE   VVHLTHL
Sbjct  241   LMYTPSYHSLHHTRFRTNYSLFMPIYDYIYGTMDKSSDALYEKSLIRPEELLHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
              TP+S+Y +RLGF++ A+ P ++ WYVW MWPVT  ++++   YG+TFIL+RN   K+ +
Sbjct  301   VTPQSIYHLRLGFASLASKPYTYRWYVWAMWPVTCGSIMLTWTYGRTFILERNQFNKVNV  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WV+P++K+QYLL+  +++I+SLIEEAI++A+ +G+KVLSL LLNQ +ELN  GE YI 
Sbjct  361   QTWVVPKFKIQYLLKLGNESIDSLIEEAILKADKRGIKVLSLSLLNQGDELNSYGELYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R NL KV+  IASAL Q  I+V TS 
Sbjct  421   RNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGNLTKVAYFIASALCQMDIQVATSH  479

Query  781   EDDYEKLKLA---TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              D+YE+L         +   +LS+SFT+K+WLVG+GLTKEEQ+KA+KGTLFIP SQ PPK
Sbjct  480   GDEYEQLNTKLKNVECESKLLLSKSFTEKIWLVGDGLTKEEQIKASKGTLFIPFSQFPPK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             + R+DC Y   PAM++P S  N+ +CENWLPRRAMSA+RV+G++HALEGWNVHECG  M 
Sbjct  540   RLRKDCLYLTTPAMMSPKSFQNIDSCENWLPRRAMSASRVAGVIHALEGWNVHECGNTMF  599

Query  430   DIDKVWEAALSHGFRPLPLP  371
             +I+K+WEA+L HGFRPL +P
Sbjct  600   NIEKIWEASLHHGFRPLTIP  619



>ref|XP_006354616.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=628

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/619 (65%), Positives = 509/619 (82%), Gaps = 4/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYS-FVTSEESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKY+VL+P+V HS Y+ F++ +E +RD    +ILP LLSR++
Sbjct  1     MASKPGILTEWPWTCLGNFKYLVLAPFVCHSTYTYFMSKDERQRDIVYIIILPLLLSRII  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVDK IEF+QVDRESNWDDQ++ NGLL+Y+   +L +   +
Sbjct  61    HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLLYYIGYLMLEQAHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++   +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSI TEPITSVIHPF 
Sbjct  121   PVWRTDGIIIIGLLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EH++YF LF+IP+ TT+FTGTAS +S   YVTYID MNNMGHCNFE IPKW+FSIFPPLK
Sbjct  181   EHLSYFTLFSIPLFTTVFTGTASIASFGAYVTYIDFMNNMGHCNFELIPKWIFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             Y MYTPSYHSLHHTQFRTN+SLFMP YDYIY T+DKS+DTLYE SLKR  E PDVVHLTH
Sbjct  241   YFMYTPSYHSLHHTQFRTNFSLFMPMYDYIYDTLDKSSDTLYEKSLKREAEVPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WY WLMWPVTLW+++I  IYG TF+++RN+ + IK
Sbjct  301   LTTPESIYHLRLGFASLASNPHTSRWYFWLMWPVTLWSIMITWIYGCTFVVERNMFKNIK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y+V Y ++WQ + IN+LIEE+I+EA+ KG+KVLSLGLLNQ E+LN NGE Y+
Sbjct  361   LQTWAIPKYRVHYFMKWQRETINNLIEESIMEADQKGIKVLSLGLLNQEEKLNSNGELYL  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSLAVA+++ N+IPKG++ V+LR  L+KV+ SIA AL QRGI+V T 
Sbjct  421   KRHPQLKVKVVDGSSLAVAVVL-NSIPKGSSHVVLRGRLSKVAYSIALALCQRGIQVATL  479

Query  784   CEDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y++L   L   +  N VLS+S+  K WLVG+GL+++EQ+KA KGTLFIP SQ PP+
Sbjct  480   HEEEYKRLNANLTREAATNLVLSKSYVSKTWLVGDGLSEDEQLKAPKGTLFIPYSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y + PAM+ P  L N+ +CENWLPRR MSA R++GI+HALEGWN +ECG+ M 
Sbjct  540   KARKDCFYFNTPAMITPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWNENECGDMMF  599

Query  430   DIDKVWEAALSHGFRPLPL  374
             DIDKVW+A++ HGFRPL L
Sbjct  600   DIDKVWKASVDHGFRPLTL  618



>ref|XP_010097746.1| Protein WAX2 [Morus notabilis]
 gb|EXB70701.1| Protein WAX2 [Morus notabilis]
Length=618

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/622 (65%), Positives = 506/622 (81%), Gaps = 18/622 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEE-SERDYTNFLILPFLLSRML  2045
             MATTPG LTDWPWK LG+FKYV+L+PWV +  +SF+T ++  +RD + FLI P +L RM+
Sbjct  1     MATTPGILTDWPWKHLGSFKYVILAPWVINGTHSFLTKDDPQDRDLSYFLIFPLMLWRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRI+DK +EF+QVDRE NWDDQ++ N ++FYL + +L  GS L
Sbjct  61    HNQIWISLSRYRTAKGNNRILDKGLEFDQVDRERNWDDQILFNAIIFYLGSQLLPGGSNL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P W+TDGV++T+ +H   VEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PMWKTDGVILTILLHASVVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYF LFAIP+ TT+FT TAS SS  GY+TYIDLMNNMGHCNFE IPKWLFSIFPPLK
Sbjct  181   EHIAYFTLFAIPLYTTVFTRTASISSFAGYITYIDLMNNMGHCNFELIPKWLFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPS+HSLHHT+FRTNYSLFMP YDYIYGT DKS+D+LYE+SLKR EESPDVVHLTH
Sbjct  241   YLMYTPSFHSLHHTKFRTNYSLFMPLYDYIYGTTDKSSDSLYESSLKRREESPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF+  ++ P    WY  LM PVTLW+M++  IYG+TF+++R+  +K+ 
Sbjct  301   LTTPESIYHLRLGFADLSSKPYGPKWYFKLMRPVTLWSMMLTWIYGRTFVVERHRFDKLS  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W +P+YK+QYLL+WQ+++INSLIEEAI EAE K +         QS+ELN NG  YI
Sbjct  361   LQTWALPKYKIQYLLQWQNESINSLIEEAIHEAEEKDL---------QSDELNANGGLYI  411

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
              + P++K+K+V+GSSLAVAI++ N IPKGTT+VLL   L KV+ +IA AL  +GI+V +S
Sbjct  412   HRNPQLKVKIVNGSSLAVAIVL-NNIPKGTTQVLLIGKLTKVAYAIAYALCHKGIQVASS  470

Query  784   CEDDYEKLKLATN---SKGNFVLSRSFTQ-KVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              ED++ KLK + N   SK N V+S+ +++ ++WLVG+GLT+EEQ KA+KGT+F+P SQ P
Sbjct  471   SEDEFVKLKKSQNDEDSKSNLVISKYYSRHQIWLVGDGLTEEEQSKASKGTIFVPFSQFP  530

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--  443
             PKK RRDC YHH PAML P +L N+HACENWLPRRAMSA RV+GIVHAL GW+ HECG  
Sbjct  531   PKKLRRDCFYHHTPAMLTPKTLENIHACENWLPRRAMSAWRVAGIVHALAGWDEHECGFN  590

Query  442   -EKMCDIDKVWEAALSHGFRPL  380
                +C+ +KVWEA+L HGF+PL
Sbjct  591   ITNVCNFEKVWEASLRHGFQPL  612



>ref|XP_004229696.2| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=918

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/619 (65%), Positives = 510/619 (82%), Gaps = 4/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYS-FVTSEESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKY+VL+P+V HS Y+ F++ +E +RD    +ILP L SR++
Sbjct  1     MASKPGILTEWPWTFLGNFKYLVLAPFVCHSTYTYFMSKDERQRDIVYIIILPLLFSRII  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVDK IEF+QVDRESNWDDQ++ NGLL+Y+   +L +   L
Sbjct  61    HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLLYYIGYLMLEQAHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR+DG+++   +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSI TEPITSVIHPF 
Sbjct  121   PLWRSDGIIIIGLLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EH++YF LF+IP+ TT+FT TAS +S   YVTYID MNNMGHCNFE IPKW+FS+FPPLK
Sbjct  181   EHLSYFTLFSIPLFTTVFTRTASIASFGAYVTYIDFMNNMGHCNFELIPKWMFSVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             Y MYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLYE SL+R  E PDVVHLTH
Sbjct  241   YFMYTPSYHSLHHTQFRTNYSLFMPMYDYIYDTLDKSSDTLYEKSLEREAEVPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WYVWLMWPVTLW+++I  IYG+TF+++RNI + IK
Sbjct  301   LTTPESIYHLRLGFASLASNPHTSRWYVWLMWPVTLWSIMITWIYGRTFVVERNIFKNIK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y+VQY ++WQ + IN LIEE+I+EA+ KG+KVLSLGLLNQ E LN NGE Y+
Sbjct  361   LQTWAIPKYRVQYFMKWQRETINKLIEESIMEADNKGIKVLSLGLLNQEETLNSNGELYL  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSLAVA+++ N+IPKGT++V+LR  L+KV+ SIA AL QRGI+V T 
Sbjct  421   KRHPQLKVKVVDGSSLAVAVVL-NSIPKGTSQVVLRGRLSKVAYSIALALCQRGIQVATL  479

Query  784   CEDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+DY++L  KL   +  N VLS+SF  K WLVG+GL+++EQ+KA KGTLFIP SQ PP+
Sbjct  480   DEEDYKRLNAKLTHEAATNLVLSKSFVSKTWLVGDGLSEDEQLKAPKGTLFIPYSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y + PAM+AP  L N+ +CENWLPRR MSA R++GI+HALEGWN +ECG+ M 
Sbjct  540   KSRKDCFYFNTPAMIAPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWNENECGDMMF  599

Query  430   DIDKVWEAALSHGFRPLPL  374
             DI+K W+A++ HGFRPL L
Sbjct  600   DIEKAWKASVDHGFRPLTL  618


 Score =   254 bits (648),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 166/211 (79%), Gaps = 4/211 (2%)
 Frame = -3

Query  1003  QSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIA  824
             Q E+LN NGE Y++++P++K+K+VDGSSLAVA+++ N+IP+GT++V+LR +L+KV+ SIA
Sbjct  703   QEEQLNSNGELYLRRHPQLKVKVVDGSSLAVAVVL-NSIPEGTSQVVLRGSLSKVANSIA  761

Query  823   SALTQRGIKVVTSCEDDYEKLK--LATNSKGNFVLSRSF-TQKVWLVGEGLTKEEQMKAT  653
              AL Q  I+VVT  +DDY++LK  L   +  N VLS+S+   K WLVG+GL+ +EQ+K  
Sbjct  762   LALCQGEIQVVTLNKDDYKRLKAKLTPEAAINLVLSKSYNVSKTWLVGDGLSDDEQLKVP  821

Query  652   KGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHA  473
             KGTLFIP SQ P ++ R+DC Y + PAM+AP  L N+ +CENWLPRR MSA R++GIVHA
Sbjct  822   KGTLFIPFSQFPVREVRKDCFYFNTPAMIAPKHLENVDSCENWLPRRVMSAWRIAGIVHA  881

Query  472   LEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             LEGWN H+CG+ M D++KVW+A+LSHGF  L
Sbjct  882   LEGWNEHDCGDTMIDVEKVWKASLSHGFCSL  912



>ref|XP_002526512.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35903.1| sterol desaturase, putative [Ricinus communis]
Length=622

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/619 (65%), Positives = 513/619 (83%), Gaps = 6/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG  ++WPWKPLG+FK+VVL+PWV + +YS V   E E    ++LI PFLL RM+H
Sbjct  1     MASMPGVFSEWPWKPLGSFKHVVLAPWVINHIYSIVVKGEKEN--PSYLIFPFLLWRMVH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G NRI+DK IEF+QVDRE NWDDQV+LNG+LFY+   V+ + +R+P
Sbjct  59    NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRERNWDDQVLLNGILFYVGAMVIPQANRMP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR D +++T+ +H+GPVEF+YYW HR LHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  119   MWRADSIIITILLHIGPVEFLYYWFHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYF+LFAIP+LTT+ +GTAS ++  GY+TYID MNNMGHCNFE IPK  FSIFPPLKY
Sbjct  179   HLAYFILFAIPLLTTVLSGTASVAAYCGYITYIDFMNNMGHCNFELIPKSFFSIFPPLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMDKS+D+LYE+SLKR EE   VVHLTH+
Sbjct  239   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDSLYESSLKRQEEIAHVVHLTHM  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLGF+  A++PQS  WY+WLMWPVTLWTMI   IYG+TF+L+R+  +K++L
Sbjct  299   TTPDSIYHLRLGFAYLASIPQSSKWYLWLMWPVTLWTMIFARIYGRTFLLERHRFDKLRL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+YK+QY ++WQ+++IN +IE++I+EAE KGVKVLSLGLLNQ EELNR GE Y+ 
Sbjct  359   QTWVIPKYKIQYTIQWQNESINKMIEQSILEAEAKGVKVLSLGLLNQGEELNRYGEAYMV  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++ IK+VDGSSLAVA+++ N+IPKGTT++L R  L+KV+ ++   L QRGI+V T+ 
Sbjct  419   KHPRLGIKVVDGSSLAVAVVL-NSIPKGTTQLLFRGRLSKVAFAVVLGLCQRGIQVATTL  477

Query  781   EDDYEKL-KLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             ++DYEKL K + NS+   N +LS++++ K WLV +GL +EEQ KA+KGT+FIP+SQ PPK
Sbjct  478   KEDYEKLIKASPNSECGKNVLLSKNYSLKTWLVDDGLREEEQKKASKGTVFIPVSQFPPK  537

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R DC Y+  PA++AP +L N+ +CENWLPRR MSA R +GIVH LEGWNV+ECG  M 
Sbjct  538   KARNDCFYYSTPAVVAPSALENVDSCENWLPRRVMSAWRAAGIVHGLEGWNVNECGYTMF  597

Query  430   DIDKVWEAALSHGFRPLPL  374
             D+D+VW+A L HGF+PL L
Sbjct  598   DVDRVWQATLCHGFKPLLL  616



>ref|XP_009600723.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/623 (64%), Positives = 509/623 (82%), Gaps = 5/623 (1%)
 Frame = -3

Query  2224  NMATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYS-FVTSEESERDYTNFLILPFLLSRM  2048
             +MA+ PG LT+WPW  LGNFKY+VL+P+V HS+Y+ F++ +ES+RD    +ILP LLSR+
Sbjct  30    SMASKPGILTEWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIGYLIILPLLLSRV  89

Query  2047  LHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSR  1868
             +HNQ+WIS SR+RTA G NRIVDK IEF+Q+DRESNWDDQ++ NGL++Y+   +L +   
Sbjct  90    IHNQIWISLSRYRTAKGNNRIVDKSIEFDQIDRESNWDDQIIFNGLIYYIGYLLLEQAHH  149

Query  1867  LPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPF  1688
             LP WRTDG+++   +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF
Sbjct  150   LPLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF  209

Query  1687  GEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPL  1508
              EHI+YFLLF+IP+LT   TGTAS ++   Y+TYID MNNMGHCNFE IPKW+FSIFP L
Sbjct  210   AEHISYFLLFSIPLLTATLTGTASITAFGAYITYIDFMNNMGHCNFELIPKWIFSIFPAL  269

Query  1507  KYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLT  1328
             KYL+YTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLYE SL+R  E PDVVHLT
Sbjct  270   KYLVYTPSYHSLHHTQFRTNYSLFMPMYDYIYDTLDKSSDTLYEKSLEREAELPDVVHLT  329

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLTTPES+Y +RLG ++ A+ PQS  WY WLMWPVTLW+++I  IYG TFI++RN+ + +
Sbjct  330   HLTTPESIYHLRLGLASLASKPQSSKWYFWLMWPVTLWSIMITWIYGHTFIVERNLFKNL  389

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQ+W IP+Y++QY ++WQ + IN+LIEEAI+EA+ K +KVLSLGLLNQ E+LN NGE Y
Sbjct  390   KLQTWAIPKYRIQYFMKWQRETINNLIEEAIMEADQKDIKVLSLGLLNQEEQLNSNGELY  449

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             I++ P++K+K++DGSSLAVA+++ N+IPKGT++V+LR  L+KV+ SIA AL Q GI+VVT
Sbjct  450   IKRNPQLKVKVIDGSSLAVAVVI-NSIPKGTSQVVLRGRLSKVAYSIALALCQGGIQVVT  508

Query  787   SCEDDYEKL--KLATNSKGNFVLSRSFT-QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
               +++Y +L  KL   +  N VLS+S+   K WLVG+GL+++EQ+KA KGTLFIP SQ P
Sbjct  509   LDQEEYRRLKTKLTPEAATNLVLSKSYNISKTWLVGDGLSEDEQLKAPKGTLFIPYSQFP  568

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             P K R+DC Y   PAM+ P  L N+ +CENWLPRR MSA R++GI+HALEGW  HECG  
Sbjct  569   PSKARKDCFYFSTPAMITPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWKEHECGNM  628

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             M DIDKVW+A+L HGF PL + +
Sbjct  629   MFDIDKVWKASLDHGFCPLTMAS  651



>ref|XP_003529007.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=624

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/618 (65%), Positives = 499/618 (81%), Gaps = 3/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG FK+V+L+PW+AHS YSF+ S+  ERD   FLI P+++ RMLH
Sbjct  1     MASKPGILTNWPWKPLGCFKWVILTPWIAHSTYSFLVSDAKERDLGYFLIFPYMMVRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WI+ SRHRTA GKNRIVDK IEFEQVDRESNWDDQ++ NG++FY+   ++ + S +P
Sbjct  61    DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+ TT+   TAS +S  GY+ YID MNN+GHCNFE IPK +F+ FP LKY
Sbjct  181   HIAYFVLFAIPLYTTVVARTASIASYAGYLAYIDFMNNLGHCNFECIPKAIFTAFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMDK+TDT YE +LKR E SPDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKTTDTTYEIALKREESSPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ PQS  WY+ LMWP+TLW++++   YGQTF+++RN  + + L
Sbjct  301   TTPESIYHLRLGFASLASRPQSSTWYLSLMWPLTLWSILVTWFYGQTFVMERNAFKMLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ VQYL +WQS+ +N LIEEAI++AE   VKVLSLGL NQ +  N+ GE YI+
Sbjct  361   QSWVIPRFHVQYLFKWQSETLNKLIEEAILQAELSKVKVLSLGLSNQGDSFNKYGELYIK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YP++KIK+VDGSSL VAI+V N+IPK   +VLL    NKVS +IASAL +RG KV T  
Sbjct  421   RYPELKIKIVDGSSLVVAIVV-NSIPKEARQVLLCGKPNKVSYAIASALCERGTKVTTMY  479

Query  781   EDDYEKLKL--ATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +D+Y+KL+L  +  SK N V   S+T K+WLVG+   + EQ KA KG+LFIP+SQ PPKK
Sbjct  480   KDEYDKLQLRISNESKKNLVFPGSYTAKIWLVGDQCDEVEQKKAPKGSLFIPISQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM+APPSL N+ +CENWLPRR MSA RV+GI+HALE W V+ECG  M  
Sbjct  540   LRKDCFYHSTPAMIAPPSLVNVDSCENWLPRRVMSAWRVAGILHALECWKVNECGNVMFS  599

Query  427   IDKVWEAALSHGFRPLPL  374
             ++K+W+A+L HGFRPL +
Sbjct  600   VEKIWQASLQHGFRPLKI  617



>gb|EYU42308.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
 gb|EYU42309.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
Length=624

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/616 (65%), Positives = 503/616 (82%), Gaps = 3/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LGNFKY+VL+PW   + YSF+T +++ +  ++FL+LP L+SR +H
Sbjct  1     MASKPGILTEWPWTWLGNFKYLVLAPWAVPATYSFLTKDDNRKYLSSFLVLPLLISRAVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             N +WIS SR+RTA G NRIVDK IEFEQVDRE NWDDQ++LNG++ Y     +    R+P
Sbjct  61    NLIWISLSRYRTAKGNNRIVDKSIEFEQVDRERNWDDQIILNGIIMYTAIMFIKYAQRVP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W TDG++ T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWSTDGLIWTFLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+Y+LLF+IP+LTTLF G  S  ++  Y+TYID MNNMGHCNFE IPKWLFS FPPLKY
Sbjct  181   HISYYLLFSIPLLTTLFMGNGSILAITIYLTYIDFMNNMGHCNFELIPKWLFSAFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMPFYDY+YGTMDKS+DTLYE SL R EESPDVVHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDTLYEKSLVREEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF   A+ P   NWY+WLMWPVT+W+M+I  IYG+TF ++RN+ + +KL
Sbjct  301   TTPESIYHLRLGFPYLASQPHKSNWYLWLMWPVTVWSMMITWIYGRTFTVERNVFKNLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++WQ + IN++IE +I+EAE KGV+VLSLGLLNQ E LN+NGE +++
Sbjct  361   QTWAIPKYSIQYYMQWQKEIINTMIENSILEAEDKGVRVLSLGLLNQEEGLNKNGELFLK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P++K+KLVDGSSL VA+++ N+IPKGTT+V+L+ NL+KV+ SIA AL Q GI+V T  
Sbjct  421   RQPQLKVKLVDGSSLVVAVVI-NSIPKGTTQVVLKGNLSKVAYSIALALCQDGIQVFTMS  479

Query  781   EDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
              D+Y+KL  KL+  +  N VLS+S T K WLVG+GL++EEQ+ A KGT+FIP SQ PPKK
Sbjct  480   NDEYKKLQAKLSKEAGNNLVLSKSNTPKTWLVGDGLSEEEQLNAPKGTIFIPFSQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC Y+  PAMLAP  L N+ +CENWLPRR MSA R++GI+HA+E WNV+ECG+ M +
Sbjct  540   MRKDCFYNTTPAMLAPKHLENVDSCENWLPRRVMSAWRIAGILHAMEEWNVNECGDMMFN  599

Query  427   IDKVWEAALSHGFRPL  380
             I+K+W+A+L HGFRPL
Sbjct  600   IEKIWQASLEHGFRPL  615



>ref|XP_010052731.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76801.1| hypothetical protein EUGRSUZ_D01152 [Eucalyptus grandis]
Length=627

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/620 (65%), Positives = 501/620 (81%), Gaps = 4/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKY+VL+PWV +S Y FV S   ERD + FLI PFLL RM+H
Sbjct  1     MASKPGLLTDWPWKPLGSFKYLVLAPWVVYSTYVFVNSNGRERDMSTFLIFPFLLWRMVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WI+ SR+R A G  RIVDK IEFEQVDRE +WDDQ++ NGL+FY+    LA GS LP
Sbjct  61    SQIWITLSRYRNARGNGRIVDKGIEFEQVDRERDWDDQILFNGLIFYIGAMTLAGGSHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR+DGV+ T  +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSS+VTEPITSVIHPF E
Sbjct  121   MWRSDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYF LFA+P  TT++ GTAS  SL GYVT+IDLMNNMGHCNFE IPKW+FS FPPLKY
Sbjct  181   HLAYFALFAMPQYTTVWMGTASVMSLAGYVTFIDLMNNMGHCNFELIPKWIFSYFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQ RTNYSLFMPFYDYIYGTMDKS+D L+ETSL+R  E PDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQVRTNYSLFMPFYDYIYGTMDKSSDKLHETSLEREVEVPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             TTP S+Y +R+GF++ A+ P QS  WY+WL+WPVTLW+M++  IYG+TF+++R++  K+K
Sbjct  301   TTPRSIYHLRVGFASLASWPDQSSRWYLWLIWPVTLWSMMVTWIYGRTFVVERHLFSKLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+WVIP+Y +QY ++WQ ++IN LIE+AI++AE KG KVL LGLLNQ EELN  G  Y+
Sbjct  361   LQTWVIPKYSLQYFMQWQKESINGLIEKAIMQAEEKGTKVLCLGLLNQGEELNGYGGMYV  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
              ++P++K+++VDGS LAVA++V N+IPKGT +VL R  L KV+ +IA AL QRGI+V T 
Sbjct  421   GRHPQLKVRVVDGSGLAVAVVV-NSIPKGTVQVLFRGRLTKVAYAIALALCQRGIQVATL  479

Query  784   CEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E +Y+ LK + N K   N +L      K+W+VG+ +T+E+Q+KA KGTLFIP SQ PPK
Sbjct  480   HEHEYKMLKKSFNHKCDSNLLLQSGRAPKIWVVGDDVTEEDQLKAPKGTLFIPYSQFPPK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R DC Y H PAM+ PPSL N+H+CENWLPRR MSA RV+GI+HA EGW  +ECG  + 
Sbjct  540   KLRGDCFYCHTPAMVVPPSLENMHSCENWLPRRVMSAWRVAGILHAAEGWEENECGYSIT  599

Query  430   DIDKVWEAALSHGFRPLPLP  371
             DIDKVW+A+L HGF+PL +P
Sbjct  600   DIDKVWQASLQHGFQPLGIP  619



>emb|CDP09363.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/618 (64%), Positives = 496/618 (80%), Gaps = 13/618 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG L DWPW PLGNFKYVVL+PWV H  Y ++  + S+R+   FL+LPFLL RMLH
Sbjct  1     MASKPGILYDWPWTPLGNFKYVVLAPWVIHHTYPYMVKDASDRNLPMFLVLPFLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WISYSR+RTA G NRIVDK IEFEQ+DRE NWDD ++ NG++FY+  T L   + +P
Sbjct  61    NQIWISYSRYRTAKGTNRIVDKSIEFEQIDRERNWDDNIIFNGIVFYMVAT-LKNTADMP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +HVGPVEF+YYWLHRALHHHFLYSRYHSHHH+SIVTEPITSVIHPFGE
Sbjct  120   IWRTDGVIITILLHVGPVEFLYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYFLLFAIP+ TT F+GTA   S +GY++YID MNNMGHCNFE IP WLFSIFPPLKY
Sbjct  180   HVAYFLLFAIPMATTFFSGTACIVSFIGYISYIDFMNNMGHCNFELIPNWLFSIFPPLKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIY TMDKST++LYE+SL R E+SPDVVHLTHL
Sbjct  240   LMYTPSFHSLHHTQFRTNYSLFMPLYDYIYDTMDKSTESLYESSLSRQEDSPDVVHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ P    WY + MWP+TLW++++  I+G+T +++RN+ + +KL
Sbjct  300   TTPESIYHLRLGFASLASQPHDFKWYFYFMWPLTLWSVMLTWIHGRTILVERNVFKNLKL  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P++ +QY  +WQ ++IN LIEEAI EAE KGV         ++E+LN NGE YI+
Sbjct  360   QTWTVPKFSIQYFAQWQRESINGLIEEAISEAENKGV---------KAEDLNGNGELYIR  410

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +K+KLVDGSSLAVAI++ N+IPKG   ++L  NL+KV+ SIA AL Q G KVV   
Sbjct  411   RHPLLKVKLVDGSSLAVAIVL-NSIPKGAAGIVLGGNLSKVAYSIALALCQAGTKVVAIR  469

Query  781   EDDYEKLKLATN--SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E +Y+KLK   N  ++ N V S+    KVW+VG+GLT+E+QMKA+KGT FIP S+ PPKK
Sbjct  470   EHEYKKLKARLNPEARSNLVQSKHCATKVWIVGDGLTEEDQMKASKGTTFIPFSRYPPKK  529

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YHH P+MLAP  L NL +CENWLPRR MSA+RV+GI+H LE WNV+ECG  + +
Sbjct  530   MRKDCFYHHTPSMLAPKHLENLDSCENWLPRRVMSASRVAGILHVLENWNVNECGNMIFN  589

Query  427   IDKVWEAALSHGFRPLPL  374
             I+KVW+A++ HGFRPL +
Sbjct  590   IEKVWQASIHHGFRPLAV  607



>ref|XP_007220536.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
 gb|EMJ21735.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
Length=629

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/615 (66%), Positives = 498/615 (81%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW  LG+FK+V+L+PWV HS +  V ++  ERD + FLIL  +L R+LH
Sbjct  1     MASVPGILTDWPWTALGSFKHVILAPWVIHSTWLLVANDGKERDISYFLILAVVLWRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+DK +EFEQVDRE+NWDDQ++ N LLFY  +  L  G   P
Sbjct  61    NQIWISLSRYRTAKGNGRILDKGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR +G+L+T+ +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121   FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y  LF IP+L T+ T T S  S   Y+TYID MNNMGHCNFE IP WLFS+FPPLKY
Sbjct  181   HIVYSTLFFIPILGTMLTRTTSVVSFTAYITYIDFMNNMGHCNFELIPNWLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIY TMDKS+D LYETSLKR EE+PD++HLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYKTMDKSSDVLYETSLKREEETPDILHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A+ P + NWY+WLMWPVT W+MI+  IYG+TF++DR+  + +KL
Sbjct  301   TTPESIYHLPLGFASLASRPYTSNWYLWLMWPVTFWSMILTWIYGRTFVVDRHRFDNLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY L+WQ++AIN LIEEAII+AE KGVKVL LGLLNQ EELNR G  Y+ 
Sbjct  361   QTWAIPKYSLQYYLQWQNEAINGLIEEAIIQAEEKGVKVLCLGLLNQGEELNRYGGLYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KI++VDGSSLAVAI + NTIPKGTT+VLLR NL KV+ +IA AL Q+GI+VVT  
Sbjct  421   RHPNLKIRVVDGSSLAVAITL-NTIPKGTTQVLLRGNLTKVAYAIAFALCQKGIQVVTLH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             +D+Y KL K  ++++ + VL++S+  K+WLVG+GL+ EEQ++A KGTLF+P SQ+PPKK 
Sbjct  480   KDEYLKLTKSFSSTESSLVLAKSYAHKIWLVGDGLSAEEQLRAPKGTLFVPFSQLPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+PPAM  P SL N+HACENWLPRR MSA R++GIVHALEGW  HECG  M ++
Sbjct  540   RKDCFYHYPPAMKTPTSLENIHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSNV  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A L HGF+PL
Sbjct  600   DKVWQATLQHGFQPL  614



>ref|XP_011012757.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/617 (66%), Positives = 501/617 (81%), Gaps = 6/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK+++L+PWV HS YSF+   + E+D + FL  P LL RMLH
Sbjct  1     MASRPGILTDWPWKPLGSFKHLILAPWVIHSTYSFMI--QDEKDLSTFLAFPLLLWRMLH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G NRIVDK IEF+QVDRESNWDDQ++ NG+LFY+    +   S LP
Sbjct  59    NQLWISLSRYRTAKGNNRIVDKAIEFDQVDRESNWDDQILFNGILFYVGIKTIPGASHLP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  IH+GPVEF+YYWLHR LHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  119   LWRLDGVIITALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF+LFAIP++TT+ TGTAS +SL GY+TYID+MNNMGHCNFE +PKWLF+IFPPLKY
Sbjct  179   HISYFMLFAIPLITTIMTGTASVASLAGYITYIDVMNNMGHCNFELVPKWLFTIFPPLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD S+DTLYE SLKR EE+PDVVHLTHL
Sbjct  239   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDTSSDTLYEDSLKRPEEAPDVVHLTHL  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y  RLG +  A+ PQ   WY+ L+WPVTLWTM++  IYG+ F+ +RN   K++L
Sbjct  299   TTPDSIYHSRLGLAYLASNPQKSKWYLSLLWPVTLWTMMLTWIYGRAFVAERNRFHKLRL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W+IP+Y +QY L     +IN+LIEEA+++AE KGVKVLSLGLLNQ EELNR GE Y+Q
Sbjct  359   QTWIIPKYNIQYNLRRHRASINTLIEEAVLKAEEKGVKVLSLGLLNQGEELNRYGELYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YP++K K+VDGSSLAVA ++ N+IP+GTT+VL   NL+KV+ ++   L +RGI+V    
Sbjct  419   RYPRLKTKVVDGSSLAVAAVL-NSIPEGTTQVLHIGNLSKVAYAVVLNLCRRGIQVAVPY  477

Query  781   EDDYEKLKLA---TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             EDDY+KLK +    + + N +LS++++ K WLVG+GL  E Q KAT+GTLFIP SQ PP+
Sbjct  478   EDDYKKLKKSFGIRSDQNNLILSKNYSIKTWLVGDGLKGENQKKATEGTLFIPFSQFPPQ  537

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R DC YH  PAM AP SL N+ +CENWLPRR MSA RV+GIVHALEGWN HECG  M 
Sbjct  538   KLREDCFYHSIPAMAAPASLENVDSCENWLPRRVMSAWRVAGIVHALEGWNEHECGYTMS  597

Query  430   DIDKVWEAALSHGFRPL  380
             DIDKVW+A++ HGF+PL
Sbjct  598   DIDKVWQASIQHGFKPL  614



>ref|XP_003530144.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Glycine max]
Length=625

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/618 (65%), Positives = 498/618 (81%), Gaps = 2/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKYV+L+P V HSLYS +  ++SERD TNFLILPFLL RMLH
Sbjct  1     MASKPGILTDWPWKPLGSFKYVILAPSVVHSLYSMLAKDKSERDITNFLILPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SRHRTA G  RIVDK IEF+QVDRE NWDDQ++L GL +YL N + A  SR+P
Sbjct  61    NQIWITLSRHRTAKGNGRIVDKGIEFDQVDRERNWDDQILLTGLTYYLSNYIFAGASRIP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTD  ++T+ +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDAAVVTILLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+Y  LFA P+L  +FT TAS  ++ GYVTYID MNNMGHCNFE +P WLF+IFP LKY
Sbjct  181   HISYLFLFATPLLILVFTKTASMMAVFGYVTYIDFMNNMGHCNFEIVPMWLFNIFPCLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQF+TNYSLFMPFYDYIY T+DK++D L++++ KR EE PDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFKTNYSLFMPFYDYIYDTLDKASDQLHDSASKREEEIPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF+  A  P +  WY+ LMWP+T W+MI+   YG+TFI++ N  +K+KL
Sbjct  301   TTPESIYHLRLGFAYLACKPCTSKWYLCLMWPMTAWSMILTLAYGRTFIVEGNHFDKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IP+Y  QY +  Q   IN +IEEAI++A+ KG+KVLSLGLLNQ E+LN  G FY+ 
Sbjct  361   QSWAIPKYSQQYFIRSQKMPINKMIEEAILDADKKGIKVLSLGLLNQGEDLNSYGGFYVS  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P +K+K++DGSSLA AI++ N+IP GTT+VLLR  L KV+ +IA  L Q+G++V T  
Sbjct  421   KHPNLKVKVIDGSSLATAIVL-NSIPNGTTQVLLRGKLTKVAYTIAFTLCQQGVQVATMH  479

Query  781   EDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             +DDY KLK + +S G NF++ +S+TQK WLVGEGLT+EEQ+KA KGTLFI  SQ PP K+
Sbjct  480   KDDYVKLKNSFSSFGKNFIIEKSYTQKTWLVGEGLTEEEQLKAPKGTLFITYSQFPPIKY  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DCSYH  PAML P S+ N+H+CENWLPR+ MSA R++GIVH LEGW+ HEC   M +I
Sbjct  540   RKDCSYHFTPAMLVPSSIQNVHSCENWLPRKVMSAWRIAGIVHCLEGWSEHECNYTMHNI  599

Query  424   DKVWEAALSHGFRPLPLP  371
             DKVW + L HGF+PL +P
Sbjct  600   DKVWRSTLQHGFQPLSVP  617



>gb|KHN30013.1| Protein WAX2 [Glycine soja]
Length=621

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/619 (65%), Positives = 504/619 (81%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKY++L+PWV HS YS +  ++SERD + FLI PFLL RMLH
Sbjct  1     MASRPGILTDWPWKPLGSFKYLLLAPWVVHSSYSVLVKDKSERDISTFLIFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR+RTA G  RIVDK IEF+QVDRE +WDDQ++ NGLL+YL +  L+  SR+P
Sbjct  61    NQIWITLSRYRTAKGNARIVDKGIEFDQVDRERDWDDQILFNGLLYYLASYTLSGASRIP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+M + +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVMAILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLFAIP LT +FT TAS  ++LGYVTYID MNNMGHCNFE +PKWLF IFPPLKY
Sbjct  181   HILYFLLFAIPKLTLVFTKTASVGAMLGYVTYIDFMNNMGHCNFEVVPKWLFDIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYT S+HSLHHTQFRTNYSLFMP YDYIYGT DK++D L+E++LK+ EE P+VVHLTHL
Sbjct  241   LMYTSSFHSLHHTQFRTNYSLFMPLYDYIYGTTDKASDKLHESALKQEEEIPNVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF+  A+ P +  WY+ LMWPVT W+MI+  +YG+TFI++ N  +K+KL
Sbjct  301   TTPESIYHLRLGFAYLASKPYTSKWYLCLMWPVTTWSMILTWVYGRTFIVEGNRFDKLKL  360

Query  1141  QSWVIPRY-KVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             Q+W IP+Y  +QY ++ Q  AIN++IEEAI++A+ KG+KVLSLGL NQ E+LN  G  Y+
Sbjct  361   QTWAIPKYILLQYFMQSQKVAINTMIEEAILDADRKGIKVLSLGLRNQGEDLNIYGGLYV  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
              ++PK+K+++VDGSSL VA+++ N+IPKGTT+VLLR  L K++ ++A  L Q+G++V   
Sbjct  421   SRHPKLKVRVVDGSSLVVAVVL-NSIPKGTTQVLLRGKLTKIAYALAYTLCQQGVQVAAL  479

Query  784   CEDDYEKLKLATN-SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
              EDDY +LK + N S+ N   ++S TQ  WLVG+GLT+EEQ+KA KGTLFIP +Q PP+K
Sbjct  480   YEDDYVRLKKSFNSSETNLAFTKSSTQTTWLVGDGLTEEEQLKAPKGTLFIPYTQFPPRK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
             +R+DC YH  PAMLAP S+ N+H+CE+WLPRR MSA R++GIVH+LEGW  HECG  M +
Sbjct  540   YRKDCFYHCTPAMLAPCSVENIHSCEDWLPRRIMSAWRIAGIVHSLEGWTEHECGHTMHN  599

Query  427   IDKVWEAALSHGFRPLPLP  371
             ID VW + L HGF+PLP+P
Sbjct  600   IDNVWHSTLQHGFQPLPVP  618



>ref|XP_010052726.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=620

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/618 (65%), Positives = 505/618 (82%), Gaps = 3/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKY++L+PW+AH  Y F+     ERD++ FLILPFLL R++H
Sbjct  1     MASKPGILTDWPWKPLGSFKYMILAPWMAHGTYQFIAKGPGERDFSYFLILPFLLERIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRHRTA G NRI+D+ IEFEQVDRESNWDDQ++L G+L Y+ N  + + S LP
Sbjct  61    NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTGILLYMTNWTIPQASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W+TDGV++TV IH   VE++YYWLHRALHHHFLYSRYHSHHHSS+VTEPI+S++HPF E
Sbjct  121   LWKTDGVIITVLIHALVVEYLYYWLHRALHHHFLYSRYHSHHHSSVVTEPISSIVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y +LFAIP+ TT+FT TAS +S++ Y TYID MNNMGHCNFE IP  LF+IFPPLKY
Sbjct  181   HIVYAMLFAIPMYTTVFTRTASIASIIVYTTYIDFMNNMGHCNFELIPSRLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYG MD+ST+  YETSL++ E+SPDVVHLTH+
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGAMDESTNATYETSLQKVEDSPDVVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ P S   Y+W+MWP+TL +++   I G  F+L+RN  +K+KL
Sbjct  301   TTPESIYHLRLGFASLASRPYSPKQYLWIMWPLTLVSVVWTWINGHFFVLERNAFKKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY V Y L W+++AIN+LIEEAI++A  KGVKVL+LGLLNQ E+LN +GE +IQ
Sbjct  361   QSWVIPRYNVHYRLPWRTEAINALIEEAILDANQKGVKVLTLGLLNQGEKLNGHGELFIQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+  ++ KLVDGSSLAVA+++  +IPKGT++VLLR NLNK++ +IA AL  RGI+V  + 
Sbjct  421   KHRDLRTKLVDGSSLAVAVVL-RSIPKGTSQVLLRGNLNKLACAIAHALCARGIQVNVAS  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +D++EK K + N K  GN + SR+F+QK+WLVG+ L +EEQ KA KGTLFIP SQ PPK+
Sbjct  480   KDEHEKRKRSLNGKEGGNLIHSRTFSQKIWLVGDELAEEEQKKAPKGTLFIPFSQFPPKQ  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM+AP S +NL +CENWLPRR MSA RV+GIVHALEGWNV+ECG  M D
Sbjct  540   IRKDCLYHGTPAMIAPKSFNNLDSCENWLPRRVMSAWRVAGIVHALEGWNVNECGSMMFD  599

Query  427   IDKVWEAALSHGFRPLPL  374
             I+K WEA+L HGFRPL L
Sbjct  600   IEKAWEASLQHGFRPLVL  617



>gb|KHN40120.1| Protein WAX2 [Glycine soja]
Length=627

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/620 (65%), Positives = 499/620 (80%), Gaps = 3/620 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+FK+V+L+PW+AHS YSF+ SE  ERD T FLI P ++ RMLH
Sbjct  1     MASKPGILTNWPWKPLGSFKWVILTPWIAHSTYSFLVSEPKERDLTYFLIFPLMMVRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WI+ SRHRTA GKNRIVDK IEFEQVDRESNWDDQ++ NG++FY+   ++ + S +P
Sbjct  61    DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+ TT+ T TAS +S  GY+ YID MNN+GHCNFE IPK +FS FP LKY
Sbjct  181   HIAYFVLFAIPLYTTVVTRTASIASYAGYLAYIDFMNNLGHCNFECIPKAIFSAFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMDKSTDT YE +LKR E   DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKSTDTTYEIALKREESLADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ PQS  WY++LMWP TLW++++   YGQTF+++RN  + + L
Sbjct  301   TTPESIYHLRLGFASLASRPQSSTWYLYLMWPFTLWSVLVTWFYGQTFVMERNAFKMLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ VQYL +WQS+ +N LIEEAI++AE   VKVLSLGL NQ+  LN+ GE YI+
Sbjct  361   QSWVIPRFHVQYLFKWQSETLNKLIEEAILQAELSKVKVLSLGLSNQANLLNKYGELYIK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYP++KIK+VDGSSL VAI++ N+IPK  ++VLL    NKVS +I SAL +RG KV T  
Sbjct  421   KYPELKIKIVDGSSLVVAIVL-NSIPKEASQVLLCGKPNKVSYAIVSALCERGTKVTTMY  479

Query  781   EDDYEKLKL--ATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +D+Y+KL+L     SK N V   S+  K+WL+G+   + +Q KA KG+LFIP+SQ PPKK
Sbjct  480   KDEYDKLQLRIPNESKDNLVFPGSYPAKIWLLGDQCNEVDQRKAPKGSLFIPISQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM+APP L N+ +CENWLPRR MSA RV+GI+HALEGWNV+ECG  M  
Sbjct  540   LRKDCFYHCTPAMIAPPCLVNVDSCENWLPRRVMSAWRVAGILHALEGWNVNECGNVMFS  599

Query  427   IDKVWEAALSHGFRPLPLPN  368
             ++K+ +A+L HGFRPL + N
Sbjct  600   VEKIRQASLQHGFRPLKINN  619



>ref|XP_004510147.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cicer arietinum]
Length=622

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/618 (65%), Positives = 494/618 (80%), Gaps = 3/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FK+V+L+PWVAHS YSF  +   ERD +NFLI P+L+ RMLH
Sbjct  1     MASKPGILTNWPWTPLGSFKWVILTPWVAHSTYSFFVNGSEERDLSNFLIFPYLMVRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SRHRTA GK+RIVDK IEFEQVDRESNWDDQ++ NG++FY+    + +  +LP
Sbjct  61    DQIWISLSRHRTAKGKSRIVDKSIEFEQVDRESNWDDQILFNGVIFYIGQMFIEESRKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   IWRTDGVIITILLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+ TT  T TAS +S  GY+ YID MNN+GHCNFEFIP  LFSIFP LKY
Sbjct  181   HIAYFMLFAIPLYTTAITKTASIASFAGYLAYIDFMNNLGHCNFEFIPMKLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGT+D +TDT YETSLK+ E SPDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTVDNATDTTYETSLKKEEASPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGFS+ A+ PQS  WY++LMWP T  +++    YGQTF+L+RN    + L
Sbjct  301   TTPESIYHLRLGFSSLASTPQSSKWYLYLMWPFTFASVLATWFYGQTFVLERNSFNMLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ VQYL +WQ + +N LIEEAI+EAE   VKVLSLGL NQ + LNR+GE YI+
Sbjct  361   QSWVIPRFHVQYLFKWQRETLNKLIEEAILEAELSKVKVLSLGLSNQGDLLNRHGELYIK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YP++K+K+VDGSSL VAI++ N+IPK   +VLL   L+KVS +I +AL +RG KV T  
Sbjct  421   RYPQLKLKIVDGSSLVVAIVL-NSIPKEANQVLLCGRLDKVSYAIVNALCERGTKVTTMY  479

Query  781   EDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
              DDYE  +L+L++ SK N V     + K+WLVG+   + EQ KA KG+LFIP SQ PPKK
Sbjct  480   TDDYENLQLRLSSESKKNLVSPGFNSSKIWLVGDQCDEVEQKKAPKGSLFIPFSQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC Y   PAM+ PP L N+ +CENWLPRR MSA R++GI+HALEGWN+HECGE M  
Sbjct  540   LRKDCFYGSTPAMITPPDLVNVDSCENWLPRRVMSAWRIAGILHALEGWNIHECGESMFS  599

Query  427   IDKVWEAALSHGFRPLPL  374
             I+KVW+A+L HGFRPL +
Sbjct  600   IEKVWKASLQHGFRPLKI  617



>ref|XP_009586975.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=625

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/619 (65%), Positives = 506/619 (82%), Gaps = 5/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSF-VTSEESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+VAHS++SF ++ +E ++D   F+I PFLLSRM+
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPFVAHSIHSFFLSKDEKQKDIVKFIIFPFLLSRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVDK IEF+QVDRE NWDDQ++ NGLLFY     L +   +
Sbjct  61    HNQIWISISRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIIFNGLLFYYGYMKLEQSHHI  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  IH+GPVEF+YYWLHR+LHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PFWRTDGIILTALIHIGPVEFLYYWLHRSLHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EH+AYF LFAIP+LT + TGTAS  +L GY+TYID MNN+GHCNFE IPKW+FS+FPPLK
Sbjct  181   EHVAYFALFAIPMLTAVLTGTASIVALGGYITYIDFMNNLGHCNFELIPKWIFSVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLYE SL+R  ESPDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYIYNTLDKSSDTLYEKSLERVGESPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTT ES+Y +RLGF++ A+ P +  WY  +MWP+TLW+ +    YG  FI++RNI + +K
Sbjct  301   LTTAESIYHLRLGFASLASEPHTSKWYFPVMWPITLWSTMFTWFYGHAFIVERNIFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W++P+Y+VQY + WQ ++I++L+E+AI EA+ KGVKVL+LGLLNQ E LN NGE YI
Sbjct  361   LQTWIVPKYRVQYFMPWQRESISNLMEKAIKEADQKGVKVLTLGLLNQ-ELLNMNGEQYI  419

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             ++ P++K+KLVDGSSLAVA+++ N+IPKGTT+V+L  +L+KV+  IA AL + GI+V+T 
Sbjct  420   KRNPELKVKLVDGSSLAVAVVL-NSIPKGTTQVVLGGHLSKVAYFIALALCKDGIQVITL  478

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             CE+DY  LK  L   +  N   S S+T K WLVG+GL++E+Q+KA KGTLFIP SQ PP+
Sbjct  479   CENDYNMLKARLTPEAATNLATSISYTSKTWLVGDGLSEEQQLKAPKGTLFIPFSQFPPR  538

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y H PAM+AP  L N+ +CENWLPRR MSA R++GI+HALEGW+ HECG+KM 
Sbjct  539   KARKDCFYFHTPAMIAPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWSEHECGDKMF  598

Query  430   DIDKVWEAALSHGFRPLPL  374
             DI+K ++A+L HGFRPL L
Sbjct  599   DIEKAYKASLDHGFRPLTL  617



>ref|XP_007134354.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
 gb|ESW06348.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
Length=622

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/617 (65%), Positives = 502/617 (81%), Gaps = 2/617 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKYVVL+PWV HS YS +  +++ERD   FLILP LL RM+H
Sbjct  1     MASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSMLVKDKNERDVGTFLILPLLLWRMVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR+RTA G  RIVDK +EF+QVDRE  WDDQ++ NGLL+YL    L   S LP
Sbjct  61    NQIWITLSRYRTAKGNGRIVDKGLEFDQVDREREWDDQILFNGLLYYLACYTLPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRT+G++M + IH GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTEGLVMAMLIHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YFLLF+IP+LT +FT TAS  +++ YVTYID MNNMGH NFE +PKWLF+IFPPLKY
Sbjct  181   HISYFLLFSIPMLTLVFTNTASVGTMVVYVTYIDFMNNMGHSNFEVVPKWLFAIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YT S+HSLHHTQFRTNYSLFMPFYDYIYGT DK++DTL E++LKR EE PDVVHLTHL
Sbjct  241   LIYTSSFHSLHHTQFRTNYSLFMPFYDYIYGTTDKASDTLQESALKREEEIPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLGF+  A+ P +  WY+ LMWP T W+MI+  IYG TFI++ N  +K+KL
Sbjct  301   TTPQSIYHLRLGFAYLASKPYTSKWYLSLMWPFTAWSMILTWIYGTTFIVEANRFDKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QYLL+ Q   IN++IE+AI++AE KG+KVLSLGL NQ EELN  G  Y+ 
Sbjct  361   QTWAIPKYSLQYLLKSQKVGINTMIEKAILDAERKGIKVLSLGLRNQGEELNIYGGLYVS  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++PK+K+K+VDGSSL +A+++ NTIPKGTT+VLLR  L KV+  +A  L+Q+ ++V T  
Sbjct  421   RHPKLKVKIVDGSSLVIALLL-NTIPKGTTQVLLRGKLTKVAYGLAFTLSQQNVQVATLY  479

Query  781   EDDYEKLKLA-TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             EDDY +LK +  +S+ N   S++ TQ VWLVG+ +++EEQ+KA KGTLFIP +Q PPKK+
Sbjct  480   EDDYVRLKKSFKSSETNLTFSKTSTQTVWLVGDEVSEEEQLKAPKGTLFIPYTQFPPKKY  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  PAMLAPPSL N+H+CE+WLPRR MSA R++GIVH+LEGWN HECG  M +I
Sbjct  540   RKDCFYHCTPAMLAPPSLENIHSCEDWLPRRVMSAWRIAGIVHSLEGWNEHECGHTMNNI  599

Query  424   DKVWEAALSHGFRPLPL  374
             DKVW++ L HGF+P+P+
Sbjct  600   DKVWDSTLQHGFKPIPI  616



>ref|XP_007041186.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX97017.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=620

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/619 (65%), Positives = 498/619 (80%), Gaps = 4/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSE-ESERDYTNFLILPFLLSRML  2045
             MAT PG LTDWPWK LGNFKY +L+PWV HS YS + S+ E E + T  LI PFL++R+L
Sbjct  1     MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLMSKGEKEANLTYHLIFPFLMTRVL  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA GKNRIVDK I+FEQVDRESNWDDQ++LNG+L YL N ++   S L
Sbjct  61    HNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMPGASHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR+DG ++ + +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSI TEPITSVIHPF 
Sbjct  121   PLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AYFLLFAIP++T +FTGTAS +++  Y+TYIDLMNNMGHCNFE +PKW+FS FPPLK
Sbjct  181   EEVAYFLLFAIPLMTVMFTGTASIAAIFIYITYIDLMNNMGHCNFELVPKWVFSTFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             +LMYTPSYHSLHHTQFRTNYSLFMP YDY+YGT+DKS+D LYETSLKR EESPD+VHLTH
Sbjct  241   FLMYTPSYHSLHHTQFRTNYSLFMPMYDYLYGTVDKSSDDLYETSLKRQEESPDIVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWL-MWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             LTT +S+Y +RLGF++ A+ P +  WY  + MWPV+ W+ +    YG TF+ + N    +
Sbjct  301   LTTTDSIYHLRLGFASLASKPYAFKWYFTIAMWPVSCWSAVFTWFYGHTFVSESNTFNNL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQSWV+PRY + YLL+ + + +N LIEEA++EA+ KG KV+S GLLNQ EELN NGE Y
Sbjct  361   KLQSWVVPRYTMHYLLQREKKDLNYLIEEALLEADSKGAKVVSFGLLNQHEELNGNGELY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             IQ++P+++I+LVDGSSLA A++V N+IP+ TT+VLL   ++KV  +IA AL Q+G++V  
Sbjct  421   IQRHPQLRIRLVDGSSLAAAVVV-NSIPQETTQVLLTGRISKVGYAIALALCQKGVQVAA  479

Query  787   SCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               ED+Y+KL+ +    G N VL+ ++ QK+WLVGEGLT +EQ+KATKGT+F+P +Q PPK
Sbjct  480   MNEDEYQKLQHSDCQFGKNLVLAENYDQKIWLVGEGLTDKEQLKATKGTVFVPFTQFPPK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K  +DC YH  PAM+AP SL N+H+CENWL RR MSA RV+GIVH LEGWNVHECG+ M 
Sbjct  540   KLLKDCYYHTTPAMVAPKSLDNIHSCENWLARRVMSAWRVAGIVHGLEGWNVHECGQTMF  599

Query  430   DIDKVWEAALSHGFRPLPL  374
              +DKVWEA L HGF PL L
Sbjct  600   SMDKVWEATLLHGFCPLSL  618



>ref|XP_006428971.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
 ref|XP_006480706.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|ESR42211.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
Length=627

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/625 (65%), Positives = 503/625 (80%), Gaps = 9/625 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLGNFKY+VL+PW+ HS YSF+  +E ERD  NFLI PFLL RMLH
Sbjct  1     MASKPGILTDWPWTPLGNFKYIVLAPWIIHSTYSFMVKDEKERDLLNFLIFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYL-FNTVLAKGSRL  1865
             NQ+WIS SR+RTA G+NRIVDKPIEFEQVDRE NWDDQ++L+G+LFY+ F  +L  G++L
Sbjct  61    NQIWISLSRYRTAKGRNRIVDKPIEFEQVDRERNWDDQIILSGILFYVVFGKMLPGGTQL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR DGV++   +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSV HPF 
Sbjct  121   PIWRLDGVILMALLHAGPVEFVYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVTHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYF++FA P++TT+ TG  S     GY+TYIDLMNNMGHCNFE IPKWLF+IFPPLK
Sbjct  181   EHIAYFVVFATPLITTVLTGAGSIVLAFGYITYIDLMNNMGHCNFELIPKWLFTIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPS+HSLHHTQFR NYSLFMP YDY++ T+DK++DTLYETSLK+ ++S DVV+LTH
Sbjct  241   YLMYTPSFHSLHHTQFRANYSLFMPLYDYLFSTVDKTSDTLYETSLKKQDDSLDVVYLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSH---NWYVWLMWPVTLWTMIINCIYGQTFILDRNILE  1154
             LTTPES+Y +RLG ++ A+ P  H    WY WL+WPVTL +M+I  IYG+TF+++RN L 
Sbjct  301   LTTPESIYHMRLGLASLASKPHHHASSEWYKWLLWPVTLLSMMITWIYGRTFVVERNRLN  360

Query  1153  KIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGE  974
             K+KLQ+W I +Y +QY  + Q+++IN LIEEAI+EAE KG +V+SLGLLNQ EELNR G 
Sbjct  361   KLKLQTWAISKYNMQYFSQRQNESINRLIEEAILEAEEKGARVISLGLLNQGEELNRFGG  420

Query  973   FYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKV  794
              ++ K P++KIK+VDGSSLAVA++  N+IP GTT+V++R  L KV+ + A AL Q+GI+V
Sbjct  421   LFVHKNPELKIKVVDGSSLAVAVL-TNSIPDGTTQVVIRGILTKVAYATAFALCQKGIQV  479

Query  793   VTSCEDDYEKLKLATNSKG---NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQ  623
             VT  ED++EKL  +   K    N ++SRS+ QK+WLVG GLT+EEQ KA +GT+F+P SQ
Sbjct  480   VTLREDEHEKLIRSFGGKSESKNLLVSRSYCQKIWLVGNGLTEEEQSKAERGTMFVPFSQ  539

Query  622   IPP-KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
              PP KK R+DC+YH  PAM  P +L N+ +CENWLPRR MSA R+ GIVHALEGWN HEC
Sbjct  540   FPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVHALEGWNEHEC  599

Query  445   GEKMCDIDKVWEAALSHGFRPLPLP  371
             G  + ++D VW+AAL HGF PL +P
Sbjct  600   GYTISNVDTVWDAALRHGFLPLTIP  624



>ref|XP_009614034.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/623 (64%), Positives = 508/623 (82%), Gaps = 5/623 (1%)
 Frame = -3

Query  2224  NMATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYS-FVTSEESERDYTNFLILPFLLSRM  2048
             +MA+ PG LT+WPW  LGNFKY+VL+P+V HS+Y+ F++ +ES+RD    +ILP LLSR+
Sbjct  30    SMASKPGILTEWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIVYIIILPLLLSRV  89

Query  2047  LHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSR  1868
             +HNQ+WIS SR+RTA G NRIVDK IEF+QVDRESNWDDQ++ NGL++Y+   +L +   
Sbjct  90    IHNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLIYYIGYLLLEQAHH  149

Query  1867  LPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPF  1688
             LP WRTDG+++   +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF
Sbjct  150   LPLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF  209

Query  1687  GEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPL  1508
              EHI+YFLLFAIP+LT   TGTAS ++   Y+TYID MNNMGHCNFE IPKW+FSIF PL
Sbjct  210   AEHISYFLLFAIPLLTATLTGTASITAFGAYITYIDFMNNMGHCNFELIPKWIFSIFSPL  269

Query  1507  KYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLT  1328
             KYLMYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS++TLY  SL+R  E PDVVHLT
Sbjct  270   KYLMYTPSYHSLHHTQFRTNYSLFMPMYDYIYDTLDKSSNTLYVKSLEREAELPDVVHLT  329

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLTTPES+Y +RLG ++ A+ PQS  WY WLMWPVTLW+++I  IYG TFI++RN+ + +
Sbjct  330   HLTTPESIYHLRLGLASLASKPQSSKWYFWLMWPVTLWSIMITWIYGHTFIVERNLFKNL  389

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQ+W IP+Y++QY ++WQ + IN LIEEAI+EA+ KG+KVLSLGLLNQ E+LN +GE Y
Sbjct  390   KLQTWAIPKYRIQYFMKWQRETINKLIEEAIMEADQKGIKVLSLGLLNQEEQLNNSGELY  449

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             I++ P++K+K+VDGSSLAVA+++ N+IPKGT++V+LR  L+KV+ SIA AL Q GI+VVT
Sbjct  450   IRRNPQLKVKVVDGSSLAVAVVI-NSIPKGTSQVVLRGRLSKVAYSIALALCQGGIQVVT  508

Query  787   SCEDDYEKL--KLATNSKGNFVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
               +++Y++L  KL   +    VLS+S+   K WLV +GL+++EQ+KA KGT+FIP SQ P
Sbjct  509   LDDEEYKRLKTKLTPEAATKLVLSKSYNVSKTWLVRDGLSEDEQLKAPKGTIFIPYSQFP  568

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             PKK R+DC Y   PAM+ P  L N+ +CENWLPRR MSA R++GI+HALEGW  HECG  
Sbjct  569   PKKARKDCFYFSTPAMITPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWKEHECGNM  628

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             M DIDKVW+A+L HGF PL + +
Sbjct  629   MFDIDKVWKASLDHGFCPLTMAS  651



>ref|XP_004234847.1| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=626

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/617 (65%), Positives = 505/617 (82%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESER-DYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+V  S+ S +  E+  + D    +I PFLL RML
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIESLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR++TA G NRI+DK IEF+QVDRE NWDDQ++LNGLLFY     L +   L
Sbjct  61    HNQIWISLSRYKTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR+DG+++T  +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYFLLF+IP+LTT+ T TAS  S  GY+TYID MNNMGHCNFE IPKW+FS FPPLK
Sbjct  181   EHIAYFLLFSIPLLTTVVTKTASIVSFGGYITYIDFMNNMGHCNFEIIPKWMFSTFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+DKS+DTLYE SL+R  +SPDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTLDKSSDTLYEKSLERQGKSPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF+++A+ P +  WY WLMWPVTLW+M++  IYG TF ++RN+   + 
Sbjct  301   LTTPESIYHLRLGFASFASQPYTSKWYFWLMWPVTLWSMMVTWIYGHTFTVERNVFNNLN  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y+VQY ++WQ + IN+LIEEAI+EA+ KG+KVLSLGLLNQ E+LN+NGE YI
Sbjct  361   LQTWAIPKYRVQYFMQWQRETINNLIEEAIMEADQKGIKVLSLGLLNQDEKLNKNGEVYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+KLVDGSSLAVA+++ N++PKGTT+V+L  +L+KV+ +IA AL Q G+KV+T 
Sbjct  421   RRHPQLKVKLVDGSSLAVAVVL-NSLPKGTTQVVLGGHLSKVANAIALALCQGGVKVMTL  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y+KLK  L   +  N +LS+++T K+WLVG+GL ++EQ+K  KGT+FIP SQ PP+
Sbjct  480   REEEYKKLKSSLTPEAATNLLLSKTYTSKIWLVGDGLNEDEQLKVPKGTIFIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y H PAM+ P    N+ +CENWLPRR MSA R++GI+HALE W+ HECG  M 
Sbjct  540   KTRKDCFYFHTPAMITPKHFENVDSCENWLPRRVMSAWRIAGILHALEDWHEHECGNLMF  599

Query  430   DIDKVWEAALSHGFRPL  380
             DI+KVW+A+L HGF+P+
Sbjct  600   DIEKVWKASLDHGFQPI  616



>ref|XP_011085187.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=597

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/613 (66%), Positives = 499/613 (81%), Gaps = 21/613 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PGFLTDWPWK LG+FKY++L+PW   S+Y   T  E ERDYTN LI+PFLL R LH
Sbjct  1     MATKPGFLTDWPWKHLGSFKYIILAPWGMQSIYRAATEGEKERDYTNLLIIPFLLWRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G NRIV + IEFEQVDRESNWDDQ++LNG+L Y FNT+L K + LP
Sbjct  61    NQIWISISRYRTAKGNNRIVHRSIEFEQVDRESNWDDQILLNGILLYFFNTILGKPAFLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +HVGPVE+IYYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   VWRTDGVIITILLHVGPVEYIYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF+LFAIP+L T+  GTAS +S+ GY+TYIDLMNNMGH                L Y
Sbjct  181   HISYFVLFAIPLLGTVLNGTASLASVFGYITYIDLMNNMGHF---------------LHY  225

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYI+GT+DKS+D LYET+LKR E+ PDVVHLTHL
Sbjct  226   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIHGTVDKSSDALYETALKRQEDCPDVVHLTHL  285

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES++ ++ G +++A+ PQS  WY   MWP+T W+M++  I+ + FI++RN  +K KL
Sbjct  286   TTPESIFHLQFGLASFASRPQSPKWY---MWPLTCWSMMLTFIFKRKFIVERNAFDKFKL  342

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IPRY +QY L+WQ+QAIN LIEEAI+EAE +G KVLSLGLLNQ EELNRNG  +I+
Sbjct  343   QAWAIPRYSIQYSLKWQAQAINDLIEEAILEAESRGAKVLSLGLLNQGEELNRNGALFIE  402

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPK+ I +VDGSSLA+A+++ N+IPKGTTE+L R +L+KV+ +I  AL Q+GI+V T  
Sbjct  403   KYPKLSINIVDGSSLAIALVL-NSIPKGTTEILFRGSLSKVAYAIVCALCQQGIQVATFY  461

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             E+  EKLKL+  ++   ++++SFTQKVW+VG+G++ +EQ+ A KGTLFIP SQ PPKK R
Sbjct  462   EN--EKLKLSAVTQNKVIVAKSFTQKVWIVGDGVSDDEQLNAPKGTLFIPFSQFPPKKTR  519

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
              D  Y+H P+MLAPPSLHNLH+CENWLPRR MSA RV+GIVHALEGW+VHECG+ + D+ 
Sbjct  520   NDAFYYHTPSMLAPPSLHNLHSCENWLPRRVMSAWRVAGIVHALEGWDVHECGDTIFDVK  579

Query  421   KVWEAALSHGFRP  383
             ++ EAAL HGFRP
Sbjct  580   RILEAALRHGFRP  592



>ref|XP_007134355.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
 gb|ESW06349.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
Length=625

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/618 (64%), Positives = 496/618 (80%), Gaps = 3/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT WPW+PLG+FK+V+L+PW+ HS YSF+ ++  +R+   FLI P++L RMLH
Sbjct  1     MASKPGILTHWPWEPLGSFKWVILTPWIVHSTYSFIVNDPKDRELAYFLIFPYMLVRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WI+ SRHR A GK+RIVDK IEFEQVDRESNWDDQ++ NG+LFY  + ++ + S++P
Sbjct  61    DQIWITLSRHRNAKGKSRIVDKGIEFEQVDRESNWDDQILFNGILFYAGHMLIPEASKMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  +H G VEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   FWRMDGVVITAVLHAGAVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYFLLFAIP+ TT+ T TAS  S  GY+ YID MNN+GHCNFE IPK +FS FP LKY
Sbjct  181   HIAYFLLFAIPLYTTVVTRTASIVSYAGYLAYIDFMNNLGHCNFECIPKPIFSTFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTP++HSLHHTQFRTNYSLFMP YDYIYGTMDK+TD+ YETSLKR E SPDVVHLTHL
Sbjct  241   FMYTPTFHSLHHTQFRTNYSLFMPIYDYIYGTMDKTTDSTYETSLKREETSPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ PQS  WY++LMWP TLW++++   YGQTF+++RN  + + L
Sbjct  301   TTPESIYHLRLGFASLASKPQSSTWYLYLMWPFTLWSVLVTWFYGQTFVMERNAFKMLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ VQYL +WQS+ +N LIEEAI+EAE    KVLSLGL NQ + LN+ GE YI+
Sbjct  361   QSWVIPRFHVQYLFKWQSETLNKLIEEAILEAELSKAKVLSLGLSNQGDSLNKYGELYIR  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++KIK+VDGSSL VAI++ N+IPK  T+VLL    NK+S +IASAL +RG KV T  
Sbjct  421   RFPELKIKIVDGSSLVVAIVL-NSIPKEATQVLLCGKPNKISYAIASALCERGTKVTTMS  479

Query  781   EDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +++Y+  +L+L+  SK N V   S+T K+WLVGE   + EQ KA K +LFIP+SQ PPKK
Sbjct  480   KEEYDNLELRLSNESKKNLVFPGSYTAKIWLVGEQCNEAEQKKAPKESLFIPISQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              RRDC YH  PAM+APPSL N+ +CENWLPRR MSA+RV+GIVHALEGWNVHECG     
Sbjct  540   LRRDCYYHITPAMIAPPSLVNVDSCENWLPRRVMSASRVAGIVHALEGWNVHECGNFTFS  599

Query  427   IDKVWEAALSHGFRPLPL  374
              +K+W+A+L HGFRP  +
Sbjct  600   AEKIWQASLHHGFRPFKI  617



>ref|XP_004133955.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN56665.1| hypothetical protein Csa_3G127760 [Cucumis sativus]
Length=624

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/619 (64%), Positives = 499/619 (81%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLG FKYVVL+P   +S+Y ++  +E+ERD ++ +I+P LL RM+H
Sbjct  1     MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVKDEAERDTSSLVIIPLLLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRHRTA G  RIVDK +EF+QVDRE NWDDQ++LNG+LFYL + + AKG  LP
Sbjct  61    NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVSNLTAKGRNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YFLLFAIP+LT LFTG +S +  + Y+TYID MNNMGHCNFE IP  LF++FPPLKY
Sbjct  181   HLTYFLLFAIPMLTVLFTGISSLAVYIFYLTYIDFMNNMGHCNFEIIPNRLFTLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              +YTPS+HSLHHTQFRTNYSLFMP YDYIYGT+D S+D+LYE SLKR EE  DVVHLTHL
Sbjct  241   FLYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTLDNSSDSLYEKSLKREEEVADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF+  A+ P +  WY WL+ P+T+ +M++  IYG+TF+++RN  EK+K+
Sbjct  301   TTPESIYHLRLGFADLASRPHTSTWYTWLLSPITMGSMLLTWIYGRTFVVERNQFEKLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP++ VQY L+WQ QAINS+IE+AI+EA+ KG KV SLGLLNQ EELN  G  Y+Q
Sbjct  361   QTWAIPKFNVQYFLQWQKQAINSMIEDAIVEADQKGCKVFSLGLLNQGEELNIYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+++++VDGSSLAVA+++ N+IPK  T+VLLR  L KV+ +++ +L QRGI+V    
Sbjct  421   RNPKLRVRVVDGSSLAVAVVL-NSIPKSATQVLLRGKLTKVAYALSYSLCQRGIQVAVLH  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++Y KL  + N+K   N VLS+ ++Q +WLVG+GLT EEQMKA KGT FIP SQ+PPK 
Sbjct  480   EEEYRKLNKSFNTKFESNPVLSKGYSQNIWLVGDGLTNEEQMKAPKGTTFIPFSQLPPKI  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM AP S+ N+H+CENWLPRR MSA R++G+VHA+EGW  HECG  M +
Sbjct  540   VRKDCFYHCTPAMKAPRSIENVHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYTMSN  599

Query  427   IDKVWEAALSHGFRPLPLP  371
             ID+VW+A L HGF+P+  P
Sbjct  600   IDQVWKATLRHGFQPVTTP  618



>ref|XP_009376850.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=620

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/615 (64%), Positives = 498/615 (81%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKY++++PWV HS   F+ +   ERD T FLI P +L RM+H
Sbjct  1     MASMPGILTDWPWKPLGSFKYLIMAPWVIHSTLLFMVNGGKERDITYFLIFPLMLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR+RTA G  RI+DK +EF+QVDRE NWDDQ++ NG L YL N + +    +P
Sbjct  61    NQIWITLSRYRTAKGNGRILDKGLEFDQVDRERNWDDQILFNGALMYLSNRLFSGAQNVP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+ T+ +H GPVE++YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVSTILLHAGPVEYLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y LLF++P+L T+F GT S  SL+GY TYID MNNMGHCNFE IP  LFS+FPPLKY
Sbjct  181   HIVYSLLFSMPMLATVFMGTVSVISLVGYHTYIDFMNNMGHCNFELIPNCLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+YGT+D STD+LYETSLKR EESPD++HLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYVYGTIDNSTDSLYETSLKREEESPDILHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A++P +  WY+WLMWPVTLW M++  I G+TF+++R    K++L
Sbjct  301   TTPESIYHLPLGFASLASIPHTSKWYLWLMWPVTLWYMVLTRICGRTFVVERQCFNKLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y +QY   +Q  AINSLIEEAI++AE +GVKV+SLGLLNQ E+LNR G  Y+Q
Sbjct  361   QTWVIPKYTLQYYFRFQKGAINSLIEEAIVQAEKRGVKVISLGLLNQGEDLNRYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KIK+VDGSSLAVA+I++ +IPKGTT+V+ R NL KV+ ++A AL Q+GI+V T  
Sbjct  421   RHPHLKIKVVDGSSLAVAVILS-SIPKGTTQVVFRGNLTKVAYALAFALYQKGIQVATLH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             ED+Y KL K  + ++ + VL+ S+  KVWLVG+GLT++EQ+ A +GTLF+P SQ+PPKK 
Sbjct  480   EDEYLKLTKSLSATESSLVLAESYAHKVWLVGDGLTEKEQLSAPRGTLFVPFSQLPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  P SL N+++CENWLPRR MSA R++GIVHALEGW  HECG  M D 
Sbjct  540   RKDCFYHYTPAMKIPTSLENVYSCENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSDT  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A+L HGF PL
Sbjct  600   DKVWQASLRHGFHPL  614



>ref|XP_006361513.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/617 (65%), Positives = 502/617 (81%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESER-DYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+V  S+ S +  E+  + D    +I PFLL RML
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIQSLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRI+DK IEF+QVDRE NWDDQ++LNGLLFY     L +   L
Sbjct  61    HNQIWISLSRYRTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR+DG+++T  +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYFLLF+IP+LTT+ T TAS  S  GY+TYID MNNMGHCNFE IPKW+FS FPPLK
Sbjct  181   EHIAYFLLFSIPLLTTVLTKTASIVSFGGYITYIDFMNNMGHCNFEIIPKWMFSTFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+DKS+DTLYE SL+R  +SPDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTLDKSSDTLYEKSLERQGKSPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF+++A+ P +  WY WLMWP+TLW+M++  IYG TF ++RN+ + + 
Sbjct  301   LTTPESIYHLRLGFASFASEPYTSKWYFWLMWPITLWSMMVTWIYGHTFTVERNVFKNLN  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y+VQY ++WQ + IN+LIEEAI+EA+ KG+KVLSLGLLNQ E+LN NGE YI
Sbjct  361   LQTWAIPKYRVQYFMQWQRETINNLIEEAIMEADKKGIKVLSLGLLNQDEKLNNNGEVYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+KLVDGSSLAVA+++ N+IPKGTT+V+L   L+KV+ +IA AL Q G+KV+  
Sbjct  421   RRHPQIKVKLVDGSSLAVAVVL-NSIPKGTTQVVLGGQLSKVANAIALALCQGGVKVMAL  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y+KLK  L T +  N + S+++  K+WLVG+GL ++EQ+KA KGTLFIP SQ PP+
Sbjct  480   REEEYKKLKSNLTTEAAINLLPSKTYNSKIWLVGDGLNEDEQLKAPKGTLFIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y H PAM+ P    N+ +CENWLPRR MSA R++GI+HALE W  HECG  M 
Sbjct  540   KTRKDCFYFHTPAMITPKHFENVDSCENWLPRRVMSAWRMAGILHALEDWQEHECGNMMF  599

Query  430   DIDKVWEAALSHGFRPL  380
             DI+KVW+A+L HGF+P+
Sbjct  600   DIEKVWKASLVHGFQPI  616



>ref|XP_006357723.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/617 (65%), Positives = 504/617 (82%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESER-DYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+V  S+ S +  E+  + D    +I PFLL RML
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIQSLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRI+DK IEF+QVDRE NWDDQ++LNGLLFY     L +   L
Sbjct  61    HNQIWISLSRYRTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR+DG+++T  +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYFLLF+IP+LTT+ T TAS  S  GY+TYID MNNMGHCNFE IPKW+FS FPPLK
Sbjct  181   EHIAYFLLFSIPLLTTVLTKTASIVSFGGYITYIDFMNNMGHCNFEIIPKWMFSTFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+DKS+DTLYE SL+R  +SPDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTLDKSSDTLYEKSLERQGKSPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF+++A+ P +  WY WLMWP+TLW+M++  IYG TF ++RN+ + + 
Sbjct  301   LTTPESIYHLRLGFASFASEPYTSKWYFWLMWPITLWSMMVTWIYGHTFTVERNVFKNLN  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y+VQY ++WQ ++IN+LIEEAI+EA+ KG+KVLSLGLLNQ E+LN NGE YI
Sbjct  361   LQTWAIPKYRVQYFMQWQRESINNLIEEAIMEADQKGIKVLSLGLLNQDEKLNNNGEVYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+KLVDGSSLAVA+++ N+IPKGTT+V+L  +L+KV+ SIA AL Q G+KV+  
Sbjct  421   RRHPQIKVKLVDGSSLAVAVVL-NSIPKGTTQVVLGGHLSKVANSIALALCQGGVKVMAL  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y+KLK  L   +  N + S+++  K+WLVG+GL ++EQ+KA KGTLFIP SQ PP+
Sbjct  480   REEEYKKLKSNLTPEAAINLLPSKTYNSKIWLVGDGLNEDEQLKAPKGTLFIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y H PAM+ P    N+ +CENWLPRR MSA R++GI+HALE W+ HECG  M 
Sbjct  540   KTRKDCFYFHTPAMITPKHFENVDSCENWLPRRVMSAWRIAGILHALEDWHEHECGNMMF  599

Query  430   DIDKVWEAALSHGFRPL  380
             DI+KVW+A+L HGF+P+
Sbjct  600   DIEKVWKASLDHGFQPI  616



>ref|XP_008344085.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=620

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/615 (64%), Positives = 498/615 (81%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKY++++PWV HS   F+ ++  +RD    LI P +L RM+H
Sbjct  1     MASMPGILTDWPWKPLGSFKYLIMAPWVIHSTMLFMMNDGKDRDIAYILIFPLMLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR+RTA G  RI+DK +EF+QVDRE NWDDQ++ NG L YL N + +    +P
Sbjct  61    NQIWITLSRYRTAKGNGRILDKGLEFDQVDRERNWDDQILFNGTLMYLSNRLFSGAQNVP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+ T+ +H GPVE++YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVATILLHAGPVEYLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y LLF+IP+L T+F GTAS  SL+GY TYID MNNMGHCNFE IP  LFS+FPPLKY
Sbjct  181   HIVYSLLFSIPMLATVFMGTASVISLVGYHTYIDFMNNMGHCNFELIPNCLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+YGTMD STD+LYETSLKR EESPD++HLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYVYGTMDNSTDSLYETSLKREEESPDILHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A++P +  WY+WLMWPVTLW M++  I G+TF+++R    K++L
Sbjct  301   TTPESIYHLPLGFASLASIPHTPKWYLWLMWPVTLWYMVLTRICGRTFVVERQRFNKLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y +QY   +Q +AIN LIEEAI++AE KGVKV+SLGLLNQ E+LNR G  Y+Q
Sbjct  361   QTWVIPKYTLQYNFRFQKEAINCLIEEAIVQAEKKGVKVISLGLLNQGEDLNRYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KIK+VDGSSLAVA+I+ N+IPKGTT+V+ R NL KV+ ++A AL Q+GI+V T  
Sbjct  421   RHPHLKIKVVDGSSLAVAVIL-NSIPKGTTQVVFRGNLTKVAYALAFALYQKGIQVATLH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             ED+Y KL K  + ++ + VL+ S+  K+WLVG+GLT++EQ+ A +GTLF+P SQ+PPKK 
Sbjct  480   EDEYLKLTKSLSATESSLVLAESYAHKIWLVGDGLTEKEQLSAPRGTLFVPFSQLPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  P SL N+++CENWLPRR MSA R++GIVHALEGW  HECG  M D 
Sbjct  540   RKDCFYHYTPAMKIPSSLENIYSCENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSDT  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A+L HGF PL
Sbjct  600   DKVWQASLRHGFHPL  614



>ref|XP_008438253.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=624

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/619 (64%), Positives = 500/619 (81%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLG FKYVVL+P   +S+Y ++  +E+ERD ++ +++P LL RM+H
Sbjct  1     MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVRDEAERDTSSLVVIPLLLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRHRTA G  RIVDK +EF+QVDRE NWDDQ++LNG+LFYL   + AKG  LP
Sbjct  61    NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVANLTAKGRNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YFLLFAIP+LT LFTGTAS S  + Y+TYID MNNMGHCNFE IP  LF++FPPLKY
Sbjct  181   HLTYFLLFAIPMLTVLFTGTASLSVYILYLTYIDFMNNMGHCNFEIIPNRLFTLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              +YTPS+HSLHHTQFRTNYSLFMP YDYIYGT+D S+D+LYE SLKR EE  DVV+LTHL
Sbjct  241   FLYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTLDNSSDSLYEKSLKREEEVADVVYLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF+  A+ P +  W+ W + P+T+ +M++  IYG+TF+++RN  EK+K+
Sbjct  301   TTPESIYHLRLGFADLASRPHTSTWFTWFLSPITIGSMLLTWIYGRTFVVERNQFEKLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP++ VQY L+WQ QAINSLIE+AI+EA+ KG KVLSLGLLNQ EELN  G  Y+Q
Sbjct  361   QTWAIPKFNVQYFLQWQKQAINSLIEDAIVEADQKGCKVLSLGLLNQGEELNIYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+++++VDGSSLAVA+++ N+IPK  T+VLLR  L KV+ +++ +L QRGI+V    
Sbjct  421   RNPKLRVRVVDGSSLAVAVVL-NSIPKSATQVLLRGKLTKVAYALSYSLCQRGIQVAVLH  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++Y KL  + N+K   + VLS+ ++Q +WLVG+GLT EEQMKA KGT FIP SQ+PP+ 
Sbjct  480   EEEYRKLNKSFNTKFESSPVLSKGYSQNIWLVGDGLTNEEQMKAPKGTTFIPFSQLPPRI  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM AP S+ N+H+CENWLPRR MSA R++G+VHA+EGW  HECG  M +
Sbjct  540   VRKDCFYHCTPAMKAPRSIENVHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYTMSN  599

Query  427   IDKVWEAALSHGFRPLPLP  371
             ID+VW+A L HGF+P+P P
Sbjct  600   IDQVWKATLRHGFQPVPTP  618



>ref|XP_009787252.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=590

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/617 (63%), Positives = 477/617 (77%), Gaps = 40/617 (6%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSE-ESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+V HSL SF  SE ES+RD T  +I PFLL RML
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPYVTHSLNSFFMSEDESKRDMTYLIIFPFLLFRML  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVDK IEF+Q+DRE NWDDQ++LNGLLFY   T L +   +
Sbjct  61    HNQIWISVSRYRTAKGDNRIVDKTIEFDQIDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG++MT  +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSS+ TEPITSVIHPF 
Sbjct  121   PIWRTDGIIMTALLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSVATEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAYFLLFAIP+LTT+ TGTAS  S  GY+TYID MNNMGHCNFE IPKW+FS FPPLK
Sbjct  181   EHIAYFLLFAIPLLTTVLTGTASIVSFGGYITYIDFMNNMGHCNFEIIPKWMFSSFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLYE SL+R  +SPD+VHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYIYDTLDKSSDTLYEKSLERQGKSPDMVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF+++A+ P +  WY WLMWPVTLW+M++  IYG TF ++RN+ + + 
Sbjct  301   LTTPESIYHLRLGFASFASEPYTSKWYFWLMWPVTLWSMMVTWIYGHTFTVERNVFKSLN  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++                                    Q E+LN NGE YI
Sbjct  361   LQTWAIPKYRI------------------------------------QEEQLNNNGELYI  384

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSLAVA+++ N+IPKGTT+V+L  +L+KV+ +IA AL Q G+KVVT 
Sbjct  385   RRHPELKVKVVDGSSLAVAVVL-NSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTL  443

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y+KLK  L      N V S+++  K+WLVG+GL+++EQ+KA KGTLFIP SQ PP+
Sbjct  444   REEEYKKLKSSLTPEVAANLVPSKTYASKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPR  503

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y H PAM+ P    N+ +CENWLPRR MSA RV+GI+HALEGWN HECG  M 
Sbjct  504   KARKDCLYFHTPAMITPKHFENVDSCENWLPRRVMSAWRVAGILHALEGWNEHECGNMMF  563

Query  430   DIDKVWEAALSHGFRPL  380
             DI+KVW+A+L HGF PL
Sbjct  564   DIEKVWKASLDHGFSPL  580



>ref|XP_011093465.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=624

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/616 (66%), Positives = 503/616 (82%), Gaps = 3/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LGNFKYVVL+PWV HS YS++T +ESERD +  LILP LLSR++H
Sbjct  1     MASKPGILTEWPWTRLGNFKYVVLAPWVVHSTYSYMTKDESERDLSYLLILPLLLSRVIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G NRIVDK IEFEQVDRE NWDDQ++L+G + YL +  +     LP
Sbjct  61    NQIWISLSRYRTAKGNNRIVDKSIEFEQVDRERNWDDQIILSGFVLYLGSRHIQAAHCLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+ T   H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVIWTFLFHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY+L+F++PVL TL     S  S+  Y+T+ID MNNMGHCNFE IPK LFS+FPPLKY
Sbjct  181   HIAYYLIFSLPVLFTLLMENTSILSITIYLTFIDFMNNMGHCNFEHIPKRLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHTQFRTNYSLFMPFYDY+YGTMDKS+D+LYE SL R  E+PDVVHL HL
Sbjct  241   LIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDSLYEKSLVREAEAPDVVHLIHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF+  A+ PQ + WY+WLMWPVTLW+M+I  IYG+TF ++RN+ + +KL
Sbjct  301   TTPESIYHLRLGFACLASEPQKYKWYLWLMWPVTLWSMMITWIYGRTFTVERNVFKHLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++WQ ++INS+IE++I+EAE KGV+VL+LGLLNQ E LN NG+F+++
Sbjct  361   QTWAIPKYTIQYQMQWQRESINSMIEDSILEAEEKGVRVLTLGLLNQEEGLNGNGDFFLR  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K PK+K+KLVDGSSLAVA+++ N++PKGTT+VLLR  L+KV+ S A AL Q GI+V T+ 
Sbjct  421   KNPKLKVKLVDGSSLAVAVVL-NSVPKGTTQVLLRGKLSKVAYSTALALCQGGIQVYTTS  479

Query  781   EDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             ED+YEKL  KL+  +  N VLS+    K WLVG+ L+++EQ+KA+KGT FIP S+ PPKK
Sbjct  480   EDEYEKLKAKLSNEAGNNLVLSKHSAPKTWLVGDDLSEDEQIKASKGTTFIPFSRFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC Y   PAMLAP  L N+ +CENWLPRR MSA R++GI+HA+E WNVHECG  M D
Sbjct  540   ARKDCVYLSTPAMLAPKHLENVDSCENWLPRRVMSAWRIAGILHAMEEWNVHECGNMMFD  599

Query  427   IDKVWEAALSHGFRPL  380
             I+K+W+A+L+HGFRPL
Sbjct  600   IEKIWQASLAHGFRPL  615



>ref|XP_007220541.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
 gb|EMJ21740.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
Length=623

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/615 (64%), Positives = 494/615 (80%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWK LG+ KYV+L+PW+ HS + FV ++  ERD + FL+L  +L R++H
Sbjct  1     MASVPGILTEWPWKALGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLLLGVVLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+D+ +EFEQVDRE+NWDDQ++ N LLFY  +  L    +LP
Sbjct  61    NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGAQKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR  GVL+T+ +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121   LWRAHGVLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ Y  LF IP+L T+ T T S  S   Y+TYID MNNMGHCNFE IP WLFS+FPPLKY
Sbjct  181   HVVYSALFFIPILGTMLTRTLSVVSFTAYITYIDFMNNMGHCNFELIPNWLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLY+TSLKR EE+PDV+HLTHL
Sbjct  241   FMYTPSYHSLHHTQFRTNYSLFMPIYDYIYETIDKSSDTLYKTSLKREEETPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A+ P +  WY+WLMWPVTLW+MI+  IYG+TF+++R   + + L
Sbjct  301   TTPESIYHLPLGFASLASQPHTSKWYLWLMWPVTLWSMILTWIYGRTFVVERQRFDNLIL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY L+WQ++AINSLIEEAII+AE KGVKVL LGLLNQ EELNR G  Y+ 
Sbjct  361   QTWAIPKYNLQYYLQWQNEAINSLIEEAIIQAEEKGVKVLCLGLLNQGEELNRYGGVYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KI++VDGSSLAVAI + NTIPKGTT+VLLR NL KV+ ++A AL Q+GI++ T  
Sbjct  421   RHPHLKIRIVDGSSLAVAITL-NTIPKGTTQVLLRGNLTKVAHAVAFALCQKGIQITTLH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              D+Y KL K  +  + + VL++S+  K+WLVG+GL++EEQ++A KGTLF+P SQ PPKK 
Sbjct  480   HDEYLKLTKSLSGMESSLVLAKSYAHKIWLVGDGLSEEEQLRAPKGTLFVPFSQFPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  PPSL N+HACENWLPRR MSA R++GIVHALEGW  HECG  M +I
Sbjct  540   RKDCFYHYTPAMKTPPSLENVHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYNMSNI  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A L HGF+PL
Sbjct  600   DKVWQATLQHGFQPL  614



>ref|XP_008245903.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Prunus mume]
Length=624

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/615 (65%), Positives = 499/615 (81%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWK LG+ KYV+L+PWV HS + FV ++  ERD + FL+L  +L R++H
Sbjct  1     MASVPGILTEWPWKRLGSLKYVILAPWVIHSTWLFVANDAKERDVSYFLMLGVVLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA G  RI+D+ +EFEQVDRE+NWDDQ++ N LLFY  +  L  G   P
Sbjct  61    NQIWISLSRYQTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR +G+L+T+ +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121   FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y  LF+IP+L T+ T T S  S   Y+TYID MNNMGHCNFE IP WLFS+FPPLKY
Sbjct  181   HIVYSALFSIPILGTVVTRTQSLVSFTAYITYIDFMNNMGHCNFELIPNWLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIY TMDKS++ LYETSLKR EE+PDV+HLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYRTMDKSSNALYETSLKREEETPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A+ P + N Y+WLMWPVTLW+MI+  IYG+TF++DR+  + +KL
Sbjct  301   TTPESIYHLPLGFASLASRPYTSNRYLWLMWPVTLWSMILTWIYGRTFVVDRHRFDNLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++W+++AIN LIEEAII+AE KGVKVL LGLLNQ EELNR G  Y+ 
Sbjct  361   QTWAIPKYSLQYYMQWKNEAINRLIEEAIIQAEEKGVKVLCLGLLNQGEELNRYGGLYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KI++VDGSSLAVAI + NTIPKGTT+VLLR NL KV+ ++A AL Q+GI+VVT  
Sbjct  421   RHPNLKIRVVDGSSLAVAITL-NTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVVTLH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             +D+Y KL K  ++++ + VL++S+  K+WLVG+GLT+EEQ++A KGTLFIP S  PPKK 
Sbjct  480   KDEYLKLTKSFSSTESSLVLAKSYAHKIWLVGDGLTEEEQLRAPKGTLFIPFSHFPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+PPAM  P SL N+HACENWLPRR MSA R++GIVHALEGW  HECG  M +I
Sbjct  540   RKDCFYHYPPAMKTPTSLENIHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSNI  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A + HGF+PL
Sbjct  600   DKVWQATIQHGFQPL  614



>ref|XP_011005107.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/617 (65%), Positives = 497/617 (81%), Gaps = 6/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK V+L+PWV HS YSF+  +E  +D + FL+   LL RM+H
Sbjct  1     MASRPGILTDWPWKPLGSFKRVILAPWVIHSTYSFMVKDE--KDLSTFLMFLILLWRMIH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
              QLWIS SR+RTA G NRI+DK IEF+QVDRESNWDDQ++ NG+L Y+   ++   S LP
Sbjct  59    TQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILLYVGRKIIPGASYLP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  IH+GPVEF+YYWLHR LHHH+LYSRYHSHHHSSIVT  ITS IHPF E
Sbjct  119   IWRLDGVILTALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTGAITSAIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+Y +LF IP++TT   GTAS +S+ GY+TYID MNNMGHCNFEF+P+ LF IFP LKY
Sbjct  179   HISYSMLFMIPLITTAVMGTASEASIAGYITYIDFMNNMGHCNFEFVPRRLFIIFPHLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD S+ TLYE SLKR EE+PDVVHLTHL
Sbjct  239   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDTSSVTLYEDSLKRPEEAPDVVHLTHL  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLG ++ A+ PQ   WY+WLMWPVT WTM++  IYG+TF+++RN   K++L
Sbjct  299   TTPDSIYHLRLGLASLASNPQESKWYLWLMWPVTWWTMMLTWIYGRTFVVERNRFHKLRL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P+Y +QY L  Q  +IN+LIEEA++EAE KG KVLSLGLLNQ EELNR GE Y+Q
Sbjct  359   QTWTLPKYNIQYNLRRQKVSINTLIEEAVLEAEEKGAKVLSLGLLNQGEELNRYGELYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +K K+VDGSSLAVA ++ N+IPKG+T+VL R NL+KV+ ++A  L QRGI+VV  C
Sbjct  419   RHPSLKTKVVDGSSLAVAAML-NSIPKGSTQVLHRGNLSKVAYAVALNLCQRGIQVVVPC  477

Query  781   EDDYEKLKLA---TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             EDDY+KLK +   T+ + N +LS+S++ K WLVG+GL +E+Q KA +GTLFIP SQ PPK
Sbjct  478   EDDYQKLKKSFGITSDQNNLILSKSYSIKTWLVGDGLKEEDQKKAAEGTLFIPFSQFPPK  537

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC YH  PAM AP SL N+ +CENWLPRR MSA RV+GIVHALEGW+ HECG  M 
Sbjct  538   KLRKDCFYHSIPAMAAPASLENVDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMA  597

Query  430   DIDKVWEAALSHGFRPL  380
             +IDKVW+A++ HGF+PL
Sbjct  598   NIDKVWQASIQHGFKPL  614



>gb|KHG03871.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=599

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/620 (61%), Positives = 480/620 (77%), Gaps = 29/620 (5%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY++L PWV  +++S +  +  E D TNF ++PF+L RMLH
Sbjct  1     MASKPGILTDWPWTPLGSFKYIILGPWVMETIHSIMVKDPQEWDLTNFTVIPFMLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS+SR+RTA G NRIVDK IEF+QVDRE NWDDQ++ NG+LF+L N  +   S LP
Sbjct  61    NQLWISFSRYRTAKGTNRIVDKGIEFDQVDREKNWDDQILFNGILFFLANKYVPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +HVGPVEF+YYW HRALHHH+LY                + VIHPF E
Sbjct  121   LWRTDGVIITMLLHVGPVEFLYYWFHRALHHHYLY----------------SPVIHPFAE  164

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YF LFAIP+LT + T T S  ++ GY+TYIDLMNNMGHCNFE IP W+FSIFPPLKY
Sbjct  165   HIVYFALFAIPMLTVVLTETGSIIAIAGYITYIDLMNNMGHCNFELIPNWVFSIFPPLKY  224

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE SLKR EE+P+VVHLTHL
Sbjct  225   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYDTMDKSSDILYENSLKRKEETPNVVHLTHL  284

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ P S  WY+WL+WPVTLW+M++  IY +T +++RN   +++L
Sbjct  285   TTPESIYHLRLGFASLASKPYSSAWYLWLLWPVTLWSMVLTRIYRRTLVVERNRFHQLRL  344

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY L+WQ +++N++IEEA++EAE KG            EELNR GE Y++
Sbjct  345   QTWAIPKYGIQYRLKWQKESVNNMIEEAVLEAEEKGA---------SGEELNRYGEVYVK  395

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++K+KLVDGSSLAVA+++ N+IPKGTT+VLLR +L KV+ ++A AL Q+GI+V    
Sbjct  396   KHPQLKVKLVDGSSLAVAVLL-NSIPKGTTQVLLRGHLTKVAFAVAFALCQKGIQVTILR  454

Query  781   EDDYEKL--KLATNSKGNFVLSRSFTQ-KVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             ED+YEKL   L T S+G  V S+S++  KVW VG+ LT+EEQ KA KGTLFIP SQ+PPK
Sbjct  455   EDEYEKLDKSLGTKSEGKLVTSKSYSSCKVWFVGDDLTEEEQRKANKGTLFIPFSQLPPK  514

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC YH  PAM  P +L N+ +CENWLPRR MS  R++GI+HALEGW  HECG  M 
Sbjct  515   KLRKDCFYHTTPAMQTPTALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECGYTMS  574

Query  430   DIDKVWEAALSHGFRPLPLP  371
             +IDKVWEA L HGF+PL +P
Sbjct  575   NIDKVWEACLKHGFQPLKVP  594



>ref|XP_007041185.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOX97016.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=612

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/619 (64%), Positives = 491/619 (79%), Gaps = 12/619 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSE-ESERDYTNFLILPFLLSRML  2045
             MAT PG LTDWPWK LGNFKY +L+PWV HS YS + S+ E E + T  LI PFL++R+L
Sbjct  1     MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLMSKGEKEANLTYHLIFPFLMTRVL  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA GKNRIVDK I+FEQVDRESNWDDQ++LNG+L YL N ++   S L
Sbjct  61    HNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMPGASHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR+DG ++ + +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSI TEPITSVIHPF 
Sbjct  121   PLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AYFLLFAIP++T +FTGTAS +++  Y+TYIDLMNNMGHCNFE +PKW+FS FPPLK
Sbjct  181   EEVAYFLLFAIPLMTVMFTGTASIAAIFIYITYIDLMNNMGHCNFELVPKWVFSTFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             +LMYTPSYHSLHHTQFRTNYSLFMP YDY+YGT+DKS+D LYETSLKR EESPD+VHLTH
Sbjct  241   FLMYTPSYHSLHHTQFRTNYSLFMPMYDYLYGTVDKSSDDLYETSLKRQEESPDIVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWL-MWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             LTT +S+Y +RLGF++ A+ P +  WY  + MWPV+ W+ +    YG TF+ + N    +
Sbjct  301   LTTTDSIYHLRLGFASLASKPYAFKWYFTIAMWPVSCWSAVFTWFYGHTFVSESNTFNNL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQSWV+PRY + YLL+ + + +N LIEEA++EA+ KG KV         EELN NGE Y
Sbjct  361   KLQSWVVPRYTMHYLLQREKKDLNYLIEEALLEADSKGAKV--------HEELNGNGELY  412

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             IQ++P+++I+LVDGSSLA A++V N+IP+ TT+VLL   ++KV  +IA AL Q+G++V  
Sbjct  413   IQRHPQLRIRLVDGSSLAAAVVV-NSIPQETTQVLLTGRISKVGYAIALALCQKGVQVAA  471

Query  787   SCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               ED+Y+KL+ +    G N VL+ ++ QK+WLVGEGLT +EQ+KATKGT+F+P +Q PPK
Sbjct  472   MNEDEYQKLQHSDCQFGKNLVLAENYDQKIWLVGEGLTDKEQLKATKGTVFVPFTQFPPK  531

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K  +DC YH  PAM+AP SL N+H+CENWL RR MSA RV+GIVH LEGWNVHECG+ M 
Sbjct  532   KLLKDCYYHTTPAMVAPKSLDNIHSCENWLARRVMSAWRVAGIVHGLEGWNVHECGQTMF  591

Query  430   DIDKVWEAALSHGFRPLPL  374
              +DKVWEA L HGF PL L
Sbjct  592   SMDKVWEATLLHGFCPLSL  610



>ref|XP_008232283.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=624

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/615 (65%), Positives = 498/615 (81%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW  LG+FK+V+L+PWV HS + FV ++  ERD + FLIL  +L R+LH
Sbjct  1     MASVPGILTDWPWTALGSFKHVILAPWVIHSTWLFVANDGKERDISYFLILALVLWRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+DK +EFEQVDRE+NWDDQ++ N LLFY  +  L  G   P
Sbjct  61    NQIWISLSRYRTAKGNGRILDKGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR +G+L+T+ +H GPVEF+YYW HRALHHH+LYSRY SHHHSSIVT+PITSVIHPF E
Sbjct  121   FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYQSHHHSSIVTQPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y  LF+IP+L T+ T T S  S   Y+TYID MNNMGHCNFE IP WLFS+FPPLKY
Sbjct  181   HIVYSALFSIPILGTVVTRTTSVVSFTAYITYIDFMNNMGHCNFELIPNWLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIY TMDKS++ LYETSLKR EE+PDV+HLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYRTMDKSSNALYETSLKREEETPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A+ P + N Y+WLMWPVTLW+MI+  IYG+TF++DR+  + +KL
Sbjct  301   TTPESIYHLPLGFASLASRPYTSNRYLWLMWPVTLWSMILTWIYGRTFVVDRHRFDNLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++W+++AIN LIEEAII+AE KGVKVL LGLLNQ EELNR G  Y+ 
Sbjct  361   QTWAIPKYSLQYYMQWKNEAINRLIEEAIIQAEEKGVKVLCLGLLNQGEELNRYGGLYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KI++VDGSSLAVAI + NTIPKGTT+VLLR NL KV+ ++A AL Q+GI+VVT  
Sbjct  421   RHPNLKIRVVDGSSLAVAITL-NTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVVTLH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             +D+Y KL K  ++++ + VL++S+  K+WLVG+GLT+EEQ++A KGTLFIP S  PPKK 
Sbjct  480   KDEYLKLTKSFSSTESSLVLAKSYAHKIWLVGDGLTEEEQLRAPKGTLFIPFSHFPPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+PPAM  P SL N+HACENWLPRR MSA R++GIVHALEGW  HECG  M +I
Sbjct  540   RKDCFYHYPPAMKTPTSLENIHACENWLPRRVMSAWRIAGIVHALEGWKEHECGYTMSNI  599

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A + HGF+PL
Sbjct  600   DKVWQATIQHGFQPL  614



>ref|XP_009760058.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=622

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/619 (64%), Positives = 501/619 (81%), Gaps = 4/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGNFKY++L+P+V HS+YSF+ S +ES+RD +   ILP+LLSRM+
Sbjct  1     MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+W S SR+RTA G NRI+DK IEF+QVDRE+NWDDQ++LNG++FY+      +   L
Sbjct  61    HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  +H+GPVEF+YYWLHRA HHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY  LF IP+ TTLFTGTAS +SL  Y TYID MN MGHCNFE IPKW+FS+FPPLK
Sbjct  181   EIVAYLTLFLIPMTTTLFTGTASIASLGAYTTYIDFMNYMGHCNFELIPKWMFSMFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTP++HSLHHTQFRTNYSLF+P YD++YGT+DKS DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLMYTPTFHSLHHTQFRTNYSLFVPMYDHLYGTVDKSLDTLYEKSLERKAELPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WY+ LMWPVTLW+  I  IYGQTF+++RN+   IK
Sbjct  301   LTTPESIYHLRLGFASLASRPHASKWYILLMWPVTLWSFFITWIYGQTFVVERNLFRNIK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W I +Y+ QY ++ Q   IN+LIEEAI+EA+ KG+KVLSLGLLNQ E+LN NGE YI
Sbjct  361   LQTWAILKYRKQYFMQGQRDTINNLIEEAIMEADQKGIKVLSLGLLNQEEQLNNNGELYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K P++K+K+VDGSSL VA+++ N+IPKGT++V+LR  L+KVS SIA  L QRGI+V+  
Sbjct  421   RKNPQLKVKVVDGSSLVVAVVL-NSIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVIML  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E++Y++LK  L   +  N V S+++  K+WLV +GL+++EQ+KA KGTL+IP SQ PP+
Sbjct  480   DEEEYKRLKARLTPEAATNLVQSKTYLPKIWLVDDGLSEDEQLKAPKGTLYIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R++C Y + PAML P  L N+ +CENWLPRR MSA R++GI+HALEGWN HECG+ M 
Sbjct  540   KVRKNCFYFNTPAMLTPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWNEHECGDMML  599

Query  430   DIDKVWEAALSHGFRPLPL  374
             DI+K W+A+L HGFRPL +
Sbjct  600   DIEKAWKASLDHGFRPLKM  618



>ref|XP_009793428.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=627

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/622 (65%), Positives = 507/622 (82%), Gaps = 5/622 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYS-FVTSEESERDYTNFLILPFLLSRML  2045
             MA+ PG LTDWPW  LGNFKY+VL+P+V HS+Y+ F++ +ES+RD    +ILP LLSR++
Sbjct  1     MASKPGILTDWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIIYIIILPLLLSRVI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVD+ IEF+QVDRESNWDDQ++ NGL++Y+   +L +   L
Sbjct  61    HNQIWISLSRYRTARGNNRIVDRSIEFDQVDRESNWDDQIIFNGLIYYIGYLLLEQAHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++   +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSI TEPITSVIHPF 
Sbjct  121   PLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHI+YF+LFAIP+LT   TGTAS ++  GY+TYID MNNMGHCNFE IPKW+FS+FPPLK
Sbjct  181   EHISYFMLFAIPLLTVTLTGTASITAFGGYITYIDFMNNMGHCNFELIPKWIFSMFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+D LYE SL+R  E PDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYIYDTLDKSSDILYEKSLEREAEVPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLG ++ A+ PQS  WY WLMWPVTLW+++I  I G TFI++RN+ + +K
Sbjct  301   LTTPESIYHLRLGLASLASKPQSSKWYFWLMWPVTLWSIMITWINGHTFIVERNLFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++QY ++WQ + IN+LIEEAI+EA+ KG+KVLSLGLLNQ E+LN +GE YI
Sbjct  361   LQTWAIPKYRIQYFMKWQRETINNLIEEAIMEADEKGIKVLSLGLLNQEEKLNSSGELYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             ++ P++K+K+VDGSSLAVA+++ N+IPKGT++V+ R  L+KV+ SIA AL Q GI+VVT 
Sbjct  421   RRNPQLKVKVVDGSSLAVAVVL-NSIPKGTSQVVFRGRLSKVAYSIALALCQGGIQVVTL  479

Query  784   CEDDYEKL--KLATNSKGNFVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
              E++Y++L  KL   +    VLS+S+   K WLVG+GL+++EQ+KA KGTLFIP SQ PP
Sbjct  480   DEEEYKRLKTKLTPEAATKLVLSKSYNVSKTWLVGDGLSEDEQLKAPKGTLFIPYSQFPP  539

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
              K R+DC Y   PAM+ P  L N+ +CENWLPRR MSA R++GI+HALEGW  HECG  M
Sbjct  540   SKARKDCFYFSTPAMITPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWKEHECGNMM  599

Query  433   CDIDKVWEAALSHGFRPLPLPN  368
              DIDKVW+A+L HGF PL L +
Sbjct  600   FDIDKVWKASLDHGFCPLTLAS  621



>ref|XP_009625188.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=626

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/619 (63%), Positives = 497/619 (80%), Gaps = 4/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSF-VTSEESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGNFKY++L+P+V HS+YSF +  +ES+RD    +ILP LLSR++
Sbjct  1     MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFFMGKDESQRDIAYIIILPLLLSRVI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RT  G NRI+DK IEF+QVDRE NWDDQ++LNG++FY+      +   L
Sbjct  61    HNQIWISLSRYRTTKGDNRILDKSIEFDQVDRERNWDDQIILNGMVFYVAYLKFQQTHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PLWRTDGIIITALMHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E IAY+ LF IP +TT FTGTAS ++   Y+TY+D MNNMGHCNFE IPKW+FS+FPPLK
Sbjct  181   EIIAYYTLFLIPGVTTFFTGTASIAAFGAYITYVDFMNNMGHCNFELIPKWMFSMFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YL+YTPSYHSLHHTQFRTNYSLFMP YDY+YGT+DKS+DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLIYTPSYHSLHHTQFRTNYSLFMPMYDYLYGTVDKSSDTLYEKSLERKAELPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTT ES+Y +RLGF++ A+ P +  WY WLMWPVTLW+  I  IYGQTF+++RN+   +K
Sbjct  301   LTTLESIYHLRLGFASLASTPHASKWYFWLMWPVTLWSFFITWIYGQTFVVERNLFRNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y+ QY ++ Q   IN+LIEEAI+EA+ KG+KVLSLGLLNQ EELN NGE YI
Sbjct  361   LQTWAIPKYRKQYFMQGQRDTINNLIEEAIMEADLKGIKVLSLGLLNQEEELNNNGELYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSL VA+++ N IPKGT++V+LR  L+KVS SIA  L QRGI+VV  
Sbjct  421   RRHPQLKVKVVDGSSLVVAVVL-NNIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVVML  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               +++++LK  L      N VLS++   K+WLVG+ L+++EQ+KA KGTLFIP SQ PP+
Sbjct  480   DGEEFKRLKARLTPKVATNLVLSKTNASKIWLVGDRLSEDEQLKAPKGTLFIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y   PAM  P  L N+ +CENWLPRR MSA+R++GI+H LEGWN +ECG  M 
Sbjct  540   KARKDCIYFSTPAMTIPKQLENVDSCENWLPRRVMSASRIAGILHTLEGWNENECGNMMF  599

Query  430   DIDKVWEAALSHGFRPLPL  374
             DI++VW+A+L HGFRPL +
Sbjct  600   DIERVWKASLDHGFRPLTM  618



>gb|AAB87721.1| maize gl1 homolog [Arabidopsis thaliana]
Length=625

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/625 (64%), Positives = 496/625 (79%), Gaps = 8/625 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PW  HS Y FVT +  +RD   FL+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T++GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY+   +LA+G +LP
Sbjct  61    NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLAEGKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   IH GPVEF+YYW+H+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMGALIHTGPVEFLYYWVHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS  S  GY+ YID MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFILFAIPLLTTLVTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD+STDTLYE +L+RG++  DVVHLTHL
Sbjct  241   LCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGDDRVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G  ++A+ P ++ W++ L+WP T  +MI    Y + F+ +RN   K+ L
Sbjct  301   TTPESIYHLRIGLPSFASYPFAYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFNKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY +QYLL+W+ +AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
              +P MK++LVDGS LA A+++ N++PK TT V++  NL KV+ +IASAL QRG++V T  
Sbjct  421   NHPDMKVRLVDGSRLAAAVVI-NSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLKLATNSKGN----FVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+YEK++     +      ++ S +  + KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  480   LDEYEKIRSCVPQECRDHLVYLTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ R DC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW  HECG  
Sbjct  540   LKQLRSDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWETHECGTS  599

Query  436   --MCDIDKVWEAALSHGFRPLPLPN  368
               + D+DKVWEA LSHGF+PL LP+
Sbjct  600   LLLSDLDKVWEACLSHGFQPLLLPH  624



>ref|XP_009760057.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=623

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/620 (64%), Positives = 501/620 (81%), Gaps = 5/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGNFKY++L+P+V HS+YSF+ S +ES+RD +   ILP+LLSRM+
Sbjct  1     MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+W S SR+RTA G NRI+DK IEF+QVDRE+NWDDQ++LNG++FY+      +   L
Sbjct  61    HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  +H+GPVEF+YYWLHRA HHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY  LF IP+ TTLFTGTAS +SL  Y TYID MN MGHCNFE IPKW+FS+FPPLK
Sbjct  181   EIVAYLTLFLIPMTTTLFTGTASIASLGAYTTYIDFMNYMGHCNFELIPKWMFSMFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTP++HSLHHTQFRTNYSLF+P YD++YGT+DKS DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLMYTPTFHSLHHTQFRTNYSLFVPMYDHLYGTVDKSLDTLYEKSLERKAELPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WY+ LMWPVTLW+  I  IYGQTF+++RN+   IK
Sbjct  301   LTTPESIYHLRLGFASLASRPHASKWYILLMWPVTLWSFFITWIYGQTFVVERNLFRNIK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEE-LNRNGEFY  968
             LQ+W I +Y+ QY ++ Q   IN+LIEEAI+EA+ KG+KVLSLGLLNQ EE LN NGE Y
Sbjct  361   LQTWAILKYRKQYFMQGQRDTINNLIEEAIMEADQKGIKVLSLGLLNQQEEQLNNNGELY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             I+K P++K+K+VDGSSL VA+++ N+IPKGT++V+LR  L+KVS SIA  L QRGI+V+ 
Sbjct  421   IRKNPQLKVKVVDGSSLVVAVVL-NSIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
               E++Y++LK  L   +  N V S+++  K+WLV +GL+++EQ+KA KGTL+IP SQ PP
Sbjct  480   LDEEEYKRLKARLTPEAATNLVQSKTYLPKIWLVDDGLSEDEQLKAPKGTLYIPFSQFPP  539

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             +K R++C Y + PAML P  L N+ +CENWLPRR MSA R++GI+HALEGWN HECG+ M
Sbjct  540   RKVRKNCFYFNTPAMLTPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWNEHECGDMM  599

Query  433   CDIDKVWEAALSHGFRPLPL  374
              DI+K W+A+L HGFRPL +
Sbjct  600   LDIEKAWKASLDHGFRPLKM  619



>ref|XP_011093466.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=620

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/621 (64%), Positives = 497/621 (80%), Gaps = 4/621 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LGNFKYVVL+PWV H+ YS+   EE ERD   FLILP LLSRMLH
Sbjct  1     MASRPGILTEWPWTWLGNFKYVVLAPWVVHATYSYTMKEEDERDVAYFLILPLLLSRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA G NRIVDK IEFEQV      DDQ++LNG+LFYL +  +    RLP
Sbjct  61    NQIWISLSRYQTAKGNNRIVDKSIEFEQVXXXXXXDDQIILNGILFYLGSRHMQAAHRLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV+ T   H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRADGVIWTFLFHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY+L+F++P+L TL  G AS  S+  Y+T++D MNNMGHCNFE IPK LFS+FPPLKY
Sbjct  181   HIAYYLIFSLPLLFTLLMGNASILSIASYLTFVDFMNNMGHCNFELIPKRLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHTQFRTNYSLFMPFYDY+YGT+DKS+D+LYE SL R  E+PDVVHLTHL
Sbjct  241   LIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTIDKSSDSLYEKSLLRKAEAPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF   A+ PQ   WY+WLMWPVTLW+MI+  IYG+ FI++RN+ + +KL
Sbjct  301   TTPESIYHLRLGFPYLASEPQKSKWYLWLMWPVTLWSMIVTWIYGRAFIIERNVFKHLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY ++ Q ++IN++IE++I+EAE KGVKVL+LGLLN    LN NGE +++
Sbjct  361   QTWAIPKYSIQYQIQSQRKSINNMIEDSILEAEKKGVKVLTLGLLNLDAGLNENGELFLR  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++K+KLVDGSSLAVA+++ N++PKGT +VLLR  L+KVS SIA AL +RGI+V T+ 
Sbjct  421   KHPELKLKLVDGSSLAVAVVL-NSVPKGTKQVLLRGKLSKVSSSIALALCKRGIQVYTTS  479

Query  781   EDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
              D+YEKL  KL   +  + VLS+  + K+WLVG+ L++ EQ+KA+KGT+FIP S  PPKK
Sbjct  480   GDEYEKLKAKLGNEAGNSLVLSKHNSPKIWLVGDDLSEVEQLKASKGTIFIPFSHFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R DC Y   PAMLAP  L N+ +CENWLPRR +SA R++GI+HALE WNVHECG  M D
Sbjct  540   TRNDCVYLSTPAMLAPKHLENVDSCENWLPRRVISAWRIAGILHALEEWNVHECGNMMFD  599

Query  427   IDKVWEAALSHGFRPLP-LPN  368
             I+++W+A+L+HGFRPL  +PN
Sbjct  600   IERIWQASLAHGFRPLTNVPN  620



>ref|XP_007218858.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
 gb|EMJ20057.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
Length=635

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/627 (63%), Positives = 495/627 (79%), Gaps = 14/627 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWK LG+ KYV+L+PW+ HS + FV ++  ERD + FL+L  +L R++H
Sbjct  1     MASVPGILTEWPWKALGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLLLGVVLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+D+ +EFEQVDRE+NWDDQ++ N LLFY  +  L    +LP
Sbjct  61    NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGAQKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR  GVL+T+ +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121   LWRAHGVLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ Y  LF IP+L T+ T T S  S   Y+TYID MNNMGHCNFE IP WLFS+FPPLKY
Sbjct  181   HVVYSALFFIPILGTMLTRTLSVVSFTAYITYIDFMNNMGHCNFELIPNWLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLY+TSLKR EE+PDV+HLTHL
Sbjct  241   FMYTPSYHSLHHTQFRTNYSLFMPIYDYIYETIDKSSDTLYKTSLKREEETPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A+ P +  WY+WLMWPVTLW+MI+  IYG+TF+++R   + + L
Sbjct  301   TTPESIYHLPLGFASLASQPHTSKWYLWLMWPVTLWSMILTWIYGRTFVVERQRFDNLIL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQS------------  998
             Q+W IP+Y +QY L+WQ++AINSLIEEAII+AE KGVKVL LGLLNQ+            
Sbjct  361   QTWAIPKYNLQYYLQWQNEAINSLIEEAIIQAEEKGVKVLCLGLLNQASLLFLFPFNFKG  420

Query  997   EELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASA  818
             EELNR G  Y+ ++P +KI++VDGSSLAVAI + NTIPKGTT+VLLR NL KV+ ++A A
Sbjct  421   EELNRYGGVYVHRHPHLKIRIVDGSSLAVAITL-NTIPKGTTQVLLRGNLTKVAHAVAFA  479

Query  817   LTQRGIKVVTSCEDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTL  641
             L Q+GI++ T   D+Y KL K  +  + + VL++S+  K+WLVG+GL++EEQ++A KGTL
Sbjct  480   LCQKGIQITTLHHDEYLKLTKSLSGMESSLVLAKSYAHKIWLVGDGLSEEEQLRAPKGTL  539

Query  640   FIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGW  461
             F+P SQ PPKK R+DC YH+ PAM  PPSL N+HACENWLPRR MSA R++GIVHALEGW
Sbjct  540   FVPFSQFPPKKLRKDCFYHYTPAMKTPPSLENVHACENWLPRRVMSAWRIAGIVHALEGW  599

Query  460   NVHECGEKMCDIDKVWEAALSHGFRPL  380
               HECG  M +IDKVW+A L HGF+PL
Sbjct  600   KEHECGYNMSNIDKVWQATLQHGFQPL  626



>ref|XP_010691968.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=620

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/616 (65%), Positives = 492/616 (80%), Gaps = 5/616 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA TPG LT WPW+ LGNFKYV+++P+  HS+Y +V   E +RD     I+PF+L RMLH
Sbjct  1     MAFTPGILTHWPWECLGNFKYVIVAPFAIHSIYLYVVGSE-DRDLGYLAIIPFMLWRMLH  59

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS+SR+RTA G N IVDK +EFEQVDRE NWDDQ++LN + FYL N  +     +P
Sbjct  60    NQIWISFSRYRTAKGNNLIVDKSLEFEQVDRERNWDDQILLNVIAFYLANRGMETAKNVP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              +R DG++    +H+GPVEF+YYWLHRALHHHFLYSRYHSHHH SIVTEPITSVIHPF E
Sbjct  120   FFRMDGLIYAFLLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHLSIVTEPITSVIHPFAE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YF LFAIP L+T    T+S  SL  YVTYIDLMNNMGHCNFE +PKWLFSIFPPLKY
Sbjct  180   HILYFTLFAIPTLSTTLARTSSIVSLALYVTYIDLMNNMGHCNFEIVPKWLFSIFPPLKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIYG+MDKSTDTL+ETSLK+ E+ PDVVHLTHL
Sbjct  240   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGSMDKSTDTLHETSLKKPEDIPDVVHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+SVY +RLGF+  A+ P +  WY+WLMWP+TLW+MI+  IYG+TFI++RN  +K+K 
Sbjct  300   TTPQSVYHLRLGFAALASEPLTSKWYLWLMWPLTLWSMILTWIYGRTFIIERNTFKKLKA  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IPRY + Y+L+WQ  AIN LIEEAI+EA+ KG+KV++LGLLNQ E LNR GE Y++
Sbjct  360   QAWAIPRYNIHYVLQWQRAAINKLIEEAILEADKKGIKVVTLGLLNQEEHLNRYGELYLE  419

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++PK+K+K+VDGSSLAVA+++ N+IPKGT++++ R  L+KV+ SI SAL  +GI+V T  
Sbjct  420   RHPKLKVKVVDGSSLAVAVVL-NSIPKGTSQIVFRGRLSKVAYSIVSALCHKGIQVSTLR  478

Query  781   EDDYEKLK--LATNSKGNFVLS-RSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               +YEKLK  L T    N  LS +S  QKVWLVGE LT+ EQ  A+KGT+FIP SQ PPK
Sbjct  479   SVEYEKLKNRLPTEDCNNLALSVKSCNQKVWLVGEDLTEHEQSMASKGTIFIPFSQFPPK  538

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R DC Y + P+++AP    NLH+CENWLPRR +SA RV+GI+HALEGWNV+ECG+ + 
Sbjct  539   KTREDCFYMNTPSLMAPKIFGNLHSCENWLPRRVISAWRVAGILHALEGWNVNECGDTII  598

Query  430   DIDKVWEAALSHGFRP  383
             DIDKVW A L HGFRP
Sbjct  599   DIDKVWGACLQHGFRP  614



>ref|XP_010691966.1| PREDICTED: protein ECERIFERUM 1-like [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/616 (65%), Positives = 495/616 (80%), Gaps = 5/616 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT WPW+PLG+FKYV+++P++ HS+Y +V   E ERD T   ++PF+L RMLH
Sbjct  1     MASKPGILTHWPWEPLGSFKYVIVAPFLVHSIYLYVVGAE-ERDLTYIAVVPFMLWRMLH  59

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS+SR+RTA G N IVD+ +EFEQVDRE NWDDQ++LNG+LFY    VL     LP
Sbjct  60    NQIWISFSRYRTAKGNNLIVDRSLEFEQVDRERNWDDQILLNGMLFYAGYWVLEAAKSLP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG +    +H+GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  120   LWRFDGFIQIFLLHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YF+LFAIP+L+T F  T+S  S+  Y+TYIDLMNNMGHCNFE IPKW+F+IFPPLKY
Sbjct  180   HIVYFILFAIPILSTTFVHTSSIGSIFIYITYIDLMNNMGHCNFEVIPKWVFTIFPPLKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLK+ E+ PDVVHLTHL
Sbjct  240   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKKPEDIPDVVHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+SVY +RLGF+  A+ P +  WY+WLMWP+TLW+MI+  I G+TFI +RN  +K+K 
Sbjct  300   TTPQSVYHLRLGFAELASKPLTTKWYLWLMWPLTLWSMILTWINGRTFINERNTFKKLKA  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWV+PR+K+ YLL+WQ  AIN LIEEAIIEAE KG+KV+SLGLLNQ E+ N+NGE Y+Q
Sbjct  360   QSWVVPRFKIHYLLQWQRAAINKLIEEAIIEAEEKGIKVVSLGLLNQGEQFNKNGEIYMQ  419

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P +K+K+VDGSSLAVA+++ N+IP GT++VL R  L+KV+ SI   L  RGI+V T  
Sbjct  420   KHPNLKVKVVDGSSLAVAVVL-NSIPVGTSQVLFRGRLSKVAYSIVCTLCHRGIQVATIR  478

Query  781   EDDYEKLK--LATNSKGNFVL-SRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             + +YEKLK  L      N  L S+   QKVW+VGE L ++EQ  A+KGT+FIP +Q PPK
Sbjct  479   KVEYEKLKKALTVEDGSNLALSSKGCNQKVWIVGEDLNEQEQSMASKGTIFIPFTQFPPK  538

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y + P+M+AP    NLH+CENWLPRR +SA RV+GI+H LEGW+V+E G+++ 
Sbjct  539   KTRKDCFYLNTPSMVAPTCFGNLHSCENWLPRRVISAWRVAGILHGLEGWDVNEWGDRLF  598

Query  430   DIDKVWEAALSHGFRP  383
             D+DKVWEA+  HGFRP
Sbjct  599   DVDKVWEASFQHGFRP  614



>ref|XP_008232262.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/615 (64%), Positives = 488/615 (79%), Gaps = 2/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+ KYV+L+PW+ HS + FV ++  ERD + FL+L  +L R++H
Sbjct  1     MASVPGILTEWPWKPLGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLMLGVVLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+D+ +EFEQVDRE+NWDDQ++ N LLFY  +  L  G   P
Sbjct  61    NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR +G+L+T+ +H GPVEF+YYW HRALHHH+LYSRY SHHHSSIVT+PITSVIHPF E
Sbjct  121   FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYQSHHHSSIVTQPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ Y  LF IP+L T+ T T S +S  GYVTYID MNNMGHCNFE IP WLFS+FPPLKY
Sbjct  181   HMVYSALFFIPILATILTRTTSMASFAGYVTYIDFMNNMGHCNFELIPNWLFSLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPSYHSLHHTQFRTNYSLFMP YDYIY TMDKS+D LYETSLKR EE+PDV+HLTHL
Sbjct  241   FMYTPSYHSLHHTQFRTNYSLFMPIYDYIYETMDKSSDALYETSLKREEETPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF++ A+ P +  WY+ LMWPVTLW+MI+  IYG+TF+++R   + ++L
Sbjct  301   TTPESIYHLPLGFASLASRPHTSKWYLRLMWPVTLWSMILTWIYGRTFVVERQRFDNLRL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY L+WQ++AINSLIEEAII+AE KGVKVL LGLLNQ EELNR G  Y+ 
Sbjct  361   QTWAIPKYNLQYYLQWQNEAINSLIEEAIIQAEEKGVKVLCLGLLNQGEELNRYGGLYVH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P +KI++VDGSSLAVAI + NTIPKGTT+VLLR NL KV+ ++A AL Q+GI+V    
Sbjct  421   RHPHLKIRVVDGSSLAVAITL-NTIPKGTTQVLLRGNLTKVAYAVAFALCQKGIQVTILH  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              D+Y KL K  +  +   VL++S+  K+WLVG+GL++EEQ++A KGTLF+P SQ  PKK 
Sbjct  480   HDEYLKLTKSLSGMESGLVLAKSYAHKIWLVGDGLSEEEQLRAPKGTLFVPFSQFAPKKL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM  P SL N+H CENWLPRR MSA R++GIVHALEG   HECG  M +I
Sbjct  540   RKDCFYHYTPAMKTPTSLENVHTCENWLPRRVMSAWRIAGIVHALEGRKEHECGYNMSNI  599

Query  424   DKVWEAALSHGFRPL  380
             D VW+A L HGF+PL
Sbjct  600   DNVWQATLQHGFQPL  614



>ref|XP_010052746.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW76818.1| hypothetical protein EUGRSUZ_D01172 [Eucalyptus grandis]
Length=627

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/620 (64%), Positives = 490/620 (79%), Gaps = 4/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG FKY+VL+PWV HS Y FV SE  ERD   FLI PFLL RM+H
Sbjct  1     MASKPGLLTDWPWKPLGIFKYMVLAPWVIHSTYVFVNSEGRERDLFTFLIFPFLLWRMVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+W++ SR+R A G  RI+DK IEF QVDRE NWDDQ++LNGL+FY+    L   SRLP
Sbjct  61    NQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGASRLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV+ T  +H+GPVEF+YYWLHRALHHH+LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYF LFAIP+ TT++ GTAS  S  GYVTYIDLMNNMGHCNFE IPKW+FS FPPLKY
Sbjct  181   HLAYFTLFAIPLYTTVWMGTASIVSFYGYVTYIDLMNNMGHCNFELIPKWIFSYFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTN SLFMPFYDYIYGTMDKS+D L+ETSL+R  E  DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNCSLFMPFYDYIYGTMDKSSDKLHETSLERLAEVSDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
              TP S+Y +R+GF++ A+ P +S  WY+WL+WPVTL +M+   IYG+TF+++R+   K+K
Sbjct  301   PTPGSIYHLRVGFASLASWPDRSSRWYLWLIWPVTLCSMMATWIYGRTFVVERHRFNKLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+WVIP+Y +QY + WQ ++IN LIE+AI+EAE KG KVL LGLLNQ EEL   G F++
Sbjct  361   LQTWVIPKYSIQYFMPWQKESINGLIEKAILEAEDKGTKVLCLGLLNQEEELKGYGGFHV  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+++VDGS LAVA++V N+IPKGT +VL R  L KV+ +IA AL QRGI+V   
Sbjct  421   ERHPQLKLRVVDGSGLAVAVVV-NSIPKGTVQVLFRGRLTKVAYAIALALCQRGIQVAIL  479

Query  784   CEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E +Y+ LK + N K   N +LS     KVW+VG  + +E+Q+KA +GTLFIP SQ PP+
Sbjct  480   HEHEYKMLKKSLNHKCDSNLLLSSGHAPKVWIVGADIMEEDQLKAPEGTLFIPFSQFPPE  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R DC YHH PA++AP SL N+H+CENWLPRR MS  RV+GI+HA EGW  HECG  + 
Sbjct  540   KLRGDCFYHHTPALVAPASLENVHSCENWLPRRVMSTWRVAGILHAAEGWEEHECGYSIT  599

Query  430   DIDKVWEAALSHGFRPLPLP  371
             DIDK W+A+L HGF+PL LP
Sbjct  600   DIDKAWQASLQHGFQPLGLP  619



>ref|XP_003626834.1| gl1-like protein [Medicago truncatula]
 gb|AET01310.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=622

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/618 (64%), Positives = 495/618 (80%), Gaps = 3/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG FK+V+L+P++A S Y+F+ +   E+D +NFLI P+++ RMLH
Sbjct  1     MASKPGILTDWPWTPLGRFKWVILTPFIAKSTYNFIVNSPEEKDLSNFLIFPYMMVRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SRHRTA GKNRIVDK IEFEQVDRESNWDDQ++ N L+FY+   ++ +  +LP
Sbjct  61    DQVWISLSRHRTAKGKNRIVDKAIEFEQVDRESNWDDQILFNALIFYIGQWLVPESQKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRT GV+MT+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   IWRTSGVVMTILLHSGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYFLLFAIP+ TT  T TAS +S  GY+ YID MNN+GHCNFEFIPK +FSIFP LKY
Sbjct  181   HIAYFLLFAIPLYTTAITNTASIASFAGYLAYIDFMNNLGHCNFEFIPKKVFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPS+HSLHHTQFRTNYSLFMP YDYIYGT+DK++DTLYE SLK+ E +PDVVHLTHL
Sbjct  241   TMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTVDKASDTLYENSLKKEEGTPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGFS+ A+ PQS  WY++ MWP T W++++   YG+TF+L+RN    + L
Sbjct  301   TTPESIYQLRLGFSSLASSPQSSEWYLYFMWPFTFWSVLVTWFYGKTFVLERNSFNMLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ VQYL +WQ + +N LIEEAI+EAE   VKVLSLGL NQ + LNR GE YI+
Sbjct  361   QSWVIPRFHVQYLFKWQRETLNKLIEEAILEAELSKVKVLSLGLSNQGDLLNRYGELYIK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YP++K+K+VDGSSL VAI++ N+IPK   +V L   L+KVS +I +AL +RG KV T  
Sbjct  421   RYPQLKMKIVDGSSLVVAIVL-NSIPKEENQVFLCGRLDKVSYAIVNALCERGTKVTTMY  479

Query  781   EDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
              DD+E  +L+L++ S+ N V   S + K+WLVG+   + EQ KA KG+LF+P SQ PPKK
Sbjct  480   RDDHENLQLRLSSKSQKNLVFPGSNSAKIWLVGDQCEEVEQKKAPKGSLFVPFSQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC Y   PAM+ PP+L N+H+CENWLPRR MSA R++GI+HALEGW+VHECGE M  
Sbjct  540   FRKDCFYLSTPAMITPPNLANVHSCENWLPRRVMSAWRIAGILHALEGWDVHECGEVMFS  599

Query  427   IDKVWEAALSHGFRPLPL  374
             IDK+W+A+L HGFRPL +
Sbjct  600   IDKIWQASLQHGFRPLKI  617



>ref|XP_006464361.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|KDO85380.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/636 (64%), Positives = 510/636 (80%), Gaps = 23/636 (4%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG++K+VVL+PW  HS+Y F+ S +SERDY  FLI PFLL RMLH
Sbjct  1     MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKG-SRL  1865
             +Q+WIS SR+RTA   NRIVDK IEF+QVDRE NWDDQ+V NGL+FY+   ++    S L
Sbjct  61    DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
               WR+DGV++T+ +H+GPVEF+YYW HRALHHH+LYSRYHSHHHSS+VTEPITSVIHPF 
Sbjct  121   RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHI YFLLFAIP++TT+    AS +S +GY+ Y+D MNNMGHCNFEFIP WLF++FPPLK
Sbjct  181   EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKR-GEESP------  1346
             +LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+D+S+D++YE SLKR GEE        
Sbjct  241   FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV  300

Query  1345  DVVHLTHLTTPESVYSIRLGFSTWAAVPQSH-----NWYVWLMWPVTL-WTMIINCIYGQ  1184
             DVVHLTHLTTPES+Y +R+GF++ A+ P  +      WY+ L+WP T   +++++ IYG+
Sbjct  301   DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR  360

Query  1183  TFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLN  1004
             TF+ + N L+K+KLQ+WV+PRY VQY L W+ +AINSLIEEAI+EA+ KGVKV+SLGLLN
Sbjct  361   TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN  420

Query  1003  QSEELNRNGEFYIQKYP-KMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL--NKVSI  833
             Q EELNRNGE Y+++ P K+KIK+VDGSSLA A++V N++PK T  VLLR  +  NKV+ 
Sbjct  421   QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVV-NSLPKTTAHVLLRGTVTANKVAN  479

Query  832   SIASALTQRGIKVVTSCEDDYEKLKL--ATNSKGNFVLSRSFTQ---KVWLVGEGLTKEE  668
             ++AS+L Q GIKV T C+DDYEKLKL     ++ N VLS S+     K+WLVG+ LT +E
Sbjct  480   AVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTKIWLVGDDLTGKE  539

Query  667   QMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVS  488
             Q +A KGT+FIP +QIPP+K R+DC YH  PAM+ PPSL N+H+CENWL RR MSA R++
Sbjct  540   QARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIA  599

Query  487   GIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             GI+HALEGW+++ECG+ MCDI +VW A+L HGFRPL
Sbjct  600   GIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  635



>ref|XP_006445499.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58739.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=639

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/636 (64%), Positives = 509/636 (80%), Gaps = 23/636 (4%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG++K+VVL+PW  HS+Y F+ S +SERDY  FLI PFLL RMLH
Sbjct  1     MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKG-SRL  1865
             +Q+WIS SR+RTA   NRIVDK IEF+QVDRE NWDDQ+V NGL+FY+   ++    S L
Sbjct  61    DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
               WR+DGV++T+ +H+GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHI YFLLFAIP++TT+    AS +S  GY+ Y+D MNNMGHCNFEFIP WLF++FPPLK
Sbjct  181   EHIVYFLLFAIPLVTTMVLKNASIASFAGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKR-GEESP------  1346
             +LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+D+S+D++YE SLKR GEE        
Sbjct  241   FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV  300

Query  1345  DVVHLTHLTTPESVYSIRLGFSTWAAVPQSH-----NWYVWLMWPVTL-WTMIINCIYGQ  1184
             DVVHLTHLTTPES+Y +R+GF++ A+ P  +      WY+ L+WP T   +++++ IYG+
Sbjct  301   DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR  360

Query  1183  TFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLN  1004
             TF+ + N L+K+KLQ+WV+PRY VQY L W+ +AINSLIEEAI+EA+ KGVKV+SLGLLN
Sbjct  361   TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN  420

Query  1003  QSEELNRNGEFYIQKYP-KMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL--NKVSI  833
             Q EELNRNGE Y+++ P K+KIK+VDGSSLA A++V N++PK T  VLLR  +  NKV+ 
Sbjct  421   QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVV-NSLPKTTAHVLLRGTVTANKVAN  479

Query  832   SIASALTQRGIKVVTSCEDDYEKLKL--ATNSKGNFVLSRSFTQ---KVWLVGEGLTKEE  668
             ++AS+L Q GIKV T C+DDYEKLKL     ++ N VLS S+     K+WLVG+ LT +E
Sbjct  480   AVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTKIWLVGDDLTGKE  539

Query  667   QMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVS  488
             Q +A KGT+FIP +QIPP+K R+DC YH  PAM+ PPSL N+H+CENWL RR MSA R++
Sbjct  540   QARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIA  599

Query  487   GIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             GI+HALEGW+++ECG+ MCDI +VW A+L HGFRPL
Sbjct  600   GIIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  635



>ref|XP_006464362.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
 gb|KDO85381.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=638

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/635 (63%), Positives = 510/635 (80%), Gaps = 22/635 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG++K+VVL+PW  HS+Y F+ S +SERDY  FLI PFLL RMLH
Sbjct  1     MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKG-SRL  1865
             +Q+WIS SR+RTA   NRIVDK IEF+QVDRE NWDDQ+V NGL+FY+   ++    S L
Sbjct  61    DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
               WR+DGV++T+ +H+GPVEF+YYW HRALHHH+LYSRYHSHHHSS+VTEPITSVIHPF 
Sbjct  121   RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHI YFLLFAIP++TT+    AS +S +GY+ Y+D MNNMGHCNFEFIP WLF++FPPLK
Sbjct  181   EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKR-GEESP------  1346
             +LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+D+S+D++YE SLKR GEE        
Sbjct  241   FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV  300

Query  1345  DVVHLTHLTTPESVYSIRLGFSTWAAVPQSH-----NWYVWLMWPVTL-WTMIINCIYGQ  1184
             DVVHLTHLTTPES+Y +R+GF++ A+ P  +      WY+ L+WP T   +++++ IYG+
Sbjct  301   DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR  360

Query  1183  TFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLN  1004
             TF+ + N L+K+KLQ+WV+PRY VQY L W+ +AINSLIEEAI+EA+ KGVKV+SLGLLN
Sbjct  361   TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN  420

Query  1003  QSEELNRNGEFYIQKYP-KMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL--NKVSI  833
             Q EELNRNGE Y+++ P K+KIK+VDGSSLA A++V N++PK T  VLLR  +  NKV+ 
Sbjct  421   QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVV-NSLPKTTAHVLLRGTVTANKVAN  479

Query  832   SIASALTQRGIKVVTSCEDDYEKLKL--ATNSKGNFVLSRSFT--QKVWLVGEGLTKEEQ  665
             ++AS+L Q GIKV T C+DDYEKLKL     ++ N VLS S+   + +WLVG+ LT +EQ
Sbjct  480   AVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTIWLVGDDLTGKEQ  539

Query  664   MKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSG  485
              +A KGT+FIP +QIPP+K R+DC YH  PAM+ PPSL N+H+CENWL RR MSA R++G
Sbjct  540   ARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAG  599

Query  484   IVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             I+HALEGW+++ECG+ MCDI +VW A+L HGFRPL
Sbjct  600   IIHALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  634



>ref|XP_003521032.2| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=684

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/604 (66%), Positives = 488/604 (81%), Gaps = 3/604 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+FK+V+L+PW+AHS YSF+ SE  ERD T FLI P ++ RMLH
Sbjct  1     MASKPGILTNWPWKPLGSFKWVILTPWIAHSTYSFLVSEPKERDLTYFLIFPLMMVRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WI+ SRHRTA GKNRIVDK IEFEQVDRESNWDDQ++ NG++FY+   ++ + S +P
Sbjct  61    DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+ TT+ T TAS +S  GY+ YID MNN+GHCNFE IPK +FS FP LKY
Sbjct  181   HIAYFVLFAIPLYTTVVTRTASIASYAGYLAYIDFMNNLGHCNFECIPKAIFSAFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDYIYGTMDKSTDT YE +LKR E   DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTMDKSTDTTYEIALKREESLADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF++ A+ PQS  WY++LMWP TLW++++   YGQTF+++RN  + + L
Sbjct  301   TTPESIYHLRLGFASLASRPQSSTWYLYLMWPFTLWSVLVTWFYGQTFVMERNAFKMLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ VQYL +WQS+ +N LIEEAI++AE   VKVLSLGL NQ + LN+ GE YI+
Sbjct  361   QSWVIPRFHVQYLFKWQSETLNKLIEEAILQAELSKVKVLSLGLSNQGDLLNKYGELYIK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYP++KIK+VDGSSL VAI++ N+IPK  ++VLL    NKVS +I SAL +RG KV T  
Sbjct  421   KYPELKIKIVDGSSLVVAIVL-NSIPKEASQVLLCGKPNKVSYAIVSALCERGTKVTTMY  479

Query  781   EDDYEKLKL--ATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +D+Y+KL+L     SK N V   S+  K+WL+G+   + +Q KA KG+LFIP+SQ PPKK
Sbjct  480   KDEYDKLQLRIPNESKDNLVFPGSYPAKIWLLGDQCNEVDQRKAPKGSLFIPISQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM+APPSL N+ +CENWLPRR MSA RV+GI+HALEGWNV+ECG  M  
Sbjct  540   LRKDCFYHSTPAMIAPPSLVNVDSCENWLPRRVMSAWRVAGILHALEGWNVNECGNVMFS  599

Query  427   IDKV  416
             ++K+
Sbjct  600   VEKI  603



>ref|XP_006354617.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/618 (64%), Positives = 501/618 (81%), Gaps = 5/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGN KY+VL+P+  HS+Y+F  S +ES+RD    L+LPF LSRM+
Sbjct  1     MATKPGILTEWPWAGLGNLKYLVLAPFACHSIYTFFMSRDESQRDMFYILVLPFTLSRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H QLWIS SR+RTA G NRI+DK IEF+QVDRESNWDDQ++L GL++Y+   ++ +   +
Sbjct  61    HYQLWISISRYRTAKGNNRIIDKSIEFDQVDRESNWDDQIILFGLVYYIGYLIVEQAHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  IH+GPVEF+YYW HRALHHHFLYSRYHSHHHSSI TEPIT+VIHPF 
Sbjct  121   PVWRTDGIIITALIHIGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITAVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY++LFAIPV TT+FTGT S +SL  Y  Y+D MN MGHCNFE IPKW FSIFPPLK
Sbjct  181   ELLAYYMLFAIPVFTTVFTGTVSMASLGAYTIYLDFMNLMGHCNFELIPKWTFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDY+ GT+DKS+DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYLNGTVDKSSDTLYEKSLEREAEVPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTT ES+Y +RLGF++ A+ P +  WY+ LMWPVTL ++++  IYG TF+++RN+ + +K
Sbjct  301   LTTLESIYHLRLGFASLASKPHASKWYLLLMWPVTLCSIVLTWIYGHTFVVERNLFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++QY ++W+ ++IN LIEEAIIEA+ KG+KVLSLGLLNQ E+LN +GEFY+
Sbjct  361   LQTWAIPKYRIQYFMQWERESINYLIEEAIIEADQKGIKVLSLGLLNQEEQLNSHGEFYV  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             ++YP +K+K+VDGSSLAVA+++ N+IP+GT++V+LR +L+KV+ SIA AL Q  I+VVT 
Sbjct  421   KRYPHLKVKVVDGSSLAVAVVL-NSIPEGTSQVVLRGSLSKVANSIALALCQGEIQVVTL  479

Query  784   CEDDYEKL--KLATNSKGNFVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
               DDY++L  KL   +  N VLS S+   K WLVG+GL+ +EQ+KA KGTLFIP SQ P 
Sbjct  480   NRDDYKRLKAKLTPQAATNMVLSNSYNVSKTWLVGDGLSDDEQLKAPKGTLFIPFSQFPL  539

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             +K R+DC Y + PAM+AP  L N+ +CENWLPRR MSA RV+GIVHALEGWN H+CGE M
Sbjct  540   RKVRKDCFYFNTPAMIAPKHLENVDSCENWLPRRVMSAWRVAGIVHALEGWNEHDCGEMM  599

Query  433   CDIDKVWEAALSHGFRPL  380
              D++KVW+A+LSHGF  L
Sbjct  600   IDVEKVWKASLSHGFCSL  617



>ref|XP_004307280.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=623

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/619 (63%), Positives = 494/619 (80%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LG+FKYVV++P+  HS YSF+ +E  ++D + FLI P++L RMLH
Sbjct  1     MASNPGILTEWPWTRLGSFKYVVVAPFAIHSTYSFIVNEWEDKDLSYFLIFPYMLFRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RT+ G  RI+DK +EFEQVDRE NWDDQ++ N +LFY+    L  G  +P
Sbjct  61    NQLWISLSRYRTSKGSGRIIDKGLEFEQVDRERNWDDQIIFNAILFYIGRMRLDGGRNVP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPFGE
Sbjct  121   LWRADGFVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP++T   T TAS  +   Y+TYID MNNMGHCNFE IPKW+FS+ PPLKY
Sbjct  181   HIAYFILFAIPMMTMALTRTASIITFAVYITYIDAMNNMGHCNFELIPKWIFSLIPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPSYHSLHHT FRTNY LFMP YDY+YGTM+K++D L+E+SLKR +E+PDV+HLTHL
Sbjct  241   FMYTPSYHSLHHTLFRTNYCLFMPIYDYMYGTMEKTSDELHESSLKRKDEAPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y + LGF++ A+ P +  WY+WLMWPVT W+M++  IYG+TF+++R    K+K+
Sbjct  301   TTPDSIYQLPLGFASLASKPHTSTWYLWLMWPVTFWSMMLTWIYGRTFVVERQRFNKLKI  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y +QY + WQ++AINSLIE+AI+EAE KGVKV+SLGLLNQ+EELNR G  Y +
Sbjct  361   QTWAIPKYNLQYFMPWQNEAINSLIEDAILEAEEKGVKVVSLGLLNQAEELNRYGGLYTR  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +YP++K+KLVDGSSLA A+I+ N IPK TT+V+L  N  KV+ +IA AL+QRGI+V T  
Sbjct  421   RYPQLKVKLVDGSSLAAAVIL-NNIPKETTQVVLTGNFTKVAYAIAFALSQRGIEVATIY  479

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             +D+Y KL K  + +K   VL++    K+WLVG+GL+K+ Q++A KGT+F+P +Q P K+ 
Sbjct  480   KDEYLKLTKSLSATKSTVVLAKGSASKIWLVGDGLSKQTQLQAPKGTIFVPFTQFPLKEL  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             RRDC YH PPAM  P S+ N+++CENWLPRR MSA R++GIVHA EGWN HECG  M DI
Sbjct  540   RRDCFYHCPPAMKIPKSIENVYSCENWLPRRVMSAWRIAGIVHASEGWNEHECGYAMSDI  599

Query  424   DKVWEAALSHGFRPLPLPN  368
             DKVWEA L  GF+PL +PN
Sbjct  600   DKVWEATLRLGFQPL-IPN  617



>ref|XP_010520222.1| PREDICTED: protein ECERIFERUM 1-like [Tarenaya hassleriana]
Length=631

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/624 (63%), Positives = 495/624 (79%), Gaps = 7/624 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW  LG FK+V+++PWV  S Y F+  EESERD   FL+ P LLSR++H
Sbjct  1     MATKPGILTEWPWTSLGRFKFVIVAPWVVDSTYKFMRGEESERDLVYFLVFPMLLSRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             N LWIS SR+ TA G  RIVDK I+F QVDRE+NWDDQ++ NG+LFY+  T L +  +LP
Sbjct  61    NLLWISLSRYVTAKGNRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGYTFLPEAKKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+M   +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSV HPF E
Sbjct  121   MWRTDGVVMAALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF LFAIP LTT+ T TAS +SL GY+ YID MNNMGHCNFEF+P  LF IFP  K+
Sbjct  181   HIAYFTLFAIPTLTTVMTKTASMASLGGYIFYIDFMNNMGHCNFEFLPNRLFRIFPLFKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMPFYDY+YGT D+STD+ YE SL+RGEE+PDVVHLTHL
Sbjct  241   LFYTPSFHSLHHTQFRTNYSLFMPFYDYVYGTTDESTDSTYEKSLERGEETPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + +GF+++++ P S+ W++ L+WP+T  +M     YG+ F+ +RN  + +KL
Sbjct  301   TTPESIYHLPIGFASFSSYPFSYRWFMRLLWPLTSLSMFFTLFYGRPFVSERNSFKNLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
              SWVIPRY +QY LEW+ +AIN +IEEAI+EA+ KGV VLSLGL+NQ EELNRNGE YI+
Sbjct  361   HSWVIPRYNLQYFLEWRKEAINKMIEEAILEADRKGVNVLSLGLMNQGEELNRNGEEYIE  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+PK+++++VDGSSLA A+++ N++PKGT +V++R +L KV+ +IASAL Q+GIKV T  
Sbjct  421   KHPKVRMRVVDGSSLAAAVVI-NSVPKGTVDVVMRGSLTKVAYAIASALCQKGIKVTTLR  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFT---QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
             +D+Y+KL   +    +   + S S T    K+WLVGEG+ ++EQ KAT+G++FIP SQ P
Sbjct  480   KDEYDKLMGCIPHEWRDRLLYSTSKTLPSHKIWLVGEGIDEKEQGKATQGSIFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             PK+ R+DC YH  PA+  P SL N+H+CENWLPR+A+SAAR +GIVHALEGW  HECG  
Sbjct  540   PKELRKDCLYHTTPALTVPKSLENIHSCENWLPRKAISAARAAGIVHALEGWERHECGSS  599

Query  436   MC-DIDKVWEAALSHGFRPLPLPN  368
             +  D+D +W+A+LSHGFRPLPLP+
Sbjct  600   LLHDLDAIWDASLSHGFRPLPLPH  623



>ref|XP_006375521.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
 gb|ERP53318.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
Length=588

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/614 (65%), Positives = 486/614 (79%), Gaps = 34/614 (6%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK+V+L+P V H++Y+F+  +E  +D  +FLI P LL R+LH
Sbjct  1     MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVKDE--KDLPSFLIFPILLWRVLH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G NRI+DK IEF+QVDRESNWDDQ++ NG+LFY+ + ++   S LP
Sbjct  59    NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILFYVGSKIIPGASHLP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  IH+GPVEF+YYWLHR LHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  119   MWRLDGVILTALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+Y +LFAIP++TT+ TGTAS +S  GY+TYIDLMNNMGHCNFE IP+WLF IFPPLKY
Sbjct  179   HISYSMLFAIPLITTIVTGTASLTSFAGYITYIDLMNNMGHCNFELIPRWLFIIFPPLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD S+ TLYE SLKR EE+PDVVHLTHL
Sbjct  239   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDTSSVTLYEDSLKRPEEAPDVVHLTHL  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLG +  A+ PQ   WY+WLMWPVTLWTM++   YG+TF+++RN   K++L
Sbjct  299   TTPDSIYHLRLGLACLASNPQESKWYLWLMWPVTLWTMMLTWTYGRTFVVERNRFHKLRL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P+Y +QY L WQ  +IN+LIEEA++EAE KGVKVLSLGLLNQ EELNR GE Y+Q
Sbjct  359   QTWTLPKYNIQYNLRWQKVSINTLIEEAVLEAEEKGVKVLSLGLLNQGEELNRYGELYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++K K+VDGSSLAVA ++ N+IPKGTT+VL R NL+KV+ ++A  L QRGI      
Sbjct  419   RHPRLKTKVVDGSSLAVAAVM-NSIPKGTTQVLHRGNLSKVAYAVALNLCQRGI------  471

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
                                      + WLVG+GL +E+Q KA +GTLFIP SQ PPKK R
Sbjct  472   -------------------------QTWLVGDGLKEEDQKKAAEGTLFIPFSQFPPKKLR  506

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC YH  P M AP SL N+ +CENWLPRR MSA RV+GIVHALEGW+ HECG  M DID
Sbjct  507   KDCFYHSIPVMAAPASLENVDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMADID  566

Query  421   KVWEAALSHGFRPL  380
             KVW+A++ HGF+PL
Sbjct  567   KVWQASIQHGFKPL  580



>ref|XP_009760059.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Nicotiana sylvestris]
Length=618

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/620 (63%), Positives = 497/620 (80%), Gaps = 10/620 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGNFKY++L+P+V HS+YSF+ S +ES+RD +   ILP+LLSRM+
Sbjct  1     MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+W S SR+RTA G NRI+DK IEF+QVDRE+NWDDQ++LNG++FY+      +   L
Sbjct  61    HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  +H+GPVEF+YYWLHRA HHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY  LF IP+ TTLFTGTAS +SL  Y TYID MN MGHCNFE IPKW+FS+FPPLK
Sbjct  181   EIVAYLTLFLIPMTTTLFTGTASIASLGAYTTYIDFMNYMGHCNFELIPKWMFSMFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTP++HSLHHTQFRTNYSLF+P YD++YGT+DKS DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLMYTPTFHSLHHTQFRTNYSLFVPMYDHLYGTVDKSLDTLYEKSLERKAELPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WY+ LMWPVTLW+  I  IYGQTF+++RN+   IK
Sbjct  301   LTTPESIYHLRLGFASLASRPHASKWYILLMWPVTLWSFFITWIYGQTFVVERNLFRNIK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEE-LNRNGEFY  968
             LQ+W I +Y+ QY ++ Q   IN+LIEEAI+EA+ KG+KVLSLGLLNQ EE LN NGE Y
Sbjct  361   LQTWAILKYRKQYFMQGQRDTINNLIEEAIMEADQKGIKVLSLGLLNQQEEQLNNNGELY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             I+K P++K+K+VDGSSL VA+++ N+IPKGT++V+LR  L+KVS SIA  L QRGI+V+ 
Sbjct  421   IRKNPQLKVKVVDGSSLVVAVVL-NSIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
               E++Y++LK  L   +  N V S+++  K+WLV +GL+++EQ+KA KGTL+IP SQ PP
Sbjct  480   LDEEEYKRLKARLTPEAATNLVQSKTYLPKIWLVDDGLSEDEQLKAPKGTLYIPFSQFPP  539

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             +K R++C Y + PAML P  L N     NWLPRR MSA R++GI+HALEGWN HECG+ M
Sbjct  540   RKVRKNCFYFNTPAMLTPKHLEN-----NWLPRRVMSAWRIAGILHALEGWNEHECGDMM  594

Query  433   CDIDKVWEAALSHGFRPLPL  374
              DI+K W+A+L HGFRPL +
Sbjct  595   LDIEKAWKASLDHGFRPLKM  614



>ref|XP_006354678.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/621 (62%), Positives = 498/621 (80%), Gaps = 4/621 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSF-VTSEESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGN KY+VL+P+V HS+YSF +  EES+RD++   I  +++ RM+
Sbjct  1     MATKPGILTEWPWASLGNLKYLVLAPFVGHSIYSFFMGKEESQRDFSYIFIFFYIVMRMV  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H+Q+WIS SR+RTA G NRI+D+ IEF+QVDRE+NWDDQ++LNG++FY+     A+   L
Sbjct  61    HHQMWISLSRYRTAKGDNRILDRSIEFDQVDRETNWDDQIILNGVVFYIGYLKFAETHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR DG+++T  IH GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEP T+VIHPF 
Sbjct  121   PLWRIDGIIITALIHTGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPHTAVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E + Y+ LF IP+ TT+FTGTAS +S++ Y  Y+D MN MGHCNFE IPKW FSIFPPLK
Sbjct  181   EIVTYYTLFFIPLATTIFTGTASIASIVAYSIYLDFMNLMGHCNFELIPKWTFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             Y +YTPS+HSLHHTQFR+NYSLFMP YDY+YGT+DKS+DTLYE SL+R  E PDVVHLTH
Sbjct  241   YFIYTPSFHSLHHTQFRSNYSLFMPMYDYLYGTVDKSSDTLYEKSLERKAELPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WY WLM PVTLW+  I  IYG TF+++RN+   +K
Sbjct  301   LTTPESIYHLRLGFASLASKPHTSKWYFWLMSPVTLWSFFITWIYGHTFVVERNLFRNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             +Q+W IP+Y +QYL++WQ   IN+LIEEAI+EA+ KGVKVLSLGLLNQ +++N+NGE YI
Sbjct  361   IQTWAIPKYSIQYLMQWQRDTINNLIEEAIMEADQKGVKVLSLGLLNQEKQVNKNGELYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++PK+K+K+VDGSSLAVA+++ N+IPKGT++V+LR   +KV+ SIA AL Q G +V   
Sbjct  421   RRHPKLKVKVVDGSSLAVAVVL-NSIPKGTSQVVLRGRFSKVAYSIALALCQGGTQVYLI  479

Query  784   CEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               ++Y++LK   N +   N V S+S+T K+WLVG+GL+++EQ+KA KGTLFIP SQ PP+
Sbjct  480   YGEEYKRLKALLNPEVATNLVPSKSYTSKIWLVGDGLSEDEQLKAPKGTLFIPFSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y + PAM  P  L N+ +CENWLPRR MSA R++GI+HALEGWN HECG KM 
Sbjct  540   KVRKDCFYFNTPAMNIPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWNEHECGNKMF  599

Query  430   DIDKVWEAALSHGFRPLPLPN  368
             DIDKVW+A+L HGF PL  P+
Sbjct  600   DIDKVWKASLQHGFSPLTTPS  620



>ref|XP_006375524.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
 gb|ERP53321.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
Length=584

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/614 (65%), Positives = 486/614 (79%), Gaps = 34/614 (6%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK+V+L+P V H++Y+F+  +E  +D  +FLI P LL R+LH
Sbjct  1     MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVKDE--KDLPSFLIFPILLWRVLH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G NRI+DK IEF+QVDRESNWDDQ++ NG+LFY+ + ++   S LP
Sbjct  59    NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILFYVGSKIIPGASHLP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  IH+GPVEF+YYWLHR LHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  119   MWRLDGVILTALIHMGPVEFLYYWLHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+Y +LFAIP++TT+ TGTAS +S  GY+TYIDLMNNMGHCNFE IP+WLF IFPPLKY
Sbjct  179   HISYSMLFAIPLITTIVTGTASLTSFAGYITYIDLMNNMGHCNFELIPRWLFIIFPPLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD S+ TLYE SLKR EE+PDVVHLTHL
Sbjct  239   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDTSSVTLYEDSLKRPEEAPDVVHLTHL  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLG +  A+ PQ   WY+WLMWPVTLWTM++   YG+TF+++RN   K++L
Sbjct  299   TTPDSIYHLRLGLACLASNPQESKWYLWLMWPVTLWTMMLTWTYGRTFVVERNRFHKLRL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W +P+Y +QY L WQ  +IN+LIEEA++EAE KGVKVLSLGLLNQ EELNR GE Y+Q
Sbjct  359   QTWTLPKYNIQYNLRWQKVSINTLIEEAVLEAEEKGVKVLSLGLLNQGEELNRYGELYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++K K+VDGSSLAVA ++ N+IPKGTT+VL R NL+KV+ ++A  L QRGI      
Sbjct  419   RHPRLKTKVVDGSSLAVAAVL-NSIPKGTTQVLHRGNLSKVAYAVALNLCQRGI------  471

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
                                      + WLVG+GL +E+Q +A +GTLFIP SQ PPKK R
Sbjct  472   -------------------------QTWLVGDGLKEEDQKQAAEGTLFIPFSQFPPKKLR  506

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC YH  P M AP SL N+ +CENWLPRR MSA RV+GIVHALEGW+ HECG  M DID
Sbjct  507   KDCFYHSIPVMAAPASLENVDSCENWLPRRVMSAWRVAGIVHALEGWDEHECGSTMADID  566

Query  421   KVWEAALSHGFRPL  380
             KVW+A++ HGF+PL
Sbjct  567   KVWQASIQHGFKPL  580



>ref|NP_171723.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 sp|F4HVY0.1|CER1_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27401.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=625

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/625 (64%), Positives = 497/625 (80%), Gaps = 8/625 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PW  HS Y FVT +  +RD   FL+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T++GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY+   +L +  +LP
Sbjct  61    NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   IH GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS  S  GY+ YID MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFILFAIPLLTTLLTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD+STDTLYE +L+RG++  DVVHLTHL
Sbjct  241   LCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGDDIVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P ++ W++ L+WP T  +MI    Y + F+ +RN   K+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFAYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFNKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY +QYLL+W+ +AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
              +P MK++LVDGS LA A+++ N++PK TT V++  NL KV+ +IASAL QRG++V T  
Sbjct  421   NHPDMKVRLVDGSRLAAAVVI-NSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLKLATNSKGN----FVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+YEK++     +      ++ S +  + KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  480   LDEYEKIRSCVPQECRDHLVYLTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ RRDC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW +HECG  
Sbjct  540   LKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTS  599

Query  436   --MCDIDKVWEAALSHGFRPLPLPN  368
               + D+D+VWEA LSHGF+PL LP+
Sbjct  600   LLLSDLDQVWEACLSHGFQPLLLPH  624



>ref|NP_001184890.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27402.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=630

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/630 (64%), Positives = 498/630 (79%), Gaps = 13/630 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PW  HS Y FVT +  +RD   FL+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T++GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY+   +L +  +LP
Sbjct  61    NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   IH GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS  S  GY+ YID MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFILFAIPLLTTLLTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD+STDTLYE +L+RG++  DVVHLTHL
Sbjct  241   LCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGDDIVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P ++ W++ L+WP T  +MI    Y + F+ +RN   K+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFAYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFNKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY +QYLL+W+ +AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
              +P MK++LVDGS LA A+++ N++PK TT V++  NL KV+ +IASAL QRG++V T  
Sbjct  421   NHPDMKVRLVDGSRLAAAVVI-NSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLK--LATNSKGNFVL--------SRSFTQKVWLVGEGLTKEEQMKATKGTLFIP  632
              D+YEK++  +    + + V         ++ F  KVWLVGEG T+EEQ KATKGTLFIP
Sbjct  480   LDEYEKIRSCVPQECRDHLVYLTSEALSSNKGFWVKVWLVGEGTTREEQEKATKGTLFIP  539

Query  631   MSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVH  452
              SQ P K+ RRDC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW +H
Sbjct  540   FSQFPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMH  599

Query  451   ECGEK--MCDIDKVWEAALSHGFRPLPLPN  368
             ECG    + D+D+VWEA LSHGF+PL LP+
Sbjct  600   ECGTSLLLSDLDQVWEACLSHGFQPLLLPH  629



>ref|XP_008438263.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Cucumis melo]
Length=620

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/618 (63%), Positives = 489/618 (79%), Gaps = 5/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPWKPLG+FKY+VL+P V HSLY ++  +E+ERD +   I PFLL RM+H
Sbjct  1     MASTPGILTDWPWKPLGSFKYLVLAPGVIHSLYHYIAKDETERDISYLFIFPFLLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIVDK +EFEQVDRE NWDDQ++LNG+LFY+ +  + K S LP
Sbjct  61    SQIWISFSRYRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYIASNCIEKASNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+M   +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
               AYF+LFAIP++T +F+GT S  +   Y+TYID MN MGHCNFEFIP  LF++FPPLK+
Sbjct  181   EFAYFVLFAIPIMTAVFSGTISVGAYAVYITYIDFMNYMGHCNFEFIPNRLFTLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDYIY T+ K+TD LY  SLKR EE  DVVHLTHL
Sbjct  241   LLYTPSFHSLHHTQFRTNYSLFMPFYDYIYATVHKTTDDLYFKSLKRDEELADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLGF+  A+ P +  W + L+ P+   TM++  IYG+TFI++ N +EK+K+
Sbjct  301   TTPDSIYHLRLGFAELASRPHNSTWNLNLLSPI---TMLLTWIYGRTFIVESNQIEKLKM  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP++ VQYLL+WQ+++INSLIEEAI  A+ KG KVL+LGLLNQ EELN+ GE YIQ
Sbjct  358   QTWAIPKFNVQYLLQWQTESINSLIEEAITNADQKGCKVLTLGLLNQGEELNKYGEIYIQ  417

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+K+++VDGSSLAVA+++ N IPK  T+VLL     K++ ++  +L++RGI++    
Sbjct  418   RNPKLKVRVVDGSSLAVAVVL-NNIPKFATQVLLTGKFTKLAFALYHSLSKRGIQIGVLN  476

Query  781   EDDYEKLKLATNS-KGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             E  Y+KL  A+N+ +G  VL+   +  +WLVGEGLT EEQ+KA KGT FIP SQ PPK  
Sbjct  477   EQHYKKLNKASNNYEGTLVLAEGHSHNIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKIL  536

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  PAM APPSL N+H+CENWLPRR MSA R++G+VHA+EGW  HECG  M DI
Sbjct  537   RKDCFYHCTPAMKAPPSLENMHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYGMSDI  596

Query  424   DKVWEAALSHGFRPLPLP  371
             D+VW+A L HGF+PL  P
Sbjct  597   DRVWKATLGHGFQPLDTP  614



>ref|XP_010052747.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Eucalyptus grandis]
Length=620

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/620 (64%), Positives = 486/620 (78%), Gaps = 11/620 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG FKY+VL+PWV HS Y FV SE  ERD   FLI PFLL RM+H
Sbjct  1     MASKPGLLTDWPWKPLGIFKYMVLAPWVIHSTYVFVNSEGRERDLFTFLIFPFLLWRMVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+W++ SR+R A G  RI+DK IEF QVDRE NWDDQ++LNGL+FY+    L   SRLP
Sbjct  61    NQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGASRLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV+ T  +H+GPVEF+YYWLHRALHHH+LYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYF LFAIP+ TT++ GTAS  S  GYVTYIDLMNNMGHCNFE IPKW+FS FPPLKY
Sbjct  181   HLAYFTLFAIPLYTTVWMGTASIVSFYGYVTYIDLMNNMGHCNFELIPKWIFSYFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTN SLFMPFYDYIYGTMDKS+D L+ETSL+R  E  DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNCSLFMPFYDYIYGTMDKSSDKLHETSLERLAEVSDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
              TP S+Y +R+GF++ A+ P +S  WY+WL+WPVTL +M+   IYG+TF+++R+   K+K
Sbjct  301   PTPGSIYHLRVGFASLASWPDRSSRWYLWLIWPVTLCSMMATWIYGRTFVVERHRFNKLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+WVIP+Y +Q       ++IN LIE+AI+EAE KG KVL LGLLNQ EEL   G F++
Sbjct  361   LQTWVIPKYSIQ-------ESINGLIEKAILEAEDKGTKVLCLGLLNQEEELKGYGGFHV  413

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+++VDGS LAVA++V N+IPKGT +VL R  L KV+ +IA AL QRGI+V   
Sbjct  414   ERHPQLKLRVVDGSGLAVAVVV-NSIPKGTVQVLFRGRLTKVAYAIALALCQRGIQVAIL  472

Query  784   CEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E +Y+ LK + N K   N +LS     KVW+VG  + +E+Q+KA +GTLFIP SQ PP+
Sbjct  473   HEHEYKMLKKSLNHKCDSNLLLSSGHAPKVWIVGADIMEEDQLKAPEGTLFIPFSQFPPE  532

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R DC YHH PA++AP SL N+H+CENWLPRR MS  RV+GI+HA EGW  HECG  + 
Sbjct  533   KLRGDCFYHHTPALVAPASLENVHSCENWLPRRVMSTWRVAGILHAAEGWEEHECGYSIT  592

Query  430   DIDKVWEAALSHGFRPLPLP  371
             DIDK W+A+L HGF+PL LP
Sbjct  593   DIDKAWQASLQHGFQPLGLP  612



>ref|XP_009118866.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=644

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/626 (63%), Positives = 497/626 (79%), Gaps = 11/626 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLGNFKY+V++PW  HS Y FVT +  +  Y+  L+LPFLL R+LH
Sbjct  17    MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYRFVTDDPVDLGYS--LVLPFLLFRILH  74

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T  GK RI+DK I+F QVDRE+NWDDQ++ NGLLFY+   +L +  +LP
Sbjct  75    NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  134

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  135   LWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  194

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GYV YID MNNMGHCNFE +PK LF +FPPLK+
Sbjct  195   HIAYFILFAIPLLTTLLTRTASIASFAGYVIYIDFMNNMGHCNFELVPKRLFHLFPPLKF  254

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD+++DTLYE SL+RGE+  DVVHLTHL
Sbjct  255   LCYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDETSDTLYEKSLERGEDRVDVVHLTHL  314

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +M+    Y   F+ +RN  EK+ L
Sbjct  315   TTPESIYHLRIGLASFASYPFSYRWFMGLLWPFTSLSMLFTLFYASLFVSERNSFEKLNL  374

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA  KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  375   QSWIIPRYNLQYLLKWRKDAINNMIEKAILEANKKGVKVLSLGLMNQGEELNRNGEVYIH  434

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P+MK+++VDGS L  A+++ N++PK TT++++  NL KV+ +IASAL QRG++V+T  
Sbjct  435   KHPEMKVRVVDGSRLTAAVVI-NSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVLTLL  493

Query  781   EDDYEKLK--LATNSKGNFVLSRSFT---QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              ++YEKL+  +    +   VL  S T    KVWL+GEG T+EEQ  ATKGTLFIP SQ P
Sbjct  494   PEEYEKLRSLVPQECRDRLVLLTSETLASNKVWLMGEGTTREEQEMATKGTLFIPFSQFP  553

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ RRDC YH PPA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW +HECG  
Sbjct  554   LKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTS  613

Query  436   ---MCDIDKVWEAALSHGFRPLPLPN  368
                + D+D+VWEA L+HGF+PL LP+
Sbjct  614   NILLSDLDQVWEACLTHGFQPLLLPH  639



>gb|KHN40121.1| Protein WAX2 [Glycine soja]
Length=624

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/618 (62%), Positives = 489/618 (79%), Gaps = 2/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG L+DWPWKPLG+FKY++L+P + HS YS +  + SE+D  NFLILPFLL RMLH
Sbjct  1     MASRPGILSDWPWKPLGSFKYMLLAPCIVHSSYSMMVKDNSEKDMFNFLILPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI++SR+RTA G  RIVDK IEF+QVDRE NWDDQ++ +GL+FYL N V A  S +P
Sbjct  61    NQIWITFSRYRTAKGNARIVDKGIEFDQVDRERNWDDQILFSGLIFYLANYVFAGASHIP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W+TDG +M + +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWKTDGAVMAILLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF LFAIP+LT  FT  AS   + GYVTYID MNNMGHCNFE IP WLF++FP LKY
Sbjct  181   HISYFFLFAIPLLTLAFTKKASMMVVFGYVTYIDFMNNMGHCNFEIIPTWLFNMFPLLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIYGT DK+T+ LY+++LKR EE+ DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTTDKATNQLYDSALKREEETTDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF   A+ P +  WY+ LMWP+T W++ +   YG+ FI++    +K+KL
Sbjct  301   TTPESIYHLRLGFPYLASKPYTPKWYLRLMWPMTAWSVFLTWAYGRAFIVEGCRFDKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y  +Y L+ +  AIN +IEEAI++A+ KG+KVLSLGL+NQ E+LN  G  Y+ 
Sbjct  361   QTWAIPKYNFEYFLQSEKMAINKMIEEAILDADRKGIKVLSLGLMNQGEDLNIYGGLYVS  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P +K+K+VDGSSLA A+++ N IPKGTT+VLL   L KV+ ++A AL QRG+KV T  
Sbjct  421   RNPNLKVKIVDGSSLAAAVVL-NNIPKGTTQVLLMGKLTKVAYALAFALCQRGVKVATMH  479

Query  781   EDDYEKLKLA-TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + DYE+LK + TNS+ N ++++ +TQ  WLV + LT+EEQ+KA  G LFIP SQ PP+K+
Sbjct  480   KHDYERLKKSLTNSESNLIIAKGYTQMTWLVEDQLTEEEQLKAPTGALFIPYSQFPPRKY  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  PAML P  + N+H+CE+WLPRR MSA R++GIVH+LE W+ +EC  KM +I
Sbjct  540   RKDCFYHCTPAMLIPSCVENVHSCEDWLPRRVMSAWRIAGIVHSLERWSTNECNYKMHNI  599

Query  424   DKVWEAALSHGFRPLPLP  371
             DKVW + L HGF+PL  P
Sbjct  600   DKVWRSTLQHGFQPLTTP  617



>gb|AHD24918.1| CER1 [Brassica napus]
Length=628

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/626 (64%), Positives = 495/626 (79%), Gaps = 11/626 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLGNFKY+V++PW  HS Y FVT +  +  Y+  L+LPFLL R+LH
Sbjct  1     MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYKFVTDDPVDLGYS--LVLPFLLFRILH  58

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T  GK RI+DK I+F QVDRE+NWDDQ++ NGLLFY+   +L +  +LP
Sbjct  59    NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  118

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  119   WWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  178

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GYV YID MNNMGHCNFE +PK LF +FPPLKY
Sbjct  179   HIAYFILFAIPLLTTLLTKTASIASFSGYVIYIDFMNNMGHCNFELVPKRLFHLFPPLKY  238

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD+++DTLYE SL+RGE+  DVVHLTHL
Sbjct  239   LCYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDETSDTLYEKSLERGEDRVDVVHLTHL  298

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +M+    Y   F+ +RN  EK+ L
Sbjct  299   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMLFTLFYASLFVSERNSFEKLNL  358

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA  KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  359   QSWIIPRYNLQYLLKWRKDAINNMIEKAILEANEKGVKVLSLGLMNQGEELNRNGEVYIH  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P+MK+++VDGS L  A+++ N++PK TT++++  NL KV+ +IASAL QRG++V+T  
Sbjct  419   KHPEMKVRVVDGSRLTAAVVI-NSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVLTLL  477

Query  781   EDDYEKLK--LATNSKGNFVLSRSFT---QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              ++YEKL   +    +   +L  S T    KVWL+GEG T+EEQ  ATKGTLFIP SQ P
Sbjct  478   PEEYEKLSSFVPKECRDRLILLTSETLASNKVWLMGEGTTREEQEMATKGTLFIPFSQFP  537

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ RRDC YH PPA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW  HECG  
Sbjct  538   LKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWETHECGTS  597

Query  436   ---MCDIDKVWEAALSHGFRPLPLPN  368
                + D+D+VWEA LSHGF+PL LP+
Sbjct  598   NILLSDLDQVWEACLSHGFQPLLLPH  623



>ref|XP_008438262.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cucumis melo]
Length=621

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/619 (63%), Positives = 490/619 (79%), Gaps = 6/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPWKPLG+FKY+VL+P V HSLY ++  +E+ERD +   I PFLL RM+H
Sbjct  1     MASTPGILTDWPWKPLGSFKYLVLAPGVIHSLYHYIAKDETERDISYLFIFPFLLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIVDK +EFEQVDRE NWDDQ++LNG+LFY+ +  + K S LP
Sbjct  61    SQIWISFSRYRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYIASNCIEKASNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+M   +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
               AYF+LFAIP++T +F+GT S  +   Y+TYID MN MGHCNFEFIP  LF++FPPLK+
Sbjct  181   EFAYFVLFAIPIMTAVFSGTISVGAYAVYITYIDFMNYMGHCNFEFIPNRLFTLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDYIY T+ K+TD LY  SLKR EE  DVVHLTHL
Sbjct  241   LLYTPSFHSLHHTQFRTNYSLFMPFYDYIYATVHKTTDDLYFKSLKRDEELADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLGF+  A+ P +  W + L+ P+   TM++  IYG+TFI++ N +EK+K+
Sbjct  301   TTPDSIYHLRLGFAELASRPHNSTWNLNLLSPI---TMLLTWIYGRTFIVESNQIEKLKM  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP++ VQYLL+WQ+++INSLIEEAI  A+ KG KVL+LGLLNQ EELN+ GE YIQ
Sbjct  358   QTWAIPKFNVQYLLQWQTESINSLIEEAITNADQKGCKVLTLGLLNQGEELNKYGEIYIQ  417

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+K+++VDGSSLAVA+++ N IPK  T+VLL     K++ ++  +L++RGI++    
Sbjct  418   RNPKLKVRVVDGSSLAVAVVL-NNIPKFATQVLLTGKFTKLAFALYHSLSKRGIQIGVLN  476

Query  781   EDDYEKLKLATNS-KGNFVLSRSFTQ-KVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E  Y+KL  A+N+ +G  VL+   +  ++WLVGEGLT EEQ+KA KGT FIP SQ PPK 
Sbjct  477   EQHYKKLNKASNNYEGTLVLAEGHSHNQIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKI  536

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM APPSL N+H+CENWLPRR MSA R++G+VHA+EGW  HECG  M D
Sbjct  537   LRKDCFYHCTPAMKAPPSLENMHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYGMSD  596

Query  427   IDKVWEAALSHGFRPLPLP  371
             ID+VW+A L HGF+PL  P
Sbjct  597   IDRVWKATLGHGFQPLDTP  615



>ref|XP_006306971.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
 gb|EOA39869.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
Length=647

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/624 (64%), Positives = 500/624 (80%), Gaps = 7/624 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW  LG+FKY+V++PWV HS Y FVT +  +RD    L+ PFLL R+LH
Sbjct  24    MATKPGVLTDWPWTSLGSFKYIVVAPWVVHSTYRFVTDDPEKRDLGYSLVFPFLLFRILH  83

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ TA GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY    +L +  +LP
Sbjct  84    NQVWISLSRYYTAKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  143

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  144   WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  203

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GYV YID+MNNMGHCNFE IPK LF +FPPLK+
Sbjct  204   HIAYFMLFAIPLLTTLLTKTASIASFAGYVIYIDVMNNMGHCNFELIPKRLFHLFPPLKF  263

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD++TDTLYE SL+RGE+  DVVHLTHL
Sbjct  264   LCYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDETTDTLYEKSLERGEDRVDVVHLTHL  323

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +MI    YG+ F+ + N  +K+ L
Sbjct  324   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMIFTLFYGRLFVAESNSFKKLNL  383

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELN NGE YI+
Sbjct  384   QSWMIPRYNLQYLLKWRKDAINNMIEQAILEADKKGVKVLSLGLMNQGEELNMNGEVYIR  443

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++K+++VDGS LA A+++ N++PK TT V++  NL KV+ SIASAL QRG++V T  
Sbjct  444   KHPELKVRVVDGSRLAAAVVI-NSVPKTTTNVVMTGNLTKVAYSIASALCQRGVQVSTLR  502

Query  781   EDDYEKLKLATNSKGN----FVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+YEKL+     +      ++ + S  ++KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  503   LDEYEKLRSCVPQECRDHLVYLTTDSLSSKKVWLVGEGTTREEQEKATKGTLFIPFSQFP  562

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ RRDC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW++HECG  
Sbjct  563   LKQLRRDCIYHTTPALIVPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWDMHECGTS  622

Query  436   -MCDIDKVWEAALSHGFRPLPLPN  368
              + D+D+VW+A LSHGF+PL LP+
Sbjct  623   LLSDLDQVWDACLSHGFQPLLLPH  646



>gb|KDO85382.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=627

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/633 (63%), Positives = 501/633 (79%), Gaps = 29/633 (5%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG++K+VVL+PW  HS+Y F+ S +SERDY  FLI PFLL RMLH
Sbjct  1     MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKG-SRL  1865
             +Q+WIS SR+RTA   NRIVDK IEF+QVDRE NWDDQ+V NGL+FY+   ++    S L
Sbjct  61    DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
               WR+DGV++T+ +H+GPVEF+YYW HRALHHH+LYSRYHSHHHSS+VTEPITSVIHPF 
Sbjct  121   RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHI YFLLFAIP++TT+    AS +S +GY+ Y+D MNNMGHCNFEFIP WLF++FPPLK
Sbjct  181   EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKR-GEESP------  1346
             +LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+D+S+D++YE SLKR GEE        
Sbjct  241   FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV  300

Query  1345  DVVHLTHLTTPESVYSIRLGFSTWAAVPQSH-----NWYVWLMWPVTL-WTMIINCIYGQ  1184
             DVVHLTHLTTPES+Y +R+GF++ A+ P  +      WY+ L+WP T   +++++ IYG+
Sbjct  301   DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR  360

Query  1183  TFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLN  1004
             TF+ + N L+K+KLQ+WV+PRY VQY L W+ +AINSLIEEAI+EA+ KGVKV+SLGLLN
Sbjct  361   TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN  420

Query  1003  QSEELNRNGEFYIQKYP-KMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL--NKVSI  833
             Q EELNRNGE Y+++ P K+KIK+VDGSSLA A++V N++PK T  VLLR  +  NKV+ 
Sbjct  421   QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVV-NSLPKTTAHVLLRGTVTANKVAN  479

Query  832   SIASALTQRGIKVVTSCEDDYEKLKL--ATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMK  659
             ++AS+L Q GIKV T C+DDYEKLKL     ++ N VLS S+            K EQ +
Sbjct  480   AVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAH---------KTEQAR  530

Query  658   ATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIV  479
             A KGT+FIP +QIPP+K R+DC YH  PAM+ PPSL N+H+CENWL RR MSA R++GI+
Sbjct  531   APKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGII  590

Query  478   HALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             HALEGW+++ECG+ MCDI +VW A+L HGFRPL
Sbjct  591   HALEGWDLNECGQTMCDIHQVWHASLRHGFRPL  623



>ref|XP_010276559.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=624

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/622 (63%), Positives = 494/622 (79%), Gaps = 7/622 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LT+WPWK LGNFKY+VL+PWV HS YSF+T +E+ERD  NFL  PFLL RMLH
Sbjct  1     MASTPGPLTNWPWKKLGNFKYLVLAPWVIHSTYSFMTKDETERDVGNFLTFPFLLFRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS +R++TA  K+RIV K IEFEQVDRE NWDDQ++LNGLL+Y+     +K +RLP
Sbjct  61    SQIWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGLLYYIVPIFYSKAARLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++ + +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   VWRWDGVILIMLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF LF+IP++ T+ TGT S  +L  Y+TYID MN MGHCNFE +PK LF IFP LKY
Sbjct  181   HLLYFSLFSIPLVATMITGTISGGALAAYLTYIDFMNYMGHCNFELVPKRLFHIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHT+FRTNYSLFMP YDY+YGTMD ++DTLYETSL+   E+P VVHLTHL
Sbjct  241   LMYTPSFHSLHHTKFRTNYSLFMPIYDYMYGTMDDTSDTLYETSLEGKTETPHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT ES+Y +R GF++ A+ P + NWY+W++WPVT  +M+   I G  F ++RN+L ++K+
Sbjct  301   TTLESIYHLRPGFASLASGPYAPNWYLWILWPVTYASMLFTWISGSIFTVERNMLNELKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q W IPRY  QY+L W+  +IN+LIE+AI+EA+  GVKV+SLGLLNQ EELN NGE Y++
Sbjct  361   QIWAIPRYSFQYMLSWKIDSINNLIEKAILEADAGGVKVMSLGLLNQGEELNGNGELYVK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRAN-LNKVSISIASALTQRGIKVVTS  785
             K+PK+KI+LVDGSSL VA+++ N+IP+GTT+VLLR    +K+  +IAS+L QRG++VV +
Sbjct  421   KHPKLKIRLVDGSSLVVAVVL-NSIPQGTTQVLLRGKPASKIVYAIASSLCQRGVQVVVT  479

Query  784   CEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEG-LTKEEQMKATKGTLFIPMSQIPP  614
              +DD EKLKL    +   N V+S S+TQKVWLV +  +T+EEQ +A KGT FIP SQ  P
Sbjct  480   SKDDIEKLKLRLPKELWSNLVVSSSYTQKVWLVDDAVMTREEQKRAPKGTHFIPFSQFSP  539

Query  613   KKHR-RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             KK R  DC Y+H PAM  P +L N+H+CENWLPRR MSA R++GI+HALEGW  HECG+ 
Sbjct  540   KKLRSNDCVYYHTPAMAIPKALENVHSCENWLPRRVMSARRIAGIIHALEGWEEHECGDN  599

Query  436   M-CDIDKVWEAALSHGFRPLPL  374
             M  D+ K+W AAL HGF PLPL
Sbjct  600   MLIDVQKIWVAALRHGFLPLPL  621



>ref|XP_006354620.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=623

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/618 (62%), Positives = 496/618 (80%), Gaps = 5/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MA  PG LT+ PW  LGN KY+VL+P+  HS+Y+F  S +ESERD    L+LP  L RM+
Sbjct  1     MANKPGILTNCPWACLGNLKYLVLAPFACHSIYTFFMSKDESERDMFYILLLPLTLFRMV  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H Q+WIS SR+RTA G NRI+D+ IEF+QVDRESNWDD+++L GL +Y+   +L +   +
Sbjct  61    HYQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNWDDEIILFGLAYYIGYLILEQAHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++   +H+GPVE +YYWLHRALHHHFLYSRYHSHHHSSIVTEPIT+V+HPF 
Sbjct  121   PMWRTDGIIIIALLHIGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY+ LF IPV TTLFTGTAS +S+  YV YID MN MGHCNFE IPKW+FSIFPPLK
Sbjct  181   EILAYYTLFGIPVFTTLFTGTASIASIGAYVIYIDFMNLMGHCNFELIPKWMFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             Y MYTPSYHSLHHTQFRTNY LFMP YDYIY TMDK++DTLYE SL+R  E PDVVHLTH
Sbjct  241   YFMYTPSYHSLHHTQFRTNYCLFMPLYDYIYDTMDKASDTLYEKSLEREAEVPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTT ES+Y +RLGF++ A+ P +  WY+ LMWPVTLW++++  IYG TF+++RN+ + +K
Sbjct  301   LTTLESIYHLRLGFASLASKPHTSKWYMLLMWPVTLWSIMLTWIYGYTFVVERNLFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++QY ++WQ ++IN++IE+AIIEA+ KG+KVLSLGLLNQ E+LN NGE Y+
Sbjct  361   LQTWAIPKYRIQYFMQWQRESINNMIEKAIIEADQKGIKVLSLGLLNQEEQLNSNGELYL  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSLAVA+++ N+I KGT++V++R  L+KV+ SIA AL + GI+VVT 
Sbjct  421   RRHPQLKVKVVDGSSLAVAVVL-NSISKGTSQVVVRGRLSKVANSIALALCKGGIQVVTL  479

Query  784   CEDDYEKL--KLATNSKGNFVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
              E+DY++L  KL   +  N VLS+ +   K WLVG+GL+K+EQ+KA KGTLFIP SQ PP
Sbjct  480   DEEDYKRLKAKLTPEAATNLVLSKCYNVSKTWLVGDGLSKDEQLKAPKGTLFIPYSQFPP  539

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             +K R+DC Y + PAM+AP  L N+ +CENWLPRR  SA R++GIVHALEGWN HECG+ +
Sbjct  540   RKVRKDCFYFNTPAMIAPNHLENVDSCENWLPRRVTSAWRIAGIVHALEGWNEHECGDMI  599

Query  433   CDIDKVWEAALSHGFRPL  380
              D  KVW+A+L HGF PL
Sbjct  600   LDTQKVWKASLVHGFCPL  617



>ref|XP_007041196.1| CER1 protein [Theobroma cacao]
 gb|EOX97027.1| CER1 protein [Theobroma cacao]
Length=627

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/646 (61%), Positives = 478/646 (74%), Gaps = 47/646 (7%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ LGNFKYV+L+PWV HS YS+ T   +ER   NFLI PFLL+R+LH
Sbjct  1     MATKPGILTNWPWESLGNFKYVILAPWVVHSAYSWATKAGNERGLFNFLIFPFLLTRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNW-------------------------  1937
             NQ+WISYSR+RTA G NRIVDK I+FEQVDRESNW                         
Sbjct  61    NQIWISYSRYRTAKGSNRIVDKGIDFEQVDRESNWSISILHCCLIAYDLGTNMRKLMDMF  120

Query  1936  --DDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhf  1763
               DDQ++LNG++ YL   +L   S LP WR+DGV++T+ +H GPVEF+YYWLHRALHHH+
Sbjct  121   GRDDQIILNGIILYLTIMILPGASHLPIWRSDGVIITILLHTGPVEFLYYWLHRALHHHY  180

Query  1762  lysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYI  1583
             LYSRYHSHHHSSIVTEPITSVIHPF E I+YF+LF IP+LTT   GTAS  S+ GY+TYI
Sbjct  181   LYSRYHSHHHSSIVTEPITSVIHPFAEMISYFVLFMIPILTTTSMGTASIVSIFGYITYI  240

Query  1582  DLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTM  1403
             D MNNMGHCNFEF  KW+FSIFP +KY MYTPS+HSLHHTQFRTNYSLFMPFYDYIYGTM
Sbjct  241   DFMNNMGHCNFEFTSKWVFSIFPLVKYFMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTM  300

Query  1402  DKSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPV  1223
             DKS D LYE SLKR EESPDVVHLTHLTTP+S++ +RLG ++ A+ P  H     +MWPV
Sbjct  301   DKSADALYEASLKRREESPDVVHLTHLTTPDSLFHLRLGLASLASKP--HQAPTMVMWPV  358

Query  1222  TLWTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaE  1043
             T W++++  IYG  F+ +RN  EK+KLQSWV       YL   Q   IN LIEEAI EA+
Sbjct  359   TFWSVLVTWIYGHAFVSERNTFEKLKLQSWV-------YLSRGQRGKINKLIEEAISEAD  411

Query  1042  gkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVL  863
              KG          + EELN +GE YIQ++PK+KIK+VDGSSLA A++V N+IP+ T +V+
Sbjct  412   RKGA---------KDEELNGSGELYIQRHPKLKIKVVDGSSLAAAVVV-NSIPEETRQVV  461

Query  862   LRANLNKVSISIASALTQRGIKVVTSCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGE  686
             LR  L KV+ +IA AL Q+G+KV    +D+Y+KL       G N VL+  +  K+WLVG+
Sbjct  462   LRGKLCKVAYAIALALCQKGVKVAALKDDEYKKLLKHVGKFGDNLVLAERYDPKIWLVGD  521

Query  685   GLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAM  506
             GLTKEEQ+KA KGT+FIP SQ PP+K R+DC YH  PAM+AP S+ N+H+CENWLPRR M
Sbjct  522   GLTKEEQLKAPKGTIFIPFSQFPPRKVRKDCYYHSTPAMVAPKSIENMHSCENWLPRRIM  581

Query  505   SAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPLPLPN  368
             SA RV+GI+H LEGW+VHECG  +  I KVWEA L HGFRPL +P 
Sbjct  582   SAWRVAGIIHGLEGWDVHECGHTIFGIGKVWEATLQHGFRPLSIPT  627



>ref|XP_006354619.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/618 (62%), Positives = 497/618 (80%), Gaps = 5/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MA  PG LT+ PW  LGN KY+VL+P+  HS+Y+F  S +ESERD    L+LP  L RM+
Sbjct  1     MANKPGILTNCPWACLGNLKYLVLAPFACHSIYTFFMSKDESERDMFYILLLPLTLFRMV  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H Q+WIS SR+RTA G NRI+D+ IEF+QVDRESNWDD+++L GL +Y+   +L +   +
Sbjct  61    HYQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNWDDEIILFGLAYYIGYLILEQAHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++   +H+GPVE +YYWLHRALHHHFLYSRYHSHHHSSIVTEPIT+V+HPF 
Sbjct  121   PMWRTDGIIIIALLHIGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY+ LF IPV TTLFTGTAS +S+  YV YID MN MGHCNFE IPKW+FSIFPPLK
Sbjct  181   EILAYYTLFGIPVFTTLFTGTASIASIGAYVIYIDFMNLMGHCNFELIPKWMFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             Y MYTPSYHSLHHTQFRTNY LFMP YDYIY TMDK++DTLYE SL+R  E PDVVHLTH
Sbjct  241   YFMYTPSYHSLHHTQFRTNYCLFMPLYDYIYDTMDKASDTLYEKSLEREAEVPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTT ES+Y +RLGF++ A+ P +  WY+ LMWPVTLW++++  IYG TF+++RN+ + +K
Sbjct  301   LTTLESIYHLRLGFASLASKPHTSKWYMLLMWPVTLWSIMLTWIYGYTFVVERNLFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++QY ++WQ ++IN++IE+AIIEA+ KG+KVLSLGLLNQ+++LN NGE Y+
Sbjct  361   LQTWAIPKYRIQYFMQWQRESINNMIEKAIIEADQKGIKVLSLGLLNQAKQLNSNGELYL  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++P++K+K+VDGSSLAVA+++ N+I KGT++V++R  L+KV+ SIA AL + GI+VVT 
Sbjct  421   RRHPQLKVKVVDGSSLAVAVVL-NSISKGTSQVVVRGRLSKVANSIALALCKGGIQVVTL  479

Query  784   CEDDYEKL--KLATNSKGNFVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
              E+DY++L  KL   +  N VLS+ +   K WLVG+GL+K+EQ+KA KGTLFIP SQ PP
Sbjct  480   DEEDYKRLKAKLTPEAATNLVLSKCYNVSKTWLVGDGLSKDEQLKAPKGTLFIPYSQFPP  539

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             +K R+DC Y + PAM+AP  L N+ +CENWLPRR  SA R++GIVHALEGWN HECG+ +
Sbjct  540   RKVRKDCFYFNTPAMIAPNHLENVDSCENWLPRRVTSAWRIAGIVHALEGWNEHECGDMI  599

Query  433   CDIDKVWEAALSHGFRPL  380
              D  KVW+A+L HGF PL
Sbjct  600   LDTQKVWKASLVHGFCPL  617



>gb|EPS65064.1| hypothetical protein M569_09713, partial [Genlisea aurea]
Length=618

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/620 (62%), Positives = 492/620 (79%), Gaps = 6/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT WPW  LG+FKY+V++P    ++++  T    + DYTN L +PFLLSR +H
Sbjct  1     MASKPGILTHWPWTTLGSFKYLVMAPGALQTIFALATQPTHQWDYTNLLTIPFLLSRAIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WISYSR+RTA G+ RI+D+ IEF+Q+DRESNWDDQ++L G+L Y FN +  K S LP
Sbjct  61    NQIWISYSRYRTATGRARILDRSIEFDQIDRESNWDDQILLTGILLYFFNNLTGKASFLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
             AWR DGV++T  +H   VE++YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   AWRMDGVIITALVHALVVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYF+LFAIP+L T+FT TAS +S+ GY+T+ID MNN+GHCNFE +P W+F+IFPPLKY
Sbjct  181   HLAYFILFAIPLLGTIFTETASLASIYGYITFIDFMNNLGHCNFEIVPSWVFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             +MYTPS+HSLHHTQFRTNYSLFMPFYDYI+GT D S+D L+E SL R EE PDVVHLTHL
Sbjct  241   IMYTPSFHSLHHTQFRTNYSLFMPFYDYIHGTTDNSSDELFEKSLNRPEECPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYV-WLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             TTPES++ + +G +++AA PQS  W    LM P +LWTM++N I G+T +++RN +EK+K
Sbjct  301   TTPESIFHLPIGLASFAARPQSSKWCTRLLMGPFSLWTMMLNFITGKTLVVERNFMEKLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGE-FY  968
             LQ+W +PRY +QY L+WQ +AIN +IEEAI  AE +GVKVLSLGLLNQ +E  RNG+ F 
Sbjct  361   LQTWAVPRYTIQYTLKWQEKAINKMIEEAINRAEARGVKVLSLGLLNQVKEPKRNGQLFI  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             ++K P  K+K++DGSSLAVA+++ N+IPKGTTE++ R  L K + +I  AL ++GI++  
Sbjct  421   VKKQPNQKMKIIDGSSLAVAVVI-NSIPKGTTEIMFRGKLCKTAHAIIGALLEKGIQIAA  479

Query  787   SCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               E+  E+LKLA    G   ++ +SFTQKVW+VGEGLTKEEQ+KA KG +FIP SQ PPK
Sbjct  480   MYEN--ERLKLAGRFTGREVIVPKSFTQKVWIVGEGLTKEEQLKAPKGAVFIPYSQFPPK  537

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             + RRD  Y   P+M+APPSL NLH+CENWLPRRAMSA RV+GI+HA+E WNV E G+ + 
Sbjct  538   QARRDAVYCLTPSMMAPPSLKNLHSCENWLPRRAMSAWRVAGILHAIEEWNVDEYGDAIF  597

Query  430   DIDKVWEAALSHGFRPLPLP  371
             D +K+WEAAL HGFR LP P
Sbjct  598   DHNKIWEAALKHGFRLLPGP  617



>ref|XP_004308720.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=614

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/615 (64%), Positives = 498/615 (81%), Gaps = 6/615 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLG+FKYVVL+PWV HS YS++  EE   D    LILPF L RMLH
Sbjct  1     MASTPGILTDWPWTPLGSFKYVVLAPWVIHSTYSYMFGEEGT-DLFYILILPFQLWRMLH  59

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA GK+ I+DK +EFEQVDRE +WDDQ++ NG+LFY+   +L + + L 
Sbjct  60    NQIWISLSRYQTARGKS-IIDKGLEFEQVDRERDWDDQIIFNGMLFYVGRCILLQ-TDLQ  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG++MT+ +H GPVE++YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSV HPF E
Sbjct  118   IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YFLLFAIP++ TL  GTAS +S   Y+TYID M N+GHCNFEFIP W+FS+FPPLKY
Sbjct  178   HISYFLLFAIPMIGTLLIGTASITSYFVYITYIDFMKNLGHCNFEFIPNWIFSLFPPLKY  237

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDY+YGTMDKS+D+L+E+SL + EESPDVVHLTHL
Sbjct  238   LMYTPSYHSLHHTQFRTNYSLFMPIYDYMYGTMDKSSDSLHESSLMK-EESPDVVHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y + L F++ A+ P++  WY+WL+WPVTL ++I+  + G++F+++R   +K  L
Sbjct  297   TSAKSIYRLPLAFASLASNPRTSTWYLWLLWPVTLCSLILTRLLGRSFVIERQRFDKHSL  356

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP++ +QY L WQ++AIN  IE+AI+EAE KGVKV+SLGLLNQ E LN  G  Y+Q
Sbjct  357   QTWVIPKFILQYSLSWQNEAINRFIEDAILEAEQKGVKVISLGLLNQGEGLNSYGGIYVQ  416

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +  ++KIK+VDGSSLAVA+I+ N+IPKGTT+VLL  NL KV+ ++A +L QR I+VVTS 
Sbjct  417   RNLRLKIKVVDGSSLAVAVIL-NSIPKGTTQVLLIGNLTKVAYALAFSLCQRDIQVVTSH  475

Query  781   EDDYEKLKLATNS-KGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + +Y KL  + N+ +G  V  RS+ QK+WLVG+GL+K+EQ+ A KGT+F+P SQ PPKK 
Sbjct  476   QAEYLKLTKSLNATEGKVVHDRSYAQKIWLVGDGLSKKEQLSAPKGTIFVPFSQFPPKKL  535

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             RRDC YH+ PAM  P SL N+++CENWLPRR MSA R++GIVHA+EGWN HECG  M +I
Sbjct  536   RRDCFYHYTPAMKIPKSLENVYSCENWLPRRVMSAWRIAGIVHAMEGWNEHECGYTMSNI  595

Query  424   DKVWEAALSHGFRPL  380
             DKVW+A L HGF+PL
Sbjct  596   DKVWQATLRHGFQPL  610



>gb|EYU42307.1| hypothetical protein MIMGU_mgv1a003396mg [Erythranthe guttata]
Length=588

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/578 (66%), Positives = 469/578 (81%), Gaps = 3/578 (1%)
 Frame = -3

Query  2107  EESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQ  1928
             EE E    +FL++PFLLSR  HN +WIS SR+RTA G NRI+DK IEFEQVDRE NWDDQ
Sbjct  3     EEKENYLVSFLVIPFLLSRAAHNIIWISLSRYRTAKGNNRILDKSIEFEQVDRERNWDDQ  62

Query  1927  VVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysry  1748
             ++ NG+LFYL    +    R P WRTDG++ T  +H GPVEF+YYWLHRALHHH+LYSRY
Sbjct  63    IIFNGILFYLGLMFIESAPRTPLWRTDGLIWTFLLHAGPVEFLYYWLHRALHHHYLYSRY  122

Query  1747  hshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNN  1568
             HSHHHSSIVTEPITSV HPF EHI+Y+LLF IPVLTTLF G  S S+L  Y TYID MNN
Sbjct  123   HSHHHSSIVTEPITSVTHPFAEHISYYLLFLIPVLTTLFMGNTSLSTLAIYATYIDFMNN  182

Query  1567  MGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTD  1388
             MGHCNFE IPKWLFS FPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDY+YGTMDKS+D
Sbjct  183   MGHCNFELIPKWLFSAFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSD  242

Query  1387  TLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTM  1208
             TLYE SL R EESPDVVHLTHLTTPES+Y +RLGF   A+ P   NWY+WLMWPVT+W+M
Sbjct  243   TLYEKSLVRKEESPDVVHLTHLTTPESIYHLRLGFPYLASQPHKSNWYLWLMWPVTVWSM  302

Query  1207  IINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvk  1028
             +I  IYG+TF ++RN  + +K+Q+W IP+Y +QY ++WQ + IN++IE +I+EAE KGV+
Sbjct  303   MITWIYGRTFTVERNAFKHLKIQTWAIPKYNIQYYMQWQKETINTMIENSILEAEDKGVR  362

Query  1027  vlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL  848
             VLSLGLLNQ E LN+NGE ++++ P++K KLVDGSSL VA+++ N+I KGTT+V+L+ NL
Sbjct  363   VLSLGLLNQEEGLNKNGELFLKRQPQLKTKLVDGSSLVVAVVI-NSILKGTTQVVLKGNL  421

Query  847   NKVSISIASALTQRGIKVVTSCEDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTK  674
             +KV+ SIA AL Q GI+V T  E +Y+KL  KL+  +  N VLS+S T K WLVG+ L++
Sbjct  422   SKVAYSIALALCQGGIQVFTMLEYEYKKLQAKLSKEAGNNLVLSKSNTPKTWLVGDKLSE  481

Query  673   EEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAAR  494
             EEQ+KA KGT+FIP SQ PPKK R+DCSY+  PAMLAP  L N+ +CENWLPRR MSA R
Sbjct  482   EEQLKAPKGTIFIPFSQFPPKKMRKDCSYNTTPAMLAPKHLENVDSCENWLPRRVMSAWR  541

Query  493   VSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             ++GI+HA+E WNV+ECG+ M DI+K+W+A+L HGFRPL
Sbjct  542   IAGILHAMEEWNVNECGDMMFDIEKIWQASLEHGFRPL  579



>ref|XP_010496713.1| PREDICTED: protein ECERIFERUM 1 isoform X1 [Camelina sativa]
Length=625

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/625 (63%), Positives = 495/625 (79%), Gaps = 8/625 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PWV HS Y FVT +  +RD    L+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T+ GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY    +L +  +LP
Sbjct  61    NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GYV YID+MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFMLFAIPLLTTLLTKTASIASFAGYVIYIDVMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD++TDTLYE SL+RGE+  DVVHLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDETTDTLYEKSLERGEDKVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +MI    Y + F+ +RN  +K+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFKKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWMIPRYNLQYLLKWRKDAINTMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIY  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P +K+++VDGS LA A+++ N++ K T  V++  +L KV+ +IASAL QRG++V T  
Sbjct  421   KHPDVKVRVVDGSRLAAAVVI-NSVSKATKNVVITGHLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLK--LATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+ EKL+  +    + + V   S    + KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  480   LDECEKLRSCVPLEYRDHLVYQTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ R+DC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW +HECG  
Sbjct  540   LKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTS  599

Query  436   M--CDIDKVWEAALSHGFRPLPLPN  368
             +   D+D+VWEA LSHGF+PL LP+
Sbjct  600   LLPSDLDQVWEACLSHGFQPLLLPH  624



>emb|CDY38059.1| BnaCnng09200D [Brassica napus]
Length=829

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/626 (64%), Positives = 495/626 (79%), Gaps = 11/626 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLGNFKY+V++PW  HS Y FVT +  +  Y+  L+LPFLL R+LH
Sbjct  202   MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYKFVTDDPVDLGYS--LVLPFLLFRILH  259

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T  GK RI+DK I+F QVDRE+NWDDQ++ NGLLFY+   +L +  +LP
Sbjct  260   NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  319

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  320   WWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  379

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GYV YID MNNMGHCNFE +PK LF +FPPLKY
Sbjct  380   HIAYFILFAIPLLTTLLTKTASIASFSGYVIYIDFMNNMGHCNFELVPKRLFHLFPPLKY  439

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD+++DTLYE SL+RGE+  DVVHLTHL
Sbjct  440   LCYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDETSDTLYEKSLERGEDRVDVVHLTHL  499

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +M+    Y   F+ +RN  EK+ L
Sbjct  500   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMLFTLFYASLFVSERNSFEKLNL  559

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA  KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  560   QSWIIPRYNLQYLLKWRKDAINNMIEKAILEANEKGVKVLSLGLMNQGEELNRNGEVYIH  619

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P+MK+++VDGS L  A+++ N++PK TT++++  NL KV+ +IASAL QRG++V+T  
Sbjct  620   KHPEMKVRVVDGSRLTAAVVI-NSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVLTLL  678

Query  781   EDDYEKLK--LATNSKGNFVLSRSFT---QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              ++YEKL   +    +   +L  S T    KVWL+GEG T+EEQ  ATKGTLFIP SQ P
Sbjct  679   PEEYEKLSSFVPKECRDRLILLTSETLASNKVWLMGEGTTREEQEMATKGTLFIPFSQFP  738

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ RRDC YH PPA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW  HECG  
Sbjct  739   LKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWETHECGTS  798

Query  436   ---MCDIDKVWEAALSHGFRPLPLPN  368
                + D+D+VWEA LSHGF+PL LP+
Sbjct  799   NILLSDLDQVWEACLSHGFQPLLLPH  824



>gb|KGN56664.1| hypothetical protein Csa_3G127750 [Cucumis sativus]
Length=634

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/631 (59%), Positives = 500/631 (79%), Gaps = 18/631 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPWKPLG+FKYV+L+PWV HS+Y +V  +E+ERD +  +I PFLL R++H
Sbjct  1     MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+DK IEF+QVDRE NWDDQ++L GLL Y+ + V+ + S+LP
Sbjct  61    NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLLLYVVSYVMEEASKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++   +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121   LWRTDGMIIIFLLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFVE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AYF+LFAIP++T +F+GT S ++ + Y+TYID MNNMGHCNFEFIP   F++FPPLK+
Sbjct  181   ELAYFVLFAIPIMTAVFSGTMSVAAYVVYITYIDFMNNMGHCNFEFIPNRFFTLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDY+Y T DKS+DTLY+ SLK+ E+  DVVHLTHL
Sbjct  241   LIYTPSFHSLHHTQFRTNYSLFMPFYDYVYATFDKSSDTLYKESLKKQEDVVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+P+S+Y +RLGF++ A+ P +  WY+WL++P+TL +M++  IYG+TFI++RN  +++ +
Sbjct  301   TSPQSIYHLRLGFASLASRPHTSTWYLWLLYPITLVSMLLTWIYGRTFIVERNQTDELNM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y+ Q+L++W  Q IN LIEEAII A+ KG KVL+LGLLNQ+ ELN++G  Y+Q
Sbjct  361   QTWTIPKYQFQFLIQW--QPINKLIEEAIINADQKGCKVLTLGLLNQANELNKHGALYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+K+++VDG+SLAV +++ N IPK  T+VLL   + K++ +I  +L++RGI++V   
Sbjct  419   RNPKLKVRVVDGNSLAVGVVL-NNIPKFATQVLLIGKVTKLAFAIYHSLSKRGIQIVVLN  477

Query  781   EDDYEKLKLATN---------------SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKG  647
             E +Y++L    +                +   +LS + +Q +WLVGEG+  EEQ+KA KG
Sbjct  478   EQNYKRLNRKPSNYNYNTNINNNNNNFEEPTLLLSTASSQNIWLVGEGVRDEEQLKAPKG  537

Query  646   TLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALE  467
             T FIP SQ PPK  R+DC YH+ PA+ APPSL NLH+CENWLPRR MSA RV+GIVHA+E
Sbjct  538   TTFIPFSQFPPKVLRKDCFYHYTPALKAPPSLQNLHSCENWLPRRVMSAWRVAGIVHAME  597

Query  466   GWNVHECGEKMCDIDKVWEAALSHGFRPLPL  374
             GW  HECG+ M D+++VW A+L HGF+PL +
Sbjct  598   GWTEHECGDAMFDVEQVWLASLQHGFQPLEI  628



>gb|AIE57503.1| CER1 [Camelina sativa]
Length=625

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/625 (63%), Positives = 491/625 (79%), Gaps = 8/625 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PWV HS Y FVT +   RD    L+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPETRDIGYSLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T+ GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY    +L +  +LP
Sbjct  61    NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GY+ YID MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFMLFAIPLLTTLLTKTASIASFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             + YTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD++TDTLYE SL+RGE+  DVVHLTHL
Sbjct  241   ICYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDETTDTLYEKSLERGEDKVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +MI    Y + F+ + N  +K  L
Sbjct  301   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMIFTLFYARLFVAESNSFKKFNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWMIPRYNLQYLLKWRKDAINTMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++K+++VDGS L+ A+++ N++ K T  V++  +L KV+ +IASAL QRG++V T  
Sbjct  421   KHPELKVRVVDGSRLSAAVVI-NSVSKATKNVVMTGHLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLK--LATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+YEKL+  +    +   V   S    + KVWLVGEG T EEQ KATKGTLFIP SQ P
Sbjct  480   LDEYEKLRSCIPQECRDYLVYQTSEVLSSNKVWLVGEGTTSEEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ R+DC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW VHECG  
Sbjct  540   LKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHECGTS  599

Query  436   M--CDIDKVWEAALSHGFRPLPLPN  368
             +   D+D+VWEA LSHGF+PL LP+
Sbjct  600   LLPSDLDQVWEACLSHGFQPLLLPH  624



>ref|XP_004134362.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
Length=634

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/631 (59%), Positives = 499/631 (79%), Gaps = 18/631 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPWKPLG+FKYV+L+PWV HS+Y +V  +E+ERD +  +I PFLL R++H
Sbjct  1     MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+DK IEF+QVDRE NWDDQ++L GLL Y+ + V+ + S+LP
Sbjct  61    NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLLLYVVSYVMEEASKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++   +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121   LWRTDGMIIIFLLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFVE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AYF+LFAIP++T +F+GT S  + + Y+TYID MNNMGHCNFEFIP   F++FPPLK+
Sbjct  181   ELAYFVLFAIPIMTAVFSGTMSVGAYVVYITYIDFMNNMGHCNFEFIPNRFFTLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDY+Y T DKS+DTLY+ SLK+ E+  DVVHLTHL
Sbjct  241   LIYTPSFHSLHHTQFRTNYSLFMPFYDYVYATFDKSSDTLYKESLKKQEDVVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+P+S+Y +RLGF++ A+ P +  WY+WL++P+TL +M++  IYG+TFI++RN  +++ +
Sbjct  301   TSPQSIYHLRLGFASLASRPHTSTWYLWLLYPITLVSMLLTWIYGRTFIVERNQTDELNM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP+Y+ Q+L++W  Q IN LIEEAII A+ KG KVL+LGLLNQ +ELN++G  Y+Q
Sbjct  361   QTWTIPKYQFQFLIQW--QPINKLIEEAIINADQKGCKVLTLGLLNQGDELNKHGALYVQ  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+K+++VDG+SLAV +++ N IPK  T+VLL   + K++ +I  +L++RGI++V   
Sbjct  419   RNPKLKVRVVDGNSLAVGVVL-NNIPKFATQVLLIGKVTKLAFAIYHSLSKRGIQIVVLN  477

Query  781   EDDYEKLKLATN---------------SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKG  647
             E +Y++L    +                +   +LS + +Q +WLVGEG+  EEQ+KA KG
Sbjct  478   EQNYKRLNRKPSNYNYNTNINNNNNNFEEPTLLLSTASSQNIWLVGEGVRDEEQLKAPKG  537

Query  646   TLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALE  467
             T FIP SQ PPK  R+DC YH+ PA+ APPSL NLH+CENWLPRR MSA RV+GIVHA+E
Sbjct  538   TTFIPFSQFPPKVLRKDCFYHYTPALKAPPSLQNLHSCENWLPRRVMSAWRVAGIVHAME  597

Query  466   GWNVHECGEKMCDIDKVWEAALSHGFRPLPL  374
             GW  HECG+ M D+++VW A+L HGF+PL +
Sbjct  598   GWTEHECGDAMFDVEQVWLASLQHGFQPLEI  628



>ref|XP_004229695.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum lycopersicum]
Length=625

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/621 (61%), Positives = 494/621 (80%), Gaps = 5/621 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSF-VTSEESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGNFKY+VL+P+V HS+YSF ++ EES+RD++   I  +++ RM+
Sbjct  1     MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H+Q+WIS SR+R+A G NRI+D+ IEF+QVDRE+NWDDQ++ NG+ FY+     ++   L
Sbjct  61    HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKFSETHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR DG+++T  +H GPVEF+YYW+HRALHHHFLYSRYHSHHHSSIVTEP T+VIHPF 
Sbjct  121   PLWRIDGIIITALLHTGPVEFLYYWIHRALHHHFLYSRYHSHHHSSIVTEPHTAVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E + Y+ LF IP++TT+ TGTAS +S++ Y  Y+D MN MGHCNFE IPKW+FSIFPPLK
Sbjct  181   EIVTYYTLFFIPLVTTVLTGTASIASVVAYAIYLDFMNLMGHCNFELIPKWMFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YL+YTPS+HSLHHTQF +NYSLFMP YDY+Y T+DKS+DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLIYTPSFHSLHHTQFGSNYSLFMPMYDYLYSTVDKSSDTLYEKSLERKAELPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WY WL+ PVTLW+  I  IYG TF+++RN+   +K
Sbjct  301   LTTPESIYHLRLGFASLASKPHTSKWYFWLISPVTLWSFFITWIYGHTFVVERNLFSNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y +QY ++WQ  +IN+LIEEAI+EA+ KGVKVLSLGLLNQ +++N NGE YI
Sbjct  361   LQTWAIPKYSIQYFMQWQRDSINNLIEEAIMEADQKGVKVLSLGLLNQEKQVNNNGELYI  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++PK+K+K+VDGSSLAVA+++ N+IPKGT+ V+LR  L+KV+ SIA  L Q G +V+  
Sbjct  421   RRHPKLKVKVVDGSSLAVAVVL-NSIPKGTSRVVLRGRLSKVAYSIALTLCQGGTQVMID  479

Query  784   CEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E +Y++LK   N +   N V S+S+  K+WLVG+ L+++EQ+KA KGTLFIP SQ PP+
Sbjct  480   GE-EYKRLKALLNPEVASNLVPSKSYASKIWLVGDELSEDEQLKAPKGTLFIPFSQFPPR  538

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y + PAM  P  L N+ +CENWLPRR MSA R++GI+HALEGWN HECG KM 
Sbjct  539   KVRKDCFYFNTPAMNIPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWNEHECGNKMF  598

Query  430   DIDKVWEAALSHGFRPLPLPN  368
             DI KVW+A+L HGF PL  P+
Sbjct  599   DIQKVWKASLQHGFSPLTTPS  619



>ref|XP_010496714.1| PREDICTED: protein ECERIFERUM 1 isoform X2 [Camelina sativa]
Length=625

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/625 (63%), Positives = 494/625 (79%), Gaps = 8/625 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PWV HS Y FVT +  +RD    L+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T+ GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY    +L +  +LP
Sbjct  61    NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GYV YID+MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFMLFAIPLLTTLLTKTASIASFAGYVIYIDVMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTN SLFMP YDYIYGTMD++TDTLYE SL+RGE+  DVVHLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNCSLFMPLYDYIYGTMDETTDTLYEKSLERGEDKVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +MI    Y + F+ +RN  +K+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFKKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWMIPRYNLQYLLKWRKDAINTMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIY  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P +K+++VDGS LA A+++ N++ K T  V++  +L KV+ +IASAL QRG++V T  
Sbjct  421   KHPDVKVRVVDGSRLAAAVVI-NSVSKATKNVVITGHLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLK--LATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+ EKL+  +    + + V   S    + KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  480   LDECEKLRSCVPLEYRDHLVYQTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ R+DC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW +HECG  
Sbjct  540   LKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTS  599

Query  436   M--CDIDKVWEAALSHGFRPLPLPN  368
             +   D+D+VWEA LSHGF+PL LP+
Sbjct  600   LLPSDLDQVWEACLSHGFQPLLLPH  624



>gb|KHG15491.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=612

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/621 (60%), Positives = 472/621 (76%), Gaps = 16/621 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKY++L P +   +YSF+  +E + D +  ++ PF+L RMLH
Sbjct  1     MASKPGILTDWPWKPLGSFKYILLVPLITEHIYSFMEKDE-DIDVSKLVLFPFMLWRMLH  59

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+ TA G N+IVDK IEF+QVDRE +WDDQ++ N +LFY  N  +  GS LP
Sbjct  60    NQLWISLSRYLTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAILFYWGNKYVPGGSHLP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T+ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  120   FWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYFLLFAIP+LTT+ TGT S  +L  Y+TY+D MNNMGHCNFE IP WLF++ PPLKY
Sbjct  180   HIAYFLLFAIPILTTVLTGTVSIVALAAYITYLDFMNNMGHCNFELIPSWLFTLIPPLKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             ++YTPS+HSLHH QFRTNYSLFMPFYDYIYGTMDKS+DTLYE SL+R EESP VVHLTHL
Sbjct  240   IIYTPSFHSLHHVQFRTNYSLFMPFYDYIYGTMDKSSDTLYEKSLRRKEESPHVVHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQS-HNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             TTPES+Y +RLGF+++A+ P +   W++WL+WPVTL +M++  IY  TF+++ N    I+
Sbjct  300   TTPESIYHLRLGFASFASKPYTPSTWHMWLLWPVTLCSMMLTWIYCFTFVVESNRFHNIR  359

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y +QY  + Q Q+ N+              + +       +EELN  G  ++
Sbjct  360   LQTWTIPKYNIQYRSKSQKQSTNN-----------LIEEAILEAEEKGAEELNMYGGLFV  408

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             QK+P++K+KLVDGSSLAVA+++ N+IPKGTT+V+LR  L KV+ ++A  L Q+ I+V   
Sbjct  409   QKHPQLKVKLVDGSSLAVAVVL-NSIPKGTTQVVLRGKLTKVACALAFTLCQKRIQVSVL  467

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              ED+YEKL   L T S+G  VLS+S+T K WLVG+GL++ EQ KA+KGTLFIP SQ PPK
Sbjct  468   REDEYEKLDKLLGTKSEGKLVLSKSYTCKTWLVGDGLSEVEQKKASKGTLFIPFSQFPPK  527

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R DC YH  PAM  P +  N+ +CENWLPRR MS  R++G+VHALEGW  HECG    
Sbjct  528   KLRTDCFYHTTPAMQTPLAFENVDSCENWLPRRVMSVWRIAGLVHALEGWEEHECGYTTS  587

Query  430   DIDKVWEAALSHGFRPLPLPN  368
             +I+KVWEA + HGF+PL +P 
Sbjct  588   NIEKVWEATVKHGFQPLRVPT  608



>emb|CBI16760.3| unnamed protein product [Vitis vinifera]
Length=2763

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/620 (66%), Positives = 502/620 (81%), Gaps = 6/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLGNFKYVVL+PW  H+++SF+  +E ERD  +FLI PFLLSRMLH
Sbjct  1     MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SRHRTA G NRIVDK IEFEQVDRE NWDDQ++ NG++FY+   +L   S +P
Sbjct  61    NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T+ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRADGVVITILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF+IP+LT +FT T+S  +  GY++YID MNNMGHCNFE +PKWLFSIFP LKY
Sbjct  181   HIGYFLLFSIPLLTMIFTRTSSVVAFFGYISYIDFMNNMGHCNFELVPKWLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYD++YGTMDKS+D LYE SL R EESPDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDFMYGTMDKSSDVLYEKSLTRPEESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP S+Y IRLGF++ A+ P    WY+ LMWP+T   M++  I  +TF+L+RN   K+K 
Sbjct  301   TTPNSIYHIRLGFASVASKPYISKWYLRLMWPLTSSYMMLIWICSRTFVLERNHFNKLKS  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y+VQY L+WQ++ INSLIEEAI+ AE +GVKVLSLGLLNQ EELN  G+ YI 
Sbjct  361   QTWVIPKYRVQYFLKWQNEPINSLIEEAILHAEERGVKVLSLGLLNQGEELNLYGKLYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
               PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R  L+KV+   A AL Q+GI+V T C
Sbjct  421   LNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGKLSKVAYFTAIALCQKGIQVTTFC  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             E++++K+K+  N+K      LS+++  K+WLVG+GLT+EEQ+KA KGTLFIP SQ PPK+
Sbjct  480   EEEHKKIKMKLNTKLGDKLALSKNYAHKIWLVGDGLTEEEQLKAPKGTLFIPFSQFPPKR  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM++P S  N+ +CENWLPRRAMSA RV+GI+HALEGWNVHECG  + D
Sbjct  540   MRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGILHALEGWNVHECGHTIFD  599

Query  427   IDKVWEA---ALSHGFRPLP  377
             I+K+WEA    +  G + LP
Sbjct  600   IEKIWEAMCFEVGIGLQTLP  619


 Score =   319 bits (817),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 229/296 (77%), Gaps = 14/296 (5%)
 Frame = -3

Query  1483  YHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHLTTPESV  1304
             +HSLH+TQFRTNYSLFMPFYDY+YGTMDKS+D LYE SL R EESPDVVHLTHLTTP+S+
Sbjct  2454  FHSLHYTQFRTNYSLFMPFYDYMYGTMDKSSDVLYEKSLTRPEESPDVVHLTHLTTPDSI  2513

Query  1303  YSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKLQSWVIP  1124
             Y IRLGF++ A+ P    WY+ LMWP+T   M++  I  +TF+L+RN   K+KLQ+WVIP
Sbjct  2514  YHIRLGFASVASKPYISKWYLRLMWPLTSSYMMLIWICSRTFVLERNHFNKLKLQTWVIP  2573

Query  1123  RYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQ-----------SEELNRNG  977
             +Y++QY L+WQ++ INSLIEEAI++AE +GV VLSLGLLN+            EELN  G
Sbjct  2574  KYRIQYFLKWQNEPINSLIEEAILDAEQRGVNVLSLGLLNRIVVPINNFTILGEELNIYG  2633

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E YI + PK+KIK+VDGSSLA+A+++ N+IPKGTT+VL R  L+KV+   A AL Q+GI+
Sbjct  2634  ELYIHRNPKLKIKVVDGSSLAIAVVL-NSIPKGTTQVLFRGKLSKVAYFTALALCQKGIQ  2692

Query  796   VVTSCEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFI  635
             V T  E++Y K+ +  N+K  G   LS+++  K+WLVG+GLTKEEQ+KA KGTLFI
Sbjct  2693  VATFHEEEYAKINMKLNTKLGGKLALSKNYAHKIWLVGDGLTKEEQLKAPKGTLFI  2748



>ref|XP_010496480.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=625

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/625 (63%), Positives = 493/625 (79%), Gaps = 8/625 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PWV HS Y FVT +  +RD    L+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T+ GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY    +L +  +LP
Sbjct  61    NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GYV YID+MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFMLFAIPLLTTLLTKTASIASFAGYVIYIDVMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTN SLFMP YDYIYGTMD++TDTLYE SL+RGE+  DVVHLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNCSLFMPLYDYIYGTMDETTDTLYEKSLERGEDKVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +MI    Y   F+ +RN  +K+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMIFTLFYAGLFVAERNSFKKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWMIPRYNLQYLLKWRKDAINTMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIY  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P +K+++VDGS LA A+++ N++ K T  V++  +L KV+ +IASAL QRG++V T  
Sbjct  421   KHPDVKVRVVDGSRLAAAVVI-NSVSKATKNVVITGHLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLK--LATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+ EKL+  +    + + V   S    + KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  480   LDECEKLRSCVPLEYRDHLVYQTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ R+DC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW +HECG  
Sbjct  540   LKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTS  599

Query  436   M--CDIDKVWEAALSHGFRPLPLPN  368
             +   D+D+VWEA LSHGF+PL LP+
Sbjct  600   LLPSDLDQVWEACLSHGFQPLLLPH  624



>ref|XP_008460068.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
 gb|ADN34102.1| sterol desaturase [Cucumis melo subsp. melo]
Length=618

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/619 (63%), Positives = 481/619 (78%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG +K+V+L+PWV HS  S    EE + D +  LI PFLL RM+H
Sbjct  1     MASKPGILTDWPWKPLGKYKFVILTPWVIHST-SLYFREEEKGDLSYILIFPFLLLRMIH  59

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA G  RIVDKPIEFEQVDRES+WDDQ++ NGLLF L   V+ KG  LP
Sbjct  60    NQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSWDDQILFNGLLFCLGRMVVEKGEYLP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+M   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSI TEPITSVIHPF E
Sbjct  120   LWRTDGVVMAALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFAE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF IP+L T+ T TAS  S + YV +ID MNNMGHCNFE +PK LF IFPPLKY
Sbjct  180   HIVYFLLFTIPLLVTVLTETASIGSFVLYVMFIDFMNNMGHCNFEVVPKRLFFIFPPLKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHTQFRTNYSLFMP YDY+YGT+DK++D+LYE SL R EE  DVVHL+HL
Sbjct  240   LIYTPSYHSLHHTQFRTNYSLFMPIYDYLYGTVDKNSDSLYENSLLREEEVADVVHLSHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLG +T A+ P +  W++ L+WP T + +++   YG TF+ +RN  + +KL
Sbjct  300   TTPQSIYHMRLGLATVASQPFASEWWLSLLWPFTSFYVLVTSFYGHTFVYERNSFKALKL  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ +QY ++ + +AIN LIE AI++A+ KGVKVLSLGLLNQ +ELN  GEFYIQ
Sbjct  360   QSWVIPRFNLQYFMKARREAINKLIEAAILDADKKGVKVLSLGLLNQGKELNEYGEFYIQ  419

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPK+KIKLVDGSSLA AI+V NTIPK TT+VLLR NL+KV+ ++A AL Q G +V T  
Sbjct  420   KYPKLKIKLVDGSSLAAAIVV-NTIPKATTKVLLRGNLSKVAYAVADALCQLGFQVATLY  478

Query  781   EDDYEKLK-LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             E++++KLK   T +  N VL++  T K+W+VG+GL + EQ+ A KGT+FIP SQ PPK+ 
Sbjct  479   ENEHKKLKSKVTANSNNLVLAKITTHKIWIVGDGLEEFEQLNAPKGTIFIPYSQFPPKRL  538

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  P+M  P S  N+ +CENWLPRR MSA R++GI+H LEG   HECGE M  +
Sbjct  539   RKDCYYHVTPSMRVPSSFQNIDSCENWLPRRVMSAWRMAGILHVLEGREGHECGETMLSL  598

Query  424   DKVWEAALSHGFRPLPLPN  368
             ++ W A+L +GF PL +P+
Sbjct  599   EEAWRASLQNGFLPLEIPS  617



>ref|XP_010324966.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum lycopersicum]
Length=626

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/622 (61%), Positives = 494/622 (79%), Gaps = 6/622 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSF-VTSEESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGNFKY+VL+P+V HS+YSF ++ EES+RD++   I  +++ RM+
Sbjct  1     MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H+Q+WIS SR+R+A G NRI+D+ IEF+QVDRE+NWDDQ++ NG+ FY+     ++   L
Sbjct  61    HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKFSETHHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR DG+++T  +H GPVEF+YYW+HRALHHHFLYSRYHSHHHSSIVTEP T+VIHPF 
Sbjct  121   PLWRIDGIIITALLHTGPVEFLYYWIHRALHHHFLYSRYHSHHHSSIVTEPHTAVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E + Y+ LF IP++TT+ TGTAS +S++ Y  Y+D MN MGHCNFE IPKW+FSIFPPLK
Sbjct  181   EIVTYYTLFFIPLVTTVLTGTASIASVVAYAIYLDFMNLMGHCNFELIPKWMFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YL+YTPS+HSLHHTQF +NYSLFMP YDY+Y T+DKS+DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLIYTPSFHSLHHTQFGSNYSLFMPMYDYLYSTVDKSSDTLYEKSLERKAELPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES+Y +RLGF++ A+ P +  WY WL+ PVTLW+  I  IYG TF+++RN+   +K
Sbjct  301   LTTPESIYHLRLGFASLASKPHTSKWYFWLISPVTLWSFFITWIYGHTFVVERNLFSNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSE-ELNRNGEFY  968
             LQ+W IP+Y +QY ++WQ  +IN+LIEEAI+EA+ KGVKVLSLGLLNQ E ++N NGE Y
Sbjct  361   LQTWAIPKYSIQYFMQWQRDSINNLIEEAIMEADQKGVKVLSLGLLNQQEKQVNNNGELY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             I+++PK+K+K+VDGSSLAVA+++ N+IPKGT+ V+LR  L+KV+ SIA  L Q G +V+ 
Sbjct  421   IRRHPKLKVKVVDGSSLAVAVVL-NSIPKGTSRVVLRGRLSKVAYSIALTLCQGGTQVMI  479

Query  787   SCEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
               E +Y++LK   N +   N V S+S+  K+WLVG+ L+++EQ+KA KGTLFIP SQ PP
Sbjct  480   DGE-EYKRLKALLNPEVASNLVPSKSYASKIWLVGDELSEDEQLKAPKGTLFIPFSQFPP  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             +K R+DC Y + PAM  P  L N+ +CENWLPRR MSA R++GI+HALEGWN HECG KM
Sbjct  539   RKVRKDCFYFNTPAMNIPKHLENVDSCENWLPRRVMSAWRIAGILHALEGWNEHECGNKM  598

Query  433   CDIDKVWEAALSHGFRPLPLPN  368
              DI KVW+A+L HGF PL  P+
Sbjct  599   FDIQKVWKASLQHGFSPLTTPS  620



>ref|XP_008438252.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=635

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/634 (59%), Positives = 501/634 (79%), Gaps = 20/634 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPWK LG+FKYV+L+PWV HS+Y +V  +E+ERD ++ +I PFLL R++H
Sbjct  1     MASTPGILTDWPWKTLGSFKYVILAPWVVHSIYQYVVKDETERDVSSLVIFPFLLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+RTA G  RI+DK IEF+QVDRE NWDDQ++LNGLL Y+ + V+ + S+LP
Sbjct  61    NQIWISVSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLNGLLLYIVSYVMEEASKLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++   +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVT+PITSVIHPF E
Sbjct  121   LWRTDGMVIIFLLHIGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPITSVIHPFVE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AYF LFAIP++T +F+GT S ++ + Y+TYID MNNMGHCNFEFIP  LF+IFPPLK+
Sbjct  181   ELAYFGLFAIPIMTAVFSGTMSVAAYVVYITYIDFMNNMGHCNFEFIPNRLFTIFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHT+FRTNYSLFMPFYDYIY T DKS+DTLY+ SL++ E+  DVVHLTHL
Sbjct  241   LIYTPSFHSLHHTKFRTNYSLFMPFYDYIYATFDKSSDTLYKESLRKEEDVVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+PES+Y +RLGF+T A+ P +  WY+WL++P+TL +M++  IYG+TF+++RN   ++ +
Sbjct  301   TSPESIYHLRLGFATLASRPHTSTWYLWLLYPITLVSMLLTWIYGRTFVVERNQTNELNM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W+IP+YK Q+LL+W  + IN LIEEAII+A+ KG KVL+LGLLNQ +ELN++G  Y++
Sbjct  361   QTWMIPKYKFQFLLQW--EPINRLIEEAIIKADQKGCKVLTLGLLNQGDELNKHGAIYVE  418

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+K+++VDG+SLAVA+++ N IPK  T+VLL   + K++ +I  +L++RGI++V   
Sbjct  419   RNPKLKVRVVDGNSLAVAVVL-NNIPKFATQVLLIGKVTKLACAIYHSLSKRGIQIVVLN  477

Query  781   EDDYEKL-----------------KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKAT  653
             E +Y+KL                       +   +LS + +Q +WLVG+G+  EEQ+KA 
Sbjct  478   EQNYKKLINRKPSNNNNANIINNNNNNNFEEATLLLSTASSQNIWLVGDGIRDEEQLKAP  537

Query  652   KGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHA  473
             KGT FIP SQ PPK  R+DC YH+ PA+  P SL NLH+CENWLPRR MSA RV+GIVHA
Sbjct  538   KGTTFIPFSQFPPKILRKDCFYHYTPALKVPSSLQNLHSCENWLPRRVMSAWRVAGIVHA  597

Query  472   LEGWNVHECGEKMCDIDKVWEAALSHGFRPLPLP  371
             +EGW  HECG+ + D+++VW A+L HGF+PL +P
Sbjct  598   MEGWTEHECGDAIFDVEQVWLASLRHGFQPLEMP  631



>gb|KFK42594.1| hypothetical protein AALP_AA1G015600 [Arabis alpina]
Length=624

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/624 (63%), Positives = 490/624 (79%), Gaps = 7/624 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PW  HS+Y  VT +  + D    L+LPFLL R+LH
Sbjct  1     MATKPGILTDWPWTPLGSFKYIVIAPWAIHSIYKLVTDDLEKIDLGYSLVLPFLLLRVLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T  G+ RIVDK I+F QVDRE+NWDDQ++ NG+LFY   ++L +   LP
Sbjct  61    NQVWISLSRYYTVKGERRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGISLLPEAKHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLMT  +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   VWRTDGVLMTALLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS +S  GY+ YID MNNMGHCNFE +PK LF +FPPLK+
Sbjct  181   HIAYFMLFAIPLLTTLLTKTASIASFAGYLIYIDFMNNMGHCNFELVPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT D+++DTLYE SL+RGE+  DVVHLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTTDETSDTLYEKSLERGEDRVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +M+    Y + F+ +RN  EK+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFSYRWFMRLLWPFTSLSMLFTLFYARLFVAERNSFEKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPRY +QYLL+W+  AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWIIPRYNLQYLLKWRKDAINNMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++K+++VDGS LA A+++ N++PK TT V++  NL KV+ +IASAL  RG++V T  
Sbjct  421   KHPELKVRVVDGSRLAAAVVI-NSLPKATTTVVVTGNLTKVAYTIASALCHRGVQVSTLR  479

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQ-----KVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
               +YEKL+     +    L    T+     KVWLVGEG +KEEQ KA KGTLFIP SQ P
Sbjct  480   LHEYEKLRSCIPRECRDQLVHITTEALSSNKVWLVGEGTSKEEQEKAIKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ R DC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HALEGW +HECG  
Sbjct  540   LKQLRGDCIYHTTPALVVPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTS  599

Query  436   -MCDIDKVWEAALSHGFRPLPLPN  368
              + D+D+VWEA LSHGF+PL LP+
Sbjct  600   LLSDLDQVWEACLSHGFQPLLLPH  623



>gb|KGN56666.1| hypothetical protein Csa_3G127770 [Cucumis sativus]
Length=608

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/615 (62%), Positives = 483/615 (79%), Gaps = 13/615 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG  TDWPWKPLG+FKY+VL+P V HS Y ++  + +ERD +  LI PFLL RM+H
Sbjct  1     MASTPGIFTDWPWKPLGSFKYLVLAPGVIHSFYHYIAKDWTERDISYLLIFPFLLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SRHRTA G  RIVDK +EFEQVDRE NWDDQ++LNG+LFY+ +  + K S LP
Sbjct  61    SQIWISFSRHRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYITSNCIEKASNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+M   +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
               AYF+LFAIP++T +F+GT S ++ + Y+TYID MN MGHCNFEFIP  LF++FPPL++
Sbjct  181   EFAYFVLFAIPIMTAVFSGTMSVAAYVVYITYIDFMNYMGHCNFEFIPNRLFTLFPPLRF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDY+Y T+ KSTD LY  SLKR EE  DVVHLTHL
Sbjct  241   LLYTPSFHSLHHTQFRTNYSLFMPFYDYLYATVHKSTDDLYFESLKRDEEFADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLGF+  A+ P +  WY+ L+ P+   TM++  IYG TFI++ N LEK+K+
Sbjct  301   TTPDSIYHLRLGFAELASRPHNSTWYLCLLSPI---TMLLTWIYGSTFIVESNQLEKLKM  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W        YLL+W++++IN+LIEEAI  A+ KG KVL+LGLLNQ EELN+ GE YIQ
Sbjct  358   QTW--------YLLQWETESINNLIEEAITNADQKGCKVLTLGLLNQGEELNKYGEIYIQ  409

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+K+++VDGSSLAV +++ N IPK  T+VLL   + K++ ++  +L++RGI++    
Sbjct  410   RNPKLKVRVVDGSSLAVGVVL-NNIPKFATQVLLTGKITKLAFALYRSLSKRGIQIGVLN  468

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             E  Y+KL K++ N +G  VL++  +  +WLVGEGLT EEQ+KA KGT FIP SQ PPK  
Sbjct  469   EQLYKKLNKVSNNYEGTLVLAKGHSHHIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKIV  528

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  PAM APPSL N+H+CENWLPRR MSA R++G+VHA+EGW  HECG  M DI
Sbjct  529   RKDCFYHCTPAMKAPPSLENMHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECGYGMSDI  588

Query  424   DKVWEAALSHGFRPL  380
             D+VW+A L HGF+PL
Sbjct  589   DRVWKATLGHGFQPL  603



>gb|KDO85387.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/617 (63%), Positives = 493/617 (80%), Gaps = 23/617 (4%)
 Frame = -3

Query  2164  KYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRI  1985
             ++VVL+PW  HS+Y F+ S +SERDY  FLI PFLL RMLH+Q+WIS SR+RTA   NRI
Sbjct  20    QHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRI  79

Query  1984  VDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKG-SRLPAWRTDGVLMTVAIHVGPV  1808
             VDK IEF+QVDRE NWDDQ+V NGL+FY+   ++    S L  WR+DGV++T+ +H+GPV
Sbjct  80    VDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPV  139

Query  1807  EFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFT  1628
             EF+YYW HRALHHH+LYSRYHSHHHSS+VTEPITSVIHPF EHI YFLLFAIP++TT+  
Sbjct  140   EFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVL  199

Query  1627  GTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTN  1448
               AS +S +GY+ Y+D MNNMGHCNFEFIP WLF++FPPLK+LMYTPSYHSLHHTQFRTN
Sbjct  200   KNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTN  259

Query  1447  YSLFMPFYDYIYGTMDKSTDTLYETSLKR-GEESP------DVVHLTHLTTPESVYSIRL  1289
             YSLFMP YDYIYGT+D+S+D++YE SLKR GEE        DVVHLTHLTTPES+Y +R+
Sbjct  260   YSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRI  319

Query  1288  GFSTWAAVPQSH-----NWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIKLQSWVI  1127
             GF++ A+ P  +      WY+ L+WP T   +++++ IYG+TF+ + N L+K+KLQ+WV+
Sbjct  320   GFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVV  379

Query  1126  PRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQKYP-K  950
             PRY VQY L W+ +AINSLIEEAI+EA+ KGVKV+SLGLLNQ EELNRNGE Y+++ P K
Sbjct  380   PRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNK  439

Query  949   MKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL--NKVSISIASALTQRGIKVVTSCED  776
             +KIK+VDGSSLA A++V N++PK T  VLLR  +  NKV+ ++AS+L Q GIKV T C+D
Sbjct  440   LKIKVVDGSSLAAAVVV-NSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKD  498

Query  775   DYEKLKL--ATNSKGNFVLSRSFTQ---KVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             DYEKLKL     ++ N VLS S+     K+WLVG+ LT +EQ +A KGT+FIP +QIPP+
Sbjct  499   DYEKLKLRIPVEAQHNLVLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPR  558

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC YH  PAM+ PPSL N+H+CENWL RR MSA R++GI+HALEGW+++ECG+ MC
Sbjct  559   KLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMC  618

Query  430   DIDKVWEAALSHGFRPL  380
             DI +VW A+L HGFRPL
Sbjct  619   DIHQVWHASLRHGFRPL  635



>ref|XP_006365794.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=625

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/622 (61%), Positives = 493/622 (79%), Gaps = 11/622 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LGNFKY+VL P+V HS+YSF+     E D     ILPFLL R +H
Sbjct  1     MASKPGILTEWPWANLGNFKYLVLVPFVGHSIYSFL----REGDIGYIAILPFLLFRFIH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRHRTA G NRIVD+ IEF+QVDRE++WDDQ++ NGLL+Y+    + +   LP
Sbjct  57    NQIWISLSRHRTAKGNNRIVDRSIEFDQVDRENSWDDQIIFNGLLYYIGYLRMEQVHHLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++T  IH+GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVT+PI++ IHPF E
Sbjct  117   LWRTDGLIITALIHIGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTQPISAFIHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
               +Y+ +FA+PV+ T FTGT S +++  YV + D MNN+GHCNFE IPKW+FS+FPPLKY
Sbjct  177   VASYYAIFAVPVIATEFTGTTSVATITLYVIFTDFMNNLGHCNFEVIPKWMFSLFPPLKY  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHTQFRTNYSLFMP YDYI+GTMDKS+DTLYE SL++  E PDVVHLTHL
Sbjct  237   LIYTPSYHSLHHTQFRTNYSLFMPIYDYIFGTMDKSSDTLYEKSLEKKAEVPDVVHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQ--SHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             TT +++Y +RLGFS+ A+ P   S  WY+WLMWPVTLW+++I  IY  TF+++RN+ + +
Sbjct  297   TTLQAIYHLRLGFSSLASKPHMTSSKWYLWLMWPVTLWSIVITWIYSHTFVIERNLFKDL  356

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQ+W IP+++ QY  +WQ ++IN+LI+EAI+EA+ KGVKVLSLGLLNQ+++LN NG+ Y
Sbjct  357   KLQTWAIPKFRKQYFSQWQRKSINNLIKEAIMEADQKGVKVLSLGLLNQAKKLNNNGKIY  416

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRA-NLNKVSISIASALTQRGIKVV  791
             I+K+P++K+K+VDGSSL VA+++ N+IPKGT++V+L+A  L+KV+ +IA AL QRGI+VV
Sbjct  417   IRKHPELKVKVVDGSSLVVAVVL-NSIPKGTSQVVLQARRLSKVASAIALALCQRGIQVV  475

Query  790   TSCEDDYEKLK--LATNSKGNFVLSRS-FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQI  620
             T  E++Y+ LK      +  N VLS+S    K WLV +GL+++EQ+KA KGTLFIP S  
Sbjct  476   TLDEEEYKGLKARFTPEAAANLVLSKSTCVSKTWLVDDGLSEDEQLKAPKGTLFIPYSPF  535

Query  619   PPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGE  440
             PPKK   DC Y   PAM+ P  L N+ +CENWLPRR MSA+R++GI+HA EGWN HECG+
Sbjct  536   PPKKVSEDCFYFSTPAMICPKHLQNVDSCENWLPRRVMSASRIAGILHASEGWNEHECGD  595

Query  439   KMCDIDKVWEAALSHGFRPLPL  374
              M D+DKVW+A+L HGF P  +
Sbjct  596   MMFDVDKVWKASLDHGFSPFTM  617



>ref|XP_007015842.1| CER1 protein isoform 1 [Theobroma cacao]
 gb|EOY33461.1| CER1 protein isoform 1 [Theobroma cacao]
Length=618

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/617 (61%), Positives = 479/617 (78%), Gaps = 2/617 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG L+DWPW+ +GNFKY +L P   +S YSF+T+ E+ER+   FL+ PFLL R  H
Sbjct  1     MATKPGILSDWPWQSIGNFKYALLVPGAIYSTYSFITTAENERNLFMFLVFPFLLFRFAH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
              QLWIS SR+RTA G NRIVDK ++FEQVDRE +WDDQ+VLNG+LFY    VL     +P
Sbjct  61    YQLWISVSRYRTAKGNNRIVDKSLDFEQVDRERSWDDQIVLNGILFYAAGVVLRDQFNMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              ++ DG ++T+ +H GP EF+YYWLHRALHHH+LY+RYHSHHHSSIVTEP TS +HPF E
Sbjct  121   FFKADGTIITLLLHWGPAEFLYYWLHRALHHHYLYARYHSHHHSSIVTEPNTSFVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              I+Y++L  IP+LT+++ G AS   +  YVT +D +NNMGHCNFEFIP+W F+IFPPLKY
Sbjct  181   VISYYVLLLIPILTSIYIGKASIIGVFTYVTVVDFLNNMGHCNFEFIPEWAFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             ++YTPS+HSLHHTQFRTNYSLF PFYDY+YGT+DKSTD+LYET++KR  ESPDVVHLTHL
Sbjct  241   IVYTPSFHSLHHTQFRTNYSLFCPFYDYVYGTVDKSTDSLYETTIKREAESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y + LGF + ++ PQ+  WY+  MWPVTLW++++  IYG  FI +RN  +K+KL
Sbjct  301   TTPDSIYHLPLGFPSLSSKPQASKWYLLFMWPVTLWSVLLTWIYGHAFISERNAFKKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WV+P+Y +QY  +WQ + I+ LI EAI +A+ KG KVLSLGLLNQ EE +RN E YI+
Sbjct  361   QAWVVPKYNMQYFSKWQRETISKLIGEAIQDADKKGAKVLSLGLLNQHEEFSRNIELYIK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++KIK+VDGSSLA AI++ N IPK TT+VLLR  ++K +  +  AL Q+GI+VVT  
Sbjct  421   RHPQLKIKVVDGSSLAAAIVL-NCIPKETTQVLLRGRISKDACLLVQALCQKGIQVVTLQ  479

Query  781   EDDYEK-LKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             EDDY+K LK     + N V S  +  KVWLVG+GLT +EQ KA KGTLFIP S  PP + 
Sbjct  480   EDDYKKLLKYDNKLESNLVPSARYDVKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQI  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  PAM AP S+ N+H+CE+WLPRR MSA+RV+GI+HA EGW V+ECG     I
Sbjct  540   RKDCYYHTTPAMEAPKSVENMHSCEDWLPRRVMSASRVAGIIHASEGWEVNECGGTTFSI  599

Query  424   DKVWEAALSHGFRPLPL  374
             DKVWEA+L HGFRPL +
Sbjct  600   DKVWEASLEHGFRPLSI  616



>ref|XP_004145021.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 ref|XP_004153200.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN46281.1| hypothetical protein Csa_6G079750 [Cucumis sativus]
Length=618

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/619 (62%), Positives = 479/619 (77%), Gaps = 3/619 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK+V+L+PWV HS Y +    E +RD +  LI PFL+ RM+H
Sbjct  1     MASKPGILTDWPWKPLGSFKFVILTPWVIHSSYLYFKGGE-KRDLSYILIFPFLVLRMIH  59

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA G  RIVDKPIEFEQVDRES+WDDQ++ NGLLF L   V+ KG  LP
Sbjct  60    NQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSWDDQILFNGLLFCLGRMVVEKGENLP  119

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRT+GV++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSI TEPITSVIHPF E
Sbjct  120   LWRTNGVVIAALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFAE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YFLLF IP+L T+ T TAS  S + YV +ID MNNMGHCNFE +PK LF IFPPLKY
Sbjct  180   HIVYFLLFTIPLLVTVLTETASIGSFVLYVMFIDFMNNMGHCNFEIVPKSLFFIFPPLKY  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMP YDYIYGT+DK++D+LYE SL R EE  DVVHL+HL
Sbjct  240   LIYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTVDKNSDSLYENSLLREEEVADVVHLSHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y +RLG +T A+ P +  W++ L+WP T + ++    YG  F+ +RN  + +KL
Sbjct  300   TTPQSIYHMRLGLATVASQPFTSKWWLTLLWPFTSFYVLATSFYGHIFVYERNTFKALKL  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ +QY ++ + +AIN LIE AI++A+ KGVKVLSLGLLNQ +ELN  GEFYI 
Sbjct  360   QSWVIPRFNLQYFMKGRREAINKLIEAAILDADKKGVKVLSLGLLNQGKELNEYGEFYIH  419

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYP ++IKLVDGSSLA AI++ NTIPK TT+VLLR NL+KV+ +IA AL Q G +V T  
Sbjct  420   KYPNLRIKLVDGSSLAAAIVI-NTIPKATTKVLLRGNLSKVAYAIADALCQLGFQVATLY  478

Query  781   EDDYEKLK-LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             E++++KLK   T +  N VL++  T K+W+VG+GL + EQ+ A KGT+FIP SQ PP++ 
Sbjct  479   ENEHKKLKSKVTTNSNNLVLAKITTHKIWIVGDGLEEFEQLNAPKGTIFIPYSQFPPQRL  538

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  P+M  P S  N+ +CENWLPRR MSA R++GI+HALEG   HECGE M  +
Sbjct  539   RKDCYYHITPSMRVPSSFQNIDSCENWLPRRVMSAWRMAGILHALEGREGHECGETMLSL  598

Query  424   DKVWEAALSHGFRPLPLPN  368
             D  W A+L +GF PL +P+
Sbjct  599   DDAWRASLENGFLPLEIPS  617



>ref|XP_006354618.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=589

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/615 (62%), Positives = 482/615 (78%), Gaps = 33/615 (5%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW  LGN KY+VL+P+  HS+Y+F  S +ES+RD    L+LPF LSRM+
Sbjct  1     MATKPGILTEWPWAGLGNLKYLVLAPFACHSIYTFFMSRDESQRDMFYILVLPFTLSRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H QLWIS SR+RTA G NRI+DK IEF+QVDRESNWDDQ++L GL++Y+   ++ +   +
Sbjct  61    HYQLWISISRYRTAKGNNRIIDKSIEFDQVDRESNWDDQIILFGLVYYIGYLIVEQAHHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  IH+GPVEF+YYW HRALHHHFLYSRYHSHHHSSI TEPIT+VIHPF 
Sbjct  121   PVWRTDGIIITALIHIGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIATEPITAVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY++LFAIPV TT+FTGT S +SL  Y  Y+D MN MGHCNFE IPKW FSIFPPLK
Sbjct  181   ELLAYYMLFAIPVFTTVFTGTVSMASLGAYTIYLDFMNLMGHCNFELIPKWTFSIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDY+ GT+DKS+DTLYE SL+R  E PDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYLNGTVDKSSDTLYEKSLEREAEVPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTT ES+Y +RLGF++ A+ P +  WY+ LMWPVTL ++++  IYG TF+++RN+ + +K
Sbjct  301   LTTLESIYHLRLGFASLASKPHASKWYLLLMWPVTLCSIVLTWIYGHTFVVERNLFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W IP+Y++QY ++W+ ++IN LIEEAIIEA+ KG+KVLSLGLLNQ E+LN +GEFY+
Sbjct  361   LQTWAIPKYRIQYFMQWERESINYLIEEAIIEADQKGIKVLSLGLLNQEEQLNSHGEFYV  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             ++YP +K+K+VDGSSLAVA+++ N+IP+GT++V+LR +L+KV+ SIA AL Q  I     
Sbjct  421   KRYPHLKVKVVDGSSLAVAVVL-NSIPEGTSQVVLRGSLSKVANSIALALCQGEI-----  474

Query  784   CEDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
                                       + WLVG+GL+ +EQ+KA KGTLFIP SQ P +K 
Sbjct  475   --------------------------QTWLVGDGLSDDEQLKAPKGTLFIPFSQFPLRKV  508

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC Y + PAM+AP  L N+ +CENWLPRR MSA RV+GIVHALEGWN H+CGE M D+
Sbjct  509   RKDCFYFNTPAMIAPKHLENVDSCENWLPRRVMSAWRVAGIVHALEGWNEHDCGEMMIDV  568

Query  424   DKVWEAALSHGFRPL  380
             +KVW+A+LSHGF  L
Sbjct  569   EKVWKASLSHGFCSL  583



>ref|XP_006418509.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
 gb|ESQ36862.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
Length=615

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/625 (61%), Positives = 485/625 (78%), Gaps = 18/625 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKYVV++PW  HS Y FVT +  ++D   FL+ PFLL R+LH
Sbjct  1     MATKPGILTDWPWTPLGSFKYVVIAPWAVHSTYKFVTDDPEKKDLGYFLVFPFLLLRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ TA GK RI+DK I+F QVDRE+NWDDQ++ NGL FY+   +L +G +LP
Sbjct  61    NQVWISLSRYCTAKGKRRILDKGIDFNQVDRETNWDDQILFNGLWFYIGMRLLPQGKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLMAAVLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LF+IP+LTTL T TAS +S  GYV YID MNNMGHCNFE +PK LF +FPPLK+
Sbjct  181   HIAYFVLFSIPLLTTLITETASIASFAGYVMYIDFMNNMGHCNFEIVPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGTMD+++DTLYE +L+RGE+  DVVHLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTMDETSDTLYEKTLERGEDRVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P S+ W++ L+WP T  +M+    Y + F      L++ +L
Sbjct  301   TTPESIYHLRIGLASFASYPFSYTWFMRLLWPFTSLSMLFTLFYARLFCCREKFLQEAQL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
                        YLL+W+  AIN++IE+A++EA+ KGVKVLSLGL+NQ EELNR GE YI 
Sbjct  361   ----------AYLLKWRKDAINNMIEKAVLEADKKGVKVLSLGLMNQGEELNRYGEVYIH  410

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P +K+++VDGS L  A+++ N++PK TT V++  NL KV+ +IASAL QRG++V T  
Sbjct  411   KHPDVKVRVVDGSRLTAAVVI-NSVPKSTTSVVMTGNLTKVAYTIASALCQRGVQVSTLF  469

Query  781   EDDYEKLK--LATNSKGNFV--LSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+YEKL+  +    +G+ V   S +F + KVWLVGEG T+E+Q KAT GTLFIP SQ P
Sbjct  470   PDEYEKLRSSVPRECRGHLVHLTSEAFSSSKVWLVGEGTTREDQEKATNGTLFIPFSQFP  529

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              K+ R+DC YH  PA++ P SL N+H+CENWLPR+AMSA RV+GI+HA+EGW +HECG  
Sbjct  530   LKQLRKDCIYHTTPALIVPKSLVNIHSCENWLPRKAMSATRVAGILHAVEGWEMHECGAS  589

Query  436   --MCDIDKVWEAALSHGFRPLPLPN  368
               + D+D+VWEA LSHGF+PL LP+
Sbjct  590   VLLSDLDQVWEACLSHGFQPLLLPD  614



>ref|XP_010247895.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/620 (61%), Positives = 485/620 (78%), Gaps = 6/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA +PG LT +PW+ LGNFKYVVL+PW+ HS Y FVT +E ERD   FL+LP+LLSR++H
Sbjct  1     MALSPGPLTKYPWEKLGNFKYVVLAPWIVHSTYQFVTKDEKERDLAYFLMLPYLLSRVIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
              Q+WIS +R+ TA  K+RIVDK IEFEQVDRE NWDD ++ NG+++YL  T+L   SR+P
Sbjct  61    AQIWISLARYMTAKSKHRIVDKGIEFEQVDRERNWDDNIIFNGIIYYLAITLLPGASRMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              +R DG+L+   +HVGPVEF+YYW HRALHHH LY+ YHSHHHSSIVTEPITSVIHPF E
Sbjct  121   MFRWDGILIAALVHVGPVEFLYYWFHRALHHHILYTGYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              I YF+LF IP    L TGT S ++ +GY TYID+MN +GHCNFE  PKWLF+IFPPLKY
Sbjct  181   IIVYFILFCIPTSAALATGTLSFAAAVGYATYIDIMNYVGHCNFEIFPKWLFNIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHT+FRTNYSLFMP YDY+YGT+D +TDTLYE S+K  +E+PD+VHLTHL
Sbjct  241   LVYTPSFHSLHHTKFRTNYSLFMPIYDYMYGTVDDTTDTLYEASVKGKKETPDIVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
              T ES+Y +R GF++ A+ P   +  WY+W++WPVT  +M++  I+  TF ++RN+  ++
Sbjct  301   PTLESIYYLRPGFASLASYPYASTSKWYIWMLWPVTYGSMLLTWIFDSTFTVERNMFREL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W IPRY  QYLL W+  AIN+LIE+AI+EA   GVKV+SLGLLNQ EELNRNGE Y
Sbjct  361   KMQTWAIPRYSYQYLLSWKRNAINTLIEKAILEANEAGVKVMSLGLLNQGEELNRNGELY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             +Q++PK+KIKLVDGSSL VAI++ N+IPKGT +VL+R  L+KV  +I+  L +RGI+V  
Sbjct  421   VQRHPKLKIKLVDGSSLVVAIVL-NSIPKGTQQVLIRGKLSKVVSAISLLLCRRGIQVAV  479

Query  787   SCEDDYEKLKLATNSK--GNFVLSRSFTQKVWLV-GEGLTKEEQMKATKGTLFIPMSQIP  617
             + +DD+EKLKL   ++     +LS S+ QKVWLV  E +T +EQ KA +GT FIP+SQ+P
Sbjct  480   ASKDDFEKLKLQLPAELSSLLILSSSYKQKVWLVDNETMTDKEQQKAVEGTYFIPLSQLP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              KK R+DC Y++ PAM  P +  N+H+CENWLPRR MSA R+ GIVHALEG + HECG+ 
Sbjct  540   LKKVRKDCVYYNTPAMAIPKAFVNVHSCENWLPRRVMSAWRIGGIVHALEGLDAHECGDT  599

Query  436   MCDIDKVWEAALSHGFRPLP  377
             + D++KVW AAL HGF PLP
Sbjct  600   ILDVEKVWRAALHHGFLPLP  619



>ref|XP_010255641.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/620 (62%), Positives = 486/620 (78%), Gaps = 6/620 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWK LGNFKYV+L+PW  HS + FVT +E ERD    L+ PFLL RMLH
Sbjct  1     MASRPGPLTNWPWKKLGNFKYVILAPWAVHSTHQFVTKDEKERDLGYSLVFPFLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
              Q+WIS +R+RTA  K+RIV K IEFEQVDRE NWDDQ++ NG+L+YL   +L   SR+P
Sbjct  61    AQIWISLARNRTAESKHRIVHKGIEFEQVDRERNWDDQIIFNGILYYLAINLLPGASRIP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              +R DG+L+T  +H G VEF+YYWLHRALHHH LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   MFRWDGILLTSLLHAGLVEFLYYWLHRALHHHILYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YFLLFAIP++  L TGT S ++L GY+TY+D MN MGHCNFE IPK LF +FP LKY
Sbjct  181   HISYFLLFAIPMVVMLVTGTLSIAALAGYITYVDFMNYMGHCNFELIPKRLFELFPLLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHT+FRTNY LFMP YDY+YGT+D ++DTLYE S+K  +E+PD+VHLTHL
Sbjct  241   LVYTPSFHSLHHTKFRTNYCLFMPMYDYMYGTVDDTSDTLYEASVKGKKETPDIVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             TT ES+Y +R GF++ A+ P   +  WY+W++WPVT  +M++  I+  TF ++RN+  ++
Sbjct  301   TTLESIYYLRPGFASLASYPYDSTSKWYMWMLWPVTYGSMLLTWIFDSTFTVERNMFNEL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W IPRY  QYLL W+  AIN+LIE+AI+EA   GVKV+SLGLLNQ EELNRNGE Y
Sbjct  361   KMQTWAIPRYSYQYLLSWKRNAINTLIEKAILEANEAGVKVMSLGLLNQGEELNRNGELY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             +Q++PK+KIKLVDGSSL VAI++ N+IPKGT +VL+R  L+KV  +I+  L +RGI+V  
Sbjct  421   VQRHPKLKIKLVDGSSLVVAIVL-NSIPKGTQQVLIRGKLSKVVSAISLLLCRRGIQVAV  479

Query  787   SCEDDYEKLKLATNSK--GNFVLSRSFTQKVWLV-GEGLTKEEQMKATKGTLFIPMSQIP  617
             + +DD+EKLKL   ++     +LS S+ QKVWLV  E +T +EQ KA +GT FIP+SQ+P
Sbjct  480   ASKDDFEKLKLQLPAELSSLLILSSSYKQKVWLVDNETMTDKEQQKAVEGTYFIPLSQLP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              KK R+DC Y++ PAM  P +  N+H+CENWLPRR MSA R+ GIVHALEG + HECG+ 
Sbjct  540   LKKVRKDCVYYNTPAMAIPKAFENVHSCENWLPRRVMSAWRIGGIVHALEGLDAHECGDT  599

Query  436   MCDIDKVWEAALSHGFRPLP  377
             + D++KVW AAL HGF PLP
Sbjct  600   ILDVEKVWRAALHHGFLPLP  619



>ref|XP_008232308.1| PREDICTED: protein ECERIFERUM 1-like, partial [Prunus mume]
Length=594

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/586 (64%), Positives = 466/586 (80%), Gaps = 2/586 (0%)
 Frame = -3

Query  2134  HSLYSFVTSEESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQV  1955
             HS + FV ++  ERD + FL+L  +L R++HNQ+WIS SR+RTA G  RI+D+ +EFEQV
Sbjct  1     HSTWLFVANDAKERDVSYFLMLGVVLWRIIHNQIWISLSRYRTAKGNGRILDRGLEFEQV  60

Query  1954  DRESNWDDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAl  1775
             DRE+NWD+Q++ N LLFY  +  L    +LP WR  GVL+++ +H GPVEF+YYW HRAL
Sbjct  61    DRENNWDEQILFNALLFYTGSRHLPGAQKLPLWRAHGVLLSIVLHAGPVEFLYYWFHRAL  120

Query  1774  hhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGY  1595
             HHH+LYSRYHSHHHSSIVT+PITSVIHPF EH+ Y  LF IP+L T+ T T S  S   Y
Sbjct  121   HHHYLYSRYHSHHHSSIVTQPITSVIHPFAEHVVYSALFFIPILGTMLTRTMSVLSFTAY  180

Query  1594  VTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYI  1415
             +TYID MNNMGHCNFE IP WLFS+FPPLKY MYTPSYHSLHHTQFRTNYSLFMP YDYI
Sbjct  181   ITYIDFMNNMGHCNFELIPNWLFSLFPPLKYFMYTPSYHSLHHTQFRTNYSLFMPIYDYI  240

Query  1414  YGTMDKSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWL  1235
             Y TMDKS+D LYETSLKR EE+PDV+HLTHLTTPES+Y + LGF++ A+ P +  WY+WL
Sbjct  241   YETMDKSSDALYETSLKREEETPDVLHLTHLTTPESIYHLPLGFASLASRPHTSKWYLWL  300

Query  1234  MWPVTLWTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeai  1055
             MWPVTLW+MI+  IYG+TF+++R   + ++LQ+W IP+Y +QY L+WQ++AIN LIEEAI
Sbjct  301   MWPVTLWSMILTWIYGRTFVVERQRFDNLRLQTWAIPKYNLQYYLQWQNEAINRLIEEAI  360

Query  1054  ieaEgkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGT  875
             I+AE KGVKVL LGLLNQ EELNR G  Y+ ++P +KI++VDGSSLAVAI + NTIPKGT
Sbjct  361   IQAEEKGVKVLCLGLLNQGEELNRYGGLYVHRHPHLKIRVVDGSSLAVAITL-NTIPKGT  419

Query  874   TEVLLRANLNKVSISIASALTQRGIKVVTSCEDDYEKL-KLATNSKGNFVLSRSFTQKVW  698
             T+VLLR NL KV+ ++A AL Q+GI+V T   D+Y KL K  +  +   +L++S+  KVW
Sbjct  420   TQVLLRGNLTKVAYAVAFALCQKGIQVATLHHDEYLKLTKSLSGMESGLLLAKSYAHKVW  479

Query  697   LVGEGLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLP  518
             LVG+GL++EEQ++A KGTLF+P SQ PPKK R+DC YH+ PAM  P SL N+HACENWLP
Sbjct  480   LVGDGLSEEEQLRAPKGTLFVPFSQFPPKKLRKDCFYHYTPAMRTPISLENVHACENWLP  539

Query  517   RRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             RR MSA R++GIVHALEGW  HECG  M +ID VW+A L HGF+PL
Sbjct  540   RRVMSAWRIAGIVHALEGWKEHECGYNMSNIDNVWQATLQHGFQPL  585



>gb|KDP28917.1| hypothetical protein JCGZ_14688 [Jatropha curcas]
Length=571

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 461/563 (82%), Gaps = 5/563 (1%)
 Frame = -3

Query  2050  MLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGS  1871
             MLHNQLWIS SR+RTA G  RI+D+ IEF+QVDRE NWDDQ++ NG+LFY+ + VL   +
Sbjct  1     MLHNQLWISLSRYRTAKGSKRILDRGIEFDQVDRERNWDDQILFNGILFYVGSMVLPNAT  60

Query  1870  RLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHP  1691
              LP WR DGV++T+ +H GPVEF+YYW HR LHHH+LYSRYHSHHHSSIVTEPITSVIHP
Sbjct  61    HLPLWRKDGVILTILLHAGPVEFLYYWFHRLLHHHYLYSRYHSHHHSSIVTEPITSVIHP  120

Query  1690  FGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPP  1511
             F EHIAY++LFAIP+LTTLF GTAS +S  GY+T+ID MNNMGHCNFE IPKWLFSIFPP
Sbjct  121   FAEHIAYYMLFAIPMLTTLFNGTASTASFFGYITWIDFMNNMGHCNFELIPKWLFSIFPP  180

Query  1510  LKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHL  1331
             LKYLMYTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKS+D+LYE SLKR EE PDVVHL
Sbjct  181   LKYLMYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTADKSSDSLYENSLKRQEEFPDVVHL  240

Query  1330  THLTTPESVYSIRLGFSTWAAVP--QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNIL  1157
             THLT+P+S+Y +RLGF+  A+ P  Q  NWY+ LMWPVTLWTMI   IYG+TF+++RN  
Sbjct  241   THLTSPDSIYHLRLGFAYLASTPETQKSNWYLCLMWPVTLWTMICAWIYGRTFVVERNRF  300

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
              K+ LQ+W IPRY +QY ++WQ+Q+IN++IEEAI+EA+ KGVKVLSLGLLNQ EELN  G
Sbjct  301   HKLTLQTWAIPRYNLQYCMQWQNQSINNMIEEAILEADRKGVKVLSLGLLNQGEELNGYG  360

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y++++P++K K+VDGSSLAVA ++ N+IPKGT ++LL  + +KV+  + SAL QRGI+
Sbjct  361   EVYVKRHPRLKTKVVDGSSLAVAAVL-NSIPKGTAQLLLTGSPSKVAFGVVSALCQRGIQ  419

Query  796   VVTSCEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQ  623
             V T+ + DYEK+K +  S+   N +LS+ ++ K WLV E L++EEQ KATKGTLFIP+SQ
Sbjct  420   VKTALKKDYEKVKTSLGSEYHSNLLLSKDYSVKTWLVDERLSEEEQKKATKGTLFIPLSQ  479

Query  622   IPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG  443
              PPKK R DC YH  PAM+AP SL N+ +CENWLPRR MSA RV+GIVHALE W V ECG
Sbjct  480   FPPKKLRNDCFYHTTPAMVAPASLENVDSCENWLPRRVMSAWRVAGIVHALEEWKVDECG  539

Query  442   EKMCDIDKVWEAALSHGFRPLPL  374
               M  IDKVW+AAL HGF+PL +
Sbjct  540   YSMYHIDKVWQAALRHGFKPLSI  562



>ref|XP_002526511.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35902.1| sterol desaturase, putative [Ricinus communis]
Length=617

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/618 (61%), Positives = 487/618 (79%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWK LG+FKYV+L+PWV HS+YSFV  EE ERD T+ LI P +L R+LH
Sbjct  1     MASRPGILTDWPWKSLGDFKYVILAPWVVHSIYSFVVKEEKERDLTSVLIFPSILLRLLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA GK R+VDK IEF+QVDRE +WDDQV+L G++ Y  N  +A  S +P
Sbjct  61    NQIWISVSRYQTAKGKKRVVDKCIEFDQVDRERDWDDQVLLYGIITYSINMGVAGASNMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVT+PI+SVIHPF E
Sbjct  121   IWRTDGVVLTMILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTQPISSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY+LLF IP+L ++F+GTAS +S +GY+ YID MNN+GHCNFE IPK LFS  PPLKY
Sbjct  181   ILAYYLLFLIPILASIFSGTASVASAVGYIFYIDFMNNLGHCNFEIIPKSLFSFCPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIYGTMDK  D L+E SL + ++SP +VHLTH 
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTMDKCCDQLHEASLAKPQDSPALVHLTHF  300

Query  1321  TTPESVYSIRLGF--STWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             TTP+S+Y +RLGF          S + ++W+ +P+T   M+  C +G++F+ +RN  + +
Sbjct  301   TTPDSIYHLRLGFASLASRPSSSSASSFLWIFYPLTYLFMVFACFFGRSFVAERNSFKNL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
               Q+W+IPR++  YLLE ++ AIN LIEEAI EAE +G KVLSLGLLNQ++ELNRNG+ Y
Sbjct  361   VSQTWIIPRFRKHYLLESETTAINDLIEEAIAEAEARGSKVLSLGLLNQAKELNRNGQIY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             I+K+P++K+KLVDGSSLA A+++ N+IPKGT +VLL    NKV+ +IASAL  RG ++V 
Sbjct  421   IEKHPQLKVKLVDGSSLAAAVVI-NSIPKGTMQVLLNGKFNKVAKAIASALCLRGTQIVV  479

Query  787   SCEDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
               E+ Y K+ L        ++S+S+ QK+WLVG+ ++++EQ++A KGTLFIP +Q P ++
Sbjct  480   LDEEGYGKVGLQNE---KVMVSKSYDQKIWLVGDEISEKEQLQAPKGTLFIPFTQFPIRR  536

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC Y   PAML+P SLHNL +CENWLPRRAMSA R++GI+HALE W V+ECGE +  
Sbjct  537   IRKDCFYQITPAMLSPDSLHNLDSCENWLPRRAMSAWRIAGIIHALEEWKVNECGESIFS  596

Query  427   IDKVWEAALSHGFRPLPL  374
             I +VWEA+L HGFRPL +
Sbjct  597   IHRVWEASLHHGFRPLSI  614



>ref|XP_006480707.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
Length=592

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/590 (64%), Positives = 473/590 (80%), Gaps = 9/590 (2%)
 Frame = -3

Query  2116  VTSEESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNW  1937
             +  +E ERD  NFLI PFLL RMLHNQ+WIS SR+RTA G+NRIVDKPIEFEQVDRE NW
Sbjct  1     MVKDEKERDLLNFLIFPFLLWRMLHNQIWISLSRYRTAKGRNRIVDKPIEFEQVDRERNW  60

Query  1936  DDQVVLNGLLFYL-FNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhfl  1760
             DDQ++L+G+LFY+ F  +L  G++LP WR DGV++   +H GPVEF+YYWLHRALHHH+L
Sbjct  61    DDQIILSGILFYVVFGKMLPGGTQLPIWRLDGVILMALLHAGPVEFVYYWLHRALHHHYL  120

Query  1759  ysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYID  1580
             YSRYHSHHHSSIVTEPITSV HPF EHIAYF++FA P++TT+ TG  S     GY+TYID
Sbjct  121   YSRYHSHHHSSIVTEPITSVTHPFAEHIAYFVVFATPLITTVLTGAGSIVLAFGYITYID  180

Query  1579  LMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMD  1400
             LMNNMGHCNFE IPKWLF+IFPPLKYLMYTPS+HSLHHTQFR NYSLFMP YDY++ T+D
Sbjct  181   LMNNMGHCNFELIPKWLFTIFPPLKYLMYTPSFHSLHHTQFRANYSLFMPLYDYLFSTVD  240

Query  1399  KSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSH---NWYVWLMW  1229
             K++DTLYETSLK+ ++S DVV+LTHLTTPES+Y +RLG ++ A+ P  H    WY WL+W
Sbjct  241   KTSDTLYETSLKKQDDSLDVVYLTHLTTPESIYHMRLGLASLASKPHHHASSEWYKWLLW  300

Query  1228  PVTLWTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiie  1049
             PVTL +M+I  IYG+TF+++RN L K+KLQ+W I +Y +QY  + Q+++IN LIEEAI+E
Sbjct  301   PVTLLSMMITWIYGRTFVVERNRLNKLKLQTWAISKYNMQYFSQRQNESINRLIEEAILE  360

Query  1048  aEgkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTE  869
             AE KG +V+SLGLLNQ EELNR G  ++ K P++KIK+VDGSSLAVA++  N+IP GTT+
Sbjct  361   AEEKGARVISLGLLNQGEELNRFGGLFVHKNPELKIKVVDGSSLAVAVL-TNSIPDGTTQ  419

Query  868   VLLRANLNKVSISIASALTQRGIKVVTSCEDDYEKLKLATNSKG---NFVLSRSFTQKVW  698
             V++R  L KV+ + A AL Q+GI+VVT  ED++EKL  +   K    N ++SRS+ QK+W
Sbjct  420   VVIRGILTKVAYATAFALCQKGIQVVTLREDEHEKLIRSFGGKSESKNLLVSRSYCQKIW  479

Query  697   LVGEGLTKEEQMKATKGTLFIPMSQIPP-KKHRRDCSYHHPPAMLAPPSLHNLHACENWL  521
             LVG GLT+EEQ KA +GT+F+P SQ PP KK R+DC+YH  PAM  P +L N+ +CENWL
Sbjct  480   LVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCENWL  539

Query  520   PRRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPLPLP  371
             PRR MSA R+ GIVHALEGWN HECG  + ++D VW+AAL HGF PL +P
Sbjct  540   PRRVMSAWRIGGIVHALEGWNEHECGYTISNVDTVWDAALRHGFLPLTIP  589



>ref|XP_010255640.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=627

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/617 (62%), Positives = 476/617 (77%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW+ LGNFKYVVL+PWV HS+Y FVT +E+ERD    L  PFLLSRMLH
Sbjct  1     MASKPGPLTNWPWQKLGNFKYVVLAPWVVHSIYQFVTKDENERDVGYLLTFPFLLSRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +QLWIS +R++TA  K+RIV K IEFEQVDRE NWDDQ++LNG++ Y+   +    SRLP
Sbjct  61    SQLWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGIVNYIIPQIFPGASRLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+ + +  H GPVEF+YYWLHR LHHHFLYSRYHSHHH+S+VTEPITSV+HPF E
Sbjct  121   MWRWDGIFLVILFHAGPVEFLYYWLHRVLHHHFLYSRYHSHHHASVVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF LF+IP++ T+FTGT S  ++  Y TY+D MNNMGHCNFE +PK LFSIFP LKY
Sbjct  181   HLLYFSLFSIPIMATVFTGTISLGAIGLYFTYVDFMNNMGHCNFEMVPKRLFSIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHT+FRTNYSLFMP YDY+Y TMD S+DT+YETS K  +E+P VVHLTHL
Sbjct  241   LMYTPSFHSLHHTKFRTNYSLFMPIYDYMYATMDDSSDTVYETSHKGQQETPHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT ES+Y +R GF++ A+ P +  WY+W++WPVT  +M+   I    F ++RN+  ++K+
Sbjct  301   TTLESIYHLRPGFASLASGPYTPKWYLWMLWPVTYVSMLFAWISSSIFTVERNLFNELKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IPRY  QYL  W+  +IN LIE+A++EA+  GV+VLSLGLLNQ EELN NGE Y++
Sbjct  361   QTWAIPRYSFQYLFSWKRDSINGLIEKAVLEADAGGVRVLSLGLLNQGEELNGNGELYVK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+PK+KI+LVDGSSL VAI++ NTIPKGT +VLLR    K+  +IA  L Q+G++V  +C
Sbjct  421   KHPKLKIRLVDGSSLVVAIVL-NTIPKGTKQVLLRGKPYKIVSAIALYLCQKGVQVAVAC  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEG-LTKEEQMKATKGTLFIPMSQIPPK  611
             +DD EKLK  L      N  LS S++QKVWLV EG +T EEQ KA KGT FIP S  PPK
Sbjct  480   KDDLEKLKLRLPKELWSNLSLSSSYSQKVWLVDEGVITSEEQRKAPKGTHFIPFSHFPPK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             K R+DC Y++ PAM  P +  N+H+CENWLPRR MSA R++GIVHALEGW  HECGE M 
Sbjct  540   KVRKDCIYYNTPAMAIPKAFENVHSCENWLPRRVMSAWRIAGIVHALEGWKEHECGETML  599

Query  430   DIDKVWEAALSHGFRPL  380
             D+ KV+ AAL HGF PL
Sbjct  600   DVHKVYVAALRHGFLPL  616



>ref|XP_007015845.1| CER1 protein [Theobroma cacao]
 gb|EOY33464.1| CER1 protein [Theobroma cacao]
Length=618

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/617 (60%), Positives = 479/617 (78%), Gaps = 2/617 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTD PW+ +G FKY +L P   +S YSF+T+ E+ER+   FL+ PFLL R+ H
Sbjct  1     MASKPGILTDSPWQSIGYFKYALLVPGAIYSTYSFITTAENERNLFMFLVFPFLLFRLAH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +QLWIS SR+RTA G NRIVDK ++FEQVDRE +WDDQ+V+NG+LFY    VL     +P
Sbjct  61    HQLWISVSRYRTAKGNNRIVDKSLDFEQVDRERSWDDQMVVNGILFYAAGVVLRDQFNMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              ++ DG ++T+ +H GPVEF+YYWLHRALHHH+LY+RYHSHH SSIVTEP TS +HPF E
Sbjct  121   FFKADGTIITLLLHWGPVEFVYYWLHRALHHHYLYARYHSHHQSSIVTEPNTSFVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              ++Y++LF IP+ T+++ G AS   +  Y T ID +NNMGHCNFEFIP+W F+IFPPLKY
Sbjct  181   VLSYYVLFLIPISTSIYIGKASIIGVFTYFTVIDFLNNMGHCNFEFIPEWAFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             ++YTPS+HSLHHTQFRTNYSL+ PFYDY+YGT+DKSTDTLYET++KR  ESPDVVHLTHL
Sbjct  241   IVYTPSFHSLHHTQFRTNYSLYCPFYDYVYGTVDKSTDTLYETTIKREAESPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTP+S+Y + LGF + ++ PQ+  WY+  MWPVTLW++++  IYG  FI +RN  +K+KL
Sbjct  301   TTPDSIYHLPLGFPSLSSKPQASKWYLLFMWPVTLWSVLLTWIYGHAFISERNAFKKLKL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WV+P+Y +QY  +WQ + ++ LI EAI +A+ KG KVLSLGLLNQ EE +RN E Y++
Sbjct  361   QAWVVPKYNMQYFSKWQRETVSKLIGEAIQDADKKGAKVLSLGLLNQHEEFSRNIELYMK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++KIK+VDGSSLA AI++ N IPK TT+VLLR  ++K +  +  AL Q+GI+VVT  
Sbjct  421   RHPQLKIKVVDGSSLAAAIVL-NCIPKETTQVLLRGRISKDACLLVQALCQKGIQVVTLQ  479

Query  781   EDDYEK-LKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             EDDY+K LK     + N VLS  +  KVWLVG+GLT +EQ KA KGTLFIP S  PP + 
Sbjct  480   EDDYKKLLKYDNKLESNLVLSARYDVKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQI  539

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH  PAM AP S+ N+H+CE+WLPRR MSA+RV+GI+HA EGW V+ECG     I
Sbjct  540   RKDCYYHTTPAMEAPKSVENMHSCEDWLPRRVMSASRVAGIIHASEGWEVNECGGTTFSI  599

Query  424   DKVWEAALSHGFRPLPL  374
             DKVWEA+L HGFRPL +
Sbjct  600   DKVWEASLEHGFRPLSI  616



>gb|EPS71900.1| hypothetical protein M569_02856, partial [Genlisea aurea]
Length=619

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/619 (63%), Positives = 485/619 (78%), Gaps = 6/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESE-RDYTNFLILPFLLSRML  2045
             MA+ PG LT WPW  LGN+KYVVL+P   ++  S++   ESE RD    L+LP L+SR L
Sbjct  1     MASKPGILTQWPWGCLGNYKYVVLAPMAIYTTSSYLMKNESEKRDMLPVLVLPLLISRFL  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SRHRTA G NRIVD+ IEFEQVDRESNWDDQ++ NGL  YL      K   L
Sbjct  61    HNQIWISISRHRTAQGTNRIVDRSIEFEQVDRESNWDDQIIFNGLYMYLLLIFEKKAQNL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG++ T  +H GPVE+ YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PFWRTDGMIWTFILHAGPVEYTYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAY+ +F+IP LTT++ G AS  S+  Y+TYID MNN+GHCNFE IPKWLFS FPPLK
Sbjct  181   EHIAYYAIFSIPFLTTIYMGKASILSIGIYLTYIDFMNNLGHCNFELIPKWLFSAFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YL+YTPS+HSLHHTQF+TNYSLFMPFYDY+YGT DKS+DTLYE SL R EE PDVVHLTH
Sbjct  241   YLIYTPSFHSLHHTQFQTNYSLFMPFYDYLYGTEDKSSDTLYERSLVRKEEIPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTPES++ +R+GF+ +AA PQ  N ++WLMWP+TLW+M I+ IYGQ F L+RN+ + +K
Sbjct  301   LTTPESIFHLRIGFAHYAATPQKFNRFLWLMWPITLWSMFISWIYGQAFTLERNVFKHLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W I +Y +QYL E Q +++NSLIE+ I+EA+G+GVKV++LGLLNQ E LN +GE ++
Sbjct  361   LQTWAISKYSIQYLTESQRKSVNSLIEKTILEADGRGVKVMTLGLLNQDEHLNNHGEIFL  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
              K P++K++LVDGSSLAVA+++ ++IPKGTT+++L   L+KV+ S+A  L Q GIKV T 
Sbjct  421   TKNPQLKLRLVDGSSLAVAVVL-HSIPKGTTQLVLTGKLSKVAYSLALELCQGGIKVFTM  479

Query  784   CEDDYEKLK-LATNSKG-NFVLSRSFT--QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              E++Y+KLK + +N  G N +LS+      K WL+GEG+ K+EQ+KA KGT FIP S  P
Sbjct  480   YENEYKKLKQIVSNEYGNNLLLSKGSVPMTKTWLIGEGVCKKEQIKAPKGTTFIPFSHFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             PK+ R+DC+YH  PAML P  L N+ +CENWLPRR MSA R++GIVHA+E WNV+E G+ 
Sbjct  540   PKEWRKDCTYHTTPAMLVPKHLENIDSCENWLPRRVMSAWRIAGIVHAMEQWNVNEFGKI  599

Query  436   MCDIDKVWEAALSHGFRPL  380
             + DI K WEA L HGF PL
Sbjct  600   VFDISKTWEATLRHGFIPL  618



>ref|XP_003625022.1| Protein WAX2 [Medicago truncatula]
 gb|ABD28316.1| Sterol desaturase [Medicago truncatula]
 gb|AES81240.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/615 (61%), Positives = 478/615 (78%), Gaps = 5/615 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+FK+V+L PW+ HS+YSF+  E   RD   +LI PF+L RMLH
Sbjct  1     MASKPGILTNWPWKPLGSFKFVILIPWIGHSIYSFIWVE---RDPIQYLICPFILVRMLH  57

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ TA GK++IVDK +EFEQVDRE+NWDDQ++   LL+Y+   +    S LP
Sbjct  58    NQIWISISRYETARGKSKIVDKSLEFEQVDRETNWDDQILFTALLYYIGYMIFPMASNLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEP+TSV HPF E
Sbjct  118   WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPVTSVAHPFAE  177

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H++YF LFAIP+LTTLF   +S ++L GYV +ID MNNMGHCNFEF PK LFS FP LKY
Sbjct  178   HLSYFTLFAIPMLTTLFIKKSSVAALYGYVFFIDFMNNMGHCNFEFFPKKLFSYFPQLKY  237

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHT+FR NYSLFMP YDYIYGT+DKSTD +YETSL R +ESPDVVHLTHL
Sbjct  238   LSYTPSFHSLHHTKFRRNYSLFMPMYDYIYGTVDKSTDVIYETSLMRPKESPDVVHLTHL  297

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT  S+Y +RLGF++ A+ PQ+  WY+ LMWP T+++M++  I G+ F+L+ N  + +KL
Sbjct  298   TTFNSIYQLRLGFASLASNPQTSKWYLHLMWPFTMFSMLMTWICGRAFVLESNSFKNLKL  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q W+IPR+K QY  +WQS+  N+LIEEAI+EAE  G KV+SLGL N++ +LN   E YI 
Sbjct  358   QCWLIPRFKRQYFSKWQSKTFNNLIEEAIVEAELNGAKVISLGLFNKNHQLNERHEHYIG  417

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P++KIK+VDGSSLA A ++ N IPKGT +VLLR   NKV+  IA+AL ++ ++VV   
Sbjct  418   RLPQLKIKVVDGSSLAAATVL-NNIPKGTNQVLLRGKFNKVAFVIANALCKKNVQVVVLY  476

Query  781   EDDYEKLKLATN-SKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             +D+ ++L+   N SKGN  LS   T K+WLVG+   + EQM+A KG+LFIP S  PPKK 
Sbjct  477   KDELKELEQRINTSKGNLALSPFNTPKIWLVGDEWDEYEQMEAPKGSLFIPFSHFPPKKM  536

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+DC YH+ PAM+ P +  N H+CENWLPRR MSA R++GI+HALEGWNVHECG+ +   
Sbjct  537   RKDCFYHYTPAMITPTTFMNSHSCENWLPRRVMSAWRIAGIIHALEGWNVHECGDTILST  596

Query  424   DKVWEAALSHGFRPL  380
             +KVWEA++ HGF+PL
Sbjct  597   EKVWEASIRHGFQPL  611



>ref|XP_009779400.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=824

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/586 (64%), Positives = 477/586 (81%), Gaps = 4/586 (1%)
 Frame = -3

Query  2116  VTSEESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNW  1937
             ++ +ES+RD    +ILP LLSR++HNQ+WIS SR+RTA G NRI+D+ IEF+QVDRESNW
Sbjct  1     MSKDESQRDLVYIIILPLLLSRVIHNQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNW  60

Query  1936  DDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhfly  1757
             DDQ++ NGL++Y+   +L +   LP WRTDG++M   +H+GPVEF+YYWLHRALHHHFLY
Sbjct  61    DDQIIFNGLIYYIGYLLLEQAHHLPLWRTDGIVMIALLHIGPVEFLYYWLHRALHHHFLY  120

Query  1756  sryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDL  1577
             SRYHSHHHSSIVTEPITSVIHPF EHI+YF+LFAIP+LT   T TAS ++   Y+TYID 
Sbjct  121   SRYHSHHHSSIVTEPITSVIHPFAEHISYFMLFAIPLLTVTLTETASITAFGAYITYIDF  180

Query  1576  MNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDK  1397
             MNNMGHCNFE IPKW+FS+FPPLKYLMYTPSYHSLHHTQF+TNYSLFMP YDYIY T+D 
Sbjct  181   MNNMGHCNFELIPKWIFSMFPPLKYLMYTPSYHSLHHTQFKTNYSLFMPMYDYIYDTLDM  240

Query  1396  STDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL  1217
             S+DTLY+ SL+R  E PDVVHLTHLTTPES+Y +RLG ++ A+ PQS  WY WLMWP TL
Sbjct  241   SSDTLYKKSLEREAEVPDVVHLTHLTTPESIYHLRLGLASLASKPQSSKWYFWLMWPATL  300

Query  1216  WTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgk  1037
             W+++I  IYG TFI++RN+ + +KLQ+W IP+Y++QY ++WQ + IN+LIEEAI+EA+ K
Sbjct  301   WSIMITWIYGHTFIVERNLFKNLKLQTWAIPKYRIQYFMKWQREIINNLIEEAIMEADQK  360

Query  1036  gvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLR  857
             G+KVLSLGLLNQ E+LN +GE YI++ P++K+ +VDGSSLAVA+++ N+IPKGT++V+LR
Sbjct  361   GIKVLSLGLLNQEEQLNNSGELYIRRNPQLKVNVVDGSSLAVAVVI-NSIPKGTSQVVLR  419

Query  856   ANLNKVSISIASALTQRGIKVVTSCEDDYEKL--KLATNSKGNFVLSRSF-TQKVWLVGE  686
               L+KV+ SIA AL Q GI+VVT  E++Y++L  KL + +    VLS+S+   K WLVG+
Sbjct  420   GRLSKVAYSIALALCQGGIQVVTLDEEEYKRLKTKLTSEAATKLVLSKSYNVSKTWLVGD  479

Query  685   GLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAM  506
             GL+++EQ+K  KGTLFIP SQ PP K R+DC Y   PAM+ P  L N+ +CENWLPRR M
Sbjct  480   GLSEDEQLKVPKGTLFIPYSQFPPSKARKDCFYFSTPAMITPKHLENVDSCENWLPRRVM  539

Query  505   SAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPLPLPN  368
             SA R++GI+HALEGWN +ECG  M DIDKVW+A+L HGF PL + +
Sbjct  540   SAWRIAGILHALEGWNENECGNMMFDIDKVWKASLDHGFCPLTMAS  585


 Score =   325 bits (832),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 204/267 (76%), Gaps = 10/267 (4%)
 Frame = -3

Query  2200  LTDWPWKPLGNFKYVVLSPWVAHSLYSFV----------TSEESERDYTNFLILPFLLSR  2051
             L  W     GN  + +   W A   + F            + ES+RD    +ILP LLSR
Sbjct  551   LEGWNENECGNMMFDIDKVWKASLDHGFCPLTMASATESKNYESQRDLVYIIILPLLLSR  610

Query  2050  MLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGS  1871
             ++HNQ+WIS SR+RTA G NRI+D+ IEF+QVDRESNWDDQ++ NGL++Y+   +L +  
Sbjct  611   VIHNQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNWDDQIIFNGLIYYIGYLLLEQAH  670

Query  1870  RLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHP  1691
              LP WRTDG++M   +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHP
Sbjct  671   HLPLWRTDGIVMIALLHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHP  730

Query  1690  FGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPP  1511
             F EHI+YF+LFAIP+LT   T TAS ++   Y+TYID MNNMGHCNFE IPKW+FS+FPP
Sbjct  731   FAEHISYFMLFAIPLLTVTLTETASITAFGAYITYIDFMNNMGHCNFELIPKWIFSMFPP  790

Query  1510  LKYLMYTPSYHSLHHTQFRTNYSLFMP  1430
             LKYLMYTPSYHSLHHTQF+TNYSLFMP
Sbjct  791   LKYLMYTPSYHSLHHTQFKTNYSLFMP  817



>ref|XP_006464363.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Citrus sinensis]
Length=611

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/607 (63%), Positives = 485/607 (80%), Gaps = 23/607 (4%)
 Frame = -3

Query  2134  HSLYSFVTSEESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQV  1955
             HS+Y F+ S +SERDY  FLI PFLL RMLH+Q+WIS SR+RTA   NRIVDK IEF+QV
Sbjct  2     HSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIVDKAIEFDQV  61

Query  1954  DRESNWDDQVVLNGLLFYLFNTVLAKG-SRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRA  1778
             DRE NWDDQ+V NGL+FY+   ++    S L  WR+DGV++T+ +H+GPVEF+YYW HRA
Sbjct  62    DRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRA  121

Query  1777  lhhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLG  1598
             LHHH+LYSRYHSHHHSS+VTEPITSVIHPF EHI YFLLFAIP++TT+    AS +S +G
Sbjct  122   LHHHYLYSRYHSHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVG  181

Query  1597  YVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDY  1418
             Y+ Y+D MNNMGHCNFEFIP WLF++FPPLK+LMYTPSYHSLHHTQFRTNYSLFMP YDY
Sbjct  182   YIIYVDFMNNMGHCNFEFIPMWLFTVFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPIYDY  241

Query  1417  IYGTMDKSTDTLYETSLKR-GEESP------DVVHLTHLTTPESVYSIRLGFSTWAAVPQ  1259
             IYGT+D+S+D++YE SLKR GEE        DVVHLTHLTTPES+Y +R+GF++ A+ P 
Sbjct  242   IYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIGFASLASKPH  301

Query  1258  SH-----NWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLE  1097
              +      WY+ L+WP T   +++++ IYG+TF+ + N L+K+KLQ+WV+PRY VQY L 
Sbjct  302   RYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLP  361

Query  1096  WQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQKYP-KMKIKLVDGSS  920
             W+ +AINSLIEEAI+EA+ KGVKV+SLGLLNQ EELNRNGE Y+++ P K+KIK+VDGSS
Sbjct  362   WRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSS  421

Query  919   LAVAIIVANTIPKGTTEVLLRANL--NKVSISIASALTQRGIKVVTSCEDDYEKLKL--A  752
             LA A++V N++PK T  VLLR  +  NKV+ ++AS+L Q GIKV T C+DDYEKLKL   
Sbjct  422   LAAAVVV-NSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIP  480

Query  751   TNSKGNFVLSRSFTQ---KVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHH  581
               ++ N VLS S+     K+WLVG+ LT +EQ +A KGT+FIP +QIPP+K R+DC YH 
Sbjct  481   VEAQHNLVLSTSYAAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHS  540

Query  580   PPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAAL  401
              PAM+ PPSL N+H+CENWL RR MSA R++GI+HALEGW+++ECG+ MCDI +VW A+L
Sbjct  541   TPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCDIHQVWHASL  600

Query  400   SHGFRPL  380
              HGFRPL
Sbjct  601   RHGFRPL  607



>ref|XP_004302222.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=596

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/601 (64%), Positives = 484/601 (81%), Gaps = 6/601 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLG FKYVVL+PWV HS YS++  EES  D    L+LPFLL RMLH
Sbjct  1     MASTPGILTDWPWTPLGKFKYVVLAPWVIHSTYSYMFGEEST-DLFYILVLPFLLWRMLH  59

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA GK  I+DK +EFEQVDRE +WDDQ++ NG+LFY+   VL K + LP
Sbjct  60    NQIWISLSRYQTAKGKA-IIDKGLEFEQVDRERDWDDQIIFNGILFYVSRCVLFK-TDLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG++MT+ +H GPVE++YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSV HPF E
Sbjct  118   IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF+LFAIP++ TL  GTAS +S   Y+T ID MNN+GHCNFEFIP W+FS+FPPLKY
Sbjct  178   HISYFMLFAIPMIGTLLIGTASLTSYFVYITCIDFMNNLGHCNFEFIPNWIFSLFPPLKY  237

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGTMDKS+D+L+E+SL++ EE+ DVVHLTHL
Sbjct  238   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDSLHESSLRK-EETTDVVHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y + L F++ A+ P++  WY+WL+WPVTL ++++  ++G++F+++R    K +L
Sbjct  297   TSTKSIYRLPLAFASLASNPRTCTWYLWLLWPVTLCSLMLTRLFGRSFVIERQRFGKHRL  356

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WVIP+Y +QY L WQ++AIN  IE+AI+EAE KGVKV+SLGL NQ E LN  G  Y+Q
Sbjct  357   QTWVIPKYSLQYSLSWQNEAINRAIEDAILEAEQKGVKVISLGLYNQGEGLNSYGGIYVQ  416

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P +KIK+VDGSSLAVA+I+ N+IPKGTT+VLL   L KV+ ++A +L QR I+VVT  
Sbjct  417   RNPGLKIKVVDGSSLAVAVIL-NSIPKGTTQVLLIGYLTKVAYALAFSLCQRDIQVVTVH  475

Query  781   EDDYEKLKLATNS-KGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             + +Y KL  + N+ +G  V  RS+ QK+WLVG+G +K+EQ+ A KGT+F+P SQ PPKK 
Sbjct  476   QAEYLKLTKSLNATEGKVVHDRSYAQKIWLVGDGSSKKEQLSAPKGTIFVPFSQFPPKKL  535

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             RRDC YH+ PAM  P SL N+++CENWLPRR MSA R++GIVHALEGWN HECG  M +I
Sbjct  536   RRDCFYHYTPAMKIPKSLENVYSCENWLPRRVMSAWRIAGIVHALEGWNEHECGYTMSNI  595

Query  424   D  422
             D
Sbjct  596   D  596



>ref|XP_009384064.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=625

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/616 (62%), Positives = 473/616 (77%), Gaps = 3/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG  T+WPW+ LGNFKY+VL+PW  HSLY  V+ E  E D T  +ILP LL RMLH
Sbjct  1     MASRPGLFTEWPWQRLGNFKYLVLAPWSLHSLYLAVSKERKELDLTYLIILPSLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R + A  KNRIVDK IEFEQVDRE NWDDQ++ NG+LFYL    +   + LP
Sbjct  61    NQVWISLARFQNARSKNRIVDKSIEFEQVDRERNWDDQIIFNGILFYLGYFYIPGATNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG L+   +H+GPVEF+YYW HRALHHHFLYSRYHSHHH+S+VTEPITSVIHPF E
Sbjct  121   VWRTDGALLMALLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASVVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YFLLF+IP++TT+ T  AS  +LLGYV YIDLMNNMGHCNFE +PKWLF++FPPLKY
Sbjct  181   HVVYFLLFSIPMVTTIVTRRASILALLGYVAYIDLMNNMGHCNFELVPKWLFTVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE SLK  EE PDVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYSTMDKSSDDLYERSLKGKEEVPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S+Y +R+GF++ A+ P +    + LMWPV   +M++  IY  +F ++RN  +KIK+
Sbjct  301   TTLQSIYHLRIGFASLASKPYNSKMPILLMWPVVWTSMLLTWIYSSSFTVERNGFKKIKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IPR+K QY L  +  AIN LIE+AI+EAE KGVKVL+L LLNQ+ ELN NGE Y+ 
Sbjct  361   QTWAIPRFKFQYGLPNERDAINDLIEKAILEAEDKGVKVLTLELLNQANELNGNGELYLH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYP +++++VDGSSLA A+++ N+IP  T +V L  NL+KV+  +AS L QR ++V+ + 
Sbjct  421   KYPNLRLRIVDGSSLAAAVVL-NSIPPETKKVALCGNLSKVAYRVASVLCQRCVEVIITR  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + +Y  LK  +  +  G  +LS +   +VWLVG+GL   EQ  A KGTLF+P S  PPKK
Sbjct  480   KHEYYMLKSQIPESIAGYLLLSNNHNTQVWLVGDGLEDVEQRTAPKGTLFVPYSSFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC+Y   PAM  P ++ N+H+CENWLPRR MSA+RV+GIVHALEGW+ HECG+K  D
Sbjct  540   VRKDCTYCTTPAMKIPDTVENMHSCENWLPRRVMSASRVAGIVHALEGWDSHECGDKTQD  599

Query  427   IDKVWEAALSHGFRPL  380
             IDK+W AAL HGF PL
Sbjct  600   IDKMWSAALRHGFLPL  615



>gb|EPS60467.1| hypothetical protein M569_14337, partial [Genlisea aurea]
Length=623

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/624 (60%), Positives = 482/624 (77%), Gaps = 11/624 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW  LGN+KY+V++P+   S Y+F+T E  ERD +NFLILP +L R++H
Sbjct  1     MASNPGILTDWPWTWLGNYKYIVMAPFAVRSTYAFITKEAHERDLSNFLILPMMLWRVVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             N LWIS+SR++TA G NRIVDK I+FEQVDRE+NWDDQ++ NGLL Y+    + +   LP
Sbjct  61    NLLWISFSRYKTAKGSNRIVDKNIDFEQVDREANWDDQILFNGLLLYVGQHYMRRSHNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W   GV+ T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSS+VTEPITSVIHPF E
Sbjct  121   FWNAGGVIWTFVLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSVVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AY+ LFA P+++T++ G  S SS+  Y+TYIDLMNNMGHCNFE IPK  FSIFPPLKY
Sbjct  181   HLAYYALFASPLVSTVYMGNISISSIALYITYIDLMNNMGHCNFEHIPKEFFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKS+D+LYE SL R E+S DVVHLTHL
Sbjct  241   LLYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTTDKSSDSLYEKSLVREEDSADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKIK  1145
             TTPES+Y + +G +  A+ P    WY+ LMWP+TLWTMI   +YG+  F+++RN+ + +K
Sbjct  301   TTPESIYHLHIGLAHLASQPYRSKWYLLLMWPLTLWTMIFTWLYGRRPFVVERNLFKHLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQS--------EEL  989
             LQ+WV+P+Y +QY + WQ++AIN +IE+A++ AE KGV++LSLGLLNQ+          L
Sbjct  361   LQTWVVPKYTIQYHMNWQAEAINGMIEDAVLSAEEKGVRILSLGLLNQASLGFTLTHNNL  420

Query  988   NRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQ  809
             N NGE +++++P +K+K+VDGSSLAVAI++ N + K TT+VLL  NL KV+ +IASAL  
Sbjct  421   NGNGEAFLRRHPHLKLKVVDGSSLAVAIVL-NAVHKDTTQVLLCGNLTKVAYAIASALCN  479

Query  808   RGIKVVTSCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIP  632
             +GIKV+   E  Y+ LK   +  G N  L      K+WLVG+G+T+ EQ  A KG++FIP
Sbjct  480   KGIKVLALNEAQYKMLKAKIDDGGKNLALLAKDAPKIWLVGDGITEAEQAMAPKGSIFIP  539

Query  631   MSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVH  452
              SQ PPKK R+DC+YH  P+M+ P  L NL +CENWLPRR MSA R++GI+H  EGWNV+
Sbjct  540   FSQFPPKKVRKDCTYHVTPSMVVPKYLQNLDSCENWLPRRVMSAWRIAGILHGAEGWNVN  599

Query  451   ECGEKMCDIDKVWEAALSHGFRPL  380
             ECGE + D++++WEA+L HGFRPL
Sbjct  600   ECGELVFDVNRIWEASLKHGFRPL  623



>ref|XP_008361247.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=561

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/591 (61%), Positives = 454/591 (77%), Gaps = 34/591 (6%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LTDWPW PLG+FK+VV++PW+ H  YS+  ++E ++D + FLI PF+L R LH
Sbjct  1     MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQLWIS SR+RTA G  RIVDK +EFEQVDRE NWDDQ++ NG+LFYL +  L   + LP
Sbjct  61    NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T+ +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI+YF+LFAIP+LTT++TGT+S  S  GYVTYID MNNMGHCNFE IPKWLF+IFPPLKY
Sbjct  181   HISYFVLFAIPMLTTIYTGTSSIVSFAGYVTYIDFMNNMGHCNFELIPKWLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS HSLHHTQFRTNY LFMP YDY+YGTMDKS+D+LYETSLKR EESPDV+HLTHL
Sbjct  241   LLYTPSXHSLHHTQFRTNYCLFMPIYDYVYGTMDKSSDSLYETSLKREEESPDVLHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + LGF+  A+ P +  WY+WLMWPVTLW+M+I  I+G+T          I  
Sbjct  301   TTPESIYHLPLGFAALASRPHTRTWYLWLMWPVTLWSMMITWIHGRT----------IYT  350

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             + + I R+   + ++      N  +                     + EELNR G  Y+Q
Sbjct  351   KVYQILRH--YFFVKGTFTKKNMYM---------------------KGEELNRYGGLYVQ  387

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P + IK+VDGSSLAVA+I+ N+IPKGTT+V+LR  L KV+ +IA AL+Q+G+++ T  
Sbjct  388   RHPHLNIKVVDGSSLAVAVIL-NSIPKGTTQVVLRGKLTKVAYAIAYALSQKGVQIATLY  446

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             + +Y KL  + +++ N V+++S+ QK+WLVG+GLT++EQM A KGTLF+P SQ PPKK R
Sbjct  447   QAEYLKLTKSLDTESNLVVAKSYAQKIWLVGDGLTEKEQMSAPKGTLFVPFSQFPPKKLR  506

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHE  449
             +DC YH+ PAM  P SL N+HACENWLPRR MSA RV+GIVHALEGW  H+
Sbjct  507   KDCFYHYTPAMKTPTSLENVHACENWLPRRVMSAWRVAGIVHALEGWKEHD  557



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/618 (61%), Positives = 488/618 (79%), Gaps = 5/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LT WPW+ LG+FKYVVL+PWVAHS+YSFVT +  +RD TN LILP+LL R++H
Sbjct  94    MATTPGPLTSWPWQKLGSFKYVVLAPWVAHSIYSFVTKDPKDRDLTNLLILPYLLWRLVH  153

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WI+ +RH+TA  K+RI+DK IEFEQVDRE NWDD ++LNG+LFY+ N +L +   LP
Sbjct  154   HQAWITLARHQTAKSKHRILDKGIEFEQVDRERNWDDLILLNGILFYMANLILNESKNLP  213

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+++  +H+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPIT+V+HPF E
Sbjct  214   MWRTDGVVLSFLLHMGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFAE  273

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF LF+IP++ TLF GTAS +SLL Y+TY+D MNN+GHCNFE +PKW+F IFP +KY
Sbjct  274   HIAYFALFSIPMVVTLFNGTASIASLLLYITYVDFMNNLGHCNFEVVPKWIFDIFPFVKY  333

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTN+SLFMP YDY+YGTMD S+D LYETSLK   E+ +VVHLTH 
Sbjct  334   LMYTPSFHSLHHTQFRTNFSLFMPLYDYMYGTMDISSDKLYETSLKGRPETLNVVHLTHP  393

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNIL-EKIK  1145
             TT ES+Y +R   ++ A+ P +  WY+W++ PVT  +M++  I+G TF ++RN+  +++K
Sbjct  394   TTLESLYHLRPVIASLASGPYAPKWYLWMLRPVTYLSMLLTWIFGSTFTIERNVFDDELK  453

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             +Q+W IPR+   Y L W   AIN LIE+AI++AE +GVKVLSLGLLNQ EELN+NGE Y+
Sbjct  454   MQTWAIPRFSFHYFLSWHKDAINRLIEKAILDAEQRGVKVLSLGLLNQGEELNKNGELYL  513

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             QK+P +K+++VDGS LAV +++ N+IP+GT +VLLR    K +I+I+  L QRGI+V   
Sbjct  514   QKHPNLKVRIVDGSGLAVGVVL-NSIPQGTKQVLLRGRTTKTAIAISRVLCQRGIQVAMI  572

Query  784   CEDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEG-LTKEEQMKATKGTLFIPMSQIPP  614
              ++ +++LKL   ++   N  LS ++  KVWLVGEG L  EEQ +  +GT FIP SQ PP
Sbjct  573   DKNQFDRLKLRLPTELWSNLFLSTNYNYKVWLVGEGALKDEEQRQLPEGTHFIPFSQFPP  632

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             K+ R DC Y+  PA+  P +L N+H+CENWLPRR MSA RV+GIVHALEGW+ HECG+ +
Sbjct  633   KRVRSDCIYYTTPALRIPKALENVHSCENWLPRRVMSAWRVAGIVHALEGWDEHECGDTV  692

Query  433   CDIDKVWEAALSHGFRPL  380
              D+DKVW A+L HGF P+
Sbjct  693   LDVDKVWTASLRHGFLPV  710



>ref|XP_008245904.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Prunus mume]
Length=575

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/566 (65%), Positives = 462/566 (82%), Gaps = 2/566 (0%)
 Frame = -3

Query  2074  ILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLF  1895
             +L  +L R++HNQ+WIS SR++TA G  RI+D+ +EFEQVDRE+NWDDQ++ N LLFY  
Sbjct  1     MLGVVLWRIIHNQIWISLSRYQTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTG  60

Query  1894  NTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTE  1715
             +  L  G   P WR +G+L+T+ +H GPVEF+YYW HRALHHH+LYSRYHSHHHSSIVT+
Sbjct  61    SRYLPGGQHAPFWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYHSHHHSSIVTQ  120

Query  1714  PITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPK  1535
             PITSVIHPF EHI Y  LF+IP+L T+ T T S  S   Y+TYID MNNMGHCNFE IP 
Sbjct  121   PITSVIHPFAEHIVYSALFSIPILGTVVTRTQSLVSFTAYITYIDFMNNMGHCNFELIPN  180

Query  1534  WLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGE  1355
             WLFS+FPPLKYLMYTPSYHSLHHTQFRTNYSLFMP YDYIY TMDKS++ LYETSLKR E
Sbjct  181   WLFSLFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYRTMDKSSNALYETSLKREE  240

Query  1354  ESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFI  1175
             E+PDV+HLTHLTTPES+Y + LGF++ A+ P + N Y+WLMWPVTLW+MI+  IYG+TF+
Sbjct  241   ETPDVLHLTHLTTPESIYHLPLGFASLASRPYTSNRYLWLMWPVTLWSMILTWIYGRTFV  300

Query  1174  LDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSE  995
             +DR+  + +KLQ+W IP+Y +QY ++W+++AIN LIEEAII+AE KGVKVL LGLLNQ E
Sbjct  301   VDRHRFDNLKLQTWAIPKYSLQYYMQWKNEAINRLIEEAIIQAEEKGVKVLCLGLLNQGE  360

Query  994   ELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASAL  815
             ELNR G  Y+ ++P +KI++VDGSSLAVAI + NTIPKGTT+VLLR NL KV+ ++A AL
Sbjct  361   ELNRYGGLYVHRHPNLKIRVVDGSSLAVAITL-NTIPKGTTQVLLRGNLTKVAYAVAFAL  419

Query  814   TQRGIKVVTSCEDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLF  638
              Q+GI+VVT  +D+Y KL K  ++++ + VL++S+  K+WLVG+GLT+EEQ++A KGTLF
Sbjct  420   CQKGIQVVTLHKDEYLKLTKSFSSTESSLVLAKSYAHKIWLVGDGLTEEEQLRAPKGTLF  479

Query  637   IPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWN  458
             IP S  PPKK R+DC YH+PPAM  P SL N+HACENWLPRR MSA R++GIVHALEGW 
Sbjct  480   IPFSHFPPKKLRKDCFYHYPPAMKTPTSLENIHACENWLPRRVMSAWRIAGIVHALEGWK  539

Query  457   VHECGEKMCDIDKVWEAALSHGFRPL  380
              HECG  M +IDKVW+A + HGF+PL
Sbjct  540   EHECGYTMSNIDKVWQATIQHGFQPL  565



>ref|XP_004252845.1| PREDICTED: protein ECERIFERUM 1 [Solanum lycopersicum]
Length=620

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/620 (61%), Positives = 486/620 (78%), Gaps = 11/620 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG L++WPW  LGNFKY+VL+P+V HS+YSF+     + D     ILPFLL R +H
Sbjct  1     MASKPGILSEWPWANLGNFKYLVLAPFVGHSIYSFL----RDGDIGYIAILPFLLFRFIH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRHRTA G NRIVD+ IEF+QVDRE+NWDDQ++ NGLL+Y+    + +   LP
Sbjct  57    NQIWISLSRHRTAKGNNRIVDRSIEFDQVDRENNWDDQIIFNGLLYYVGYLRMEQVHHLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR+ G ++T   H+GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVT+PI++ IHPF E
Sbjct  117   LWRSGGFIVTALAHIGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTQPISAFIHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
               +Y+ +FA+PV+ T  TGT S +++  YV + D MNN+GHCNFE IPKW+FS+FPPLKY
Sbjct  177   VASYYAIFAVPVIATELTGTTSIATITLYVIFTDFMNNLGHCNFEVIPKWIFSLFPPLKY  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YT SYHSLHHTQFRTNYSLFMP YDYI+GTMDKS+DTLYE SL++  E P VVHLTHL
Sbjct  237   LIYTSSYHSLHHTQFRTNYSLFMPIYDYIFGTMDKSSDTLYEKSLEKKAELPHVVHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQ--SHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             TT +S+Y +RLGFS+ A+ P   S  WY+WLMWPVTLW+++I  IY  TF+++RN+ + +
Sbjct  297   TTLQSIYHLRLGFSSLASKPHMTSSKWYLWLMWPVTLWSILITWIYSHTFVIERNLFKDL  356

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             KLQ+W IP+++ QY  +WQ ++IN+LI+EAI+EA+ KGVKVLSLGLLNQ E+LN NGE  
Sbjct  357   KLQTWAIPKFRKQYFSQWQRKSINNLIKEAIMEADQKGVKVLSLGLLNQDEKLNNNGEIC  416

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRAN-LNKVSISIASALTQRGIKVV  791
             I+K+P++K+KLVDGSSL VA+++ N+IPKGT++V+L+A  L+KV+ +IA AL QRGI+V+
Sbjct  417   IRKHPELKVKLVDGSSLVVAVVL-NSIPKGTSQVVLQAGRLSKVANAIALALCQRGIQVI  475

Query  790   TSCEDDYEKLK--LATNSKGNFVLSRS-FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQI  620
             T  E++Y+ LK      +  N VL +S    K WLV +GL+++EQ+KA KGTLFIP S  
Sbjct  476   TLDEEEYKGLKARFTPEAAANLVLLKSTCVSKTWLVDDGLSEDEQLKAPKGTLFIPYSPF  535

Query  619   PPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGE  440
             PPKK R DC Y   PAM+ P  + N+ +CENWLPRR MSA+R++GI+HA EGWN HECG+
Sbjct  536   PPKKVREDCFYLSTPAMICPKHVQNVDSCENWLPRRVMSASRIAGILHAFEGWNEHECGD  595

Query  439   KMCDIDKVWEAALSHGFRPL  380
              M DIDKVW+A+L HGF PL
Sbjct  596   MMFDIDKVWKASLDHGFSPL  615



>ref|XP_003625020.1| Protein WAX2 [Medicago truncatula]
 gb|AES81238.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/614 (61%), Positives = 476/614 (78%), Gaps = 5/614 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FK+++LSPW+AHS+YSF+  E   RD    +I PF+L RMLH
Sbjct  1     MASKPGILTDWPWKPLGSFKFMILSPWIAHSMYSFIWGE---RDPVYHVIFPFMLIRMLH  57

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA GK++IVDK +EFEQVDRE+NWDDQ++   L++Y+   +    S LP
Sbjct  58    NQIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFPMASNLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSV HPF E
Sbjct  118   WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVTHPFAE  177

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H++YF LFAIP+LTTLF   +S ++L GYV +ID MNNMGHCNFEFIPK L S FP LKY
Sbjct  178   HLSYFTLFAIPMLTTLFIKKSSVAALYGYVFFIDFMNNMGHCNFEFIPKKLLSYFPILKY  237

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHT+FR NYSLFMP YDYIYGT+ KSTD  YETSL R +ESPDVVHLTHL
Sbjct  238   LSYTPSFHSLHHTKFRANYSLFMPMYDYIYGTVHKSTDATYETSLMRPKESPDVVHLTHL  297

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S+Y +RLGF++ A+ PQ+  WY+ LMWP T+++M+I  I G+ F+L+ N    +KL
Sbjct  298   TTLDSIYQMRLGFASLASNPQTSKWYLHLMWPFTMFSMLITWICGRAFVLESNTFNDLKL  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW+IPR+K QY  + Q+  +N+LIEE I+EAE  G KV+SLGLLNQ  +LN + E YI 
Sbjct  358   QSWIIPRFKTQYFSKGQNITLNNLIEETIMEAELNGAKVISLGLLNQKHQLNAHCELYIG  417

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P++KIK+VDGSSLA A ++ N IPKGT +VLLR   NKV+ +IA+AL ++ ++V    
Sbjct  418   RLPQLKIKVVDGSSLAAATVL-NNIPKGTNQVLLRGKFNKVAFAIANALCRKNVQVAVLY  476

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             +D+   L+    SK + V+S   T K+WLVG+   + EQM+A KG+LFIP S  PPKK R
Sbjct  477   KDELMDLRQRV-SKESLVVSPINTPKIWLVGDEWDEYEQMEAPKGSLFIPFSHFPPKKMR  535

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC YH+ PAM+ P +  N H+CENWLPRR MSA R++GI+HALEGWNVHECG+ +  I+
Sbjct  536   KDCFYHYTPAMITPTTFMNSHSCENWLPRRVMSAWRIAGIIHALEGWNVHECGDTILSIE  595

Query  421   KVWEAALSHGFRPL  380
             KVWEA++ HGF+PL
Sbjct  596   KVWEASIRHGFQPL  609



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/616 (60%), Positives = 485/616 (79%), Gaps = 4/616 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG LT+WPW+ LGNFKY+VL+PWVAHS+YSFV+    + D+TN LI P+LL RMLH
Sbjct  1     MATTPGPLTNWPWQKLGNFKYLVLAPWVAHSIYSFVSKGPKDGDWTNLLIFPYLLWRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WI+ +R++TA  K+RI+D+ IEFEQVDRE NWDD ++LNG+LFY+ N +  +   LP
Sbjct  61    HQAWITLARYQTAKSKHRILDRGIEFEQVDRERNWDDLILLNGILFYMTNLMYDEAKNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+++  +H GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPIT+V+HPF E
Sbjct  121   LWRTDGVVLSFLLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITAVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LF+IP+L T+F GTAS +S+L Y+TY+D MNN+GHCNFE +PKWLF+IFP LKY
Sbjct  181   HIAYFVLFSIPMLVTMFNGTASVASMLLYITYVDFMNNLGHCNFEVVPKWLFNIFPFLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPS+HSLHHTQFRTN SLFMP YDY+YGT+D S+D LYETSLK   E+P+VVHLTH 
Sbjct  241   FMYTPSFHSLHHTQFRTNLSLFMPLYDYMYGTLDISSDKLYETSLKGRPETPNVVHLTHP  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT ES+Y +R   ++ A+ P +  WY+ ++ P+T  +M +  I+G TF ++RNI  ++K+
Sbjct  301   TTLESIYHLRPVIASLASGPYAPKWYLRMLRPLTYLSMFLTWIFGSTFTVERNIFNQLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IPR+   Y L W   AIN LIE+AI++AE +GVKVLSLGLLNQ EELN+NGE Y+Q
Sbjct  361   QAWAIPRFSFHYFLSWHKDAINRLIEKAILDAEQRGVKVLSLGLLNQGEELNKNGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P +KI++VDGSSL V +++ N+IPK T ++LLR N++K +I+I+ AL +RG++V    
Sbjct  421   KHPNLKIRIVDGSSLVVGVVL-NSIPKETKQLLLRGNVSKTAIAISKALCRRGVQVAMVD  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMK-ATKGTLFIPMSQIPPK  611
             + D++KLKL   ++   N VLS S+  KVWLV + +++EE+ K A +GT FIP SQ P K
Sbjct  480   KVDFDKLKLQLPTELWRNLVLSTSYNYKVWLVEDRVSREEEQKQAPEGTHFIPFSQFPLK  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             + R DC Y+  PA+L P +L N+H+CENWLPRR MSA RV+GIVHALEGW  HECG+ + 
Sbjct  540   RIRNDCVYYTTPALLIPKALENVHSCENWLPRRVMSAWRVAGIVHALEGWEEHECGDTVL  599

Query  430   DIDKVWEAALSHGFRP  383
             D+DKVW A L HGF P
Sbjct  600   DVDKVWNATLRHGFLP  615



>ref|XP_010535406.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Tarenaya hassleriana]
Length=628

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/623 (61%), Positives = 484/623 (78%), Gaps = 7/623 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG +K+V+L+PW  HS Y  +   E ERD+  FLI P+LL RMLH
Sbjct  1     MATKPGILTDWPWTPLGRYKFVILAPWAVHSTYKLMKGGEEERDWGYFLIFPYLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             N +WIS SR+ TA GK RI+DK I+F QVDRE+NWDDQ++ NG+LFY+   ++    ++P
Sbjct  61    NLVWISLSRYVTARGKRRILDKGIDFNQVDRETNWDDQILFNGVLFYVGYILMEGAKQMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG +MT  +H GPVE +YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVMTALLHAGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP++TT+   TAS  S+ GY+ YID MNNMGHCNFE  PK LF +FPPLK 
Sbjct  181   HIAYFVLFAIPMITTVVKRTASIGSIAGYIFYIDFMNNMGHCNFELFPKRLFLLFPPLKL  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMPFYDYIYGT D+S+D  YE SL+RGEE PDVVHLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTTDQSSDATYEKSLERGEERPDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y + + F+++++ P S+ W++ L+WP+T  +M+    YG+ F+ +RN  +K+ L
Sbjct  301   TTPESIYHLPICFASFSSYPFSYRWFMRLLWPLTSLSMLFTLFYGRPFVSERNSFKKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY +QYLLEW+ + I  +IEEAI+EA+ KGVKVLSLGL+NQ EELN+NG+ YI+
Sbjct  361   QSWVIPRYNLQYLLEWRKETIGKMIEEAILEADRKGVKVLSLGLMNQGEELNKNGKEYIE  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++++++VDGSSLA A+++ N+IPKGTT+V++R +L KV+ +IASAL +RGI+V    
Sbjct  421   KHPELRVRVVDGSSLAAAVVI-NSIPKGTTDVVMRGSLTKVAYAIASALCRRGIQVTALR  479

Query  781   EDDYEKLKLA--TNSKGNFVLSRSFT---QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              ++YE+L L      KG  + S S T    K+WLVGEG+ + +Q +AT+GT+FIP S  P
Sbjct  480   RNEYERLTLCVPAECKGRLLYSTSKTLPSHKIWLVGEGMDERDQERATEGTVFIPFSPFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             PK+ R+DC YH  PA+  P SL N H+CENWLPR+A+SA R +GI+HALEGW  HE G  
Sbjct  540   PKELRKDCIYHTTPALTVPKSLENFHSCENWLPRKAISATRAAGILHALEGWETHEHGST  599

Query  436   MC-DIDKVWEAALSHGFRPLPLP  371
             +  D+D +W+A L HGFRPLP P
Sbjct  600   LLHDLDFIWDACLGHGFRPLPFP  622



>gb|ACG35856.1| CER1 [Zea mays]
Length=619

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/617 (59%), Positives = 469/617 (76%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG  T+WPWK LGNFKY++L+PWVAH  Y   T      D     ILP LL R LH
Sbjct  1     MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYQAATKGWRAADLGYVAILPSLLLRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ WI+ SR ++A G+ ++VD+ IEFEQVDRE NWDDQ++L+G+L YL +T L  G  LP
Sbjct  61    NQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG  +   +H GPVE +YYWLHRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++     GTAS  +   YV YID MNNMGHCNFE +P WLF  FPPLKY
Sbjct  181   LVAYELLFSIPLIVCTLNGTASIIAFEIYVIYIDFMNNMGHCNFELVPNWLFKWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+DTLYE SLK  EE+ DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYEKSLKGKEETADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+  S+Y +R GF+ +A+ P +  WYV +MWP++  +M++   YG +F ++RN+++K+K+
Sbjct  301   TSLHSIYHMRPGFAEYASRPYTAKWYVRMMWPMSWLSMVLTWSYGSSFTVERNVMKKLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY   Y L W+ +AINSL+E+AI EA+ KG KV++LGLLNQ+  LNRNGE Y+Q
Sbjct  361   QSWVIPRYSFHYGLTWEKEAINSLVEKAICEADKKGAKVVTLGLLNQAHNLNRNGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPK+ ++LVDG+SLA A++V N++P+GT +V+L  N++KV+ ++A+AL ++ IKVV + 
Sbjct  421   KYPKLGVRLVDGTSLAAAVVV-NSVPQGTDQVVLAGNISKVARAVAAALCRKNIKVVMTN  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + DY  LK  +A ++  N + S++ T KVWL+G+ L   EQ KA KGT FIP SQ PP+ 
Sbjct  480   KQDYHFLKPNMAEDAAENLLFSKTTTAKVWLIGDRLDASEQFKAQKGTQFIPYSQFPPRM  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM+ P +L N+H+CENWLPRR MSA R++G+VHALEGWN HECG+ + 
Sbjct  540   ARKDTCTYSTTPAMVVPKTLQNVHSCENWLPRRVMSAWRIAGMVHALEGWNEHECGDIVL  599

Query  430   DIDKVWEAALSHGFRPL  380
             D++KVW  AL HGFRP+
Sbjct  600   DMEKVWSGALLHGFRPV  616



>ref|NP_001146661.1| uncharacterized protein LOC100280261 [Zea mays]
 gb|ACL54484.1| unknown [Zea mays]
 gb|AFW68612.1| CER1 [Zea mays]
Length=619

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/617 (59%), Positives = 469/617 (76%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG  T+WPWK LGNFKY++L+PWVAH  Y   T      D     ILP LL R LH
Sbjct  1     MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYLAATKGWRAADLGYVAILPSLLLRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ WI+ SR ++A G+ ++VD+ IEFEQVDRE NWDDQ++L+G+L YL +T L  G  LP
Sbjct  61    NQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG  +   +H GPVE +YYWLHRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++     GTAS  +   YV YID MNNMGHCNFE +P WLF  FPPLKY
Sbjct  181   LVAYELLFSIPLIVCTLNGTASIIAFEIYVIYIDFMNNMGHCNFELVPNWLFKWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+DTLYE SLK  EE+ DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYEKSLKGKEETADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+  S+Y +R GF+ +A+ P +  WYV +MWP++  +M++   YG +F ++RN+++K+K+
Sbjct  301   TSLHSIYHMRPGFAEYASRPYTAKWYVRMMWPMSWLSMVLTWSYGSSFTVERNVMKKLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY   Y L W+ +AINSL+E+AI EA+ KG KV++LGLLNQ+  LNRNGE Y+Q
Sbjct  361   QSWVIPRYSFHYGLSWEKEAINSLVEKAICEADKKGAKVVTLGLLNQAHNLNRNGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K PK+ ++LVDG+SLA A++V N++P+GT +V+L  N++KV+ ++A+AL ++ IKVV + 
Sbjct  421   KCPKLGVRLVDGTSLAAAVVV-NSVPQGTDQVVLAGNISKVARAVAAALCRKNIKVVMTN  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + DY  LK  +A ++  N + S++ T KVWL+G+GL   EQ KA KGT FIP SQ PP+ 
Sbjct  480   KQDYHFLKPNMAEDAAENLLFSKTTTAKVWLIGDGLDASEQFKAQKGTQFIPYSQFPPRM  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM+ P +L N+H+CENWLPRR MSA R++G+VHALEGWN HECG+ + 
Sbjct  540   ARKDTCTYSTTPAMVVPKTLQNVHSCENWLPRRVMSAWRIAGMVHALEGWNEHECGDIVL  599

Query  430   DIDKVWEAALSHGFRPL  380
             D++K+W  AL HGFRP+
Sbjct  600   DMEKMWSGALLHGFRPV  616



>ref|XP_002464501.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
 gb|EER91499.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
Length=619

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/617 (59%), Positives = 468/617 (76%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG  T+WPWK LGNFKY++++PWVAH +Y   T      D     I P LL RML 
Sbjct  1     MATNPGLFTEWPWKKLGNFKYLLVAPWVAHGVYLVATKGWKAADLGYMAIFPSLLLRMLQ  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR + A G+ +IVD+ IEFEQVDRE NWDDQ++L+G+L YL    +  G  LP
Sbjct  61    NQVWITVSRLQNARGRRQIVDRGIEFEQVDRERNWDDQILLSGILMYLGFMYIPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++   +H GPVE IYYW HRALHHHFLY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP+   +F GTAS  + + YV+YID MNNMGHCNFE +P WLF  FPPLKY
Sbjct  181   LVAYELLFSIPLFVCIFNGTASILAFVIYVSYIDFMNNMGHCNFELVPNWLFKWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+DTLYE SLK  EE+ DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYEKSLKGKEETVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+  S+Y +R GF+ +A+ P +  WYV +MWP++  +M++   YG +F ++RN+++K+K+
Sbjct  301   TSLHSIYHMRPGFAEYASRPYASKWYVRMMWPMSWISMVLTWTYGSSFTVERNVMKKLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY   Y L W+ +AINSLIE+AI EA+  G KV+SLGLLNQ+  LN NGE Y+Q
Sbjct  361   QSWAIPRYSFHYGLTWEKEAINSLIEKAICEADKNGAKVVSLGLLNQAHNLNGNGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPK+ ++LVDG+SLA A+++ N+IP+GT +V+L  N++KV+ ++A+AL ++ IKVV + 
Sbjct  421   KYPKLGVRLVDGTSLAAAVVM-NSIPQGTDQVVLAGNISKVARAVATALCRKNIKVVMTN  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + DY  LK  +A ++  N + S++ T KVWL+GEGL   EQ KA KGT FIP SQ PP+ 
Sbjct  480   KQDYHFLKPSMAEDAAENLLFSKTATAKVWLIGEGLDASEQFKAHKGTQFIPYSQFPPRM  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM  P +L N+H+CENWLPRR MSA R++G+VHALEGWN HECG+ + 
Sbjct  540   ARKDTCTYSITPAMAVPKTLQNVHSCENWLPRRVMSAWRIAGMVHALEGWNEHECGDIVL  599

Query  430   DIDKVWEAALSHGFRPL  380
             D++KVW  AL HGFRP+
Sbjct  600   DMEKVWSGALLHGFRPV  616



>ref|XP_007041184.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOX97015.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=1331

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/600 (63%), Positives = 472/600 (79%), Gaps = 12/600 (2%)
 Frame = -3

Query  2164  KYVVLSPWVAHSLYSFVTSE-ESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNR  1988
             +Y +L+PWV HS YS V S+ E E D    LI P L++R+LHNQ+WIS SR+RTA GKNR
Sbjct  739   QYAILTPWVIHSTYSLVMSKGEKEADLGYLLIFPLLMTRVLHNQIWISLSRYRTAKGKNR  798

Query  1987  IVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPV  1808
             IVDK I+FEQVDRESNWDDQ+VLNG+LFYL N ++   S LP WR+DG ++ + +H+GPV
Sbjct  799   IVDKGIDFEQVDRESNWDDQIVLNGILFYLANMIMPGASHLPLWRSDGFIIVILLHMGPV  858

Query  1807  EFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFT  1628
             EF+YYWLHRALHHHFLYSRYHSHHHSSI TEPITSVIHPF E +AYFLLFAIP++T + T
Sbjct  859   EFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFAEEVAYFLLFAIPLMTMVLT  918

Query  1627  GTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTN  1448
             GTAS +++  Y+TY D MNNMGHCNFE +PKW+FS FPPLK+LMYTPSYHSLHHTQFRTN
Sbjct  919   GTASIAAISSYITYTDFMNNMGHCNFELVPKWVFSTFPPLKFLMYTPSYHSLHHTQFRTN  978

Query  1447  YSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAA  1268
             YSLFMP YDY+YGT+DKS+D LYETSLKR EESPD+VHLTHLTT +S+Y +RLGF++ A+
Sbjct  979   YSLFMPMYDYLYGTVDKSSDDLYETSLKRQEESPDIVHLTHLTTTDSIYHLRLGFASLAS  1038

Query  1267  VPQSHNWYVWL-MWPVTLWTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQ  1091
              P +  WY  + MWP++ W+ ++   YG+TF+ + N    +KLQSWV+PRY + YLL+ +
Sbjct  1039  KPYAFKWYFTMAMWPLSCWSRVLAWFYGRTFVSESNTFNDLKLQSWVVPRYTMHYLLQRE  1098

Query  1090  SQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAV  911
              + +N LIEEA++EA+ KG KV         EELN NGE YIQ+ P+++IKLVDGSSLA 
Sbjct  1099  QKDLNYLIEEALLEADSKGAKV--------HEELNGNGELYIQRQPQLRIKLVDGSSLAA  1150

Query  910   AIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSCEDDYEKLKLATNSKG-N  734
             A++V N+IPK TT+VLL   ++KV  +IA AL Q+G++V    ED+Y+KL+ +    G N
Sbjct  1151  AVVV-NSIPKETTQVLLTGRISKVGYAIALALCQKGVQVAAMNEDEYQKLQDSDCQFGKN  1209

Query  733   FVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPS  554
              VL+ ++ QK+WLVGEGLT +EQ+KATKGT+ IP +Q PPKK  +DC YH  PAM+AP S
Sbjct  1210  LVLAENYDQKIWLVGEGLTDKEQLKATKGTVLIPFTQFPPKKLLKDCYYHTTPAMVAPKS  1269

Query  553   LHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPLPL  374
             L N+H+CENWL RR +SA RV+GIVH LEGWNVHECG+ M  +DKVWEA L HGF PL L
Sbjct  1270  LDNIHSCENWLARRVISAWRVAGIVHGLEGWNVHECGQTMFSMDKVWEATLHHGFCPLSL  1329


 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/595 (61%), Positives = 466/595 (78%), Gaps = 12/595 (2%)
 Frame = -3

Query  2164  KYVVLSPWVAHSLYSFVTSE-ESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNR  1988
             ++++       S YS V S+ E E D    LI PFL++R+LHNQ+WIS SR+RTA GKNR
Sbjct  2     EFIIFKATCLPSTYSLVMSKGEKEADLGYLLIFPFLMTRVLHNQIWISLSRYRTAKGKNR  61

Query  1987  IVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPV  1808
             IVDK I+FEQVDRESNWDDQ++LNG+LFYL N ++   S LP WR+DG ++ + +H+GPV
Sbjct  62    IVDKGIDFEQVDRESNWDDQIILNGILFYLANMIMPGASHLPLWRSDGFIIVILLHMGPV  121

Query  1807  EFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFT  1628
             EF+YYWLHRALHHHFLYSRYHSHHHSSI TEPITSVIHPF E +AYFLLFAIP++T +FT
Sbjct  122   EFLYYWLHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFAEEVAYFLLFAIPLMTMVFT  181

Query  1627  GTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTN  1448
             GTAS +++ GY+TY D MNNMGHCNFE +PKW+FS  PPLK+LMYTPSYHSLHH QFRTN
Sbjct  182   GTASIAAISGYLTYTDFMNNMGHCNFELVPKWVFSTCPPLKFLMYTPSYHSLHHIQFRTN  241

Query  1447  YSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAA  1268
             YSLFMP YDY+YGT+DKS+D LYETSLKR EESPD+V+LTHLT+ +S+Y +RLGF++ A+
Sbjct  242   YSLFMPMYDYLYGTVDKSSDDLYETSLKRQEESPDIVNLTHLTSTDSIYHLRLGFASLAS  301

Query  1267  VPQSHNWYVWL-MWPVTLWTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQ  1091
              P +  WY  + MWP++ W+ ++   YG+TF+ + N    +KLQSWV+PRY + YLL+ +
Sbjct  302   KPYAFKWYFTMAMWPLSCWSGVLIWFYGRTFVSESNTFNNLKLQSWVVPRYTMHYLLQRK  361

Query  1090  SQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAV  911
              + +N LIEEA++EA+ KG KV         EELN NGE YIQ++P+++IKLVDGSSL  
Sbjct  362   QKDLNYLIEEALLEADSKGAKV--------HEELNGNGELYIQRHPQLRIKLVDGSSLTA  413

Query  910   AIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSCEDDYEKLKLATNSKG-N  734
             A++V N+IPK TT+VLL   ++KV  +IA AL Q+G++V    ED+Y+KL+ +    G N
Sbjct  414   AVVV-NSIPKETTQVLLTGRISKVGYAIALALCQKGVQVAAMNEDEYQKLQHSGCQFGKN  472

Query  733   FVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPS  554
              VL+ ++ QK+WLVGEGLT +EQ++ATKG++FIP +Q PPKK  +DC YH  PA++AP S
Sbjct  473   LVLAENYDQKIWLVGEGLTDKEQLRATKGSVFIPFTQFPPKKLLKDCYYHTTPALVAPKS  532

Query  553   LHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGF  389
             L N+H+CENWL RR MSA RV+GIVH LEGWNVHECG+ M  +DKVWEA L HG+
Sbjct  533   LDNIHSCENWLARRVMSAWRVAGIVHGLEGWNVHECGQTMFSMDKVWEATLRHGY  587


 Score = 79.3 bits (194),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  685  GLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACE  530
            GLT++EQ+KA +GT+FIP SQ PP+K R+DC Y   PAM+AP SL N+H+CE
Sbjct  593  GLTQKEQLKAAQGTIFIPFSQFPPRKVRKDCYYRSTPAMVAPKSLKNMHSCE  644



>ref|XP_004982905.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/617 (59%), Positives = 469/617 (76%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG  T+WPWK LGNFKY++L+PWVAH  Y   T      D     ILP LL R+LH
Sbjct  1     MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYLAATKGWRAADVGYLAILPSLLLRVLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI+ SR + A  + +IVD+ IEFEQVDRE NWDDQ++L+G+L YL    +  G  LP
Sbjct  61    NQVWITVSRVQNARSRRQIVDRGIEFEQVDRERNWDDQILLSGILLYLGALYVPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG L+   +H GPVEFIYYW HRALHHHFLY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRADGFLLIALLHAGPVEFIYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLFAIP+++   +GTAS  +   YV YID MNNMGHCNFE +P WLF  FPPLKY
Sbjct  181   LVAYELLFAIPLISCALSGTASILAFEIYVLYIDFMNNMGHCNFELVPNWLFKWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE SLK  EE+ DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDKLYEKSLKGKEETVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y +R GF+ +A+ P +  WY+ +MWPV+  +M++   YG +F ++RN+++K+K+
Sbjct  301   TSLQSIYHMRPGFAEYASKPYTSKWYMRMMWPVSWLSMVLTWTYGSSFTVERNVMKKLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY   Y L W+ +AIN+LIE+AI EA+ KG KV+SLGLLNQ+  LN NGE Y+Q
Sbjct  361   QSWAIPRYSFHYGLTWEKEAINNLIEKAICEADEKGAKVVSLGLLNQAHNLNGNGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPK+ ++LVDG+SLA A++V N+IP GT +V+L  N++KV+ ++A+AL ++ +KVV + 
Sbjct  421   KYPKLGVRLVDGTSLAAAVVV-NSIPHGTDQVVLAGNISKVARAVAAALCKKNVKVVMTN  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + DY  LK  +  ++  NFV S++ T KVWL+GEGL   EQ KA KGT FIP SQ+PP+ 
Sbjct  480   KQDYHFLKPNMPVDAADNFVFSKTATAKVWLLGEGLDASEQFKAQKGTQFIPYSQLPPRM  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM  P +L N+H+CENWLPRR MSA R++G+VHALEGWN HECG+ + 
Sbjct  540   VRKDSCTYSTTPAMAVPKTLQNVHSCENWLPRRVMSAWRIAGMVHALEGWNDHECGDIVL  599

Query  430   DIDKVWEAALSHGFRPL  380
             D++KVW AA+ HGFRP+
Sbjct  600   DMEKVWSAAILHGFRPV  616



>gb|KHG12604.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=619

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/618 (58%), Positives = 477/618 (77%), Gaps = 3/618 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFV-TSEESERDYTNFLILPFLLSRML  2045
             MA+ PG L+DWPWK +GNFKY ++ P   +S YSF+   +E+ER++  FL+LPFL+ R++
Sbjct  1     MASKPGVLSDWPWKSMGNFKYALVVPGAIYSTYSFIRCKDENERNWFMFLVLPFLVFRLI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H QLWISYSR+RTA G NRI+DK I+F+QVDRE +WDDQ++LNG+LFY    VL     +
Sbjct  61    HYQLWISYSRYRTAKGNNRILDKSIDFDQVDRERSWDDQIILNGILFYGAGIVLKDQFNM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P ++ DG L+ + +H GP EF+YYWLHRALHHH+LY+RYHSHHHSSIVTEP TS +HP  
Sbjct  121   PFFKADGTLIILLLHWGPAEFLYYWLHRALHHHYLYARYHSHHHSSIVTEPNTSFVHPMA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E +AY+ L  IP L +++ G A+   +  YVT ID +NNMGHCNFEFIPKW ++IFPPLK
Sbjct  181   EVLAYYGLLLIPTLLSVYIGKANIVGVFIYVTVIDFLNNMGHCNFEFIPKWFYTIFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             Y++YTPS+HSLHHTQFRTNY+LF P YDY+YGT+DKSTD++YE +LKR  ESPDVVHL+H
Sbjct  241   YIIYTPSFHSLHHTQFRTNYTLFCPLYDYVYGTVDKSTDSVYENALKREAESPDVVHLSH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTTP+S+Y + LGF + ++ PQ   WY+  MWPVT+W+M++  + G  FI +RN  +K+K
Sbjct  301   LTTPDSIYHLPLGFPSLSSKPQVSKWYLLFMWPVTVWSMLLTWVVGHAFISERNAFKKLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+WV+P+Y +QY  +WQ + I+ LI +AI +A+ KG KVLSLGLLNQ EE  RN E Y+
Sbjct  361   LQAWVVPKYNMQYSSKWQRETISKLIGQAIRDADKKGAKVLSLGLLNQHEEFTRNVELYM  420

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             ++ P++KIK+VDGSSLA AI++ N+IP+ TT+VLLR  +++    +  AL Q+GIKV+T 
Sbjct  421   KRNPQLKIKVVDGSSLAAAIVL-NSIPEETTQVLLRGRVSEDVYVLVQALCQKGIKVLTV  479

Query  784   CEDDYEK-LKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
              ED Y+K LK     + N  LS  +  KVWLVG+GLT +EQ KA KGT+FIP S  PPKK
Sbjct  480   QEDKYKKLLKFDNKLQSNLFLSERYDTKVWLVGDGLTDKEQFKAPKGTIFIPFSIFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM+AP S+ NLH+CE+WLPRRAMSA+RV+GI+HA EG++V+ECG  +  
Sbjct  540   VRKDCYYHTTPAMVAPASVENLHSCEDWLPRRAMSASRVAGIIHASEGFDVNECGGTIFS  599

Query  427   IDKVWEAALSHGFRPLPL  374
             +DKVWEA+L +GFRPLP+
Sbjct  600   VDKVWEASLENGFRPLPI  617



>gb|AES88391.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/619 (59%), Positives = 472/619 (76%), Gaps = 5/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+  G LT+WPWKPLG+ K+V+LSPW+AHS+YSF+  E   RD T +LI P++L RMLH
Sbjct  1     MASKAGILTNWPWKPLGSLKFVILSPWIAHSIYSFIWVE---RDPTYYLIFPYILVRMLH  57

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA GK RIVDK +EF+QVDRE+NWDDQ++   L+FY+  T+    + LP
Sbjct  58    NQIWISISRYQTAKGKRRIVDKGLEFDQVDRETNWDDQILFTALMFYILYTIFPMAANLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPIT+V HPF E
Sbjct  118   WWRTDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITAVTHPFAE  177

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AYF LF IP+LTTLF   +S  +L GY+ YID MNNMGHCNFEF PK LFS FP LKY
Sbjct  178   MLAYFTLFLIPMLTTLFMKKSSVVALYGYIFYIDFMNNMGHCNFEFFPKKLFSYFPQLKY  237

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHT+FR+NYSLFMP YD+IYGT+D S+D  YE   KR EESPDVVHLTHL
Sbjct  238   LTYTPSFHSLHHTKFRSNYSLFMPIYDHIYGTVDTSSDATYEACSKRQEESPDVVHLTHL  297

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S++ +RLG ++ A+ PQ+  WY+ LMWP T+ +M++  I G  F+L+ N  + +KL
Sbjct  298   TTLDSIFQLRLGLASLASNPQTSKWYLNLMWPFTMCSMLLTWISGSAFVLESNSFKDLKL  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q W+IPR+K QY  + QS  IN LIEE I+ A+  GVKV+SLGLLNQ +E + +   YI+
Sbjct  358   QCWLIPRFKTQYFSKKQSIKINKLIEETIMMADLSGVKVISLGLLNQRQEFSAHCALYIE  417

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +   +KIK+VDGSSL VA ++ N IP GT +VLLR   NKV+++I +AL  + ++V    
Sbjct  418   RLQNLKIKVVDGSSLVVATVL-NNIPNGTNQVLLRGKFNKVALAITNALCSKNVQVTVLY  476

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              D+ ++L +  T S G+  LS+  T K+WLVG+   ++EQM+A++G+LFIP S  PPKK 
Sbjct  477   RDELKELERRVTVSNGSLALSQINTSKIWLVGDDWDEDEQMQASEGSLFIPFSHFPPKKM  536

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+ C YH+ PAM+ P +L NLH+CENWLPRR MSA R++GI+HALE WNVHECG+ + DI
Sbjct  537   RKGCFYHYTPAMITPTALINLHSCENWLPRRVMSAWRIAGIIHALERWNVHECGDTVFDI  596

Query  424   DKVWEAALSHGFRPLPLPN  368
             +KVWEA++ HGF PL +PN
Sbjct  597   EKVWEASIRHGFLPLKIPN  615



>ref|XP_007041187.1| Fatty acid hydroxylase superfamily isoform 3, partial [Theobroma 
cacao]
 gb|EOX97018.1| Fatty acid hydroxylase superfamily isoform 3, partial [Theobroma 
cacao]
Length=556

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/557 (64%), Positives = 452/557 (81%), Gaps = 3/557 (1%)
 Frame = -3

Query  2104  ESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQV  1925
             E E + T  LI PFL++R+LHNQ+WIS SR+RTA GKNRIVDK I+FEQVDRESNWDDQ+
Sbjct  1     EKEANLTYHLIFPFLMTRVLHNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQI  60

Query  1924  VLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryh  1745
             +LNG+L YL N ++   S LP WR+DG ++ + +H GPVEF+YYWLHRALHHHFLYSRYH
Sbjct  61    ILNGILLYLTNMIMPGASHLPLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFLYSRYH  120

Query  1744  shhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNM  1565
             SHHHSSI TEPITSVIHPF E +AYFLLFAIP++T +FTGTAS +++  Y+TYIDLMNNM
Sbjct  121   SHHHSSIATEPITSVIHPFAEEVAYFLLFAIPLMTVMFTGTASIAAIFIYITYIDLMNNM  180

Query  1564  GHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDT  1385
             GHCNFE +PKW+FS FPPLK+LMYTPSYHSLHHTQFRTNYSLFMP YDY+YGT+DKS+D 
Sbjct  181   GHCNFELVPKWVFSTFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPMYDYLYGTVDKSSDD  240

Query  1384  LYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWL-MWPVTLWTM  1208
             LYETSLKR EESPD+VHLTHLTT +S+Y +RLGF++ A+ P +  WY  + MWPV+ W+ 
Sbjct  241   LYETSLKRQEESPDIVHLTHLTTTDSIYHLRLGFASLASKPYAFKWYFTIAMWPVSCWSA  300

Query  1207  IINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvk  1028
             +    YG TF+ + N    +KLQSWV+PRY + YLL+ + + +N LIEEA++EA+ KG K
Sbjct  301   VFTWFYGHTFVSESNTFNNLKLQSWVVPRYTMHYLLQREKKDLNYLIEEALLEADSKGAK  360

Query  1027  vlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL  848
             V+S GLLNQ EELN NGE YIQ++P+++I+LVDGSSLA A++V N+IP+ TT+VLL   +
Sbjct  361   VVSFGLLNQHEELNGNGELYIQRHPQLRIRLVDGSSLAAAVVV-NSIPQETTQVLLTGRI  419

Query  847   NKVSISIASALTQRGIKVVTSCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKE  671
             +KV  +IA AL Q+G++V    ED+Y+KL+ +    G N VL+ ++ QK+WLVGEGLT +
Sbjct  420   SKVGYAIALALCQKGVQVAAMNEDEYQKLQHSDCQFGKNLVLAENYDQKIWLVGEGLTDK  479

Query  670   EQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARV  491
             EQ+KATKGT+F+P +Q PPKK  +DC YH  PAM+AP SL N+H+CENWL RR MSA RV
Sbjct  480   EQLKATKGTVFVPFTQFPPKKLLKDCYYHTTPAMVAPKSLDNIHSCENWLARRVMSAWRV  539

Query  490   SGIVHALEGWNVHECGE  440
             +GIVH LEGWNVHECG+
Sbjct  540   AGIVHGLEGWNVHECGQ  556



>ref|XP_004493412.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=620

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/617 (60%), Positives = 476/617 (77%), Gaps = 9/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+FK V++SPW+AHS+YSF+   + ERD    LI P +  R+LH
Sbjct  1     MASKPGILTNWPWKPLGSFKLVIISPWIAHSIYSFI---KGERDPVYQLIFPHIFFRLLH  57

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA GK++IVDK +EFEQVDRE+NWDDQ++   L+ Y+  T++   + LP
Sbjct  58    SQIWISVSRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALITYIGYTIMPMSANLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV+ T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPFGE
Sbjct  118   WWRTDGVVFTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFGE  177

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYF LFAIP+LTT+ T T+S ++L GY+ +ID MNNMGHCNFEF P  L+S FP LKY
Sbjct  178   HLAYFTLFAIPILTTILTKTSSVAALFGYIFFIDFMNNMGHCNFEFFPPKLYSFFPQLKY  237

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHHT+FRTNYSLFMP YDYIYGT+DKSTD  YE SLK+ +ESPDVVHLTHL
Sbjct  238   LIYTPSYHSLHHTKFRTNYSLFMPMYDYIYGTVDKSTDATYEASLKKPKESPDVVHLTHL  297

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S+Y +RLGFS+ A+ PQ+  WY+ L+WP T+ ++ +  I G  F+L+ N  + +KL
Sbjct  298   TTLDSIYQLRLGFSSLASNPQTSIWYLPLLWPFTMCSIFMTWITGTAFLLESNTFKDLKL  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
               W+IPR+K QY  + QS  +N+LIE+AIIEAE  G KV+SLGLLNQ +    + E YI+
Sbjct  358   HCWLIPRFKTQYFSKKQSITLNNLIEDAIIEAELSGAKVISLGLLNQKQ----HWELYIE  413

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++KIK+VDGSSLA A ++ N IPKGT +VLLR   NKV+ +IA+AL+ + ++V    
Sbjct  414   RFPQLKIKIVDGSSLAAATVL-NNIPKGTNQVLLRGKFNKVAFAIANALSTKNVQVGVLY  472

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
             ED+ ++L +    SKG+  +    T K+WLVG+   + EQMKA +GTLFIP SQ PPKK 
Sbjct  473   EDELKELEQRVIVSKGSSTILPIDTPKIWLVGDEWDENEQMKAAEGTLFIPFSQFPPKKM  532

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+ C YH+ PAM+ PP+  N H+CENWLPRR MSA R+ GI+HALEGWNVHECG  +   
Sbjct  533   RKRCFYHYTPAMVTPPTFTNSHSCENWLPRRVMSAWRIGGIIHALEGWNVHECGSTILST  592

Query  424   DKVWEAALSHGFRPLPL  374
             DKVWEA + HGF+PL +
Sbjct  593   DKVWEATIRHGFQPLKI  609



>ref|XP_003625024.1| Protein WAX2 [Medicago truncatula]
 gb|ABN07985.1| Sterol desaturase [Medicago truncatula]
 gb|AES81242.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/616 (59%), Positives = 471/616 (76%), Gaps = 4/616 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW+PLG+FK+V++ PW+AHS+Y+F+  E   RD   ++I PF L RMLH
Sbjct  1     MASKPGILTNWPWEPLGSFKFVIVIPWIAHSIYTFIWGE---RDPVYYIIFPFALVRMLH  57

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+W S SR++TA GKNRIVDK +EFEQVDRE++WDDQ++   L++ +   +    S LP
Sbjct  58    NQIWTSVSRYQTAKGKNRIVDKGLEFEQVDRETHWDDQMLFTVLVYCIAYFIFPMASNLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSV HPF E
Sbjct  118   WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVAHPFAE  177

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H++YF LFAIP+LTTLF   +S ++L GY+ YID MNNMGHCNFEF PK L S FP LKY
Sbjct  178   HLSYFTLFAIPMLTTLFINKSSVAALYGYIFYIDFMNNMGHCNFEFFPKKLLSYFPILKY  237

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHT+FR+NYSLFMP YDYIYGT+DKSTD  YE SL R +ESPDVVHLTHL
Sbjct  238   LSYTPSFHSLHHTKFRSNYSLFMPIYDYIYGTVDKSTDATYEASLMRPKESPDVVHLTHL  297

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT  S+Y +RLGF++ A+ PQ+  WY++LMWP T+  M++  I  + F+L+ N    +KL
Sbjct  298   TTLSSIYQLRLGFTSLASNPQTSKWYLYLMWPFTMCYMLMTWISRRAFVLESNTFNDLKL  357

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q W++PR+K QY  + Q    N+LIEE IIEAE  G KV+SLGLLNQ  +LN + E YI+
Sbjct  358   QCWLLPRFKTQYFSKGQKLTWNNLIEETIIEAELNGAKVISLGLLNQKHQLNAHCELYIR  417

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             ++P++KIK+VDGSSLA A ++ N IPKGT +VLLR   NKV+ +IA+AL ++ ++VV   
Sbjct  418   RFPQLKIKVVDGSSLAAATVL-NNIPKGTNQVLLRGKFNKVAFAIANALCKKNVQVVVLY  476

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
             +D+ ++L+    +KGN  LS+    K+WLVG+   ++EQ+KA +G+LFIP S  PPKK R
Sbjct  477   KDELKELEQRVVTKGNLALSQVNIPKIWLVGDEWDEDEQLKAPEGSLFIPFSHFPPKKMR  536

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             + C YH  PAM+ P +  N H+CENWLPRR MSA R++GI+HALEGWNVHECG+ +   +
Sbjct  537   KCCFYHFTPAMITPATFMNSHSCENWLPRRVMSAWRIAGIIHALEGWNVHECGDTILSTE  596

Query  421   KVWEAALSHGFRPLPL  374
             KVWEA++ HGF+PL +
Sbjct  597   KVWEASIRHGFQPLKI  612



>ref|XP_003574039.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/617 (58%), Positives = 465/617 (75%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PGFL++WPWK LG+FKY+VL+PWVAH  +   T    E D     ILP +L R LH
Sbjct  1     MATNPGFLSEWPWKRLGSFKYLVLAPWVAHGFHQLATKGWRETDLGYIAILPSMLLRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ WI+ SR + A G+ +IVD+ IEFEQVDRE NWDDQ++L+ +LFYL    L  G  LP
Sbjct  61    NQAWITVSRLQNARGRKQIVDRGIEFEQVDRERNWDDQIILSAILFYLGALHLPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++   +H GPVE +YYW HRALHHHFLY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVLVALLHAGPVELLYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++ +  TGTAS  +   Y+ YID MNNMGHCNFE +P WLF  FPPLKY
Sbjct  181   LVAYELLFSIPMIASALTGTASIVAFEMYMLYIDFMNNMGHCNFELVPTWLFRWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              MYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D L+E SLK  EE+ DVVHLTHL
Sbjct  241   FMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDKLHENSLKNKEEAVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y +R GF+ +A+ P +  WY+ +MWP++  +M++  +YG  F ++RN+++K+++
Sbjct  301   TSLQSIYHMRPGFAEYASKPYTSKWYMRIMWPLSWLSMVLTWVYGSWFTVERNVMKKLRI  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY   Y L W+ +AINSLI +AI EA+  G KV+SLGLLNQ++ LN +GE Y+Q
Sbjct  361   QSWAIPRYNFHYGLNWEKEAINSLIIKAIHEADKNGAKVVSLGLLNQAQSLNGSGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPK+ +KLVDGSSLA A +VAN+IP+GT +V+L  N++KV+ ++A+AL +  IKV+ S 
Sbjct  421   KYPKLGVKLVDGSSLAAA-VVANSIPQGTDQVVLAGNISKVARAVATALCKNNIKVIMSN  479

Query  781   EDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + DY   K K+  ++  N +LS++   KVW++GEGL   EQ +A KGT FIP S  PP+ 
Sbjct  480   KQDYHFLKPKIPEDAADNLILSKTSIAKVWVIGEGLDTAEQFRAPKGTHFIPYSPFPPRA  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM  P +L N+H+CENWLPRR MSA R++GI+HALEGWN HECG+ + 
Sbjct  540   VRKDCCTYSTTPAMGVPKTLQNVHSCENWLPRRVMSAWRIAGIIHALEGWNEHECGDTVL  599

Query  430   DIDKVWEAALSHGFRPL  380
             D+DK+W AA+ HGF P+
Sbjct  600   DMDKIWSAAILHGFCPV  616



>ref|XP_004168237.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus]
Length=598

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/599 (61%), Positives = 461/599 (77%), Gaps = 3/599 (1%)
 Frame = -3

Query  2161  YVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIV  1982
             +V+L+PWV HS Y +    E +RD +  LI PFL+ RM+HNQ+WIS SR++TA G  RIV
Sbjct  1     FVILTPWVIHSSYLYFKGGE-KRDLSYILIFPFLVLRMIHNQIWISLSRYQTAKGTKRIV  59

Query  1981  DKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEF  1802
             DKPIEFEQVDRES+WDDQ++ NGLLF L   V+ KG  LP WRTDGV++   +H GPVEF
Sbjct  60    DKPIEFEQVDRESSWDDQILFNGLLFCLGRMVVEKGENLPLWRTDGVVIAALLHAGPVEF  119

Query  1801  IYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGT  1622
             +YYW HRALHHHFLYSRYHSHHHSSI TEPITSVIHPF EHI YFLLF IP+L T+ T T
Sbjct  120   LYYWFHRALHHHFLYSRYHSHHHSSIATEPITSVIHPFAEHIVYFLLFTIPLLVTVLTET  179

Query  1621  ASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYS  1442
             AS  S + YV +ID MNNMGHCNFE +PK LF IFPPLKYL+YTPS+HSLHHTQFRTNYS
Sbjct  180   ASIGSFVLYVMFIDFMNNMGHCNFEIVPKSLFFIFPPLKYLIYTPSFHSLHHTQFRTNYS  239

Query  1441  LFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVP  1262
             LFMP YDYIYGT+DK++D+LYE SL R EE  DVVHL+HLTTP+S+Y +RLG +T A+ P
Sbjct  240   LFMPIYDYIYGTVDKNSDSLYENSLLREEEVADVVHLSHLTTPQSIYHMRLGLATVASQP  299

Query  1261  QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQA  1082
              +  W++ L+WP T + ++    YG  F+ +RN  + +KLQSWVIPR+ +QY ++ + +A
Sbjct  300   FTSKWWLTLLWPFTSFYVLATSFYGHIFVYERNTFKALKLQSWVIPRFNLQYFMKGRREA  359

Query  1081  INSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAII  902
             IN LIE AI++A+ KGVKVLSLGLLNQ +ELN  GEFYI KYP ++IKLVDGSSLA AI+
Sbjct  360   INKLIEAAILDADKKGVKVLSLGLLNQGKELNEYGEFYIHKYPNLRIKLVDGSSLAAAIV  419

Query  901   VANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSCEDDYEKLK-LATNSKGNFVL  725
             + NTIPK TT+VLLR NL+KV+ +IA AL Q G +V T  E++++KLK   T +  N VL
Sbjct  420   I-NTIPKATTKVLLRGNLSKVAYAIADALCQLGFQVATLYENEHKKLKSKVTTNSNNLVL  478

Query  724   SRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHN  545
             ++  T K+W+VG+GL + EQ+ A KGT+FIP SQ PP++ R+DC YH  P+M  P S  N
Sbjct  479   AKITTHKIWIVGDGLEEFEQLNAPKGTIFIPYSQFPPQRLRKDCYYHITPSMRVPSSFQN  538

Query  544   LHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPLPLPN  368
             + +CENWLPRR MSA R++GI+HALEG   HECGE M  +D  W A+L +GF PL +P+
Sbjct  539   IDSCENWLPRRVMSAWRMAGILHALEGREGHECGETMLSLDDAWRASLENGFLPLEIPS  597



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/616 (59%), Positives = 470/616 (76%), Gaps = 3/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LGNFKYV+++PWV H L+   T    E D +   I P LL RMLH
Sbjct  1     MASRPGILTEWPWHRLGNFKYVIMAPWVLHGLHMMATKGWRETDLSYLTIFPSLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R + A  K+RIVDK IEFEQVDRE NWDDQ++L G L YL +T +      P
Sbjct  61    NQVWISLARFQNARSKHRIVDKSIEFEQVDRERNWDDQILLYGWLLYLGHTFIPGAQNAP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++ V +H+GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVIAVLLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AY LLF+IP+L T FTGTAS  + LGY+ Y+D MNN+GHCNFE +P+WLF  FPPLKY
Sbjct  181   HVAYALLFSIPILATAFTGTASILATLGYIVYVDFMNNLGHCNFELVPQWLFRAFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+Y T+DKS+D LYE  LK  EE+ DVVHL+H 
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYMYDTLDKSSDDLYERKLKGVEETLDVVHLSHP  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T  +S+Y +RLGF + A+ P    WY+ +MWP+T  +M++  IYG +F ++RN L+K+++
Sbjct  301   TALQSIYHLRLGFPSLASKPYKSKWYMLMMWPITWVSMVLAWIYGSSFTVERNSLKKLRM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IPRY  QY L  + +AIN LIE+AI+EA+ KGVKVLSLGLLNQ++ELN  GE YIQ
Sbjct  361   QTWAIPRYNFQYGLSRERRAINDLIEKAILEADKKGVKVLSLGLLNQAKELNGGGELYIQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYP++K+++VDGSSLA A+++ N++P GT ++LL  N++KV+ +IA  L  RGI+V+ + 
Sbjct  421   KYPELKVRIVDGSSLAAAVVL-NSVPAGTKQILLTGNVSKVARAIAFTLCNRGIQVMMTK  479

Query  781   EDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + ++   KL++  ++     LS +++ +VW+VG+GL   EQ +A  GT FIP SQ PPKK
Sbjct  480   KQEFHILKLQMPESTASYLTLSNTYSPQVWIVGDGLDDTEQRRAPTGTRFIPFSQFPPKK  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
               +DC+Y+  PAM  P +L N+H+CENWLPRR MSA R++GIVHALEGW+ HECGE M D
Sbjct  540   LNKDCTYNTTPAMKIPETLENMHSCENWLPRRVMSAWRIAGIVHALEGWSAHECGETMLD  599

Query  427   IDKVWEAALSHGFRPL  380
             I+K+W A L HGF PL
Sbjct  600   IEKIWSATLHHGFLPL  615



>ref|XP_010539481.1| PREDICTED: protein CER1-like 2 [Tarenaya hassleriana]
Length=707

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/624 (59%), Positives = 471/624 (75%), Gaps = 6/624 (1%)
 Frame = -3

Query  2233  NTHNMATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLS  2054
             ++  MA+ PG LTDWPWK LG+FKY+V++PW+  S+YS+ T  E ERD  N LI   +  
Sbjct  83    SSAEMASRPGILTDWPWKALGSFKYLVVAPWIVESIYSYGTKSEEERDLGNLLIAALMAW  142

Query  2053  RMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKG  1874
             RM+H+Q+WIS SRHRTA G  RIVDKPIEF+QVDRE  WDDQ++ N LL YL N  L   
Sbjct  143   RMVHSQIWISLSRHRTAKGSRRIVDKPIEFDQVDRERTWDDQIIFNALLMYLGNKFLPGS  202

Query  1873  SRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIH  1694
             SR P WRTDG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+H
Sbjct  203   SRAPLWRTDGAVLMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVH  262

Query  1693  PFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFP  1514
             PF EHIAY LLFAIPV+T+   G  S  S+LGY+TYID MNNMGHCNFE  P+ LFS+FP
Sbjct  263   PFAEHIAYSLLFAIPVVTSSLCGNLSIVSMLGYLTYIDFMNNMGHCNFELFPRPLFSLFP  322

Query  1513  PLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVH  1334
             PLK+L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKS+D+LYETSL+R EE+PDV+H
Sbjct  323   PLKFLFYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTDDKSSDSLYETSLQREEETPDVIH  382

Query  1333  LTHLTTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNIL  1157
             LTHLTT +S+Y IRLGF + ++ P  S  W++  MWP+TL++ +++ +   TF+L+RN  
Sbjct  383   LTHLTTLDSIYHIRLGFPSLSSHPFISSRWFLSFMWPLTLFSALLSYLSSSTFVLERNRF  442

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P++  QY    Q ++IN +IE +I+EA+ KGV+V+SLGL+NQ EELN  G
Sbjct  443   RSLTLHSRLLPKFAFQYTSPRQYESINKMIEASIVEADKKGVRVVSLGLMNQGEELNGYG  502

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y++++PK+K++LVDGSSLA A++V N IP+ T+EV+ R  L KV+ +   AL QRG+K
Sbjct  503   EMYVKRHPKLKVRLVDGSSLAAAVVV-NGIPRETSEVVFRGKLTKVAYATVFALIQRGVK  561

Query  796   VVTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLV-GEGLTKEEQMKATKGTLFIPMS  626
             V+    +++ +L   +  +   N VL R+ + ++WLV G+GL++EE+  A +GTLFIP S
Sbjct  562   VMVLRAEEHRRLVEFVGVSCSENIVLMRTNSPRIWLVGGDGLSREEETMAKEGTLFIPFS  621

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q PPKK R+DC YH  P+M  P S  N+ +CENWLPRR MSA RV GIVHALEGW  HEC
Sbjct  622   QFPPKKTRKDCHYHPTPSMYIPESAQNVDSCENWLPRRVMSAWRVGGIVHALEGWEEHEC  681

Query  445   GEK-MCDIDKVWEAALSHGFRPLP  377
             G     DID+VWEAAL HGFRPLP
Sbjct  682   GHAFFFDIDRVWEAALRHGFRPLP  705



>gb|EEC67150.1| hypothetical protein OsI_33995 [Oryza sativa Indica Group]
Length=621

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/619 (59%), Positives = 461/619 (74%), Gaps = 6/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG  T+WPWK LG+FKYV+L+PWVAH  Y   T    E D     ILP LL RMLH
Sbjct  1     MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGRREVDLGYIAILPSLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ WI+ SR + A G+ +IV + IEF+QVDRE NWDDQ++L+G+L YL    +  G  LP
Sbjct  61    NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG  +   +H GPVEF+YYW HRALHHHFLY+RYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++    TGTAS  +   Y+ YID MNNMGHCNFE +P WLF+ FPPLKY
Sbjct  181   LVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRG--EESPDVVHLT  1328
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+DTLYE SLK    EE+ DVVHLT
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYENSLKNNDEEEAVDVVHLT  300

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLTT  S+Y +R GF+ +A+ P    WY+ +MWP++  +M++   YG +F ++RN+++KI
Sbjct  301   HLTTLHSIYHMRPGFAEFASRPYVSRWYMRMMWPLSWLSMVLTWTYGSSFTVERNVMKKI  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             ++QSW IPRY   Y L+W+ +AIN LIE+A+ EA+  G KV+SLGLLNQ+  LN++GE Y
Sbjct  361   RMQSWAIPRYSFHYGLDWEKEAINDLIEKAVCEADKNGAKVVSLGLLNQAHTLNKSGEQY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             + KYPK+  ++VDG+SLA A++V N+IP+GT +V+L  N++KV+ ++A AL ++ IKV  
Sbjct  421   LLKYPKLGARIVDGTSLAAAVVV-NSIPQGTDQVILAGNVSKVARAVAQALCKKNIKVTM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + DY  LK  +      N   S++ T KVWL+G+GL   EQ +A KGTLFIP SQ PP
Sbjct  480   TNKQDYHLLKPEIPETVADNLSFSKTGTAKVWLIGDGLDSAEQFRAQKGTLFIPYSQFPP  539

Query  613   KKHRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             K  R+D CSY   PAM  P +L N+H+CENWLPRR MSA R++GI+HALEGWN HECG+K
Sbjct  540   KMVRKDSCSYSTTPAMAVPKTLQNVHSCENWLPRRVMSAWRIAGILHALEGWNEHECGDK  599

Query  436   MCDIDKVWEAALSHGFRPL  380
             + D+DKVW AA+ HGF P+
Sbjct  600   VLDMDKVWSAAIMHGFCPV  618



>emb|CAN60676.1| hypothetical protein VITISV_029045 [Vitis vinifera]
Length=557

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/592 (60%), Positives = 439/592 (74%), Gaps = 42/592 (7%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWK LG+FKYV+L+PWV HS+Y+ +  +  ERD    L  PFLL R LH
Sbjct  1     MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R+RTA G NRIVDK IEFEQVDRESNWDDQ++LNG+LFY+   +L   + +P
Sbjct  61    NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T+ +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYFLLF IP+L   F   +S +++ GY++YID MNNMGHCNFE IPK LFSIFPPLKY
Sbjct  181   HLAYFLLFLIPLLAGFFMRKSSMAAVFGYISYIDFMNNMGHCNFELIPKMLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGTMDKS+D LYE SL R E+ P VVHLTHL
Sbjct  241   LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDALYEKSLIRPEQLPHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
              TP+S+Y +RLGF++ A+ P ++ WYVW MWPVT  ++++   YG+TFIL+RN   K+ +
Sbjct  301   VTPQSIYHLRLGFASLASKPYTYKWYVWAMWPVTCXSIMLTWTYGRTFILERNQFNKVNV  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WV+P++K+QYLL+  +++I+SLI                              E  I 
Sbjct  361   QTWVVPKFKIQYLLKLGNESIDSLI------------------------------EEAIL  390

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K  K  IK++    L  A          TT+VL R NL+KV+  IASAL Q  I+V TS 
Sbjct  391   KADKRGIKVLSLGLLNQA---------RTTQVLFRGNLSKVAYFIASALCQMDIQVATSH  441

Query  781   EDDYEKLKLA---TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             +D+YE+L         +   +LS+SFT+K+W+VG+GLTKEEQMKA+KGTLFIP SQ PPK
Sbjct  442   KDEYEQLNTKLKNVECESKLLLSKSFTEKIWVVGDGLTKEEQMKASKGTLFIPFSQFPPK  501

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNV  455
             + R+DC YH  PAM+ P S  N+ +CENWLPRRAMSA+RV+G++HALEGWNV
Sbjct  502   RLRKDCLYHTTPAMMPPKSFQNIDSCENWLPRRAMSASRVAGVIHALEGWNV  553



>ref|NP_001064826.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|AAG21908.1|AC026815_12 putative CER1 [Oryza sativa Japonica Group]
 gb|AAP54228.1| CER1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26740.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|EEE51118.1| hypothetical protein OsJ_31858 [Oryza sativa Japonica Group]
Length=621

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/619 (58%), Positives = 460/619 (74%), Gaps = 6/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG  T+WPWK LG+FKYV+L+PWVAH  Y   T    E D     ILP LL RMLH
Sbjct  1     MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ WI+ SR + A G+ +IV + IEF+QVDRE NWDDQ++L+G+L YL    +  G  LP
Sbjct  61    NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG  +   +H GPVEF+YYW HRALHHHFLY+ YHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++    TGTAS  +   Y+ YID MNNMGHCNFE +P WLF+ FPPLKY
Sbjct  181   LVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRG--EESPDVVHLT  1328
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+DTLYE SLK    EE+ DVVHLT
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYENSLKNNEEEEAVDVVHLT  300

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLTT  S+Y +R GF+ +A+ P    WY+ +MWP++  +M++   YG +F ++RN+++KI
Sbjct  301   HLTTLHSIYHMRPGFAEFASRPYVSRWYMRMMWPLSWLSMVLTWTYGSSFTVERNVMKKI  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             ++QSW IPRY   Y L+W+ +AIN LIE+A+ EA+  G KV+SLGLLNQ+  LN++GE Y
Sbjct  361   RMQSWAIPRYSFHYGLDWEKEAINDLIEKAVCEADKNGAKVVSLGLLNQAHTLNKSGEQY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             + KYPK+  ++VDG+SLA A++V N+IP+GT +V+L  N++KV+ ++A AL ++ IKV  
Sbjct  421   LLKYPKLGARIVDGTSLAAAVVV-NSIPQGTDQVILAGNVSKVARAVAQALCKKNIKVTM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + DY  LK  +      N   S++ T KVWL+G+GL   EQ +A KGTLFIP SQ PP
Sbjct  480   TNKQDYHLLKPEIPETVADNLSFSKTGTAKVWLIGDGLDSAEQFRAQKGTLFIPYSQFPP  539

Query  613   KKHRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             K  R+D CSY   PAM  P +L N+H+CENWLPRR MSA R++GI+HALEGWN HECG+K
Sbjct  540   KMVRKDSCSYSTTPAMAVPKTLQNVHSCENWLPRRVMSAWRIAGILHALEGWNEHECGDK  599

Query  436   MCDIDKVWEAALSHGFRPL  380
             + D+DKVW AA+ HGF P+
Sbjct  600   VLDMDKVWSAAIMHGFCPV  618



>ref|XP_010936012.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Elaeis guineensis]
Length=624

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/615 (58%), Positives = 472/615 (77%), Gaps = 3/615 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT WPW+ LGNFKYV+L+PWVAHS++ F+ +   +RD  NFLI P LL R+L+
Sbjct  1     MASQPGPLTQWPWQKLGNFKYVLLAPWVAHSMHKFMAASGEKRDMINFLIFPILLLRLLY  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +QLWI++SR++TA  K+RIVDK ++F+QVDRE NWDDQ++L  LL Y+ N V+   S LP
Sbjct  61    SQLWITFSRYQTAKSKHRIVDKSLDFDQVDRERNWDDQIILTALLMYMGNMVVPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W T GV +T+ +H+GPVEFIYYWLHRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   WWETRGVAITILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              ++YF+LFAIP++T  FTGT S ++ +GY+ YID MN MGHCNFE +PKWLFSIFPPLKY
Sbjct  181   ELSYFVLFAIPLMTMAFTGTGSIAAAVGYLMYIDFMNYMGHCNFELVPKWLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIYGT+DKS+D  YE SLK  EE P VVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTIDKSSDEQYERSLKGKEERPHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T  +S+Y +R GFS+ A+ P +  +Y+W++WP+T  +M++  IYG TF  +RN  +++ +
Sbjct  301   THLQSIYHLRCGFSSLASKPYATKYYMWILWPLTFASMLLTWIYGTTFTAERNRFKRLIV  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             ++ V+PRY  QY    +   IN+LIE+AI ++E +G KV++LGLLNQ  ELN  GE Y++
Sbjct  361   ETRVVPRYSFQYKSLCERDTINNLIEKAISQSEEEGAKVITLGLLNQGSELNGYGELYLK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +   +K K+VDG+SLAVA+++ N++PKGT  +LL   L+K++  ++ +L +RG++V    
Sbjct  421   RNSLLKTKIVDGTSLAVAVVL-NSVPKGTKSILLVGKLSKMAYFLSLSLCKRGVQVEMVQ  479

Query  781   EDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +D+YE  KL+L     G  V S S+T +VWLVG+G+T +EQ++A KG  FIP +Q PPK 
Sbjct  480   KDEYEILKLQLPPELHGRLVFSDSYTSEVWLVGDGVTDQEQLRARKGIRFIPFTQFPPKL  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM+ P +  NLH CENWLPRR MSA RV+GI+HALE WN HECG+ +  
Sbjct  540   VRKDCIYHCTPAMVVPKAYENLHTCENWLPRRVMSAWRVAGIIHALEEWNAHECGDVVTG  599

Query  427   IDKVWEAALSHGFRP  383
             ++K W AAL+HGF P
Sbjct  600   VEKAWHAALAHGFLP  614



>gb|KDO85383.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=602

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/586 (63%), Positives = 467/586 (80%), Gaps = 23/586 (4%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG++K+VVL+PW  HS+Y F+ S +SERDY  FLI PFLL RMLH
Sbjct  1     MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKG-SRL  1865
             +Q+WIS SR+RTA   NRIVDK IEF+QVDRE NWDDQ+V NGL+FY+   ++    S L
Sbjct  61    DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
               WR+DGV++T+ +H+GPVEF+YYW HRALHHH+LYSRYHSHHHSS+VTEPITSVIHPF 
Sbjct  121   RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHI YFLLFAIP++TT+    AS +S +GY+ Y+D MNNMGHCNFEFIP WLF++FPPLK
Sbjct  181   EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKR-GEESP------  1346
             +LMYTPSYHSLHHTQFRTNYSLFMP YDYIYGT+D+S+D++YE SLKR GEE        
Sbjct  241   FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV  300

Query  1345  DVVHLTHLTTPESVYSIRLGFSTWAAVPQSH-----NWYVWLMWPVTL-WTMIINCIYGQ  1184
             DVVHLTHLTTPES+Y +R+GF++ A+ P  +      WY+ L+WP T   +++++ IYG+
Sbjct  301   DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR  360

Query  1183  TFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLN  1004
             TF+ + N L+K+KLQ+WV+PRY VQY L W+ +AINSLIEEAI+EA+ KGVKV+SLGLLN
Sbjct  361   TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN  420

Query  1003  QSEELNRNGEFYIQKYP-KMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL--NKVSI  833
             Q EELNRNGE Y+++ P K+KIK+VDGSSLA A++V N++PK T  VLLR  +  NKV+ 
Sbjct  421   QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVV-NSLPKTTAHVLLRGTVTANKVAN  479

Query  832   SIASALTQRGIKVVTSCEDDYEKLKL--ATNSKGNFVLSRSFTQ---KVWLVGEGLTKEE  668
             ++AS+L Q GIKV T C+DDYEKLKL     ++ N VLS S+     K+WLVG+ LT +E
Sbjct  480   AVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAHKTKIWLVGDDLTGKE  539

Query  667   QMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACE  530
             Q +A KGT+FIP +QIPP+K R+DC YH  PAM+ PPSL N+H+CE
Sbjct  540   QARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCE  585



>ref|XP_006661851.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=635

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/633 (58%), Positives = 468/633 (74%), Gaps = 20/633 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESE--------------RDYT  2084
             MAT PG  T+WPWK LG+FKYV+L+PWVAH  Y   T                   RD  
Sbjct  1     MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWRAADLGYLAILPSLLLRDLA  60

Query  2083  NFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLF  1904
               LILP LL RM+HNQ+WIS SR++TA  K+RIVD+ IEF+QVDRE NWDDQ++L+G L 
Sbjct  61    YSLILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERNWDDQIILSGFLL  120

Query  1903  YLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSI  1724
             YL    L  G RLP WR DG  +   +H GPVEF+YYWLHRALHHH+LY+RYHSHHH+SI
Sbjct  121   YLGALYLPGGQRLPLWRADGAAVIALLHAGPVEFLYYWLHRALHHHWLYTRYHSHHHASI  180

Query  1723  VTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEF  1544
             VTEPITSVIHPF E +AY +LF++P++ +  TGTAS  +   Y+ YIDLMNNMGHCNFE 
Sbjct  181   VTEPITSVIHPFAELVAYEVLFSVPLIASALTGTASIIAFEAYIIYIDLMNNMGHCNFEL  240

Query  1543  IPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLK  1364
             +P WLF  FPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIY T+DKS+DTLYE+SLK
Sbjct  241   VPSWLFKWFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYNTLDKSSDTLYESSLK  300

Query  1363  -RGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYG  1187
                EE+ DVVHLTHLTT  S+Y +R GF+  A+ P +  WY+ LMWPV+  +M++   YG
Sbjct  301   EEEEEAVDVVHLTHLTTLHSIYHMRPGFAECASRPYASRWYMRLMWPVSWLSMVLTWAYG  360

Query  1186  -QTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslgl  1010
               +F ++RN+++KI++QSW IPRY   Y L+W  +AIN LIE+AI EA+  G KV+SLGL
Sbjct  361   SSSFTVERNVMKKIRMQSWAIPRYSFHYGLDWGKEAINDLIEKAIHEADKNGAKVVSLGL  420

Query  1009  LNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSIS  830
             LNQ+  LN+NGE Y+ KYPK++ +LVDG+SLA A++V N+IP+GT +V+L  N++KV+ +
Sbjct  421   LNQAHTLNKNGELYLLKYPKLRARLVDGTSLAAAVVV-NSIPEGTDQVILAGNISKVARA  479

Query  829   IASALTQRGIKVVTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKA  656
             +A AL ++ +KV  + + DY  LK  +      N +  ++ T KVWL+G+GL   EQ +A
Sbjct  480   VAQALCKKNVKVTMTNKQDYHLLKPEMPETVADNLLFLKTGTAKVWLIGDGLDASEQFRA  539

Query  655   TKGTLFIPMSQIPPKKHRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIV  479
              KGT+FIP SQ PPK  R+D CSY   PAM  P +L N+H+CENWLPRR MSA R++GI+
Sbjct  540   KKGTMFIPYSQFPPKMVRKDSCSYSTTPAMTVPKTLQNVHSCENWLPRRVMSAWRIAGIL  599

Query  478   HALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             HALEGW+ +ECG+K+ D++KVW AA+ HGF P+
Sbjct  600   HALEGWDENECGDKVLDMEKVWSAAIMHGFCPV  632



>gb|KCW76761.1| hypothetical protein EUGRSUZ_D01120 [Eucalyptus grandis]
Length=568

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/616 (60%), Positives = 462/616 (75%), Gaps = 51/616 (8%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWKPLG+FKY +L+PWV    + F+     ERD++ FLILPF+L RMLH
Sbjct  1     MASKPGILTDWPWKPLGSFKYAILAPWVVQGTHQFIAKGPGERDFSYFLILPFILERMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRHRTA G NRI+++ IEFEQVDRESNWDDQ++L  +L Y+ +  + + S LP
Sbjct  61    NQIWISLSRHRTAKGNNRILERGIEFEQVDRESNWDDQILLTAILLYMVHWAIPQASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W+TDGV++T  IH   VE++YYWLHRALHHHFLYSRYHSHHHSSIVTEPI+S++HPF E
Sbjct  121   LWKTDGVIITFLIHAFVVEYLYYWLHRALHHHFLYSRYHSHHHSSIVTEPISSIVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY +LFAIP+ TT+ T TAS  S+ GY TYID MNNMGHCNFE IP  LF+IFPPLKY
Sbjct  181   HIAYAMLFAIPMYTTVITRTASIVSITGYTTYIDFMNNMGHCNFELIPNRLFTIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LM    +HSLHHTQFRTNYSLFMP YDYIYGTMD+ST+  YETSL++ E+SPDV++LTHL
Sbjct  241   LM----FHSLHHTQFRTNYSLFMPIYDYIYGTMDESTNATYETSLQKVEDSPDVMYLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T PES+Y +RLGF+++++ P S   Y+W+MWP+TL +++     G +F+L+RN  +K+KL
Sbjct  297   TAPESIYHLRLGFASFSSRPYSPKRYLWIMWPLTLASVVWTWTCGHSFVLERNAFKKLKL  356

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPR+ V Y+L W+++ IN+LIEEAI++A  KGVKVL+LGLLNQ E+LN +GE +IQ
Sbjct  357   QSWVIPRFNVHYILPWRTEVINALIEEAILDANQKGVKVLTLGLLNQGEKLNWHGELFIQ  416

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+  ++ KLVDGSSLA              +VL+R NLNK++ +IA AL  RGI      
Sbjct  417   KHSDLRTKLVDGSSLA------------GCQVLIRGNLNKLAYAIAHALCARGI------  458

Query  781   EDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHR  602
                 ++++LA                         +EEQ KA KGTLFIP SQ PPK+ R
Sbjct  459   ----QEMELA-------------------------EEEQKKAPKGTLFIPFSQFPPKQIR  489

Query  601   RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDID  422
             +DC Y + PAM+AP S +NLH+CENWLPRR MSA RV+GIVHALEGWNV++CG  M DI+
Sbjct  490   KDCLYQNTPAMIAPQSFNNLHSCENWLPRRVMSAWRVAGIVHALEGWNVNKCGGMMFDIE  549

Query  421   KVWEAALSHGFRPLPL  374
             KVWEA+L HGFRPL L
Sbjct  550   KVWEASLQHGFRPLVL  565



>gb|EMT06855.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/617 (58%), Positives = 468/617 (76%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MATTPG  ++WPWK LG+FKYVVL+PWVAH +    T    E D    +ILP ++ R LH
Sbjct  1     MATTPGLFSEWPWKRLGSFKYVVLAPWVAHGVQQVATKGWREADLGYLVILPSMMLRGLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ WI+ SR + A GK +IVD+ IEFEQ+DRE NWDDQ++L+ +LF+L    L     LP
Sbjct  61    NQAWITVSRLQNARGKRQIVDRGIEFEQIDRERNWDDQIILSAILFFLGALHLPGAQNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++   +H GPVE IYYW HRALHHHFLY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++    TGTAS  +   Y+ YID MNNMGHCNFE +P WLF+ FPPLKY
Sbjct  181   LVAYELLFSIPMIACALTGTASIMTFELYMLYIDFMNNMGHCNFELVPSWLFTWFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+DTL+E S++  EE+ DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLHEKSIESKEEAVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y +R GF+ +A+ P +  WY+ +MWP++  +M++   YG  F  +RN+++K+++
Sbjct  301   TSLQSIYHMRPGFAEFASKPYASKWYMRIMWPLSWLSMVLTWTYGSWFTAERNVMKKLRI  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY   Y L W+ +AIN+LI +AI EA+ KG KV+SLGLLNQ++ LN +GE Y+Q
Sbjct  361   QSWAIPRYNFHYGLNWEKEAINNLIVKAICEADKKGAKVVSLGLLNQAQSLNGSGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPK+ +KLVDG+SLA A +VAN+IP+GT +V+L  N++KV+ ++A+AL ++ IKV+ + 
Sbjct  421   KYPKLGLKLVDGTSLAAA-VVANSIPQGTDQVVLSGNISKVACAVAAALCKKNIKVIITN  479

Query  781   EDDYEKL--KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + DY  L  K+  ++  N +LS++   KVW++GEG    EQ++A KGT FIP SQ PP+ 
Sbjct  480   KQDYHFLQPKIPEDAADNLLLSKTGIAKVWIIGEGADATEQLRAPKGTRFIPYSQFPPRM  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM  P +L N+H+CENWLPRR MSA RV+GIVHALEGW+ HECG+ + 
Sbjct  540   ARKDGCTYSTTPAMSVPKTLQNVHSCENWLPRRVMSAWRVAGIVHALEGWDEHECGDMVL  599

Query  430   DIDKVWEAALSHGFRPL  380
             D+DKVW AAL HGFRP+
Sbjct  600   DMDKVWSAALLHGFRPV  616



>ref|XP_010936011.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Elaeis guineensis]
Length=638

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/629 (57%), Positives = 471/629 (75%), Gaps = 17/629 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT WPW+ LGNFKYV+L+PWVAHS++ F+ +   +RD  NFLI P LL R+L+
Sbjct  1     MASQPGPLTQWPWQKLGNFKYVLLAPWVAHSMHKFMAASGEKRDMINFLIFPILLLRLLY  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNW--------------DDQVVLNGLLF  1904
             +QLWI++SR++TA  K+RIVDK ++F+QVDRE N               DDQ++L  LL 
Sbjct  61    SQLWITFSRYQTAKSKHRIVDKSLDFDQVDRERNCVRNAIESDGELDGRDDQIILTALLM  120

Query  1903  YLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSI  1724
             Y+ N V+   S LP W T GV +T+ +H+GPVEFIYYWLHRALHHHFLYSRYHSHHH+SI
Sbjct  121   YMGNMVVPGASHLPWWETRGVAITILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASI  180

Query  1723  VTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEF  1544
             VTEPITSVIHPF E ++YF+LFAIP++T  FTGT S ++ +GY+ YID MN MGHCNFE 
Sbjct  181   VTEPITSVIHPFAEELSYFVLFAIPLMTMAFTGTGSIAAAVGYLMYIDFMNYMGHCNFEL  240

Query  1543  IPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLK  1364
             +PKWLFSIFPPLKYLMYTPS+HSLHHTQFRTNYSLFMPFYDYIYGT+DKS+D  YE SLK
Sbjct  241   VPKWLFSIFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTIDKSSDEQYERSLK  300

Query  1363  RGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQ  1184
               EE P VVHLTHLT  +S+Y +R GFS+ A+ P +  +Y+W++WP+T  +M++  IYG 
Sbjct  301   GKEERPHVVHLTHLTHLQSIYHLRCGFSSLASKPYATKYYMWILWPLTFASMLLTWIYGT  360

Query  1183  TFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLN  1004
             TF  +RN  +++ +++ V+PRY  QY    +   IN+LIE+AI ++E +G KV++LGLLN
Sbjct  361   TFTAERNRFKRLIVETRVVPRYSFQYKSLCERDTINNLIEKAISQSEEEGAKVITLGLLN  420

Query  1003  QSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIA  824
             Q  ELN  GE Y+++   +K K+VDG+SLAVA+++ N++PKGT  +LL   L+K++  ++
Sbjct  421   QGSELNGYGELYLKRNSLLKTKIVDGTSLAVAVVL-NSVPKGTKSILLVGKLSKMAYFLS  479

Query  823   SALTQRGIKVVTSCEDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATK  650
              +L +RG++V    +D+YE  KL+L     G  V S S+T +VWLVG+G+T +EQ++A K
Sbjct  480   LSLCKRGVQVEMVQKDEYEILKLQLPPELHGRLVFSDSYTSEVWLVGDGVTDQEQLRARK  539

Query  649   GTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHAL  470
             G  FIP +Q PPK  R+DC YH  PAM+ P +  NLH CENWLPRR MSA RV+GI+HAL
Sbjct  540   GIRFIPFTQFPPKLVRKDCIYHCTPAMVVPKAYENLHTCENWLPRRVMSAWRVAGIIHAL  599

Query  469   EGWNVHECGEKMCDIDKVWEAALSHGFRP  383
             E WN HECG+ +  ++K W AAL+HGF P
Sbjct  600   EEWNAHECGDVVTGVEKAWHAALAHGFLP  628



>gb|AAC24374.1| CER1 protein [Arabidopsis thaliana]
Length=580

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/569 (64%), Positives = 450/569 (79%), Gaps = 6/569 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PW  HS Y FVT +  +RD   FL+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T++GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY+   +L +  +LP
Sbjct  61    NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   IH GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS  S  GY+ YID MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFILFAIPLLTTLLTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD+STDTLYE +L+RG++  DVVHLTHL
Sbjct  241   LCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGDDIVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P ++ W++ L+WP T  +MI    Y + F+ +RN   K+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFAYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFNKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY +QYLL+W+ +AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
              +P MK++LVDGS LA A+++ N++PK TT V++  NL KV+ +IASAL QRG++V T  
Sbjct  421   NHPDMKVRLVDGSRLAAAVVI-NSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLKLATNSKGN----FVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+YEK++     +      ++ S +  + KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  480   LDEYEKIRSCVPQECRDHLVYLTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACE  530
              K+ RRDC YH  PA++ P SL N+H+CE
Sbjct  540   LKQLRRDCIYHTTPALIVPKSLVNVHSCE  568



>ref|XP_006647531.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=619

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/618 (56%), Positives = 461/618 (75%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ LGNFKYVV++P V H  +  V+    + D    LILP LL RM+H
Sbjct  1     MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGAHRVVSKGWGDIDLAYSLILPSLLLRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  K+RIVD+ IEF+QVDRE  WDDQ++ NGLLFY+    +    R+P
Sbjct  61    NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLLFYVGYLAMPSVRRMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG +MT  +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVMTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF+LFAIP+L+T++ G  S   ++ Y+ YID MNNMGHCNFE +P W+F IFPPLKY
Sbjct  181   HVVYFILFAIPILSTIYVGNVSAMGIVAYIAYIDFMNNMGHCNFELVPSWIFQIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             ++YTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE+SLK  EE+PD+VHLTH+
Sbjct  241   MIYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDELYESSLKGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T+ ES Y +R+G ++ A+ P S++ WY+W +WP+   +M++  IYG + F+++R  L K+
Sbjct  301   TSLESAYHLRIGIASIASKPYSNSAWYMWALWPLAWLSMVLAWIYGSSAFVVERIKLNKM  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W IPRY  QY L W+ + IN LIE+AI++A+ +GVKV+SLGLLNQ+++LN NGE +
Sbjct  361   KMQTWAIPRYNFQYGLTWEREPINDLIEKAILDADMRGVKVVSLGLLNQTKQLNGNGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QKYPK+ +++VDGS LA A+++  +IP    +V L    +K++ +IA AL  RG++V+ 
Sbjct  421   RQKYPKLGVRIVDGSGLATAVVL-KSIPSDAKKVFLHTGSSKIARAIAMALCSRGVQVIM  479

Query  787   SCEDDYEKLKLAT--NSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + +Y+ LKL    N      LS     ++W+V + +  +EQ  A KGT FIP+SQ P 
Sbjct  480   NEKKEYDMLKLQIPENRAIYLKLSSDDIPQLWIV-DNIDDDEQKMAPKGTTFIPISQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK RRDC+Y   PAM  P  + N+H+CENWLPRR MSA  ++GI+HALEGWN HECG+ M
Sbjct  539   KKVRRDCTYASTPAMRIPEEMKNVHSCENWLPRRVMSAWHIAGILHALEGWNTHECGDDM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              D +K W AA+ HGF PL
Sbjct  599   MDAEKSWSAAIRHGFLPL  616



>gb|EEC73617.1| hypothetical protein OsI_08114 [Oryza sativa Indica Group]
Length=619

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/618 (56%), Positives = 461/618 (75%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW  LGNFKYVV++P VAH     + +   + D    LILP LL RM+H
Sbjct  1     MATRPGPLTEWPWHRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  K+RIVD+ IEF+QVDRE  WDDQ++ NGL+FY     +    R+P
Sbjct  61    NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++T  +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF+LFAIP+L+T++ G  S   ++GY+ YID MNNMGHCNFE +P+W+F IFPPLKY
Sbjct  181   HVVYFILFAIPILSTIYLGNVSAMGIVGYIAYIDFMNNMGHCNFELVPEWIFQIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE+SLK  EE+PD+VHLTH+
Sbjct  241   LIYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDELYESSLKGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T  +S Y +R+G ++ A+ P S + WY+W +WP+   +M++  IYG + F+++R  L K+
Sbjct  301   TNLQSAYHLRIGIASIASKPYSDSAWYMWTLWPLAWLSMVLAWIYGSSAFVVERIKLNKM  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W IPRY  QY L W+ + IN LIE+AI++A+ KGVKV+SLGLLNQ+++LN NGE +
Sbjct  361   KMQTWAIPRYNFQYGLTWEREPINDLIEKAILDADMKGVKVISLGLLNQAKQLNGNGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QKYPK+ +++VDGS LA A+++  +IP    +V LR   +K++ +IA AL  RG++V+ 
Sbjct  421   RQKYPKLGVRIVDGSGLATAVVL-KSIPSDAKKVFLRTGTSKIARAIAIALCDRGVQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + ++ Y  LK  +  N      LS     ++W+V   +   EQ  A KGT+FIP+SQ P 
Sbjct  480   NEKEVYHMLKSQIPENRASYLKLSSDNVPQLWIV-HNIDDNEQKMAPKGTIFIPISQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P  + N+H+CENWLPRR MSA  ++GI+HALEGWN+HECG++M
Sbjct  539   KKLRKDCTYMSTPAMRIPEEMKNIHSCENWLPRRVMSAWHIAGILHALEGWNMHECGDEM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              DI+K W AA+ HGF PL
Sbjct  599   MDIEKSWSAAIRHGFLPL  616



>gb|ACR38546.1| unknown [Zea mays]
 gb|AFW72382.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=623

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/622 (56%), Positives = 463/622 (74%), Gaps = 10/622 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ LGNFKY+V++P   H     V     + D    LILP LL RM+H
Sbjct  1     MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVVARGWGDIDLAFALILPSLLLRMVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R++TA  K+RIVD+ IEF+QVDRE  WDDQ++LNGLLFY+    +    R+P
Sbjct  61    NQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIPSARRMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
             AWR+DG +    +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   AWRSDGAVAMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ Y++LFAIP+L+TL+ G AS   ++ Y+ YID MNNMGHCNFE +P+W+F +FPPLKY
Sbjct  181   HMVYYVLFAIPMLSTLYMGNASVLGIVLYIAYIDFMNNMGHCNFELVPRWMFQLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMP YDY+Y TMDKS+D LYETSL+  EE+P +VHLTH+
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPLYDYVYSTMDKSSDQLYETSLRGAEETPGLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN---WYVWLMWPVTLWTMIINCIYGQT-FILDRNILE  1154
             T  +SVY +R+GF++ A+ P +     WY+W++WPV   +M +   YG + F+++R  L 
Sbjct  301   TDLQSVYHLRIGFASVASRPSATGAMWWYMWVLWPVAWLSMALAWAYGSSAFVVERIKLG  360

Query  1153  KIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGE  974
             K+++Q+W +PRY  QY L W+ ++IN LIE AI++A+ +GVKVLSLGLLNQ+++LN  GE
Sbjct  361   KLRMQTWAVPRYNFQYGLSWERESINGLIERAILDADARGVKVLSLGLLNQAKQLNGGGE  420

Query  973   FYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKV  794
              +  +YPK++++LVDGS LA A+++  +IP+   +VLL A  +KV+ + A+AL +RG++V
Sbjct  421   LFRHRYPKLRVRLVDGSGLATAVVL-RSIPRDAKQVLLHAGPSKVACATAAALCERGVQV  479

Query  793   VTSCEDDYEKLKLA-TNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             V +   +Y+ LK    +SK +++  RS    T +VWLV + +  EEQ  A KG +F+P+S
Sbjct  480   VMNPNKEYDMLKSQIADSKASYLERRSDNHHTPQVWLV-DSIDDEEQKMAPKGAVFVPIS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q P KK R+DC+Y   PAM  P ++ N+HACENWLPRR MSA R+ GI+HALEGW VHEC
Sbjct  539   QFPIKKIRKDCTYLSTPAMKIPETMQNIHACENWLPRRVMSAWRIGGILHALEGWTVHEC  598

Query  445   GEKMCDIDKVWEAALSHGFRPL  380
             G+ M   DK W AA+ HGF PL
Sbjct  599   GDAMVHADKAWSAAIRHGFVPL  620



>ref|NP_001047459.1| Os02g0621300 [Oryza sativa Japonica Group]
 dbj|BAD21539.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAD21579.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAF09373.1| Os02g0621300 [Oryza sativa Japonica Group]
Length=619

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/618 (56%), Positives = 461/618 (75%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW  LGNFKYVV++P VAH     + +   + D    LILP LL RM+H
Sbjct  1     MATRPGPLTEWPWHRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  K+RIVD+ IEF+QVDRE  WDDQ++ NGL+FY     +    R+P
Sbjct  61    NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++T  +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF+LFAIP+L+T++ G  S   ++GY+ YID MNNMGHCNFE +P+W+F IFPPLKY
Sbjct  181   HVVYFILFAIPILSTIYLGNVSAMGIVGYIAYIDFMNNMGHCNFELVPEWIFQIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE+SLK  EE+PD+VHLTH+
Sbjct  241   LIYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDELYESSLKGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T  +S Y +R+G ++ A+ P S + WY+W +WP+   +M++  IYG + F+++R  L K+
Sbjct  301   TNLQSAYHLRIGIASIASKPYSDSAWYMWTLWPLAWLSMVLAWIYGSSAFVVERIKLNKM  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W +PRY  QY L W+ + IN LIE+AI++A+ KGVKV+SLGLLNQ+++LN NGE +
Sbjct  361   KMQTWALPRYNFQYGLTWEREPINDLIEKAILDADMKGVKVISLGLLNQAKQLNGNGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QKYPK+ ++++DGS LA A+++  +IP    +V LR   +K++ +IA AL  RG++V+ 
Sbjct  421   RQKYPKLGVRIIDGSGLATAVVL-KSIPSDAKKVFLRTGTSKIARAIAIALCDRGVQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + ++ Y  LK  +  N      LS     ++W+V   +   EQ  A KGT+FIP+SQ P 
Sbjct  480   NEKEVYHMLKSQIPENRASYLKLSSDNVPQLWIV-HNIDDNEQKMAPKGTIFIPISQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P  + N+H+CENWLPRR MSA  ++GI+HALEGWN+HECG++M
Sbjct  539   KKLRKDCTYMSTPAMRIPEEMKNIHSCENWLPRRVMSAWHIAGILHALEGWNMHECGDEM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              DI+K W AA+ HGF PL
Sbjct  599   MDIEKSWSAAIRHGFLPL  616



>gb|ABG66132.1| CER1 protein, putative, expressed [Oryza sativa Japonica Group]
Length=595

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/619 (54%), Positives = 434/619 (70%), Gaps = 32/619 (5%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG  T+WPWK LG+FKYV+L+PWVAH  Y   T    E D     ILP LL RMLH
Sbjct  1     MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ WI+ SR + A G+ +IV + IEF+QVDRE NWDDQ++L+G+L YL    +  G  LP
Sbjct  61    NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG  +   +H GPVEF+YYW H                           VIHPF E
Sbjct  121   LWRTDGAGLIALLHAGPVEFLYYWFH--------------------------PVIHPFAE  154

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++    TGTAS  +   Y+ YID MNNMGHCNFE +P WLF+ FPPLKY
Sbjct  155   LVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWFPPLKY  214

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRG--EESPDVVHLT  1328
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+DTLYE SLK    EE+ DVVHLT
Sbjct  215   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYENSLKNNEEEEAVDVVHLT  274

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLTT  S+Y +R GF+ +A+ P    WY+ +MWP++  +M++   YG +F ++RN+++KI
Sbjct  275   HLTTLHSIYHMRPGFAEFASRPYVSRWYMRMMWPLSWLSMVLTWTYGSSFTVERNVMKKI  334

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             ++QSW IPRY   Y L+W+ +AIN LIE+A+ EA+  G KV+SLGLLNQ+  LN++GE Y
Sbjct  335   RMQSWAIPRYSFHYGLDWEKEAINDLIEKAVCEADKNGAKVVSLGLLNQAHTLNKSGEQY  394

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             + KYPK+  ++VDG+SLA A++V N+IP+GT +V+L  N++KV+ ++A AL ++ IKV  
Sbjct  395   LLKYPKLGARIVDGTSLAAAVVV-NSIPQGTDQVILAGNVSKVARAVAQALCKKNIKVTM  453

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + DY  LK  +      N   S++ T KVWL+G+GL   EQ +A KGTLFIP SQ PP
Sbjct  454   TNKQDYHLLKPEIPETVADNLSFSKTGTAKVWLIGDGLDSAEQFRAQKGTLFIPYSQFPP  513

Query  613   KKHRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             K  R+D CSY   PAM  P +L N+H+CENWLPRR MSA R++GI+HALEGWN HECG+K
Sbjct  514   KMVRKDSCSYSTTPAMAVPKTLQNVHSCENWLPRRVMSAWRIAGILHALEGWNEHECGDK  573

Query  436   MCDIDKVWEAALSHGFRPL  380
             + D+DKVW AA+ HGF P+
Sbjct  574   VLDMDKVWSAAIMHGFCPV  592



>gb|AES88379.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=600

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/619 (56%), Positives = 460/619 (74%), Gaps = 26/619 (4%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+FK+V+LSPW+AHS+YSF+  E+   D + ++I P++  RMLH
Sbjct  1     MASKPGILTNWPWKPLGSFKFVILSPWIAHSIYSFIWVEQ---DPSYYIIFPYMFVRMLH  57

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA GKNRIVDK +EFEQVDRE+NWDDQ++L  L FY+  T+    + LP
Sbjct  58    SQIWISISRYQTAKGKNRIVDKCLEFEQVDRETNWDDQILLTALTFYILYTIFPMAANLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITS       
Sbjct  118   WWRTDGVVLTALLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITS-------  170

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
                           T+F   +S +++ GY+ YID MNNMGHCNFEF PK LFS FP LKY
Sbjct  171   --------------TMFVKKSSIAAVYGYIFYIDFMNNMGHCNFEFFPKKLFSYFPLLKY  216

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHT+FR+NYSLFMP YDYIYGT+D STD  YE+ LKR EESPDVVHLTHL
Sbjct  217   LSYTPSFHSLHHTKFRSNYSLFMPIYDYIYGTVDASTDATYESCLKRQEESPDVVHLTHL  276

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S++ +RLGF++ A+ PQ+  WY+ LMWP TL +M++  I G   +L+ N  + +KL
Sbjct  277   TTLDSIFQLRLGFASLASNPQTSKWYLNLMWPFTLCSMLVTWISGHAIVLESNFFKDLKL  336

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q W+IPR+K+QY  + Q   IN LIEE I+ A+  GVKV+SLGLLNQ +E++ +   YI+
Sbjct  337   QCWLIPRFKIQYFSKKQCIKINKLIEETIMMADLSGVKVISLGLLNQRQEISAHCAVYIE  396

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P +KIK+VDGSSL VA ++ N IPKGT +VLLR   NKV+++I +AL  + ++V    
Sbjct  397   RLPNLKIKVVDGSSLVVATVL-NNIPKGTNQVLLRGKFNKVALAIINALCSKNVQVTVLY  455

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              D+ ++L +    S G+  LS   T K WLVGE   ++EQM+A++G+LFIP S  PPKK 
Sbjct  456   RDELKELERRVAVSDGSLALSPINTPKTWLVGEDWDEDEQMQASEGSLFIPFSHFPPKKM  515

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             ++ C YH+ PAM+ P +L NLH+CENWLPRR MSA R++GI+HALEGW+ HECG+ + +I
Sbjct  516   QKGCLYHYTPAMITPTTLVNLHSCENWLPRRVMSAWRIAGIIHALEGWDAHECGDTVFNI  575

Query  424   DKVWEAALSHGFRPLPLPN  368
             +KVWEA++ HG+ PL +P 
Sbjct  576   EKVWEASIRHGYLPLKIPQ  594



>ref|XP_010493027.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/628 (57%), Positives = 466/628 (74%), Gaps = 14/628 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG FKY++++P    S++S+VT++E E+D  + LI+  +L R++H
Sbjct  1     MASRPGVLTEWPWSPLGGFKYLLVAPLAMASMHSYVTAQEEEKDLASLLIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR +TA G+ +IVDKPIEF+QVDRE +WDDQ++ N L  YL N+ L   SR+P
Sbjct  61    SQIWISVSRQKTAKGRKKIVDKPIEFDQVDRERSWDDQIIFNTLYMYLLNSKLPGCSRMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   LWRLDGAILIALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY LLF+IP++T    G  S  +++ Y TYID MNN GHCNFE +PK LF +FPPLK+
Sbjct  181   HIAYTLLFSIPLVTASLCGILSIGTVIAYFTYIDFMNNYGHCNFECLPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LY+ SLKR EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKCSDSLYQNSLKREEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLW--TMIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF ++++ P      WY+ + MWP TL     +   +   TF+ +RN L
Sbjct  301   TTLDSIYQMRLGFPSFSSRPLWSRSPWYLTYSMWPFTLLFSFALTFALSSCTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P++   Y  +   +++N++IE AIIEA+ KGVKV+SLGL+N +EELN  G
Sbjct  361   RNLTLHSHLLPKFSFHYKSQRHHESMNNIIEAAIIEADEKGVKVMSLGLMNTTEELNGYG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+PK+KI+LVDG+S+A A++V N+IPKGTTEV+ R NL KV+ ++  +L+++ +K
Sbjct  421   ELYVQKHPKLKIRLVDGTSMAAAVVV-NSIPKGTTEVVFRGNLTKVASAVVFSLSEKSVK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV  CE++Y KL   + +  N VLS S    +  VWLVG+GL KEEQMKA +GTLFIP S
Sbjct  480   VVVLCEEEYTKLS-ESGADKNLVLSTSNNCCSSTVWLVGDGLRKEEQMKAKEGTLFIPFS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q PP K R+DC YH  PAML P S  N+ +CENWL RR MSA R+ GIVHALEGW  H+C
Sbjct  539   QFPPDKLRKDCFYHSTPAMLVPKSAQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDC  598

Query  445   GEKMCD---IDKVWEAALSHGFRPLPLP  371
             G   C+   +  +WEAAL H F+PL LP
Sbjct  599   GNT-CNFFRLRAIWEAALRHDFQPLLLP  625



>gb|EMT33049.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/618 (56%), Positives = 459/618 (74%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ +GNFKY+V++P V H  Y  +     + D    LILP L  RM+H
Sbjct  1     MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYSLILPSLALRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  K+RIVD+ IEFEQVDRE  WDDQ+V NGLLFY+    +    R P
Sbjct  61    NQIWISLSRYQTARSKHRIVDRDIEFEQVDRERGWDDQIVFNGLLFYVGYLAMPSVRRFP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG + T  +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPFGE
Sbjct  121   LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YF LFAIP+L+T++ G  S    + Y+ YID MNNMGHCNFE +PKW+F +FPPLKY
Sbjct  181   HIVYFTLFAIPMLSTVYMGNGSALVFVLYIVYIDFMNNMGHCNFELVPKWMFQVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDK++D LYE+SLK  EE+PD+VHLTH+
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYSTMDKASDELYESSLKGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T  +S Y +R+GF++ A+ P  ++ WY+W +WP+   +M++  IYG + F+++R  L+K+
Sbjct  301   TNLQSAYHLRVGFASIASKPSDNSEWYMWTLWPLAWLSMVVAWIYGSSAFVVERIKLKKM  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+WV+PRY  QY L W  ++IN LIE+AI++A+ +GVKVLSLGLLNQ+++LN NGE +
Sbjct  361   KMQTWVVPRYNFQYGLTWDRESINDLIEKAILDADVRGVKVLSLGLLNQAKQLNGNGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QKYPK+ +++VDGS LA  +++  +IP    +V L    +K++ ++A AL  +GI+V+ 
Sbjct  421   RQKYPKLGVRIVDGSGLATGVVL-KSIPSDAKQVFLHTGTSKIARAVAMALCGKGIQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + +Y+ LK  +  N       S +   K+WLV E +  +EQ  A KGT+FIP+SQ P 
Sbjct  480   NRKKEYDMLKSQMPENRASYLKCSSNDITKIWLV-ERIDDKEQRMAPKGTVFIPISQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P ++ N+H+CENWLPRR MSA  ++GI+H LEGW+VHECG+ M
Sbjct  539   KKVRKDCTYLSTPAMKIPDTMQNIHSCENWLPRRVMSAWHIAGILHVLEGWSVHECGDDM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              D +K W AA+ HGF PL
Sbjct  599   MDPEKAWSAAIRHGFVPL  616



>ref|XP_003575378.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/618 (56%), Positives = 459/618 (74%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ LGNFKY+V++P V H  +  +T    + D    LILP LL RM+H
Sbjct  1     MATRPGPLTEWPWQRLGNFKYLVMAPVVVHGAHRVMTKGWGDIDLAYALILPSLLLRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  K+RIVD+ IEF+QVDRE  WDDQ++ NGLLFY     +      P
Sbjct  61    NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIIFNGLLFYAGYLAMPSVRGFP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG +MT  +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPFGE
Sbjct  121   LWRTDGAVMTALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF LFAIP+L+T++ G  S    + Y+ YID MNNMGHCNFE +PKW F +FPPLKY
Sbjct  181   HVVYFTLFAIPMLSTIYMGNGSALVFVLYIVYIDFMNNMGHCNFELVPKWAFQVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE SLK  EE+PD+VHLTH+
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYSTMDKSSDELYENSLKGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T  +S Y +R+GF++ A+ P ++  WY+W +WP+   +M++  +YG + F+++R  L+K+
Sbjct  301   TNLQSAYHLRIGFASIASKPSENSEWYMWTLWPLAWLSMVVAWMYGSSAFVVERIKLKKL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+WVIPRY  QY L W+ ++IN LIE+AI++A+ +GVKVLSLGLLNQ++ELN  GE +
Sbjct  361   KMQTWVIPRYNFQYALTWERESINDLIEKAILDADVRGVKVLSLGLLNQTKELNGAGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QKYPK+ ++LVDGS LA A+++  +IP    +V L+   +K++ +IA  L  RGI+V+ 
Sbjct  421   RQKYPKLGVQLVDGSGLATAVVL-KSIPLDAKQVFLQTGTSKIARAIAITLCGRGIQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + +Y+ LK  +  N       S     K+WLV + +  +EQ+ A KGT+FIP+SQ P 
Sbjct  480   NRKKEYDILKPQIPENRASYLKCSSDDMPKIWLV-DCIDAKEQLVAPKGTVFIPISQFPT  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P ++ N+H+CENWLPRR MSA  ++GI+H LEGW++HECG+ M
Sbjct  539   KKVRKDCTYLSTPAMKIPEAMQNIHSCENWLPRRVMSAWHIAGILHVLEGWSMHECGDSM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              DI+K W AA  HGF PL
Sbjct  599   MDIEKTWSAATRHGFVPL  616



>ref|XP_006306552.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
 gb|EOA39450.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
Length=626

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/629 (57%), Positives = 465/629 (74%), Gaps = 19/629 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLT+WPW PLG FKY++++P+   S++S++T+EE E+D    LI+  +L RM+H
Sbjct  1     MASRPGFLTEWPWSPLGGFKYLLVAPFALASMHSYITAEEEEKDLGRMLIVALMLWRMVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
              Q+WIS SR +TA G+N+IVDKPIEFEQVDRE +WDDQ++ N LL YL N  L   SRLP
Sbjct  61    CQIWISVSRQKTAKGRNKIVDKPIEFEQVDRERSWDDQIIFNTLLMYLLNNKLPGSSRLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   LWRLDGAILIALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY LLF+IP++T    G  S  S++ Y+TYID MNN GHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTLLFSIPIVTASLCGILSIVSVIAYLTYIDFMNNYGHCNFECFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YT S+HSLHHTQFRTNYSLFMP YDYIY T DK +D+LYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTSSFHSLHHTQFRTNYSLFMPIYDYIYKTADKCSDSLYENSLEREEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWTMII--NCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF ++++ P      WY+ + MWP TL    +  + +   TF+ +RN L
Sbjct  301   TTLDSIYQMRLGFPSFSSHPLWSRSPWYLTYSMWPFTLLVSFVLSSALSSCTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P++          ++IN +IE +IIEA+ KGVKV+SLGL+N +EELN  G
Sbjct  361   RNLTLHSHLLPKFGFHR----HHKSINDIIEVSIIEADEKGVKVMSLGLMNTTEELNGYG  416

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+PK+KI+LVDG+S+A A++V N+IP+GT EV+ R NL KV+ ++  +L+Q+G+K
Sbjct  417   ELYVQKHPKLKIRLVDGTSMAAAVVV-NSIPEGTKEVVFRGNLTKVASAVVFSLSQKGVK  475

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS----FTQKVWLVGEGLTKEEQMKATKGTLFIPM  629
             VV   E++Y KL + + +  N VLS S    ++  VWLVG+GL KEEQMKA +GTLFIP 
Sbjct  476   VVMLHEEEYNKL-IKSGADKNLVLSTSNNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPF  534

Query  628   SQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHE  449
             SQ PP+K R+DC YH  PAML P S  N+ +CENWL RR MSA R+ GIVHALEGW  H+
Sbjct  535   SQFPPEKLRKDCFYHSTPAMLVPKSAQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHD  594

Query  448   CGEKMCD---IDKVWEAALSHGFRPLPLP  371
             CG   C+   +  +WEAAL H F+PL LP
Sbjct  595   CG-NTCNFFRLHAIWEAALRHEFQPLLLP  622



>ref|XP_003574037.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=621

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/619 (57%), Positives = 460/619 (74%), Gaps = 6/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG L++WPWK LG+FKY+VL+PWV H  +   T    E D     ILP +L R LH
Sbjct  1     MATNPGILSEWPWKRLGSFKYLVLAPWVVHGCHLAATKGWRELDLGYVAILPSMLLRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WI+ SR   A GK +IV + IEF+QVDRE NWDDQ++L+ +L  L    L  G  LP
Sbjct  61    DQAWITVSRLYNARGKRQIVRRGIEFDQVDRERNWDDQIILSAILLLLGAVYLPGGQHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++   +H GPVEF+YYW HRALHHH LY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVLLALLHAGPVEFLYYWFHRALHHHVLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF+IP++T   TGTAS  +   YV YID MNNMGHCNFE +P WLF   PPLKY
Sbjct  181   LLAYQLLFSIPMITCALTGTASIITFEIYVIYIDFMNNMGHCNFELVPNWLFEWIPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESP--DVVHLT  1328
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS++TLY+ SLK   E    DVVHLT
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSETLYQDSLKDKNEEKEVDVVHLT  300

Query  1327  HLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKI  1148
             HLT+ +S+Y IR GF+ +A+ P +  W++ +MWPV+  +M++   YG  F ++RN++ K+
Sbjct  301   HLTSLQSIYHIRPGFAQYASRPYTSMWHLRIMWPVSWLSMVLTWSYGSWFTVERNVMGKL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             ++QSW IPRY+  Y L+ + +AIN LIE+AI EA+ KG KV+SLGLLNQ+  LNR+GE Y
Sbjct  361   RMQSWAIPRYRFHYGLKQEKEAINDLIEKAISEADKKGTKVVSLGLLNQAHNLNRSGELY  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             +QKYPK+ +++VDG+SLA A++V N+IPKGT +V+L  N++KV++++ASAL ++ +KV+ 
Sbjct  421   LQKYPKLGVRIVDGTSLAAAVVV-NSIPKGTNQVILAGNISKVALAVASALCKKNVKVIL  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + DY  LK  +  NS  N VLS + + KVW++GEGL   EQ+KA KGT FIP SQ PP
Sbjct  480   TNKQDYHSLKPNIPQNSASNLVLSNTDSAKVWVIGEGLDAAEQLKAEKGTQFIPYSQFPP  539

Query  613   KKHRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             +  R+D C+Y   PAM  P ++ NLH+CENWLPRR MSA R++GIVHALEGW   ECG+ 
Sbjct  540   RMVRKDCCTYLTTPAMSVPKTMQNLHSCENWLPRRVMSAWRIAGIVHALEGWKEDECGDT  599

Query  436   MCDIDKVWEAALSHGFRPL  380
             + D++KVW AA+ HGF P+
Sbjct  600   VLDMEKVWSAAVMHGFSPV  618



>ref|XP_006857470.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
 gb|ERN18937.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
Length=621

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/616 (56%), Positives = 452/616 (73%), Gaps = 3/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWK LGNFKY+V+ P   H++Y    +++ +RD+   + L   LSR++H
Sbjct  1     MASKPGPLTDWPWKKLGNFKYMVIVPCAIHAVYRIYGAQKQKRDHATIISLGLFLSRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +QLWI+ SR +TA  K+RI  + I+FEQVDRE NWDDQ +L+ ++FY+    L     LP
Sbjct  61    DQLWITLSRFQTARSKHRIQSRGIDFEQVDRERNWDDQAILHAIIFYIGELFLPGAQNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W T GV++ V  H GPVE+IYYW HRALHHHFLY+RYHSHHHSS VTEPITSV+HPF E
Sbjct  121   LWNTKGVIIAVLCHAGPVEYIYYWAHRALHHHFLYTRYHSHHHSSFVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+FA+P L T+ T TAS + L+GY+T+ID MNNMGHCNFEF PKW F IFPPLKY
Sbjct  181   HILYALIFAVPFLATVLTYTASYTVLIGYMTFIDFMNNMGHCNFEFFPKWTFKIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPSYHSLHH+Q  TN+SLFMP YDY+Y T+DK+TD++YE+S++  E++ DVVHLTH 
Sbjct  241   LIYTPSYHSLHHSQVHTNFSLFMPIYDYMYNTVDKTTDSVYESSIEGREDTTDVVHLTHP  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+  S+Y +RLGF+  AA P S  WY+WLM P++   M++  I+G TF++++N L + K+
Sbjct  301   TSLHSIYHLRLGFAYLAAEPYSSKWYLWLMCPLSFVLMLVTWIFGCTFVVEKNKLYEHKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IPRY  QY L+WQ   IN++IE+AI+EA+  GVKV+SLGLLNQ EE N+NGE Y+ 
Sbjct  361   QTWAIPRYNFQYSLKWQKAPINNMIEKAILEADAMGVKVISLGLLNQGEEFNKNGELYLH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
                K+K ++VDGS+L+ A ++ N IP GT +VL+R  L K   + A AL +R  K+V   
Sbjct  421   NREKLKTRIVDGSTLSAATVL-NGIPHGTQKVLIRGCLTKTLFTTALALLERRTKIVVIR  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
              ++YE LK+   SK      LS ++  KVWLVGE L  EEQ +A +GTLFIP +Q PP+ 
Sbjct  480   TEEYENLKMRIPSKYQSGISLSNNYDTKVWLVGEDLRAEEQSRANRGTLFIPFTQFPPRA  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R DC YH  PA++ P +L ++H+CENWLPRR MSA RV+GIVHALEGW+ HECG    D
Sbjct  540   VREDCIYHTTPALVIPRTLEDVHSCENWLPRRVMSAWRVAGIVHALEGWDSHECGNMTLD  599

Query  427   IDKVWEAALSHGFRPL  380
             ++KVW   LSHGF+P+
Sbjct  600   VEKVWSTTLSHGFKPI  615



>ref|XP_002454185.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
 gb|EES07161.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
Length=619

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/618 (56%), Positives = 461/618 (75%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ LGNFKY+V+ P V       V     + D    LILP LL RM H
Sbjct  1     MATRPGPLTEWPWQRLGNFKYLVMGPVVVDGARRVVARGWGDIDLAFALILPSLLLRMAH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R++TA  K+RIVD+ IEFEQVDRE  WDDQ++LNGLLFY     +     LP
Sbjct  61    NQIWISAARYQTARSKHRIVDRGIEFEQVDRERGWDDQIILNGLLFYAGYLAIPSARHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
             AWRTDG  +   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   AWRTDGAAVMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ Y++LFAIP+L+T++ G AS   ++ Y+ YID MNNMGHCNFE +PKW+F +FPPLKY
Sbjct  181   HMVYYVLFAIPMLSTVYIGNASVLGIVVYIAYIDFMNNMGHCNFELVPKWMFQVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE+SL+  EE+PD+VHLTH+
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDQLYESSLRGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYG-QTFILDRNILEKI  1148
             T  +S Y +R+GF++ A+ P  S  WY+W++WPV   +M++  +YG  TF+++R  L K+
Sbjct  301   TDLQSAYHLRIGFASIASRPSDSSMWYMWVLWPVAWLSMVLAWVYGSSTFVVERIKLGKL  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W +PRY  QY L W+ ++IN LIE+AI++A+ +GVKVLSLGLLNQ+++LN  GE +
Sbjct  361   KMQTWAVPRYNFQYGLSWERESINDLIEKAILDADARGVKVLSLGLLNQAKQLNGGGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QKYPK+ ++LVDGS LA A+++  +IP    +V L A  +K++ + A AL +RG++V+ 
Sbjct  421   RQKYPKLTVRLVDGSGLATAVVL-KSIPHDAKQVFLHAGPSKIACATAFALCERGVQVIM  479

Query  787   SCEDDYEKLKLA-TNSKGNFVL-SRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + +Y+ LK    +SK +++  S + T ++WLV + +  +EQ  A +G +F+P+SQ P 
Sbjct  480   NPKKEYDMLKSQIADSKASYLKHSSNHTPQIWLV-DNIDDKEQKMAPQGAIFVPISQFPI  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P ++ N+HACENWLPRR MSA R+ GI+HALEGW +HECG+ M
Sbjct  539   KKIRKDCTYLSTPAMKIPETMQNIHACENWLPRRVMSAWRIGGILHALEGWTMHECGDAM  598

Query  433   CDIDKVWEAALSHGFRPL  380
                +K W AA+ HGF PL
Sbjct  599   MHTEKAWSAAIRHGFIPL  616



>dbj|BAA11024.1| possible aldehyde decarbonylase [Arabidopsis thaliana]
Length=567

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/559 (64%), Positives = 441/559 (79%), Gaps = 6/559 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG+FKY+V++PW  HS Y FVT +  +RD   FL+ PFLL R+LH
Sbjct  1     MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR+ T++GK RIVDK I+F QVDRE+NWDDQ++ NG+LFY+   +L +  +LP
Sbjct  61    NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVLM   IH GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP+LTTL T TAS  S  GY+ YID MNNMGHCNFE IPK LF +FPPLK+
Sbjct  181   HIAYFILFAIPLLTTLLTKTASIISFAGYIIYIDFMNNMGHCNFELIPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPSYHSLHHTQFRTNYSLFMP YDYIYGTMD+STDTLYE +L+RG++  DVVHLTHL
Sbjct  241   LCYTPSYHSLHHTQFRTNYSLFMPLYDYIYGTMDESTDTLYEKTLERGDDRVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +R+G +++A+ P ++ W++ L+WP T  +MI    Y + F+ +RN   K+ L
Sbjct  301   TTPESIYHLRIGLASFASYPFAYRWFMRLLWPFTSLSMIFTLFYARLFVAERNSFNKLNL  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY +QYLL+W+ +AIN++IE+AI+EA+ KGVKVLSLGL+NQ EELNRNGE YI 
Sbjct  361   QSWVIPRYNLQYLLKWRKEAINNMIEKAILEADKKGVKVLSLGLMNQGEELNRNGEVYIH  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
              +P MK++LVDGS LA A+++ N++PK TT V++  NL KV+ +IASAL QRG++V T  
Sbjct  421   NHPDMKVRLVDGSRLAAAVVI-NSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTLR  479

Query  781   EDDYEKLKLATNSKGN----FVLSRSF-TQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              D+YEK++     +      ++ S +  + KVWLVGEG T+EEQ KATKGTLFIP SQ P
Sbjct  480   LDEYEKIRSCVPQECRDHLVYLTSEALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFP  539

Query  616   PKKHRRDCSYHHPPAMLAP  560
              K+ R DC YH  PA++ P
Sbjct  540   LKQLRSDCIYHTTPALIVP  558



>ref|XP_004953128.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=620

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/619 (56%), Positives = 461/619 (74%), Gaps = 7/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEE-SERDYTNFLILPFLLSRML  2045
             MAT PG LT+WPW+ LGNFKYVV++P V H       +    E D    LILP LL RM+
Sbjct  1     MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGSRRVAGAGGWGELDLAFALILPSLLLRMV  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS +R++TA  K+RIVD+ I+F+QVDRE  WDDQ++LNGLLFY+   ++     +
Sbjct  61    HNQIWISAARYQTARSKHRIVDRGIDFDQVDRERGWDDQIILNGLLFYVAYLLIPSARHM  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             PAWRTDG +    +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PAWRTDGAVAMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHI Y++LFAIP+LTT++ G  S   ++ Y+ YID MNNMGHCNFE +PKW+F +FPPLK
Sbjct  181   EHIVYYILFAIPMLTTIYMGNGSVLGIVLYIAYIDFMNNMGHCNFELVPKWMFQVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE+SLK  EE+PD+VHLTH
Sbjct  241   YLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDQLYESSLKGTEETPDLVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVP-QSHNWYVWLMWPVTLWTMIINCIYGQT-FILDRNILEK  1151
             +T  +S Y +R+GF++ A+ P  S  WY+W +WP+   +M++  +YG + F+++R  L K
Sbjct  301   MTNLQSAYHLRIGFASIASKPSDSSMWYMWTLWPLAWLSMVLAWVYGSSAFVVERIKLNK  360

Query  1150  IKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEF  971
             +K+Q+W +PRY  QY L W+ ++IN LIE+AI++A+ +GVKVLSLGLLNQ+++LN  GE 
Sbjct  361   LKMQTWAVPRYNFQYGLNWERESINDLIEKAILDADARGVKVLSLGLLNQAKQLNGGGEL  420

Query  970   YIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVV  791
             + QKYPK++++LVDGS LA A+++  +IP    +V L A  +K++ + A AL ++G+KV+
Sbjct  421   FRQKYPKLRVRLVDGSGLATAVVL-KSIPHDAKQVFLHAGPSKIAYATAFALCEKGVKVI  479

Query  790   TSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              +  + Y+ LK  +A +       S +   ++WLV + +  +EQ  A +G +FIP+SQ P
Sbjct  480   MNPNNKYDMLKSQIADSRASYLKHSSNHMPQIWLV-DNIDDKEQKMAPEGAIFIPISQFP  538

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
              KK R+DC+Y   PAM  P ++ N+HACENWLPR+ MSA R++GI+HALEGW  HECG+ 
Sbjct  539   IKKIRKDCTYLSTPAMKIPETMQNVHACENWLPRKVMSAWRIAGILHALEGWTKHECGDA  598

Query  436   MCDIDKVWEAALSHGFRPL  380
             M D +K W AA+ HGF PL
Sbjct  599   MMDAEKAWSAAIRHGFVPL  617



>ref|XP_003606182.1| Protein WAX2 [Medicago truncatula]
Length=594

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/619 (56%), Positives = 458/619 (74%), Gaps = 32/619 (5%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPWKPLG+FK+V+LSPW+AHS+YSF+  E+   D + ++I P++  RMLH
Sbjct  1     MASKPGILTNWPWKPLGSFKFVILSPWIAHSIYSFIWVEQ---DPSYYIIFPYMFVRMLH  57

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA GKNRIVDK +EFEQVDRE+NWDDQ++L  L FY+  T+    + LP
Sbjct  58    SQIWISISRYQTAKGKNRIVDKCLEFEQVDRETNWDDQILLTALTFYILYTIFPMAANLP  117

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITS       
Sbjct  118   WWRTDGVVLTALLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITS-------  170

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
                           T+F   +S +++ GY+ YID MNNMGHCNFEF PK LFS FP LKY
Sbjct  171   --------------TMFVKKSSIAAVYGYIFYIDFMNNMGHCNFEFFPKKLFSYFPLLKY  216

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHT+FR+NYSLFMP YDYIYGT+D STD  YE+ LKR EESPDVVHLTHL
Sbjct  217   LSYTPSFHSLHHTKFRSNYSLFMPIYDYIYGTVDASTDATYESCLKRQEESPDVVHLTHL  276

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S++ +RLGF++ A+ PQ+  WY+ LMWP TL +M++  I G   +L+ N  + +KL
Sbjct  277   TTLDSIFQLRLGFASLASNPQTSKWYLNLMWPFTLCSMLVTWISGHAIVLESNFFKDLKL  336

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q W+IPR+K+Q +       IN LIEE I+ A+  GVKV+SLGLLNQ +E++ +   YI+
Sbjct  337   QCWLIPRFKIQCI------KINKLIEETIMMADLSGVKVISLGLLNQRQEISAHCAVYIE  390

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + P +KIK+VDGSSL VA ++ N IPKGT +VLLR   NKV+++I +AL  + ++V    
Sbjct  391   RLPNLKIKVVDGSSLVVATVL-NNIPKGTNQVLLRGKFNKVALAIINALCSKNVQVTVLY  449

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              D+ ++L +    S G+  LS   T K WLVGE   ++EQM+A++G+LFIP S  PPKK 
Sbjct  450   RDELKELERRVAVSDGSLALSPINTPKTWLVGEDWDEDEQMQASEGSLFIPFSHFPPKKM  509

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             ++ C YH+ PAM+ P +L NLH+CENWLPRR MSA R++GI+HALEGW+ HECG+ + +I
Sbjct  510   QKGCLYHYTPAMITPTTLVNLHSCENWLPRRVMSAWRIAGIIHALEGWDAHECGDTVFNI  569

Query  424   DKVWEAALSHGFRPLPLPN  368
             +KVWEA++ HG+ PL +P 
Sbjct  570   EKVWEASIRHGYLPLKIPQ  588



>ref|XP_010496697.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/628 (57%), Positives = 463/628 (74%), Gaps = 14/628 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY++++P+V  S++S+VT  + E+D++  +I+  +L R++H
Sbjct  1     MASKPGALTEWPWSPLGSFKYLLVAPFVMASMHSYVTVADEEKDFSRLMIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR RTA G  +IVDKPIEFEQVDRE  WDDQ++ N LL YL N  L   S LP
Sbjct  61    SQIWISVSRQRTAKGTRKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG L+   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   LWRLDGALLMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY LLFAIP++T    G  S   ++GY+TYID MNNMGHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYSLLFAIPMVTASLCGILSIVPIIGYMTYIDFMNNMGHCNFELFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +++LYE SL+R E+SPDV++LTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKLSESLYERSLEREEDSPDVIYLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF + ++ P      WY+   MWP TL    ++ + +  +TF+ +RN L
Sbjct  301   TTHDSIYQMRLGFPSLSSFPLWNRSPWYLTCFMWPFTLLCSFVLTSALSSRTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P+Y   Y  +   ++IN+LIE AI+EA+ KGVKV+SLGL+N   ELN  G
Sbjct  361   RHLTLHSHLLPKYSFHYKSQRHHESINNLIEGAILEADAKGVKVMSLGLMNNRAELNGYG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QKYPK+KI+LVDGSS+A A++V N IPK TTE++ R NL KV+ ++  AL Q+G+K
Sbjct  421   EMYVQKYPKLKIRLVDGSSMAAAVVV-NNIPKETTEIVFRGNLTKVASAVVFALCQKGVK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   ++++ KL + +    N VLS +   ++ KVWLVG+G+ KEEQMKA +GTLF+P S
Sbjct  480   VVLLRKEEHIKL-IQSGVVKNLVLSTNKSYYSPKVWLVGDGIEKEEQMKAKEGTLFVPFS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
               PPKK R+DC YH  PAM  P S  N+ +CENWL RR MSA ++ GIVHALEGW  H+C
Sbjct  539   HFPPKKLRKDCFYHSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDC  598

Query  445   GEKMCD---IDKVWEAALSHGFRPLPLP  371
             G   C+   +  +WEAAL H F+PL LP
Sbjct  599   GNT-CNFFRLHTIWEAALRHDFQPLILP  625



>ref|XP_004976194.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/618 (55%), Positives = 463/618 (75%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ +G+FKY+VL+P V H+ +   T    + D     +LP LL RM+H
Sbjct  1     MATRPGPLTEWPWQWMGSFKYLVLAPAVLHTAHRVATKGWGDLDPAYITMLPALLLRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  KN IVD+ IEFEQVDRE +WDDQ++ NGL FYL   ++     LP
Sbjct  61    NQIWISLSRYQTARRKNVIVDRSIEFEQVDRERSWDDQIIFNGLEFYLAYAMIPNVRLLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++TV +H+GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   VWRTDGAIITVLLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF+LF+IP LT +F G  S   ++ Y+ YID MNNMGHCNFE +PKW+F  FPPLKY
Sbjct  181   HVVYFMLFSIPTLTPIFMGCGSVLGVVLYIAYIDFMNNMGHCNFELVPKWIFKAFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+Y TMDKS+D LYE SLK  +E+PD+VHLTH+
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYMYNTMDKSSDELYEKSLKVTDETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T  +S Y +R+G ++ A+ P  +  WY W++WPV   +M++  +YG + F+++R  ++K 
Sbjct  301   TNLQSTYHLRIGIASIASKPSDNPVWYSWMIWPVAWLSMVLAWVYGSSAFVIERLQMKKF  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W IPRY  QY + W+ ++INSLIE+AI++A+ +GVKVLSLGLLNQ++ LNR+GE +
Sbjct  361   KMQTWAIPRYNFQYGMSWERESINSLIEKAILDADERGVKVLSLGLLNQAKPLNRSGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             IQKYPK++++LVDGS LA A+++  +IP GT +V L  + +KV+ + A AL ++G +V+ 
Sbjct  421   IQKYPKLRVRLVDGSGLATAVVL-KSIPLGTKKVFLSGSTSKVAHATAMALCEKGFQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + +Y+ LK  L   +      S     ++W +G+ +  ++Q +A KGT F+P SQ P 
Sbjct  480   NQKKEYDMLKSRLPVGTTVYLKFSNKDIPQIW-IGDYIDDKQQQRAPKGTTFVPTSQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P ++ N+H CENWLPRR MSA R++GI+HA+EGW++HECG+ M
Sbjct  539   KKIRKDCTYLSTPAMKIPATMENVHTCENWLPRRVMSAWRIAGILHAVEGWDMHECGDDM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              DI+K W AA+ HGF PL
Sbjct  599   MDIEKTWSAAIKHGFVPL  616



>gb|EEE57393.1| hypothetical protein OsJ_07566 [Oryza sativa Japonica Group]
Length=619

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/618 (56%), Positives = 457/618 (74%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG   +W    LGNFKYVV++P VAH     + +   + D    LILP LL RM+H
Sbjct  1     MATRPGPFYEWALDRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  K+RIVD+ IEF+QVDRE  WDDQ++ NGL+FY     +    R+P
Sbjct  61    NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++T  +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF+LFAIP+L+T++ G  S   ++GY+ YID MNNMGHCNFE +P+W+F IFPPLKY
Sbjct  181   HVVYFILFAIPILSTIYLGNVSAMGIVGYIAYIDFMNNMGHCNFELVPEWIFQIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L+YTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKS+D LYE+SLK  EE+PD+VHLTH+
Sbjct  241   LIYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDELYESSLKGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T  +S Y +R+G ++ A+ P S + WY+W +WP+   +M++  IYG + F+++R  L K+
Sbjct  301   TNLQSAYHLRIGIASIASKPYSDSAWYMWTLWPLAWLSMVLAWIYGSSAFVVERIKLNKM  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W +PRY  QY L W+ + IN LIE+AI++A+ KGVKV+SLGLLNQ+++LN NGE +
Sbjct  361   KMQTWALPRYNFQYGLTWEREPINDLIEKAILDADMKGVKVISLGLLNQAKQLNGNGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QKYPK+ ++++DGS LA A+++  +IP    +V LR   +K++ +IA AL  RG++V+ 
Sbjct  421   RQKYPKLGVRIIDGSGLATAVVL-KSIPSDAKKVFLRTGTSKIARAIAIALCDRGVQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + ++ Y  LK  +  N      LS     ++W+V   +   EQ  A KGT+FIP+SQ P 
Sbjct  480   NEKEVYHMLKSQIPENRASYLKLSSDNVPQLWIV-HNIDDNEQKMAPKGTIFIPISQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P  + N+H+CENWLPRR MSA  ++GI+HALEGWN+HECG++M
Sbjct  539   KKLRKDCTYMSTPAMRIPEEMKNIHSCENWLPRRVMSAWHIAGILHALEGWNMHECGDEM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              DI+K W AA+ HGF PL
Sbjct  599   MDIEKSWSAAIRHGFLPL  616



>ref|XP_010480305.1| PREDICTED: protein CER1-like 1 isoform X1 [Camelina sativa]
Length=629

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/628 (57%), Positives = 465/628 (74%), Gaps = 14/628 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG FKY+++ P    S+YS++T+EE E+D    LI+  +L R++H
Sbjct  1     MASRPGVLTEWPWSPLGGFKYLLVVPLAIGSIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR +TA G  +IVDKPIEFEQVDRE +WDDQ++ N L  YL N+ L   SR+P
Sbjct  61    SQIWISVSRKKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRVP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY +LFAIP++     G  S  S++ Y+TYID MNN+GHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTILFAIPLVAASLCGILSIFSVVAYMTYIDFMNNLGHCNFECFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +++LYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKCSESLYENSLQRKEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLW--TMIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGFS++++ P      WY+ + MWP TL     +   +   TF+ +RN +
Sbjct  301   TTRDSIYQMRLGFSSFSSRPLWSRSPWYLTYSMWPFTLLFSFFLTFAVSSCTFVFERNRV  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P+++  Y  +   ++IN++IE AIIEA+ KGVKV+SLGL+N +EELN  G
Sbjct  361   RNLILHSHLLPKFEFHYKSQRHHRSINNIIEAAIIEADEKGVKVMSLGLMNTTEELNGYG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+PK+KI+LVDGSS+A A++V N+IPKGTTEV+ R N+ K++ +I  +L+Q+GIK
Sbjct  421   ELYVQKHPKLKIRLVDGSSMAAAVVV-NSIPKGTTEVVFRGNITKIASAIVFSLSQKGIK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E++Y KL + + +  N VL  S   ++  VWLVG+GL KEEQMKA +GTLFIP S
Sbjct  480   VVVLREEEYTKL-IKSGADENLVLFSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q PP K R+DC YH  PAML P    N+ +CENWL RR MSA R+ G+VHALEGW  H+C
Sbjct  539   QFPPDKLRKDCFYHSTPAMLVPKCAQNIDSCENWLGRRVMSAWRIGGVVHALEGWEEHDC  598

Query  445   GEKMCD---IDKVWEAALSHGFRPLPLP  371
             G   C+   +  +WEAAL H F+PL LP
Sbjct  599   GNT-CNFFRLHAIWEAALRHDFQPLQLP  625



>gb|ACA14353.1| TCER1 [Triticum aestivum]
Length=619

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/618 (56%), Positives = 455/618 (74%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ +GNFKY+V++P V H  Y  +     + D    LILP L  RM+H
Sbjct  1     MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYSLILPSLALRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WI  SR++TA  K+RIVD+ IEF+QVDRE  WDDQ+V NGLLFY+    +    R P
Sbjct  61    NQIWIGLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIVFNGLLFYVGYLAMPSVRRFP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG + T  +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPFGE
Sbjct  121   LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI YF LFAIP+L+T++ G  S    + Y+ YID MNNMGHCNFE  PKW+F +FPPLKY
Sbjct  181   HIVYFTLFAIPMLSTVYMGNGSALVFVLYIVYIDFMNNMGHCNFELAPKWMFQVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HS HHTQFRTNYSLFMPFYDYIY TMDK++D LYE+SLK  EE+PD+VHLTH+
Sbjct  241   LMYTPSFHSPHHTQFRTNYSLFMPFYDYIYSTMDKASDELYESSLKGTEETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             T  +S Y +R+GF++ A+ P  ++ WY+W +WP+   +M++  IYG + F+++R  L+K+
Sbjct  301   TNLQSAYHLRVGFASIASKPSDNSEWYMWTLWPLAWLSMVVAWIYGSSAFVVERIKLKKM  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+WV+PRY  QY L W  ++IN LIE+AI++A+ +GVKVLSLGLLNQ+++LN NGE +
Sbjct  361   KMQTWVVPRYNFQYGLTWDRESINDLIEKAILDADVRGVKVLSLGLLNQAKQLNGNGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
              QK PK+ +++VDGS LA  +++  +IP    +V L    +KV+ +IA AL  RGI+V+ 
Sbjct  421   GQKCPKLGVRIVDGSGLATGVVL-KSIPSDAKQVFLHTGTSKVARAIAMALCGRGIQVIM  479

Query  787   SCEDDYEKLKLATNSKGNFVL--SRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + +Y+ LK      G   L  S +   K+WLV E +  +EQ  A +GT+FIP+SQ P 
Sbjct  480   NRKKEYDVLKSQMPEDGASYLKCSSNDITKIWLV-EKIDDKEQRMAPRGTVFIPISQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK R+DC+Y   PAM  P ++ N+H+CENWLPRR MSA  ++GI+H LEGW+VHECG+ M
Sbjct  539   KKVRKDCTYLSTPAMKIPDTMQNIHSCENWLPRRVMSAWHIAGILHVLEGWSVHECGDDM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              D +K W AA+ HGF PL
Sbjct  599   MDPEKAWSAAIRHGFVPL  616



>ref|XP_010511349.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/628 (57%), Positives = 464/628 (74%), Gaps = 14/628 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW P G FKY+++ P    S+YS++T+EE E+D    LI+  +L R++H
Sbjct  1     MASRPGVLTEWPWSPFGGFKYLLVVPLAIASIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR +TA G  +IVDKPIEFEQVDRE +WDDQ++ N L  YL N+ L   SR+P
Sbjct  61    SQIWISVSRQKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRIP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY +LFAIP++     G  S  S++ Y+TYID MNN+GHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTILFAIPIVAASLCGILSIFSVIAYMTYIDFMNNLGHCNFECFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK T++LYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKCTESLYENSLEREEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLW--TMIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF ++++ P      WY+ + MWP TL    ++ + I   TF+ +RN L
Sbjct  301   TTLDSIYQMRLGFPSFSSRPLWSRSPWYLTYSMWPFTLLFSFVLTSAISSCTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P++   Y  +   ++IN++IE AIIEA+ KGVKV+SLGL+N +EELN  G
Sbjct  361   RNLILHSHLLPKFGFHYKSQRHHRSINNIIEAAIIEADEKGVKVMSLGLMNTTEELNGYG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+PK+KI+LVDGSS+A A++V N+IPKGTTEV+ R NL K++ +I  +L+ +GIK
Sbjct  421   ELYVQKHPKLKIRLVDGSSMAAAVVV-NSIPKGTTEVVFRGNLTKIASAIVFSLSHKGIK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E++Y KL + + +  N VL  S   ++  VWLVG+GL KEEQMKA +GTLFIP S
Sbjct  480   VVVLREEEYTKL-IKSGADENLVLFSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q PP K R+DC YH  PA+L P S  ++ +CENWL RR MSA R+ GIVHALEGW  H+C
Sbjct  539   QFPPAKLRKDCFYHSTPALLVPKSAQSIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDC  598

Query  445   GEKMCD---IDKVWEAALSHGFRPLPLP  371
             G   C+   +  +WEAAL H F+PL LP
Sbjct  599   G-NTCNFFRLHAIWEAALRHDFQPLQLP  625



>ref|XP_002448160.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
 gb|EES12488.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
Length=619

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/618 (56%), Positives = 458/618 (74%), Gaps = 6/618 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW+ +GNFKY+VL P V H+ +   T    + D     +LP LL RM+H
Sbjct  1     MATRPGPLTEWPWQWMGNFKYLVLVPAVLHTAHRVATKGWGDLDPAYATMLPALLLRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SR++TA  KN IVD+ IEFEQVDRE +WDDQ++ NGL FYL   ++     LP
Sbjct  61    NQIWISLSRYQTARRKNVIVDRSIEFEQVDRERSWDDQIIFNGLEFYLAYAMIPNVRLLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++TV +H+GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   IWRTDGAIVTVLLHMGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YF+LF+IP LT +F G  S   ++ Y+ YID MNNMGHCNFE +PKW+F  FPPLKY
Sbjct  181   HVVYFMLFSIPTLTPIFMGCGSVLGIVLYIAYIDFMNNMGHCNFELVPKWIFKAFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+Y TMDKS+D LYE SLK  +E+PD+VHLTH+
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYMYNTMDKSSDELYEKSLKVTDETPDLVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             TT +S Y +R+G ++ A+ P +   WY W++WPV   +M++  +YG + F+++R  ++K 
Sbjct  301   TTLQSTYHLRIGIASIASKPSNKPVWYSWMIWPVAFLSMVLAWVYGSSAFVIERLQMKKF  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+W IPRY  QY +  + ++INSLIE+AI++A+ +GVKVLSLGLLNQ++ LNR+GE +
Sbjct  361   KMQTWAIPRYNFQYGMTLERESINSLIEKAILDADERGVKVLSLGLLNQAKTLNRSGELF  420

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             IQKYPK++++LVDGS LA A+++  +IP GT +V L    +KV+   A AL + GI+V+ 
Sbjct  421   IQKYPKLRVRLVDGSGLATAVVL-KSIPFGTKKVFLSRITSKVAQGTAIALCEIGIQVIM  479

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
             + + +++ LK  L          S     K+W +G+ +  ++Q +A KGT FIP SQ P 
Sbjct  480   NQKKEHDMLKSRLPEGRTVYLKFSNKDIPKIW-IGDNIDDKQQQRAPKGTTFIPTSQFPL  538

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKM  434
             KK RRDC+Y   PAM  P ++ N+H CENWLPRR MSA R++GI+HALEGW++HE G+ M
Sbjct  539   KKIRRDCTYLSTPAMKIPETMENVHTCENWLPRRVMSAWRIAGILHALEGWDMHESGDDM  598

Query  433   CDIDKVWEAALSHGFRPL  380
              DIDK W AA+ HGF PL
Sbjct  599   MDIDKTWSAAIKHGFAPL  616



>ref|NP_171721.3| protein CER1-like 1 [Arabidopsis thaliana]
 sp|F4HVX7.1|CERL1_ARATH RecName: Full=Protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27399.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=627

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/626 (57%), Positives = 458/626 (73%), Gaps = 14/626 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY++++P V  S++S+VT+ + E+D +  +I+  +L R++H
Sbjct  1     MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR RTA G N+IVDKPIEFEQVDRE  WDDQV+ N LL YL N  L   S LP
Sbjct  61    SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY LLFAIP++T    G  S  S++GY+TYID MNNMGHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTLLFAIPMVTASLCGILSIVSIMGYITYIDFMNNMGHCNFELFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YD+IYGT D  TD+LYE SL+  EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNIL  1157
             TT  S+Y +RLGF + ++ P      WY+   MWP TL     + + I  +TF+ +RN L
Sbjct  301   TTHNSIYQMRLGFPSLSSCPLWSRPPWYLTCFMWPFTLLCSFALTSAIPLRTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + + S ++P++   Y  +   ++IN++IEEAI+EA+ KGVKV+SLGL+N  EELN +G
Sbjct  361   RDLTVHSHLLPKFSFHYKSQRHHESINTIIEEAILEADEKGVKVMSLGLMNNREELNGSG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QKYPK+KI+LVDGSS+A A +V N IPK  TE++ R NL KV+ ++  AL Q+G+K
Sbjct  421   EMYVQKYPKLKIRLVDGSSMA-ATVVINNIPKEATEIVFRGNLTKVASAVVFALCQKGVK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E+++ KL + +    N VLS S   ++ KVWLVG+G+  EEQMKA +GTLF+P S
Sbjct  480   VVVLREEEHSKL-IKSGVDKNLVLSTSNSYYSPKVWLVGDGIENEEQMKAKEGTLFVPFS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
               PP K R+DC Y   PAM  P S  N+ +CENWL RR MSA ++ GIVHALEGW  H+C
Sbjct  539   HFPPNKLRKDCFYQSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDC  598

Query  445   GEKMCDIDK---VWEAALSHGFRPLP  377
             G   C++ +   +WEAAL H F+PLP
Sbjct  599   GNT-CNVLRLHAIWEAALRHDFQPLP  623



>gb|EMS58604.1| Protein WAX2 [Triticum urartu]
Length=619

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/617 (57%), Positives = 455/617 (74%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG L++WPWK LG+FKY+VL+PWV H  +   T    E D     ILP +L R LH
Sbjct  1     MATNPGILSEWPWKRLGSFKYLVLAPWVVHGCHLAATKGWRELDLGYIAILPSMLLRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WI+ SR   A GK +IVD+ IEF+QVDRE NWDDQ++L+ +L  L +  L  G  LP
Sbjct  61    DQAWITVSRLYNARGKRQIVDRGIEFDQVDRERNWDDQIILSAILLLLGSLYLPGGQNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++ V +H GPVEF+YYW HRALHHHFLY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   WWRIDGAVLLVLLHAGPVEFLYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF++P++T   TGTAS  +   YV YID MNNMGHCNFE +P  LF   PPLKY
Sbjct  181   LLAYQLLFSVPMITCALTGTASIITFEMYVIYIDFMNNMGHCNFELVPNRLFKWIPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDYIY TMDKSTD LYE SLK  E+  DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSTDALYENSLKGKEKEVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y IR GF+ +A+ P +  W + +MWPV+  +M++   YG  F ++RN ++K+++
Sbjct  301   TSLQSIYHIRTGFAQYASKPYTSMWQLRIMWPVSWLSMVLTWAYGSWFTVERNSMKKLRM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY   Y L  + +AIN LIE+AI EA  KG KV+SLGLLNQ+  LN +GE Y+Q
Sbjct  361   QSWAIPRYSFHYGLNNEKEAINDLIEKAISEAGKKGAKVVSLGLLNQAHSLNGSGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPKM ++LVDG+SLA A+++ +TIP+GT +V+L   ++KV+ S+A+AL ++ +KV+ + 
Sbjct  421   KYPKMGVRLVDGTSLAAAVVI-DTIPRGTNQVILAGKISKVARSVAAALCKKNVKVIMTN  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + +Y  LK  +  N  GN +LS + T +VWL+GEGL   EQ +A +GT FIP SQ PPK 
Sbjct  480   KQEYHLLKPCIPENEAGNLLLSTTSTTEVWLIGEGLDAAEQFRAPQGTKFIPFSQFPPKM  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM  P S+ N+H+CENWLPR  MSA RV+GIVHALEGW+  ECG+ + 
Sbjct  540   ARKDCCTYAMTPAMGVPESMQNVHSCENWLPRMVMSAWRVAGIVHALEGWSEDECGDTVL  599

Query  430   DIDKVWEAALSHGFRPL  380
             D++KVW AA+ HGFRP+
Sbjct  600   DLEKVWSAAIMHGFRPV  616



>ref|XP_009410811.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/616 (56%), Positives = 454/616 (74%), Gaps = 4/616 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT WPW+ LGN KYV+L+P +AHS++ F+T +  +RD  NFLI+P LL R+LH
Sbjct  1     MASQPGPLTQWPWQRLGNMKYVLLAPLLAHSVHKFMTVKPEDRDMFNFLIIPSLLMRLLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
              QLWI+ SR +TAN K+ IVDK ++FEQVDRE NWDDQ++   +L Y+ N V+   S LP
Sbjct  61    AQLWITLSRMKTANSKHSIVDKSLDFEQVDRERNWDDQIIFTAILAYVVNKVIPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W T G ++   +H+GPVEF+YYW HRALHHH+LYSRYHSHHH+S+VTEPITSVIHPF E
Sbjct  121   WWNTRGAILISLLHIGPVEFLYYWFHRALHHHYLYSRYHSHHHASVVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              + YFLLFAIP + T+ TG+ S  +  GY+ YID MN MGHCNFE +PKWL   FPPLKY
Sbjct  181   ELVYFLLFAIPPIITVLTGSGSIITSYGYLNYIDFMNYMGHCNFEMVPKWLLDSFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHT+FRTNYSLFMP YDYIYGT+D+S+D L+E SL++ EE  DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTRFRTNYSLFMPIYDYIYGTVDESSDELHERSLRKKEEMVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S+Y  R+G S+ A+ P  H WY+W++WP T   + +    G TF ++RN LEK+++
Sbjct  301   TTLQSMYHSRIGLSSLASKPYKHQWYLWIVWPFTHALVQLAWHIGTTFTVERNKLEKLRM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             ++W++PRY  QY      + IN LIEEAI+EA+ +G KVLSLGLLNQ++ELN  G  Y++
Sbjct  361   ETWMVPRYSFQYATFAGKEKINGLIEEAILEADKRGAKVLSLGLLNQADELNGCGLLYVK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLR-ANLNKVSISIASALTQRGIKVVTS  785
             + PK+K+++VDG+SLAVA+++ ++IPKGT  VLL   N++K+++S+  AL Q  I+V   
Sbjct  421   RNPKLKVRIVDGTSLAVAVVL-HSIPKGTQSVLLLVGNVSKMALSLCLALCQIDIQVEMV  479

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
               D +  LK  L T  +   V S  +  K WL+G G++ +EQ  A++G  FIP SQ PP+
Sbjct  480   QRDKFNLLKQRLPTQLQKYLVFSGKYRSKTWLLGNGVSDQEQRNASEGIHFIPYSQFPPR  539

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
               R DC YH  PAML P +  NLHACENWLPRR MSA RV+GIVHALE WN +ECGE + 
Sbjct  540   VVREDCIYHCTPAMLVPKAYQNLHACENWLPRRVMSAWRVAGIVHALEQWNKNECGETVS  599

Query  430   DIDKVWEAALSHGFRP  383
             +I+ +W AAL HGF P
Sbjct  600   NIETMWRAALRHGFLP  615



>ref|XP_010480306.1| PREDICTED: protein CER1-like 1 isoform X2 [Camelina sativa]
Length=625

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/628 (57%), Positives = 463/628 (74%), Gaps = 18/628 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG FKY+++ P    S+YS++T+EE E+D    LI+  +L R++H
Sbjct  1     MASRPGVLTEWPWSPLGGFKYLLVVPLAIGSIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR +TA G  +IVDKPIEFEQVDRE +WDDQ++ N L  YL N+ L   SR+P
Sbjct  61    SQIWISVSRKKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRVP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY +LFAIP++     G  S  S++ Y+TYID MNN+GHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTILFAIPLVAASLCGILSIFSVVAYMTYIDFMNNLGHCNFECFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +++LYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKCSESLYENSLQRKEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLW--TMIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGFS++++ P      WY+ + MWP TL     +   +   TF+ +RN +
Sbjct  301   TTRDSIYQMRLGFSSFSSRPLWSRSPWYLTYSMWPFTLLFSFFLTFAVSSCTFVFERNRV  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P+++         ++IN++IE AIIEA+ KGVKV+SLGL+N +EELN  G
Sbjct  361   RNLILHSHLLPKFEFHR----HHRSINNIIEAAIIEADEKGVKVMSLGLMNTTEELNGYG  416

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+PK+KI+LVDGSS+A A++V N+IPKGTTEV+ R N+ K++ +I  +L+Q+GIK
Sbjct  417   ELYVQKHPKLKIRLVDGSSMAAAVVV-NSIPKGTTEVVFRGNITKIASAIVFSLSQKGIK  475

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E++Y KL + + +  N VL  S   ++  VWLVG+GL KEEQMKA +GTLFIP S
Sbjct  476   VVVLREEEYTKL-IKSGADENLVLFSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFS  534

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q PP K R+DC YH  PAML P    N+ +CENWL RR MSA R+ G+VHALEGW  H+C
Sbjct  535   QFPPDKLRKDCFYHSTPAMLVPKCAQNIDSCENWLGRRVMSAWRIGGVVHALEGWEEHDC  594

Query  445   GEKMCD---IDKVWEAALSHGFRPLPLP  371
             G   C+   +  +WEAAL H F+PL LP
Sbjct  595   G-NTCNFFRLHAIWEAALRHDFQPLQLP  621



>ref|XP_010414810.1| PREDICTED: protein CER1-like 1 isoform X1 [Camelina sativa]
Length=629

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/627 (57%), Positives = 461/627 (74%), Gaps = 12/627 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY+++ P    S+ S++T+EE E+D    LI+  +L R++H
Sbjct  1     MASRPGVLTEWPWSPLGDFKYLLVVPLAIASIISYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR +TA G  +IV KPIEFEQVDRE +WDDQ++ N L  YL N+ L   SR+P
Sbjct  61    SQIWISVSRQKTAKGTKKIVYKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRIP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   IH GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVT+PITSV+HPF E
Sbjct  121   IWRLDGAILIALIHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTKPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY +LFAIP++     G  S  S++ Y+TYID MNN+GHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTILFAIPIVAASLCGILSIFSVIAYMTYIDFMNNLGHCNFECFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK T++LYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKCTESLYENSLEREEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLW--TMIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF ++++ P      WY+ + MWP TL    ++ + +   TF+ +RN L
Sbjct  301   TTLDSIYQMRLGFPSFSSRPLWSRSPWYLTYSMWPFTLLFSFVLTSAVSSCTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               +   S ++P++   Y  +   ++IN++IE AIIEA+ KGVKV+SLGL+N SEELN  G
Sbjct  361   RNLIHHSHLLPKFGFHYKSQRHHRSINNIIEAAIIEADEKGVKVMSLGLMNTSEELNGYG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+P +KI+LVDGSS+A A++V N+IP GTTEV+ R NL K++ +I  +L+Q+GIK
Sbjct  421   ELYVQKHPNLKIRLVDGSSMAAAVVV-NSIPTGTTEVVFRGNLTKIASAIVFSLSQKGIK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E++Y KL + + +  N VL  S   ++  VWLVG+GL KEEQMKA +GTLFIP S
Sbjct  480   VVVLREEEYTKL-IKSGADENLVLFSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q PP K R+DC YH  PAML P S  N+ +CENWL RR MSA R+ GIVHALEGW  H+C
Sbjct  539   QFPPDKLRKDCFYHPTPAMLVPKSAQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDC  598

Query  445   GE--KMCDIDKVWEAALSHGFRPLPLP  371
             G   K   +  +WEAAL H F+PL LP
Sbjct  599   GNTCKFLRLHAIWEAALRHDFQPLQLP  625



>dbj|BAK00236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/617 (57%), Positives = 455/617 (74%), Gaps = 4/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG L++WPWK LG+FKY+VL+PWV H  +   T    E D     ILP +L R LH
Sbjct  1     MATNPGILSEWPWKRLGSFKYLVLAPWVVHGCHLAATKGWRELDLGYVAILPSMLLRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WI+ SR   A GK +IVD+ IEF+QVDRE NWDDQ++L+ +L  L    L  G  LP
Sbjct  61    DQVWITVSRLYNARGKRQIVDRGIEFDQVDRERNWDDQIILSAILLLLGAVYLPGGQNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++ V +H GPVEF+YYW HRALHHHFLY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   WWRTDGAVLLVLLHAGPVEFLYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF++P++T   TGTAS  +   YV YID MNNMGHCNFE +P  LF   PPLKY
Sbjct  181   LLAYQLLFSVPMITCALTGTASILTFEMYVIYIDFMNNMGHCNFELVPNRLFKWIPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+Y TMDKSTD L+E SL+  E+  DVVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYLYNTMDKSTDKLHEKSLESKEKEVDVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y IR GF+ +A+ P +  W + +MWPV+  +M++   YG  F ++RN ++K+++
Sbjct  301   TSLQSIYHIRTGFAQYASKPYTSMWQLRIMWPVSWLSMVLTWAYGSWFTVERNSMKKLRM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY   Y L+ + +AIN LIE+AI EA  KG KV+SLGLLNQ+  LN +GE Y+Q
Sbjct  361   QSWAIPRYSFHYGLKKEKEAINDLIEKAISEAGKKGAKVVSLGLLNQAHGLNASGELYLQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPKM ++LVDG+SLA A+++ + IP+GT +V+L   ++KV+ S+A+AL ++ +KV+ + 
Sbjct  421   KYPKMGVRLVDGTSLAAAVVI-HAIPRGTNQVILAGRISKVARSVAAALCKKNVKVIMTN  479

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + +Y  LK  +  N   N VLS + T +VWL+GEGL   EQ +A +GT FIP SQ PPK 
Sbjct  480   KQEYHLLKPCIPENEADNLVLSTTSTAEVWLIGEGLDAPEQSRAPQGTKFIPYSQFPPKM  539

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM  P S+ N+H+CENWLPR+ MSA RV+GIVHALEGW+  ECG+ + 
Sbjct  540   ARKDCCTYAMTPAMGVPESMQNVHSCENWLPRKVMSAWRVAGIVHALEGWSEDECGDTVL  599

Query  430   DIDKVWEAALSHGFRPL  380
              ++KVW AA+ HGFRP+
Sbjct  600   GLEKVWSAAIMHGFRPV  616



>ref|XP_010479268.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
 ref|XP_010496715.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=630

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/629 (56%), Positives = 463/629 (74%), Gaps = 15/629 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVT-SEESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW PLG+FKY++++P+V  S++S+VT ++E  +D++  +I+  +L R++
Sbjct  1     MASKPGALTEWPWSPLGSFKYLLVAPFVMASMHSYVTVADEDHKDFSRLMIVVLMLWRIV  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             H+Q+WIS SR RTA G  +IVDKPIEFEQVDRE  WDDQ++ N LL YL N  L   S L
Sbjct  61    HSQIWISVSRQRTAKGTTKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHL  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR DG L+   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF 
Sbjct  121   PLWRLDGALLMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAY LLFAIP++T    G  S   ++GY+TYID MNNMGHCNFE  PK LF +FPPLK
Sbjct  181   EHIAYSLLFAIPMVTASLCGILSIVPIIGYMTYIDFMNNMGHCNFELFPKRLFHLFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             +L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +++LYE SL+R E+SPDV++LTH
Sbjct  241   FLCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKLSESLYERSLEREEDSPDVIYLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNI  1160
             LTT +S+Y +RLGF + ++ P      WY+   MWP TL    ++ + +  +T + +RN 
Sbjct  301   LTTHDSIYQMRLGFPSLSSFPLWNRSPWYLTCFMWPFTLLCSFVLTSALSSRTLVFERNR  360

Query  1159  LEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRN  980
             L  + L S ++P++   Y  + + ++IN+LIE AI+EA+ KGVKV+SLGL+N   ELN  
Sbjct  361   LRHLTLHSHLLPKFSFHYKSQRRHESINNLIEGAILEADAKGVKVMSLGLMNNRAELNGY  420

Query  979   GEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGI  800
             GE Y+QKYPK+KI+LVDGSS+A A++V N IPK TTE++ R NL KV+ ++  AL Q+G+
Sbjct  421   GEMYVQKYPKLKIRLVDGSSMAAAVVV-NNIPKETTEIVFRGNLTKVASAVVFALCQKGV  479

Query  799   KVVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPM  629
             KVV   ++++ KL + +    N VLS +   ++  VWLVG+G+ KEEQMKA +GTLF+P 
Sbjct  480   KVVLLRKEEHIKL-IKSGVVKNLVLSTNKSYYSPTVWLVGDGIEKEEQMKAKEGTLFVPF  538

Query  628   SQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHE  449
             S  PPKK R+DC YH  PAM  P S  N+ +CENWL RR MSA ++ GIVHALEGW  H+
Sbjct  539   SHFPPKKLRKDCFYHSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHD  598

Query  448   CGEKMCD---IDKVWEAALSHGFRPLPLP  371
             CG   C+   +  +WEAAL H F+PL LP
Sbjct  599   CGNT-CNFFRLHTIWEAALRHDFQPLILP  626



>ref|NP_973742.1| protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27398.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=623

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/626 (57%), Positives = 456/626 (73%), Gaps = 18/626 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY++++P V  S++S+VT+ + E+D +  +I+  +L R++H
Sbjct  1     MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR RTA G N+IVDKPIEFEQVDRE  WDDQV+ N LL YL N  L   S LP
Sbjct  61    SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY LLFAIP++T    G  S  S++GY+TYID MNNMGHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTLLFAIPMVTASLCGILSIVSIMGYITYIDFMNNMGHCNFELFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YD+IYGT D  TD+LYE SL+  EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNIL  1157
             TT  S+Y +RLGF + ++ P      WY+   MWP TL     + + I  +TF+ +RN L
Sbjct  301   TTHNSIYQMRLGFPSLSSCPLWSRPPWYLTCFMWPFTLLCSFALTSAIPLRTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + + S ++P++          ++IN++IEEAI+EA+ KGVKV+SLGL+N  EELN +G
Sbjct  361   RDLTVHSHLLPKFSFHR----HHESINTIIEEAILEADEKGVKVMSLGLMNNREELNGSG  416

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QKYPK+KI+LVDGSS+A A +V N IPK  TE++ R NL KV+ ++  AL Q+G+K
Sbjct  417   EMYVQKYPKLKIRLVDGSSMA-ATVVINNIPKEATEIVFRGNLTKVASAVVFALCQKGVK  475

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E+++ KL + +    N VLS S   ++ KVWLVG+G+  EEQMKA +GTLF+P S
Sbjct  476   VVVLREEEHSKL-IKSGVDKNLVLSTSNSYYSPKVWLVGDGIENEEQMKAKEGTLFVPFS  534

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
               PP K R+DC Y   PAM  P S  N+ +CENWL RR MSA ++ GIVHALEGW  H+C
Sbjct  535   HFPPNKLRKDCFYQSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDC  594

Query  445   GEKMCDIDK---VWEAALSHGFRPLP  377
             G   C++ +   +WEAAL H F+PLP
Sbjct  595   GNT-CNVLRLHAIWEAALRHDFQPLP  619



>gb|KFK36660.1| hypothetical protein AALP_AA4G153400 [Arabis alpina]
Length=625

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/621 (56%), Positives = 456/621 (73%), Gaps = 9/621 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLT+WPW PLG+FKY+VL+P V  S+YS+ T     RD+    I+   + R++H
Sbjct  1     MASRPGFLTEWPWTPLGSFKYLVLAPLVMDSIYSYATL----RDHEKLFIVAVTVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WIS+SR+RTA G  RIV+K IEF+QVDRE  WDDQV+LN LLFYL    +   + LP
Sbjct  57    SQAWISFSRYRTAKGTKRIVNKSIEFDQVDRERTWDDQVILNTLLFYLVKVYVTGTNTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++T  +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRTDGAVLTAILHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y ++ A+P++TTL  GT S  S+  Y+TY+D MNN+GHCNFE IP+  FS+FPPLK+
Sbjct  177   HIGYSIILAVPLVTTLICGTVSIVSIALYITYVDFMNNLGHCNFELIPRSFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKS+D+LYETSL + EE PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKSSDSLYETSLDKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVT-LWTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y++LM P T L + I+     +TF  +RN    + 
Sbjct  297   TSLDSIYHLRLGFASLSSHPLSSRCYLFLMRPFTYLLSFILTSFSSRTFAFERNRFGDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
               S+++P++   Y+ + Q ++IN +IE AI+EAE KGV+V+SLGLLNQ EELN  GE Y+
Sbjct  357   FHSYLLPKFSSHYMSQHQKESINKMIEAAILEAEKKGVRVMSLGLLNQGEELNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+ +I  +L Q GIKV+  
Sbjct  417   RKHPKLKIRIVDGSSLAAEVVV-HSIPIGTREVLFRGQITKVARAIVFSLCQNGIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L  + K N +L+ +++  +WLVG+GL+K++Q  A KGT F+P SQ PP 
Sbjct  476   REEEHCVLAEFLDESCKENLMLTTNYSPTIWLVGDGLSKDDQKMAKKGTRFLPFSQFPPT  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             + ++DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG    
Sbjct  536   EIQKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLHN-  594

Query  430   DIDKVWEAALSHGFRPLPLPN  368
                 VWEAAL +GF+PL LP+
Sbjct  595   STKSVWEAALRNGFQPLVLPS  615



>ref|XP_010414811.1| PREDICTED: protein CER1-like 1 isoform X2 [Camelina sativa]
Length=625

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/627 (57%), Positives = 459/627 (73%), Gaps = 16/627 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY+++ P    S+ S++T+EE E+D    LI+  +L R++H
Sbjct  1     MASRPGVLTEWPWSPLGDFKYLLVVPLAIASIISYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR +TA G  +IV KPIEFEQVDRE +WDDQ++ N L  YL N+ L   SR+P
Sbjct  61    SQIWISVSRQKTAKGTKKIVYKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRIP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   IH GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVT+PITSV+HPF E
Sbjct  121   IWRLDGAILIALIHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTKPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY +LFAIP++     G  S  S++ Y+TYID MNN+GHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTILFAIPIVAASLCGILSIFSVIAYMTYIDFMNNLGHCNFECFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK T++LYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKCTESLYENSLEREEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLW--TMIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF ++++ P      WY+ + MWP TL    ++ + +   TF+ +RN L
Sbjct  301   TTLDSIYQMRLGFPSFSSRPLWSRSPWYLTYSMWPFTLLFSFVLTSAVSSCTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               +   S ++P++          ++IN++IE AIIEA+ KGVKV+SLGL+N SEELN  G
Sbjct  361   RNLIHHSHLLPKFGFHR----HHRSINNIIEAAIIEADEKGVKVMSLGLMNTSEELNGYG  416

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+P +KI+LVDGSS+A A++V N+IP GTTEV+ R NL K++ +I  +L+Q+GIK
Sbjct  417   ELYVQKHPNLKIRLVDGSSMAAAVVV-NSIPTGTTEVVFRGNLTKIASAIVFSLSQKGIK  475

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E++Y KL + + +  N VL  S   ++  VWLVG+GL KEEQMKA +GTLFIP S
Sbjct  476   VVVLREEEYTKL-IKSGADENLVLFSSNNCYSSTVWLVGDGLGKEEQMKAKEGTLFIPFS  534

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
             Q PP K R+DC YH  PAML P S  N+ +CENWL RR MSA R+ GIVHALEGW  H+C
Sbjct  535   QFPPDKLRKDCFYHPTPAMLVPKSAQNIDSCENWLGRRVMSAWRIGGIVHALEGWEEHDC  594

Query  445   GE--KMCDIDKVWEAALSHGFRPLPLP  371
             G   K   +  +WEAAL H F+PL LP
Sbjct  595   GNTCKFLRLHAIWEAALRHDFQPLQLP  621



>gb|ABF51011.1| putative aldehyde decarbonylase enzyme CER1;1 [Hordeum vulgare]
Length=618

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/617 (57%), Positives = 454/617 (74%), Gaps = 5/617 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG L++WPWK LG+FKY+VL+PWV H  +   T    E D     ILP +L R LH
Sbjct  1     MATNPGILSEWPWKRLGSFKYLVLAPWVVHGCHLAATKGWRELDLGYVAILPSMLLRALH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WI+ SR   A GK +IVD+ IEF+QVDRE NWDDQ++L+ +L  L    L  G  LP
Sbjct  61    DQVWITVSRLYNARGKRQIVDRGIEFDQVDRERNWDDQIILSAILLLLGAVYLPGGQNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG ++ V +H GPVEF+YYW HRALHHHFLY+RYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   WWRTDGAVLLVLLHAGPVEFLYYWFHRALHHHFLYTRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AY LLF++P++T   TGTAS  +   YV YID MNNMGHCNFE +P  LF   PPLKY
Sbjct  181   LLAYQLLFSVPMITCALTGTASILTFEMYVIYIDFMNNMGHCNFELVPNRLFKWIPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMPFYDY+Y TMDKSTD L+E SL+  E+  DVVHLTHL
Sbjct  241   L-YTPSFHSLHHTQFRTNYSLFMPFYDYLYNTMDKSTDKLHEKSLESKEKEVDVVHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T+ +S+Y IR GF+ +A+ P +  W + +MWPV+  +M++   YG  F ++RN ++K+++
Sbjct  300   TSLQSIYHIRTGFAQYASKPYTSMWQLRIMWPVSWLSMVLTWAYGSWFTVERNSMKKLRM  359

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSW IPRY   Y L+ + +AIN LIE+AI EA  KG KV+SLGLLNQ+  LN +GE Y+Q
Sbjct  360   QSWAIPRYSFHYGLKKEKEAINDLIEKAISEAGKKGAKVVSLGLLNQAHGLNASGELYLQ  419

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             KYPKM ++LVDG+SLA A+++ + IP+GT +V+L   ++KV+ S+A+AL ++ +KV+ + 
Sbjct  420   KYPKMGVRLVDGTSLAAAVVI-HAIPRGTNQVILAGRISKVARSVAAALCKKNVKVIMTN  478

Query  781   EDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             + +Y  LK  +  N   N VLS + T +VWL+GEGL   EQ +A +GT FIP SQ PPK 
Sbjct  479   KQEYHLLKPCIPENEADNLVLSTTSTAEVWLIGEGLDAPEQSRAPQGTKFIPYSQFPPKM  538

Query  607   HRRD-CSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
              R+D C+Y   PAM  P S+ N+H+CENWLPR+ MSA RV+GIVHALEGW+  ECG+ + 
Sbjct  539   ARKDCCTYAMTPAMGVPESMQNVHSCENWLPRKVMSAWRVAGIVHALEGWSEDECGDTVL  598

Query  430   DIDKVWEAALSHGFRPL  380
              ++KVW AA+ HGFRP+
Sbjct  599   GLEKVWSAAIMHGFRPV  615



>ref|XP_009143457.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=628

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/623 (56%), Positives = 459/623 (74%), Gaps = 10/623 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY+VL+P V  S+YS+ T     RD+   L++  ++ R++H
Sbjct  1     MASRPGFLTDWPWTPLGSFKYLVLAPLVIDSIYSYATL----RDHDKLLVVALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WIS+SR+RTA G  RIV+K IEFEQVDRE  WDDQ++ N ++ YL    + + + +P
Sbjct  57    SQAWISFSRYRTAKGTTRIVNKSIEFEQVDRERTWDDQIIFNTIIVYLVKAYVIRNNPVP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++TV +H GPVEFIYYW HRALHHH+LYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGVVLTVLLHAGPVEFIYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  IP++T L  GT S +SL  Y+TYID MNN+GHCNFE IPK  FS+FPPLK+
Sbjct  177   HIGYTLILGIPLITCLLCGTVSVASLFLYLTYIDFMNNLGHCNFELIPKPFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             + YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ EE PD +HLTHL
Sbjct  237   ICYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVT-LWTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y+ LM P T + + I+     +TF+ +RN    + 
Sbjct  297   TSLDSIYQLRLGFASLSSHPLSSRCYLLLMRPFTQILSSILISFSSRTFVFERNRFGDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             + S ++P++   Y+ +   ++IN +IE AIIEA  KGVKV+SLGLLNQ E+LN  GE Y+
Sbjct  357   IHSHLLPKFSSHYISQQCKESINKMIETAIIEANKKGVKVMSLGLLNQGEDLNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+ +I  +L Q GIKV+  
Sbjct  417   RKHPKLKIRIVDGSSLAAEVVV-HSIPVGTREVLFRGQVTKVARAIVISLCQNGIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L  + K N VL+ +++  +WLVG+GL+KEEQ  ATKGT F+P SQ PP 
Sbjct  476   REEEHCTLAGYLGGHCKENLVLTTNYSPMIWLVGDGLSKEEQKMATKGTRFLPFSQFPPT  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--EK  437
             + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG    
Sbjct  536   QLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGP  595

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             + +  +VWEAAL +GF+PL LP+
Sbjct  596   VVNPPRVWEAALRNGFKPLVLPS  618



>gb|KFK42593.1| hypothetical protein AALP_AA1G015500 [Arabis alpina]
Length=628

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/627 (57%), Positives = 461/627 (74%), Gaps = 13/627 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY++++P V  S++S+VTSEE E+D    LI+  +L R++H
Sbjct  1     MASRPGALTEWPWSPLGSFKYLLVAPLVIASMHSYVTSEEDEKDLGRLLIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             + +WIS SR RTA G+ +IVDKPIEFEQVDRE  WDDQ++ N LL YL    L   +RLP
Sbjct  61    SLIWISVSRQRTAKGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLAIMKLPGAARLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   LWRPDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y LLFAIP++T    G  S  S++ Y+TYID MNNMGHCNFE  PK LF++FPPLK+
Sbjct  181   HIGYTLLFAIPIVTASLCGILSIVSVIAYLTYIDFMNNMGHCNFEIFPKRLFNLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK ++TLYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKLSETLYERSLEREEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLW--TMIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF + ++ P      WY+ + MWP TL+   ++ + +  +TF+ +RN L
Sbjct  301   TTLDSIYQMRLGFPSLSSRPLWSRSPWYLTYFMWPFTLFFSFVLTSALSSRTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P++   Y  +   ++IN+ IE AI+EA+ KGV+V+SLGL+N  EELN  G
Sbjct  361   RNLTLHSHLLPKFAFHYKSQRHCESINNTIEAAILEADEKGVRVMSLGLMNNREELNGCG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+PK+KI+LVDGSS+A A++V N+IPKGT EV+ R N  KV+++   AL+QR +K
Sbjct  421   EVYVQKHPKLKIRLVDGSSMAAAVVV-NSIPKGTREVVFRGNPTKVALAAVFALSQRDVK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRSFTQK--VWLVGEGLTKEEQMKATKGTLFIPMSQ  623
             VV   E+++ KL + +    N VL+ S  +   VWLVG+G+ KEEQMKA +GTLFIP SQ
Sbjct  480   VVVLREEEHSKL-IRSGVVKNMVLATSNYESPTVWLVGDGIEKEEQMKAKEGTLFIPFSQ  538

Query  622   IPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG  443
              PP K R DC Y   PAML P S  N+ +CENWL RR MSA RV GIVHALEGW  H+CG
Sbjct  539   FPPNKLRNDCFYLSTPAMLVPKSAENIDSCENWLGRRVMSAWRVGGIVHALEGWEEHDCG  598

Query  442   EKMCD---IDKVWEAALSHGFRPLPLP  371
                C+   +  +WEAAL H F+PL LP
Sbjct  599   NT-CNFFRLHAIWEAALRHDFQPLLLP  624



>ref|XP_010535407.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Tarenaya hassleriana]
Length=584

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/623 (57%), Positives = 448/623 (72%), Gaps = 51/623 (8%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LTDWPW PLG +K+V+L+PW  HS Y  +   E ERD+  FLI P+LL RMLH
Sbjct  1     MATKPGILTDWPWTPLGRYKFVILAPWAVHSTYKLMKGGEEERDWGYFLIFPYLLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             N +WIS SR+ TA GK RI+DK I+F QVDRE+NWDDQ++ NG+LFY+   ++    ++P
Sbjct  61    NLVWISLSRYVTARGKRRILDKGIDFNQVDRETNWDDQILFNGVLFYVGYILMEGAKQMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG +MT  +H GPVE +YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGAVMTALLHAGPVELLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAYF+LFAIP++TT+   TAS  S+ GY+ YID MNNMGHCNFE  PK LF +FPPLK 
Sbjct  181   HIAYFVLFAIPMITTVVKRTASIGSIAGYIFYIDFMNNMGHCNFELFPKRLFLLFPPLKL  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMPFYDYIYGT D+S+D                      
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPFYDYIYGTTDQSSDA---------------------  279

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
                                     W++ L+WP+T  +M+    YG+ F+ +RN  +K+ L
Sbjct  280   -----------------------TWFMRLLWPLTSLSMLFTLFYGRPFVSERNSFKKLNL  316

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             QSWVIPRY +QYLLEW+ + I  +IEEAI+EA+ KGVKVLSLGL+NQ EELN+NG+ YI+
Sbjct  317   QSWVIPRYNLQYLLEWRKETIGKMIEEAILEADRKGVKVLSLGLMNQGEELNKNGKEYIE  376

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             K+P++++++VDGSSLA A+++ N+IPKGTT+V++R +L KV+ +IASAL +RGI+V    
Sbjct  377   KHPELRVRVVDGSSLAAAVVI-NSIPKGTTDVVMRGSLTKVAYAIASALCRRGIQVTALR  435

Query  781   EDDYEKLKLA--TNSKGNFVLSRSFT---QKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              ++YE+L L      KG  + S S T    K+WLVGEG+ + +Q +AT+GT+FIP S  P
Sbjct  436   RNEYERLTLCVPAECKGRLLYSTSKTLPSHKIWLVGEGMDERDQERATEGTVFIPFSPFP  495

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             PK+ R+DC YH  PA+  P SL N H+CENWLPR+A+SA R +GI+HALEGW  HE G  
Sbjct  496   PKELRKDCIYHTTPALTVPKSLENFHSCENWLPRKAISATRAAGILHALEGWETHEHGST  555

Query  436   MC-DIDKVWEAALSHGFRPLPLP  371
             +  D+D +W+A L HGFRPLP P
Sbjct  556   LLHDLDFIWDACLGHGFRPLPFP  578



>ref|XP_008796440.1| PREDICTED: uncharacterized protein LOC103711898 [Phoenix dactylifera]
Length=2179

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/616 (58%), Positives = 468/616 (76%), Gaps = 3/616 (0%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT WPW+ LGNFKYV+L+PWVAHS++ F+     +RD TNFLI P LL R+L+
Sbjct  1     MASQPGPLTQWPWQRLGNFKYVLLAPWVAHSMHKFMADSGEQRDMTNFLIFPILLLRLLY  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +QLWI++SR +TA  K+RIVDK ++F+QVDRE NWDDQ++L  L  Y+ N V+   S LP
Sbjct  61    SQLWITFSRFQTAKSKHRIVDKSLDFDQVDRERNWDDQIILTALFMYMANMVVPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W T GV++ + +H+GPVEFIYYWLHRALHHHFLYSRYHSHHH+S+VTEPITSVIHPF E
Sbjct  121   WWETRGVVLIILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASVVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              ++YF+LFAIP +T + TGTAS ++++GY  YID MN MGHCNFE +PKWLF +FPPLKY
Sbjct  181   ELSYFVLFAIPPMTGVLTGTASIAAVVGYPMYIDFMNYMGHCNFELVPKWLFDVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPS+HSLHHTQFRTNYSLFMPFYDY+YGT+DKS+D  YE S K  EE P VVHLTHL
Sbjct  241   LMYTPSFHSLHHTQFRTNYSLFMPFYDYVYGTIDKSSDEQYERSRKGKEERPHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             T  +S+Y +R GFS+ A+ P +  +Y+W+MWP+TL +M++  IYG  F  +RN  +K+ +
Sbjct  301   TNLQSIYHLRFGFSSLASKPYTPKYYMWIMWPLTLASMLLTWIYGTAFTAERNRFKKLIM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             +  V+PRY  QY    +S  IN+LIE+AI+++E +G KV+SLGLLNQ   LN  GE Y++
Sbjct  361   EIRVVPRYIFQYKSSSESDPINTLIEKAILQSEEEGAKVISLGLLNQGSALNGYGELYLK  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +   +K K+VDG+SLAVA+++ N++P+G   +LL  NL+K++  ++  L +RG++V T  
Sbjct  421   RNSLLKTKIVDGTSLAVAVVL-NSVPQGINSILLVGNLSKMAYFLSLTLCKRGVQVETVQ  479

Query  781   EDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKK  608
             +D YE  KL+L     G+ VLS S+  +VWLVG+G+T +EQ++A+KG  FIP +Q PPK 
Sbjct  480   KDKYELLKLQLPPELHGHLVLSDSYASEVWLVGDGVTDQEQLRASKGIRFIPFTQFPPKL  539

Query  607   HRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCD  428
              R+DC YH  PAM+ P +  NLH CENWLPR  MSA RV+GIVHALE WN HECG+ +  
Sbjct  540   VRKDCIYHCTPAMVVPRTYENLHTCENWLPRSVMSAWRVAGIVHALEEWNGHECGDTVTG  599

Query  427   IDKVWEAALSHGFRPL  380
             ++K W AAL+HGF P 
Sbjct  600   VEKAWHAALAHGFLPF  615


 Score =   556 bits (1433),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 296/547 (54%), Positives = 394/547 (72%), Gaps = 18/547 (3%)
 Frame = -3

Query  2014  HRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLM  1835
             HR  +  NR + K  +  +                  Y+ N V+   S LP W + GV++
Sbjct  1643  HRNDDAANRFLKKTFQLPKRS---------------MYMVNMVVPGASHLPWWESRGVVL  1687

Query  1834  TVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFA  1655
              + +H+GPVEFIYYWLHRALHHHFLYSRYHSHHH+SI TEPITSVIHPF E ++YF+LFA
Sbjct  1688  IILLHMGPVEFIYYWLHRALHHHFLYSRYHSHHHASIATEPITSVIHPFAEELSYFVLFA  1747

Query  1654  IPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHS  1475
             IP +T + TGTAS ++++GY  Y+D MN MGHCNFE +PKWLF +FPPLKYLMYTPS+HS
Sbjct  1748  IPPMTGILTGTASIAAVVGYPMYVDFMNYMGHCNFELVPKWLFDVFPPLKYLMYTPSFHS  1807

Query  1474  LHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSI  1295
             LHHTQFRTNYSLFMPFYDY+YGT+DKS+D  YE S K  EE P VVHLTHLT  +S+Y +
Sbjct  1808  LHHTQFRTNYSLFMPFYDYVYGTIDKSSDEQYERSRKGKEERPHVVHLTHLTNLQSIYHL  1867

Query  1294  RLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKLQSWVIPRYK  1115
             R GFS+ A+ P +  +Y+W+MWP+TL +M++  IYG  F  +RN  +K+ ++  V+PRY 
Sbjct  1868  RFGFSSLASKPYTPKYYMWIMWPLTLASMLLTWIYGTAFTAERNRFKKLIMEIRVVPRYI  1927

Query  1114  VQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKL  935
              QY    +S  IN+LIE+AI+++E +G KV+SLGLLNQ   LN  GE Y+++   +K K+
Sbjct  1928  FQYKSSSESDPINTLIEKAILQSEEEGAKVISLGLLNQGSALNGYGELYLKRNSLLKTKI  1987

Query  934   VDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSCEDDYE--KL  761
             VDG+SLAVA+++ N++P+G   +LL  NL+K++  ++  L +RG++V T  +D YE  KL
Sbjct  1988  VDGTSLAVAVVL-NSVPQGINSILLVGNLSKMAYFLSLTLCKRGVQVETVQKDKYELLKL  2046

Query  760   KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHH  581
             +L     G+ VLS S+  +VWLVG+G+T +EQ++A+KG  FIP +Q PPK  R+DC YH 
Sbjct  2047  QLPPELHGHLVLSDSYASEVWLVGDGVTDQEQLRASKGIRFIPFTQFPPKLVRKDCIYHC  2106

Query  580   PPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAAL  401
              PAM+ P +  NLH CENWLPRR MSA RV+GIVHALE WN HECG+ +  ++K W AAL
Sbjct  2107  TPAMVVPRTYENLHTCENWLPRRVMSAWRVAGIVHALEEWNGHECGDTVTGVEKAWHAAL  2166

Query  400   SHGFRPL  380
             +HGF P 
Sbjct  2167  AHGFLPF  2173



>ref|XP_006410962.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
 gb|ESQ52415.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
Length=628

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/623 (55%), Positives = 454/623 (73%), Gaps = 10/623 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL+P V   +YS+ T     RD+   +++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLTPLVIDGIYSYATM----RDHDKLMVVALMMWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS++R++ A G  RIV+K IEF+QVDRE  WDDQ++ N L+FYL   ++   +  P
Sbjct  57    SQVWISFARYQAAKGTKRIVNKSIEFDQVDRERTWDDQIIFNTLIFYLGKVLVLPTNTAP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++   +H GPVEF YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGVVLIALLHAGPVEFFYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  IP++TTL  GT S  S+  Y+TYID MNN+GHCNFE IPK  FS+FPPLK+
Sbjct  177   HIVYTLILGIPLVTTLLCGTISMVSVFLYITYIDFMNNLGHCNFELIPKPFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
               YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ EE  D +HLTHL
Sbjct  237   FCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEQEEEKTDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P +   Y++LM P +L  + I+     QTF+ +RN    + 
Sbjct  297   TSLDSIYHLRLGFASLSSHPLTSRCYLFLMRPFSLTLSFILTYFSPQTFVFERNRFGDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y+ +   + IN +IE AI+EAE KGV+V+SLGLLNQ EELN  GE Y+
Sbjct  357   LHSHLLPKFSSHYISQRHKERINKMIEAAILEAEKKGVRVMSLGLLNQGEELNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V +++P GT EVL R  + KV+ +I S+L Q GIKV+  
Sbjct  417   RKHPKLKIRIVDGSSLAAEVVV-HSVPVGTREVLFRGQITKVARAIVSSLCQNGIKVLVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L  + K N VL+R+++  +WLVG+GL+KEEQ  A KGT F+P SQ PP 
Sbjct  476   REEEHRMLAELLGGDCKENLVLTRNYSPTIWLVGDGLSKEEQKMAGKGTRFLPFSQFPPT  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--EK  437
             K R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG    
Sbjct  536   KLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLHNS  595

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             + +  KVWEAAL +GF+PL LP+
Sbjct  596   ILNPPKVWEAALRNGFKPLVLPS  618



>ref|XP_006418508.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
 gb|ESQ36861.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
Length=631

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/627 (56%), Positives = 452/627 (72%), Gaps = 10/627 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW  LG+FKY++++P V  S++S+VT+E+ E+D     I+  +L R++H
Sbjct  1     MASRPGALTEWPWSSLGSFKYLLVAPLVMASMHSYVTAEDEEKDLGRLAIVALMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS +R RTA G+ +IVDKPIEFEQVDRE  WDDQ++ N LL YL N  L    RLP
Sbjct  61    SQIWISVARQRTAMGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANFKLPGSCRLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   LWRLDGAILMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY LLF+IP++T    G  S   ++ Y+TYID MNN+GHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYTLLFSIPMVTASLCGILSIVPVIAYMTYIDFMNNLGHCNFELFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKS+++LYE SL+  EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKSSESLYERSLEIKEESPDVMHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF + ++ P      WY+   MWP TL    ++ +    +TF+ +RN +
Sbjct  301   TTLDSIYQMRLGFPSLSSHPLWSRSPWYLSCFMWPFTLLLSFVLTSPFSSRTFVFERNRI  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + + S ++P++   Y  +   ++IN++IE AI+EA+ KGV+V+SLGL+N  EELN  G
Sbjct  361   RNLTIHSHILPKFAFHYKSQCHHESINNIIEAAILEADEKGVRVMSLGLMNNREELNGCG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QK+PK+KIKLVDGSS+A A++V N+IPKGT+EV+ R N  KV+ ++  AL QRGIK
Sbjct  421   EMYVQKHPKLKIKLVDGSSMAAAVVV-NSIPKGTSEVVFRGNPTKVASAVVFALCQRGIK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS--FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQ  623
             VV    +++ +L  +   K N V   S  ++  VWLVG+ + KEEQMKA +GTLFIP S 
Sbjct  480   VVVLRAEEHSRLVKSGVVKKNLVQCTSNYYSPVVWLVGDEIGKEEQMKAKEGTLFIPFSH  539

Query  622   IPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG  443
              PP K R+DC YH  PAML P S  N+ +CENWL RR MSA +V GIVHALEG   H+CG
Sbjct  540   FPPDKLRKDCFYHSTPAMLVPKSAQNIDSCENWLGRRVMSAWKVGGIVHALEGLEEHDCG  599

Query  442   --EKMCDIDKVWEAALSHGFRPLPLPN  368
                    +  +WEAAL H F PLP P 
Sbjct  600   NTRNFFRLHAIWEAALRHDFTPLPSPT  626



>emb|CAA65200.1| CER1-like [Arabidopsis thaliana]
Length=623

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/626 (56%), Positives = 453/626 (72%), Gaps = 18/626 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY++++P V  S++S+VT+ + E+D +  +I+  +L R++H
Sbjct  1     MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR RT  G N+IVDKPIEFEQVDRE  WDDQV+ N LL YL N  L   S LP
Sbjct  61    SQIWISVSRQRTGKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++ V +H GPVEF+YYW HR LHHHFLYSRYHSHHHSSIVTEPITSV+HPFGE
Sbjct  121   PWRVDGGILMVLLHAGPVEFLYYWFHRGLHHHFLYSRYHSHHHSSIVTEPITSVVHPFGE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y LL  IP++T    G  S  S++GY+TYID MNNMGHCNFE  PK LF +FPPLK+
Sbjct  181   HIVYTLLCDIPMVTASLCGILSIVSIMGYITYIDFMNNMGHCNFELFPKRLFHLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YD+IYGT D  TD+LYE SL+  EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNIL  1157
             TT  S+Y +RLGF + ++ P      WY+   MWP TL     + + I  +TF+ +RN L
Sbjct  301   TTHNSIYQMRLGFPSLSSCPLWSRPPWYLTCFMWPFTLLCSFALTSAIPLRTFVFERNRL  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + + S ++P++          ++IN++IEEAI+EA+ KGVKV+SLGL+N  EELN +G
Sbjct  361   RDLTVHSHLLPKFSFHR----HHESINTIIEEAILEADEKGVKVMSLGLMNNREELNGSG  416

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QKYPK+KI+LVDGSS+A A +V N IPK  TE++ R NL KV+ ++  AL Q+G+K
Sbjct  417   EMYVQKYPKLKIRLVDGSSMA-ATVVINNIPKEATEIVFRGNLTKVASAVVFALCQKGVK  475

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E+++ KL + +    N VLS S   ++ KVWLVG+G+  EEQMKA +GTLF+P S
Sbjct  476   VVVLREEEHSKL-IKSGVDKNLVLSTSNSYYSPKVWLVGDGIENEEQMKAKEGTLFVPFS  534

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
               PP K R+DC Y   PAM  P S  N+ +CENWL RR MSA ++ GIVHALEGW  H+C
Sbjct  535   HFPPNKLRKDCFYQSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDC  594

Query  445   GEKMCDIDK---VWEAALSHGFRPLP  377
             G   C++ +   +WEAAL H F+PLP
Sbjct  595   GNT-CNVLRLHAIWEAALRHDFQPLP  619



>ref|XP_006306997.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
 gb|EOA39895.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
Length=629

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/627 (57%), Positives = 456/627 (73%), Gaps = 12/627 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLGNFKY++++P+V  S++++VT  + E+D +  +I+  +L R++H
Sbjct  1     MASRPGALTEWPWSPLGNFKYLLVAPFVMASMHTYVTVADEEKDLSRLMIVALMLWRIIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR RTA G  +IVDKPIEFEQVDRE  WDDQ++ N LL YL N  L   S LP
Sbjct  61    SQIWISVSRQRTAKGTRKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG L+   +H GPVEF+YYW HRALHH+FLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  121   LWRLDGALLMALLHAGPVEFLYYWFHRALHHYFLYSRYHSHHHSSIVTEPITSVVHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY LLFAIP++T    G  S   ++GY+TYID MNNMGHCNFE  PK LF +FPPLK+
Sbjct  181   HIAYSLLFAIPMVTASLCGILSIVPIIGYMTYIDFMNNMGHCNFELFPKRLFDLFPPLKF  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +++LYE SL+R EESPDV+HLTHL
Sbjct  241   LCYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTTDKWSESLYERSLEREEESPDVIHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNIL  1157
             TT +S+Y +RLGF++ +++P      WY+ + MWP TL    ++   +  +T + +RN +
Sbjct  301   TTHDSIYQMRLGFASLSSIPLWSRSPWYLTYFMWPFTLLCSFVLTLALSSRTLVFERNRI  360

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + L S ++P++   Y  +   ++IN +IE AI+EA+ KGVKV+SLGL+N SEELNR G
Sbjct  361   RDLTLHSHLLPKFSFHYKSQRHHESINKIIEGAILEADEKGVKVMSLGLMNNSEELNRYG  420

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QKYPK+KI+LVDGSS+A A +V N IP  TTEV+LR NL KV+  +  AL ++G+K
Sbjct  421   EMYVQKYPKLKIRLVDGSSMAAA-VVFNNIPTETTEVVLRGNLTKVASVVVFALCRKGVK  479

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E+++ KL + +    N VLS S    +  VWLVG+G+ KEEQMKA +GTLF+P S
Sbjct  480   VVVLKEEEHSKL-IKSGIVKNLVLSTSNNYNSPTVWLVGDGIEKEEQMKAKEGTLFVPFS  538

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
               PP K R+DC YH  PAM  P S  N+ +CENWL RR MSA +V GIVHALEGW  H+C
Sbjct  539   HFPPNKLRKDCFYHSTPAMRVPKSAQNIDSCENWLERRVMSAWKVGGIVHALEGWEEHDC  598

Query  445   GE--KMCDIDKVWEAALSHGFRPLPLP  371
             G       +  +WEAAL H F PL  P
Sbjct  599   GNTYNFFRLHAIWEAALRHDFEPLLFP  625



>ref|XP_009777506.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=524

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/510 (66%), Positives = 419/510 (82%), Gaps = 5/510 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTS-EESERDYTNFLILPFLLSRML  2045
             MA+ PG LT+WPW  LGNFKYVVL+P+VAHS++SF  S +E +RD  NF+I PFLLSRM+
Sbjct  1     MASKPGILTEWPWTWLGNFKYVVLAPFVAHSIHSFFLSKDEKQRDIVNFIIFPFLLSRMI  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             HNQ+WIS SR+RTA G NRIVDK IEF+QVDRE NWDDQ++ NGLLFY     L +   +
Sbjct  61    HNQIWISLSRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIIFNGLLFYYGYMKLEQSHHI  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WRTDG+++T  IH+GPVEF+YYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF 
Sbjct  121   PFWRTDGIILTALIHIGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EH+AYF LFAIP+LT + TGTAS  +L GY+TYID MNN+GHCNFE IPKW+FS+FPPLK
Sbjct  181   EHVAYFALFAIPMLTAILTGTASIVALGGYITYIDFMNNLGHCNFELIPKWIFSVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             YLMYTPSYHSLHHTQFRTNYSLFMP YDYIY T+DKS+DTLYE SL+R  ESPDVVHLTH
Sbjct  241   YLMYTPSYHSLHHTQFRTNYSLFMPMYDYIYNTLDKSSDTLYEKSLERVGESPDVVHLTH  300

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIK  1145
             LTT ES+Y +RLGF++ A+ P +  WY  +MWP+TLW+ ++   YG  FI++RNI + +K
Sbjct  301   LTTAESIYHLRLGFASLASEPHTSKWYFPIMWPITLWSTMVTWFYGHAFIVERNIFKNLK  360

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             LQ+W++P+Y+VQY + WQ ++I++L+E+AIIEA+ KGVKVL+LGLLNQ E LN NGE YI
Sbjct  361   LQTWIVPKYRVQYFMPWQRESISNLMEKAIIEADQKGVKVLTLGLLNQ-ELLNVNGEQYI  419

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             ++YP++K+KLVDGSSLAVA+++ N+IPKGTT+V+L  +L+KV+ SIA AL   GI+V+T 
Sbjct  420   KRYPELKVKLVDGSSLAVAVVL-NSIPKGTTQVVLGGHLSKVAYSIALALCNDGIQVITL  478

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKV  701
             CE DY  LK  L   +  N V S +FT KV
Sbjct  479   CESDYNMLKARLTPEAATNLVTSITFTSKV  508



>ref|XP_003606194.1| Protein WAX2 [Medicago truncatula]
Length=576

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/619 (55%), Positives = 439/619 (71%), Gaps = 44/619 (7%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+  G LT+WPWKPLG+ K                                        
Sbjct  1     MASKAGILTNWPWKPLGSLK----------------------------------------  20

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
               +WIS SR++TA GK RIVDK +EF+QVDRE+NWDDQ++   L+FY+  T+    + LP
Sbjct  21    --IWISISRYQTAKGKRRIVDKGLEFDQVDRETNWDDQILFTALMFYILYTIFPMAANLP  78

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPIT+V HPF E
Sbjct  79    WWRTDGVILTAILHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITAVTHPFAE  138

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              +AYF LF IP+LTTLF   +S  +L GY+ YID MNNMGHCNFEF PK LFS FP LKY
Sbjct  139   MLAYFTLFLIPMLTTLFMKKSSVVALYGYIFYIDFMNNMGHCNFEFFPKKLFSYFPQLKY  198

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHT+FR+NYSLFMP YD+IYGT+D S+D  YE   KR EESPDVVHLTHL
Sbjct  199   LTYTPSFHSLHHTKFRSNYSLFMPIYDHIYGTVDTSSDATYEACSKRQEESPDVVHLTHL  258

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TT +S++ +RLG ++ A+ PQ+  WY+ LMWP T+ +M++  I G  F+L+ N  + +KL
Sbjct  259   TTLDSIFQLRLGLASLASNPQTSKWYLNLMWPFTMCSMLLTWISGSAFVLESNSFKDLKL  318

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q W+IPR+K QY  + QS  IN LIEE I+ A+  GVKV+SLGLLNQ +E + +   YI+
Sbjct  319   QCWLIPRFKTQYFSKKQSIKINKLIEETIMMADLSGVKVISLGLLNQRQEFSAHCALYIE  378

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             +   +KIK+VDGSSL VA ++ N IP GT +VLLR   NKV+++I +AL  + ++V    
Sbjct  379   RLQNLKIKVVDGSSLVVATVL-NNIPNGTNQVLLRGKFNKVALAITNALCSKNVQVTVLY  437

Query  781   EDDYEKL-KLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              D+ ++L +  T S G+  LS+  T K+WLVG+   ++EQM+A++G+LFIP S  PPKK 
Sbjct  438   RDELKELERRVTVSNGSLALSQINTSKIWLVGDDWDEDEQMQASEGSLFIPFSHFPPKKM  497

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDI  425
             R+ C YH+ PAM+ P +L NLH+CENWLPRR MSA R++GI+HALE WNVHECG+ + DI
Sbjct  498   RKGCFYHYTPAMITPTALINLHSCENWLPRRVMSAWRIAGIIHALERWNVHECGDTVFDI  557

Query  424   DKVWEAALSHGFRPLPLPN  368
             +KVWEA++ HGF PL +PN
Sbjct  558   EKVWEASIRHGFLPLKIPN  576



>emb|CDX74937.1| BnaA05g06830D [Brassica napus]
Length=619

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/623 (54%), Positives = 450/623 (72%), Gaps = 19/623 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY+VL+P V  S+YS+ T     RD+   L++  ++ R++H
Sbjct  1     MASRPGFLTDWPWTPLGSFKYLVLAPLVIDSIYSYATL----RDHDKLLVVALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WIS+SR+RTA G  RIV+K IEFEQVDRE  WDDQ++ N ++ YL    + + + +P
Sbjct  57    SQAWISFSRYRTAKGTTRIVNKSIEFEQVDRERTWDDQIIFNTIIVYLVKAYVIRNNPVP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++TV +H GPVEFIYYW HRALHHH+LYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGVVLTVLLHAGPVEFIYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  IP++T L  GT S +SL  Y+TYID MNN+GHCNFE IPK  FS+FPPLK+
Sbjct  177   HIGYTLILGIPLITCLLCGTVSVASLFLYLTYIDFMNNLGHCNFELIPKPFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             + YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ EE PD +HLTHL
Sbjct  237   ICYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVT-LWTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y+ LM P T + + I+     +TF+ +RN    + 
Sbjct  297   TSLDSIYQLRLGFASLSSHPLSSRCYLLLMRPFTQILSSILTSFSSRTFVFERNRFGDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             + S ++P++   Y+ +   ++IN +IE AIIEA  KGV         + E+LN  GE Y+
Sbjct  357   IHSHLLPKFSSHYISQQCKESINKMIETAIIEANKKGV---------KGEDLNGYGEMYV  407

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+ +I  +L Q GIKV+  
Sbjct  408   RKHPKLKIRIVDGSSLAAEVVV-HSIPVGTREVLFRGQVTKVARAIVISLCQNGIKVMVL  466

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L  + K N VL+ +++  +WLVG+GL+KEEQ  ATKGT F+P SQ PP 
Sbjct  467   REEEHCMLAGYLGGHCKENLVLTTNYSPMIWLVGDGLSKEEQKMATKGTRFLPFSQFPPT  526

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--EK  437
             + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG    
Sbjct  527   QLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGP  586

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             + +  +VWEAAL +GF+PL LP+
Sbjct  587   VVNPPRVWEAALRNGFKPLVLPS  609



>emb|CDX91381.1| BnaC04g07690D [Brassica napus]
Length=619

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/623 (55%), Positives = 449/623 (72%), Gaps = 19/623 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY+VL+P V  S+YS+ T     RD+   L++  ++ R++H
Sbjct  1     MASRPGFLTDWPWTPLGSFKYLVLAPLVIDSIYSYATL----RDHDKLLVVALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q WIS+SR+RTA G  RIV+K IEFEQVDRE  WDDQ++ N ++ YL    + + + +P
Sbjct  57    SQAWISFSRYRTAKGTTRIVNKSIEFEQVDRERTWDDQIIFNTIIVYLVKAYVIRNNPVP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV++TV +H GPVEFIYYW HRALHHH+LYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGVVLTVLLHAGPVEFIYYWFHRALHHHYLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  IP++T L  GT S +SL  Y+TYID MNN+GHCNFE IPK  FS+FPPLK+
Sbjct  177   HIGYTLILGIPLITCLLCGTVSVASLFLYLTYIDFMNNLGHCNFELIPKPFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             + YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ EE PD +HLTHL
Sbjct  237   ICYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y+ LM P TL  + I+     +TF+ +RN    + 
Sbjct  297   TSLDSIYQLRLGFASLSSHPLSSRCYLLLMRPFTLILSFILTSFSFRTFVFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             + S ++P++   Y+ +   ++IN +IE AIIEA  KGV         + EELN  GE Y+
Sbjct  357   IHSHLLPKFSSHYISQQCKKSINKMIETAIIEANKKGV---------KGEELNGYGEMYV  407

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+  I  +L Q GIKV+  
Sbjct  408   RKHPKLKIRIVDGSSLAAEVVV-HSIPVGTREVLFRGQVTKVARVIVISLCQNGIKVMVL  466

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L  + K N VL+ +++  +WLVG+GL++EEQ  ATKGT F+P SQ PP 
Sbjct  467   REEEHCMLAGYLGGHCKENLVLTTNYSPMIWLVGDGLSREEQEMATKGTRFLPFSQFPPT  526

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--EK  437
             + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG    
Sbjct  527   QLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDGP  586

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             + +  +VWEAAL +GF+PL LP+
Sbjct  587   VVNPPRVWEAALRNGFKPLVLPS  609



>emb|CAN81825.1| hypothetical protein VITISV_014168 [Vitis vinifera]
Length=2166

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/568 (60%), Positives = 424/568 (75%), Gaps = 40/568 (7%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPWK LG+FKYV+L+PWV HS+Y+ +  +  ERD    L  PFLL R LH
Sbjct  1     MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS +R+RTA G NRIVDK IEFEQVDRESNWDDQ++LNG+LFY+   +L   + +P
Sbjct  61    NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGVL+T+ +H+GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+AYFLLF+IP+L  +F    S ++L GY++YID MNNMGHCNFE IPK LFSIFPPLKY
Sbjct  181   HLAYFLLFSIPLLAGIFMRKNSIAALFGYISYIDFMNNMGHCNFELIPKMLFSIFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHT+FRTNYSLFMP YDYIYGTMDKS+D LYE SL R EE   VVHLTHL
Sbjct  241   LMYTPSYHSLHHTRFRTNYSLFMPIYDYIYGTMDKSSDALYEKSLIRPEELLHVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
              TP+S+Y +RLGF++ A+ P ++ WYVW MWPVT  ++++   YG+TFIL+RN   K+ +
Sbjct  301   VTPQSIYHLRLGFASLASKPYTYRWYVWAMWPVTCGSIMLTWTYGRTFILERNQFNKVNV  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+WV+P++K+                                    Q +ELN  GE YI 
Sbjct  361   QTWVVPKFKI------------------------------------QGDELNSYGELYIH  384

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+KIK+VDGSSLAVA+++ N+IPKGTT+VL R NL KV+  IASAL Q  I+V TS 
Sbjct  385   RNPKLKIKVVDGSSLAVAVVL-NSIPKGTTQVLFRGNLTKVAYFIASALCQMDIQVATSH  443

Query  781   EDDYEKLKLA---TNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              D+YE+L         +   +LS+SFT+K+WLVG+GLTKEEQ+KA+KGTLFIP SQ PPK
Sbjct  444   GDEYEQLNTKLKNVECESKLLLSKSFTEKIWLVGDGLTKEEQIKASKGTLFIPFSQFPPK  503

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACEN  527
             + R+DC Y   PAM++P S  N+ +CE 
Sbjct  504   RLRKDCLYLTTPAMMSPKSFQNIDSCEQ  531



>ref|XP_009133199.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=622

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/623 (56%), Positives = 455/623 (73%), Gaps = 10/623 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+V+ P V  S+YS+ T     RD    LI+  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVVVPLVIDSIYSYATM----RDMDKLLIVAVMVGRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WISY+R++TA G  RIV+K IEF+QVDRE  WDDQV+ N L+ YL    +   + +P
Sbjct  57    SQMWISYARYKTAKGTKRIVNKSIEFDQVDRERTWDDQVIFNTLIVYLTKVYVLGTNTVP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV+    +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGVVQVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  IP++TTL  GT S +S+  Y+TYID MNN+GHCNFE IP+  FS+FPPLKY
Sbjct  177   HIGYTLILGIPLVTTLLCGTVSAASIALYITYIDFMNNLGHCNFELIPRSFFSLFPPLKY  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDY+YGT DK +D+LYE+SL+  EE PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYVYGTNDKCSDSLYESSLEEEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y+ LM P TL  ++++     +TF+ +RN +  + 
Sbjct  297   TSLDSIYHLRLGFASLSSHPLSSRCYLVLMRPFTLIISLMLTSFSSRTFVFERNRIGDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y    Q ++IN +IE AI+EAE K V+V+SLGLLNQ EELN  GE Y+
Sbjct  357   LHSHLLPKFSSHYKSRQQKESINKMIEAAILEAEKKDVRVMSLGLLNQGEELNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +KYPK+KI++VDGSSLA A++V ++IP  T EVL R  + K+  +I  +L Q GIKV+  
Sbjct  417   RKYPKLKIRIVDGSSLAAAVVV-HSIPVDTREVLFRGRITKIGRAIVISLCQNGIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   +  + K N VL+ +++  +WLVG+GL+KE+Q KA KGTLFIP SQ PP 
Sbjct  476   REEEHSMLNGFIGGHCKENLVLTTNYSPMIWLVGDGLSKEDQKKARKGTLFIPFSQFPPS  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK--  437
             K R+DC YH  PAM+ P +  N+ +CENWL RR MSA RV GIVHALEGW  HECG +  
Sbjct  536   KLRKDCFYHTTPAMIIPDAAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLEVP  595

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             M +  +VWEAAL HGF+PL LP+
Sbjct  596   MANPPRVWEAALRHGFKPLVLPS  618



>ref|XP_010509285.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=630

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/619 (55%), Positives = 453/619 (73%), Gaps = 10/619 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY++L+P V  S+YS+ T     RDY   L++   + R++H
Sbjct  1     MASRPGFLTDWPWAPLGSFKYLLLAPLVIDSIYSYATM----RDYEKLLVVAMTVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA G  RI++K IEF+QVDRE  WDDQ++ N L+ YL    +   + LP
Sbjct  57    SQVWISLSRYQTAKGTKRILNKSIEFDQVDRERTWDDQIIFNSLIVYLTKVYVLGANTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRIDGLILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  +P++TTL  GTAS  S+L Y+TY+D MNNMGHCNFE IP++LFS+ PPLK+
Sbjct  177   HIGYTLILGLPLVTTLLCGTASVVSILLYITYVDFMNNMGHCNFELIPRFLFSLLPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDY+YGT D+ +D+LYETSL++ EE PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYMYGTTDECSDSLYETSLEKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVT-LWTMIINCIYGQTFILDRNILEKIK  1145
              + +S+Y +RLGF++ ++ P S  +Y++LM P T + + I+     +TF+ +RN    + 
Sbjct  297   ISVDSIYHLRLGFASLSSHPLSSRFYLFLMKPFTFILSFILTSFSSRTFVFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L + ++P++   Y+     + IN +IE AI+EAE KGVKV+SLGLLNQ EELN  GE Y+
Sbjct  357   LHTHLLPKFPSHYMSPEHKECINKMIESAILEAEKKGVKVMSLGLLNQGEELNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA A +V ++IP GT EVL R  + KV+ +I  +L Q  IKV+  
Sbjct  417   RKHPKLKIRIVDGSSLA-AEVVLHSIPIGTKEVLFRGQVTKVARAIVFSLCQNAIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              ++++  L   LA + K N VL+ ++   +WLVG+G++ +EQ  A +GTLF+P SQ PP 
Sbjct  476   RKEEHSMLAEFLADSCKENLVLTTNYNPMIWLVGDGVSTKEQKMAKEGTLFLPFSQFPPD  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--EK  437
             K R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVH+LEGW  HECG    
Sbjct  536   KLRKDCVYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNS  595

Query  436   MCDIDKVWEAALSHGFRPL  380
             + +  +VWEAAL +GF+PL
Sbjct  596   ILNSPRVWEAALRNGFQPL  614



>gb|ACN31737.1| unknown [Zea mays]
Length=600

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/599 (55%), Positives = 443/599 (74%), Gaps = 10/599 (2%)
 Frame = -3

Query  2152  LSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKP  1973
             ++P   H     V     + D    LILP LL RM+HNQ+WIS +R++TA  K+RIVD+ 
Sbjct  1     MAPVAVHGARRVVARGWGDIDLAFALILPSLLLRMVHNQIWISAARYQTARSKHRIVDRG  60

Query  1972  IEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYY  1793
             IEF+QVDRE  WDDQ++LNGLLFY+    +    R+PAWR+DG +    +H GPVEF+YY
Sbjct  61    IEFDQVDRERGWDDQIILNGLLFYVGYLAIPSARRMPAWRSDGAVAMALLHAGPVEFLYY  120

Query  1792  WLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASN  1613
             W HRALHHHFLYSRYHSHHHSSIVTEPITSVIHPF EH+ Y++LFAIP+L+TL+ G AS 
Sbjct  121   WFHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFAEHMVYYVLFAIPMLSTLYMGNASV  180

Query  1612  SSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFM  1433
               ++ Y+ YID MNNMGHCNFE +P+W+F +FPPLKYLMYTPS+HSLHHTQFRTNYSLFM
Sbjct  181   LGIVLYIAYIDFMNNMGHCNFELVPRWMFQLFPPLKYLMYTPSFHSLHHTQFRTNYSLFM  240

Query  1432  PFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSH  1253
             P YDY+Y TMDKS+D LYETSL+  EE+P +VHLTH+T  +SVY +R+GF++ A+ P + 
Sbjct  241   PLYDYVYSTMDKSSDQLYETSLRGAEETPGLVHLTHMTDLQSVYHLRIGFASVASRPSAT  300

Query  1252  N---WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKIKLQSWVIPRYKVQYLLEWQSQ  1085
                 WY+W++WPV   +M +   YG + F+++R  L K+++Q+W +PRY  QY L W+ +
Sbjct  301   GAMWWYMWVLWPVAWLSMALAWAYGSSAFVVERIKLGKLRMQTWAVPRYNFQYGLSWERE  360

Query  1084  AINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAI  905
             +IN LIE AI++A+ +GVKVLSLGLLNQ+++LN  GE +  +YPK++++LVDGS LA A+
Sbjct  361   SINGLIERAILDADARGVKVLSLGLLNQAKQLNGGGELFRHRYPKLRVRLVDGSGLATAV  420

Query  904   IVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSCEDDYEKLKLA-TNSKGNFV  728
             ++  +IP+   +VLL A  +KV+ + A+AL +RG++VV +   +Y+ LK    +SK +++
Sbjct  421   VL-RSIPRDAKQVLLHAGPSKVACATAAALCERGVQVVMNPNKEYDMLKSQIADSKASYL  479

Query  727   LSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKHRRDCSYHHPPAMLAPP  557
               RS    T +VWLV + +  EEQ  A KG +F+P+SQ P KK R+DC+Y   PAM  P 
Sbjct  480   ERRSDNHHTPQVWLV-DSIDDEEQKMAPKGAVFVPISQFPIKKIRKDCTYLSTPAMKIPE  538

Query  556   SLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMCDIDKVWEAALSHGFRPL  380
             ++ N+HACENWLPRR MSA R+ GI+HALEGW VHECG+ M   DK W AA+ HGF PL
Sbjct  539   TMQNIHACENWLPRRVMSAWRIGGILHALEGWTVHECGDAMVHADKAWSAAIRHGFVPL  597



>ref|XP_009141689.1| PREDICTED: protein CER1-like 2 isoform X2 [Brassica rapa]
Length=625

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/623 (55%), Positives = 451/623 (72%), Gaps = 10/623 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL+P V  S+YS+ T     RD+   L++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYATM----RDHEKLLVVALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIVDK IEF+QVDRE  WDDQ++ N L+ YL    + +   LP
Sbjct  57    SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+++   +H GP EFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGLVLVALLHAGPGEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY L+  IP++TT   GT S  S+  Y+TYID MNN+GHCNFE IP++ FS+FPPLK+
Sbjct  177   HIAYSLILVIPLVTTFLCGTVSIVSIALYITYIDFMNNLGHCNFELIPRFFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ E+ PD ++LTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEQEEDKPDAIYLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLW-TMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLG ++ ++ P S   Y+ LM P TL  + I+  +  ++F  +RN    + 
Sbjct  297   TSLDSIYHLRLGSASLSSHPLSSRCYLLLMRPCTLMLSFILTFLSFRSFAFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y    Q ++IN  IE AI+EAE KGV+V+SLGLLNQ EELN  GE Y 
Sbjct  357   LHSHLVPKFSSHYKSLKQKKSINKTIETAILEAEKKGVRVMSLGLLNQEEELNGYGEMYA  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+ +I ++L   GIKV+  
Sbjct  417   RKHPKLKIRIVDGSSLAAQVVV-HSIPVGTREVLFRGQITKVARAIVTSLCLNGIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L+ + K N VL+ +++  +WLVG+G++KEEQ  A KGT F+P SQ PP 
Sbjct  476   REEEHCMLARFLSGHCKENLVLTTNYSPMIWLVGDGISKEEQKMAAKGTRFLPFSQFPPT  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK--  437
             + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG    
Sbjct  536   QLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRMMSAWRVGGIVHALEGWEEHECGLDVP  595

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             M     VWEAAL HGF+PL LP+
Sbjct  596   MVSPHGVWEAALRHGFQPLVLPS  618



>gb|EAY87991.1| hypothetical protein OsI_09413 [Oryza sativa Indica Group]
Length=635

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/619 (55%), Positives = 446/619 (72%), Gaps = 7/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVT-SEESERDYTNFLILPFLLSRML  2045
             MA+ PG LT WPW  LGN+KY +++P  A+S Y FVT S  +ERD  NF++ P LL R+L
Sbjct  1     MASKPGPLTQWPWNNLGNYKYALVAPSAAYSTYRFVTASSAAERDLLNFMVFPMLLLRLL  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             + QLWI+ SRH+TA  K++IV+K ++FEQ+DRE NWDDQ++L  L+FYL +  + +    
Sbjct  61    YGQLWITVSRHQTARSKHKIVNKSLDFEQIDRERNWDDQIILTALVFYLVSATMPQAQVA  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P W T G+++T  +H GPVEF+YYWLHRALHHH+LY+RYHSHHH+SIVTEPITSVIHPF 
Sbjct  121   PWWSTKGMVVTAVLHAGPVEFLYYWLHRALHHHWLYARYHSHHHASIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E + YF+L AIP+L+T+ TGT S  +  GY+ YID MN +GHCNFE +PK LF +FPPLK
Sbjct  181   EEVVYFVLLAIPILSTVATGTVSVVTANGYLVYIDFMNYLGHCNFELVPKCLFHVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEES---PDVVH  1334
             YL+YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKS+D LYE +L+  +E+   PDVVH
Sbjct  241   YLLYTPSFHSLHHTQFRTNYSLFMPVYDYIYGTTDKSSDELYERTLQGRDEAAWRPDVVH  300

Query  1333  LTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILE  1154
             LTHLT PESV+  RLGF+  A+ P        L+   +     +  ++  TF  + N L+
Sbjct  301   LTHLTAPESVFHNRLGFAAVASNPLGAAASGHLLRAASAVASPLLSLFASTFRSEANRLD  360

Query  1153  KIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGE  974
             K+ +++WVIPR+   Y  +     ++ LIE+A+ +AE  G +VL+LGLLNQ  +LNRNGE
Sbjct  361   KLNIETWVIPRFTSHYTSKSDGYKVSRLIEKAVSDAEASGARVLTLGLLNQGYDLNRNGE  420

Query  973   FYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKV  794
              Y+ + P +K K+VDG+SLAVA ++ N IP+GT +VLL  N NK+S+ +  +L +R I+V
Sbjct  421   LYVVRKPSLKTKIVDGTSLAVAAVL-NMIPQGTKDVLLLGNANKISLVLTLSLCKREIQV  479

Query  793   VTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQI  620
                 ++ YE LK  L    + + VLSRS++ KVWLVG+G+T EEQMKA KG+ F+P SQ 
Sbjct  480   RMVNKELYECLKQQLQPEMQEHLVLSRSYSSKVWLVGDGVTDEEQMKAQKGSHFVPYSQF  539

Query  619   PPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGE  440
             PP K R DC YH  PA+L P S  NLH CENWLPRR MSA R +GIVHALE W+ HECG 
Sbjct  540   PPNKARNDCVYHCTPALLVPESFENLHVCENWLPRRVMSAWRAAGIVHALEKWDGHECGG  599

Query  439   KMCDIDKVWEAALSHGFRP  383
             ++  + K W AAL+ GFRP
Sbjct  600   RVTGVQKAWSAALARGFRP  618



>ref|XP_006295717.1| hypothetical protein CARUB_v10024836mg [Capsella rubella]
 gb|EOA28615.1| hypothetical protein CARUB_v10024836mg [Capsella rubella]
Length=612

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/621 (55%), Positives = 451/621 (73%), Gaps = 15/621 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY++L+P V  S+YS+ T     RD+   LI+   + R++H
Sbjct  1     MASRPGFLTDWPWTPLGSFKYLLLAPLVIDSIYSYATM----RDHEKLLIVAMTVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA G  RI++K IEF+QVDRE  WDDQV+ N L+ YL    +   + LP
Sbjct  57    SQVWISLSRYQTAKGTKRILNKSIEFDQVDRERTWDDQVIFNSLIVYLTKVYVLGTNTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRTDGLILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  IP++TTL  GT S  S++ Y+TY+D MNNMGHCNFE IP++LFS+ PPLK+
Sbjct  177   HIGYTLILGIPLITTLLCGTISVVSIIVYITYVDFMNNMGHCNFELIPRFLFSLLPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT D+ +D+LYETSL++ E+ PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTTDECSDSLYETSLEKEEDKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF+++++ P S  +Y++LM P TL  + I+     +TF+ +RN    + 
Sbjct  297   TSVDSIYHLRLGFASFSSHPLSSRFYLFLMKPFTLILSFILTSFSSRTFVFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L + ++P++   Y+   Q + IN +IE AI+EAE KGVKV+SLGLLNQ EELN  GE Y+
Sbjct  357   LHTHLLPKFSSHYMSPQQKEYINKMIESAILEAEKKGVKVMSLGLLNQGEELNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KIK+VDG+SLA A +V ++IP GT EVL R  + KV+ +I  +L Q  IKV+  
Sbjct  417   RKHPKLKIKIVDGNSLA-AKVVLHSIPVGTKEVLFRGQITKVARAIVFSLCQNAIKVMVL  475

Query  784   CEDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              ++++  L         F+        +WLVG+GL+ +EQ  A +GTLF+P SQ PP   
Sbjct  476   RKEEHSML-------AEFLDDSCKENLIWLVGDGLSTKEQKMAKEGTLFLPFSQFPPTNL  528

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--EKMC  431
             R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVH+LEGW  HECG    + 
Sbjct  529   RKDCVYHTTPAMIIPHSAQNIDSCENWLERRVMSAWRVGGIVHSLEGWEEHECGLDNSIL  588

Query  430   DIDKVWEAALSHGFRPLPLPN  368
             +  +VWEAAL +GF+PLPLP+
Sbjct  589   NSHRVWEAALLNGFQPLPLPS  609



>ref|NP_001048490.1| Os02g0814200 [Oryza sativa Japonica Group]
 dbj|BAD21663.1| putative CER1 [Oryza sativa Japonica Group]
 dbj|BAD22402.1| putative CER1 [Oryza sativa Japonica Group]
 dbj|BAF10404.1| Os02g0814200 [Oryza sativa Japonica Group]
 gb|EAZ25056.1| hypothetical protein OsJ_08848 [Oryza sativa Japonica Group]
 dbj|BAG90785.1| unnamed protein product [Oryza sativa Japonica Group]
Length=635

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/619 (55%), Positives = 446/619 (72%), Gaps = 7/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVT-SEESERDYTNFLILPFLLSRML  2045
             MA+ PG LT WPW  LGN+KY +++P  A+S Y FVT S  +ERD  NF++ P LL R+L
Sbjct  1     MASKPGPLTQWPWHNLGNYKYALVAPSAAYSTYRFVTASSAAERDLLNFMVFPMLLLRLL  60

Query  2044  HNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRL  1865
             + QLWI+ SRH+TA  K++IV+K ++FEQ+DRE NWDDQ++L  L+FYL +  + +    
Sbjct  61    YGQLWITVSRHQTARSKHKIVNKSLDFEQIDRERNWDDQIILTALVFYLVSATMPQAQVA  120

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P W T G+++T  +H GPVEF+YYWLHRALHHH+LY+RYHSHHH+SIVTEPITSVIHPF 
Sbjct  121   PWWSTKGMVVTAVLHAGPVEFLYYWLHRALHHHWLYARYHSHHHASIVTEPITSVIHPFA  180

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             E + YF+L AIP+L+T+ TGT S  +  GY+ YID MN +GHCNFE +PK LF +FPPLK
Sbjct  181   EEVVYFVLLAIPILSTVATGTVSVVTANGYLVYIDFMNYLGHCNFELVPKCLFHVFPPLK  240

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEES---PDVVH  1334
             YL+YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DKS+D LYE +L+  +E+   PDVVH
Sbjct  241   YLLYTPSFHSLHHTQFRTNYSLFMPVYDYIYGTTDKSSDELYERTLQGRDEAAWRPDVVH  300

Query  1333  LTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILE  1154
             LTHLTTPESV+  RLGF+  A+ P        L+   +     +  ++  TF  + N L+
Sbjct  301   LTHLTTPESVFHNRLGFAAVASNPLGAAASGHLLRAASAVASPLLSLFASTFRSEANRLD  360

Query  1153  KIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGE  974
             K+ +++WVIPR+   Y  +     ++ LIE+A+ +AE  G +VL+LGLLNQ  +LNRNGE
Sbjct  361   KLNIETWVIPRFTSHYTSKSDGYKVSRLIEKAVSDAEASGARVLTLGLLNQGYDLNRNGE  420

Query  973   FYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKV  794
              Y+ + P +K K+VDG+SLAVA ++ N IP+GT +VLL  N NK+S+ +  +L +R I+V
Sbjct  421   LYVVRKPSLKTKIVDGTSLAVAAVL-NMIPQGTKDVLLLGNANKISLVLTLSLCKREIQV  479

Query  793   VTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQI  620
                 ++ YE LK  L    + + VLS S++ KVWLVG+G+T EEQMKA KG+ F+P SQ 
Sbjct  480   RMVNKELYECLKQQLQPEMQEHLVLSCSYSSKVWLVGDGVTDEEQMKAQKGSHFVPYSQF  539

Query  619   PPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGE  440
             PP K R DC YH  PA+L P S  NLH CENWLPRR MSA R +GIVHALE W+ HECG 
Sbjct  540   PPNKARNDCVYHCTPALLVPESFENLHVCENWLPRRVMSAWRAAGIVHALEKWDGHECGG  599

Query  439   KMCDIDKVWEAALSHGFRP  383
             ++  + K W AAL+ GFRP
Sbjct  600   RVTGVQKAWSAALARGFRP  618



>ref|XP_009141688.1| PREDICTED: protein CER1-like 2 isoform X1 [Brassica rapa]
Length=627

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/625 (55%), Positives = 451/625 (72%), Gaps = 12/625 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL+P V  S+YS+ T     RD+   L++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYATM----RDHEKLLVVALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIVDK IEF+QVDRE  WDDQ++ N L+ YL    + +   LP
Sbjct  57    SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+++   +H GP EFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGLVLVALLHAGPGEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY L+  IP++TT   GT S  S+  Y+TYID MNN+GHCNFE IP++ FS+FPPLK+
Sbjct  177   HIAYSLILVIPLVTTFLCGTVSIVSIALYITYIDFMNNLGHCNFELIPRFFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ E+ PD ++LTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEQEEDKPDAIYLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLW-TMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLG ++ ++ P S   Y+ LM P TL  + I+  +  ++F  +RN    + 
Sbjct  297   TSLDSIYHLRLGSASLSSHPLSSRCYLLLMRPCTLMLSFILTFLSFRSFAFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y    Q ++IN  IE AI+EAE KGV+V+SLGLLNQ EELN  GE Y 
Sbjct  357   LHSHLVPKFSSHYKSLKQKKSINKTIETAILEAEKKGVRVMSLGLLNQEEELNGYGEMYA  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+ +I ++L   GIKV+  
Sbjct  417   RKHPKLKIRIVDGSSLAAQVVV-HSIPVGTREVLFRGQITKVARAIVTSLCLNGIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKV--WLVGEGLTKEEQMKATKGTLFIPMSQIP  617
              E+++  L   L+ + K N VL+ +++  V  WLVG+G++KEEQ  A KGT F+P SQ P
Sbjct  476   REEEHCMLARFLSGHCKENLVLTTNYSPMVFIWLVGDGISKEEQKMAAKGTRFLPFSQFP  535

Query  616   PKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK  437
             P + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG  
Sbjct  536   PTQLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRMMSAWRVGGIVHALEGWEEHECGLD  595

Query  436   --MCDIDKVWEAALSHGFRPLPLPN  368
               M     VWEAAL HGF+PL LP+
Sbjct  596   VPMVSPHGVWEAALRHGFQPLVLPS  620



>emb|CDY55894.1| BnaA04g29150D [Brassica napus]
Length=616

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/623 (54%), Positives = 443/623 (71%), Gaps = 19/623 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL+P V  S+YS+ T     RD+   L++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYATM----RDHEKLLVVALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIVDK IEF+QVDRE  WDDQ++ N L+ YL    + +   LP
Sbjct  57    SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGLVLVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY L+  IP++TT   GT S  S+  Y+TYID MNN+GHCNFE IP++ FS+FPPLK+
Sbjct  177   HIAYSLILVIPLVTTFLCGTVSIVSIALYITYIDFMNNLGHCNFELIPRFFFSLFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ EE PD ++LTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEQEEEKPDAIYLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLW-TMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLG ++ ++ P S   Y+ LM P TL  + I+  +  ++F  +RN    + 
Sbjct  297   TSLDSIYHLRLGSASLSSHPLSSRCYLLLMRPCTLMLSFILTFLSFRSFAFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y    Q ++IN  IE AI+EAE KGV         + EELN  GE Y 
Sbjct  357   LHSHLVPKFSSHYKSLKQKKSINKTIETAILEAEKKGV---------REEELNGYGEMYA  407

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+ +I ++L   GIKV+  
Sbjct  408   RKHPKLKIRIVDGSSLAAQVVV-HSIPVGTREVLFRGQITKVARAIVTSLCLNGIKVMVL  466

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L+ + K N VL+ +++  +WLVG+G++KEEQ  A KGT F+P SQ PP 
Sbjct  467   REEEHCMLARFLSGHCKENLVLTTNYSPMIWLVGDGISKEEQKMAAKGTRFLPFSQFPPT  526

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK--  437
             + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG    
Sbjct  527   QLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRMMSAWRVGGIVHALEGWEEHECGLDVP  586

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             M     VWEAAL HGF+PL LP+
Sbjct  587   MVSPHGVWEAALRHGFQPLVLPS  609



>ref|XP_004954341.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=626

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/619 (57%), Positives = 445/619 (72%), Gaps = 9/619 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEES--ERDYTNFLILPFLLSRM  2048
             MAT PG L+ WPW  LGN+KY +L+PW A S Y FV +  S  ERD  +F +LP LL R+
Sbjct  1     MATKPGPLSRWPWHDLGNYKYALLAPWAARSTYKFVVASGSGGERDLLSFAVLPVLLLRL  60

Query  2047  LHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSR  1868
             L++QLWIS SRH+TA  K+RIV+K ++FEQVDRE NWDDQ++L  LLFY  N  +     
Sbjct  61    LYSQLWISVSRHQTARSKHRIVNKSLDFEQVDRERNWDDQILLTALLFYAVNAAVPVAQG  120

Query  1867  LPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPF  1688
             +P W   G+++T  +H GPVEF+YYWLHRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF
Sbjct  121   VPWWNPKGLVVTALLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHASIVTEPITSVIHPF  180

Query  1687  GEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPL  1508
              E + YF LFAIP+LTT+ TGTAS      Y+ YID MN +GHCNFE +PK LF +FPPL
Sbjct  181   AEEVIYFALFAIPLLTTVGTGTASVLVANAYLVYIDFMNYLGHCNFELVPKLLFDVFPPL  240

Query  1507  KYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLK-RGEESPDVVHL  1331
             KYLMYTPS+HSLHHTQFRTNYSLFMP YDY+YGT+DKS+D LYE +L  RGEE+PDVVHL
Sbjct  241   KYLMYTPSFHSLHHTQFRTNYSLFMPLYDYLYGTLDKSSDDLYERTLHGRGEEAPDVVHL  300

Query  1330  THLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEK  1151
             THLTTP+SV  +RLGF+++A+ P +                + + + G TF  + N L+ 
Sbjct  301   THLTTPDSVLHLRLGFASFASAPLA--IAYLPRAAAAALAKLTSLLLGSTFRSEANRLDS  358

Query  1150  IKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEF  971
             + +++WV+PRY  QY+ +    AI  L+E+A+ +AE  G +VL+LGLLNQ  ELNRNGE 
Sbjct  359   LNIETWVVPRYTSQYVSKEGLYAIGRLLEKAVADAEASGARVLTLGLLNQKNELNRNGEL  418

Query  970   YIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVV  791
             Y+ + P +K K+VDG+SLAVA ++ + IP+GT +VLL  +  KVS  +ASAL +R I+V 
Sbjct  419   YVIRKPNLKTKIVDGTSLAVAAVL-HMIPQGTKDVLLLGDATKVSTVLASALCEREIQVQ  477

Query  790   TSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIP  617
                +D Y+ LK  L      + +LS S++ KVWLVG+GLT EEQ KA  G  F+P SQ P
Sbjct  478   IVDKDLYDCLKQELRPELHKHLLLSCSYSSKVWLVGDGLTDEEQRKAQAGVHFVPYSQFP  537

Query  616   PKKHR-RDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGE  440
             P   R  DC YH  PA++ P S  NLHACENWLPRR MSA R +GIVHALE W+ HECG 
Sbjct  538   PAAARVDDCVYHSTPALVVPGSFENLHACENWLPRRVMSAWRAAGIVHALEKWDAHECGG  597

Query  439   KMCDIDKVWEAALSHGFRP  383
             ++  +DK W AAL+HGFRP
Sbjct  598   RVTGVDKAWRAALAHGFRP  616



>emb|CAA65199.1| CER1-like [Arabidopsis thaliana]
Length=622

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/626 (56%), Positives = 450/626 (72%), Gaps = 19/626 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY++++P V  S++S+VT+ + E+D +  +I+  +L R++H
Sbjct  1     MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR RT  G N+IVDKPIEFEQVDRE  WDDQV+ N LL YL N  L   S LP
Sbjct  61    SQIWISVSRQRTGKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG ++ V +H GPVEF+YYW HR LHHHFLYSRYHSHHHSSIVTEPIT V+HPFGE
Sbjct  121   PWRVDGGILMVLLHAGPVEFLYYWFHRGLHHHFLYSRYHSHHHSSIVTEPIT-VVHPFGE  179

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y LL  IP++T    G  S  S++GY+TYID MNNMGHCNFE  PK LF +FPPLK+
Sbjct  180   HIVYTLLCDIPMVTASLCGILSIVSIMGYITYIDFMNNMGHCNFELFPKRLFHLFPPLKF  239

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YD+IYGT D  TD+LYE SL+  EESPDV+HLTHL
Sbjct  240   LCYTPSFHSLHHTQFRTNYSLFMPIYDFIYGTTDNLTDSLYERSLEIEEESPDVIHLTHL  299

Query  1321  TTPESVYSIRLGFSTWAAVP--QSHNWYV-WLMWPVTLWT--MIINCIYGQTFILDRNIL  1157
             TT  S+Y +RLGF + ++ P      WY+   M P TL     + + I  +TF+ +RN L
Sbjct  300   TTHNSIYQMRLGFPSLSSCPLWSRPPWYLTCFMXPFTLLCSFALTSAIPLRTFVFERNRL  359

Query  1156  EKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNG  977
               + + S ++P++          ++IN++IEEAI+EA+ KGVKV+SLGL+N  EELN +G
Sbjct  360   RDLTVHSHLLPKFSFHR----HHESINTIIEEAILEADEKGVKVMSLGLMNNREELNGSG  415

Query  976   EFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIK  797
             E Y+QKYPK+KI+LVDGSS+A A +V N IPK  TE++ R NL KV+ ++  AL Q+G+K
Sbjct  416   EMYVQKYPKLKIRLVDGSSMA-ATVVINNIPKEATEIVFRGNLTKVASAVVFALCQKGVK  474

Query  796   VVTSCEDDYEKLKLATNSKGNFVLSRS---FTQKVWLVGEGLTKEEQMKATKGTLFIPMS  626
             VV   E+++ KL + +    N VLS S   ++ KVWLVG+G+  EEQMK  +GTLF+P S
Sbjct  475   VVVLREEEHXKL-IKSGVDKNLVLSTSNSYYSPKVWLVGDGIENEEQMKPKEGTLFVPFS  533

Query  625   QIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHEC  446
               PP K R+DC Y   PAM  P S  N+ +CENWL RR MSA ++ GIVHALEGW  H+C
Sbjct  534   HFPPNKLRKDCFYQSTPAMRVPKSAQNIDSCENWLGRRVMSAWKIGGIVHALEGWEEHDC  593

Query  445   GEKMCDIDK---VWEAALSHGFRPLP  377
             G   C++ +   +WEAAL H F+PLP
Sbjct  594   GNT-CNVLRLHAIWEAALRHDFQPLP  618



>ref|XP_007041189.1| Fatty acid hydroxylase superfamily isoform 5, partial [Theobroma 
cacao]
 gb|EOX97020.1| Fatty acid hydroxylase superfamily isoform 5, partial [Theobroma 
cacao]
Length=510

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/509 (64%), Positives = 411/509 (81%), Gaps = 3/509 (1%)
 Frame = -3

Query  2104  ESERDYTNFLILPFLLSRMLHNQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQV  1925
             E E + T  LI PFL++R+LHNQ+WIS SR+RTA GKNRIVDK I+FEQVDRESNWDDQ+
Sbjct  1     EKEANLTYHLIFPFLMTRVLHNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQI  60

Query  1924  VLNGLLFYLFNTVLAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryh  1745
             +LNG+L YL N ++   S LP WR+DG ++ + +H GPVEF+YYWLHRALHHHFLYSRYH
Sbjct  61    ILNGILLYLTNMIMPGASHLPLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFLYSRYH  120

Query  1744  shhhsSIVTEPITSVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNM  1565
             SHHHSSI TEPITSVIHPF E +AYFLLFAIP++T +FTGTAS +++  Y+TYIDLMNNM
Sbjct  121   SHHHSSIATEPITSVIHPFAEEVAYFLLFAIPLMTVMFTGTASIAAIFIYITYIDLMNNM  180

Query  1564  GHCNFEFIPKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDT  1385
             GHCNFE +PKW+FS FPPLK+LMYTPSYHSLHHTQFRTNYSLFMP YDY+YGT+DKS+D 
Sbjct  181   GHCNFELVPKWVFSTFPPLKFLMYTPSYHSLHHTQFRTNYSLFMPMYDYLYGTVDKSSDD  240

Query  1384  LYETSLKRGEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWL-MWPVTLWTM  1208
             LYETSLKR EESPD+VHLTHLTT +S+Y +RLGF++ A+ P +  WY  + MWPV+ W+ 
Sbjct  241   LYETSLKRQEESPDIVHLTHLTTTDSIYHLRLGFASLASKPYAFKWYFTIAMWPVSCWSA  300

Query  1207  IINCIYGQTFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvk  1028
             +    YG TF+ + N    +KLQSWV+PRY + YLL+ + + +N LIEEA++EA+ KG K
Sbjct  301   VFTWFYGHTFVSESNTFNNLKLQSWVVPRYTMHYLLQREKKDLNYLIEEALLEADSKGAK  360

Query  1027  vlslglLNQSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANL  848
             V+S GLLNQ EELN NGE YIQ++P+++I+LVDGSSLA A++V N+IP+ TT+VLL   +
Sbjct  361   VVSFGLLNQHEELNGNGELYIQRHPQLRIRLVDGSSLAAAVVV-NSIPQETTQVLLTGRI  419

Query  847   NKVSISIASALTQRGIKVVTSCEDDYEKLKLATNSKG-NFVLSRSFTQKVWLVGEGLTKE  671
             +KV  +IA AL Q+G++V    ED+Y+KL+ +    G N VL+ ++ QK+WLVGEGLT +
Sbjct  420   SKVGYAIALALCQKGVQVAAMNEDEYQKLQHSDCQFGKNLVLAENYDQKIWLVGEGLTDK  479

Query  670   EQMKATKGTLFIPMSQIPPKKHRRDCSYH  584
             EQ+KATKGT+ IP +Q PPKK  +DC YH
Sbjct  480   EQLKATKGTVLIPFTQFPPKKLLKDCYYH  508



>ref|NP_181306.3| protein CER1-like 2 [Arabidopsis thaliana]
 sp|F4IR05.1|CERL2_ARATH RecName: Full=Protein CER1-like 2 [Arabidopsis thaliana]
 gb|AEC09436.1| protein CER1-like 2 [Arabidopsis thaliana]
Length=613

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/622 (55%), Positives = 447/622 (72%), Gaps = 16/622 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY++L+P V  S+YS+ T     RD+   LI+   + R++H
Sbjct  1     MASRPGFLTDWPWTPLGSFKYLLLAPLVFDSIYSYATI----RDHEKLLIVAVTVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA G  RI++K IEF+QVDRE  WDDQ++ N L+ YL    ++  S +P
Sbjct  57    SQIWISLSRYQTAKGTKRILNKSIEFDQVDRERTWDDQIIFNTLIVYLTKVYVSGTSTIP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRTDGVILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  +P++TT   GT S  S+  Y+TYID MNNMGHCNFE IPK+LFS+ PPLK+
Sbjct  177   HIGYTLILGLPLITTFMCGTVSVVSIALYLTYIDFMNNMGHCNFELIPKFLFSLLPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT D+ +D+LYETSL++ EE PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTTDECSDSLYETSLEKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y++LM P  L  + I+     QTF+++RN    + 
Sbjct  297   TSLDSIYHLRLGFASLSSHPLSSRCYLFLMKPFALILSFILRSFSFQTFVVERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y+   Q + IN +IE AI+EA+ KGVKV+SLGLLNQ EELN  GE Y+
Sbjct  357   LHSHLLPKFSSHYMSHQQKECINKMIEAAILEADKKGVKVMSLGLLNQGEELNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +++PK+KI++VDG SLA A +V ++IP GT EVL R  + KV+ +I  +L Q  IKV+  
Sbjct  417   RRHPKLKIRIVDGGSLA-AEVVLHSIPVGTKEVLFRGQITKVARAIVFSLCQNAIKVMVL  475

Query  784   CEDDYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPKKH  605
              ++++  L         F+  +     +WLVG+GL+ +EQ  A  GTLF+P SQ PPK  
Sbjct  476   RKEEHSML-------AEFLDDKCKENLIWLVGDGLSTKEQKMAKDGTLFLPFSQFPPKTL  528

Query  604   RRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG---EKM  434
             R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG     +
Sbjct  529   RKDCFYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWKEHECGLDDNSI  588

Query  433   CDIDKVWEAALSHGFRPLPLPN  368
              +  +VWEAAL +GF+PL LP+
Sbjct  589   INPPRVWEAALRNGFQPLLLPS  610



>emb|CDX93353.1| BnaC04g45430D [Brassica napus]
Length=625

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/620 (54%), Positives = 449/620 (72%), Gaps = 11/620 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL+P V  S+YS+ T+    RD+   L++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYATT----RDHEKILVMALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIV+K IEF+QVDRE  WDDQ++ N L+ YL    L     LP
Sbjct  57    SQVWISFSRYRTAKGTKRIVNKSIEFDQVDRERTWDDQIIFNTLIAYLVKVYLIGTDTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+++   +H GP EFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGLVLVALLHAGPAEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY L+  +P++TT    T S  S+  Y+TYID MNN+GHCNFE IP++ FSIFPPLK+
Sbjct  177   HIAYSLILVMPLVTTFLCCTVSIVSIALYITYIDFMNNLGHCNFELIPRFFFSIFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYE SL++ EE PD ++LTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYEASLEQEEEKPDAIYLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLW-TMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y+ LM P TL  + I+  +  ++F+ +RN    + 
Sbjct  297   TSLDSIYHLRLGFASLSSHPLSSRCYLLLMRPFTLMLSFILTFLSFRSFVFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQ-SEELNRNGEFY  968
             L S ++P++   Y  + Q ++IN +IE AI+EAE KG++V+S+ L++Q  EELN  GE Y
Sbjct  357   LHSHLLPKFSSHYKSQKQKESINKMIETAILEAEKKGMRVMSMQLMHQLGEELNGYGELY  416

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             ++K+PK+KI++VDGSSLA  +++ ++IP G  EVL+R  + KV+ +I  +L Q GIKV+ 
Sbjct  417   VRKHPKLKIRIVDGSSLAAQVVI-HSIPVGIKEVLVRGQITKVARAIVRSLCQNGIKVMV  475

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
               E+++  L   LA +   N +L+ +++  +WLVG+GL+ EEQ  A +GT F+P SQ PP
Sbjct  476   LREEEHCMLAEFLAGHCMENLILTTNYSPMIWLVGDGLSNEEQKMAEQGTHFLPFSQFPP  535

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK-  437
              + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG   
Sbjct  536   TELRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLDV  595

Query  436   -MCDIDKVWEAALSHGFRPL  380
              M +  + WEAAL HGF+PL
Sbjct  596   PMVNSHRAWEAALRHGFQPL  615



>ref|XP_010505369.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=634

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/622 (54%), Positives = 455/622 (73%), Gaps = 13/622 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY++L+P V  S+YS+ T     RDY   L++   + R++H
Sbjct  1     MASRPGFLTDWPWAPLGSFKYLLLAPLVIDSIYSYATM----RDYEKLLVVAMTVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA G  RI++K IEF+QVDRE +WDDQ++ N L+ YL    +     LP
Sbjct  57    SQVWISLSRYQTAKGTKRILNKSIEFDQVDRERSWDDQIIFNSLIVYLTKVYVLGTDTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRTDGLILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  +P++TTL  GTAS  S+  Y+TYID MNNMGHCNFE IP +LFS+ PPLK+
Sbjct  177   HIGYTLILGLPLVTTLLCGTASVVSIFLYITYIDFMNNMGHCNFELIPGFLFSLLPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDY+YGT D+ +D+LYETSL++ EE PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYMYGTTDECSDSLYETSLEKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIY----GQTFILDRNILE  1154
             T+ +S+Y +RLGF++ ++ P S  +Y++L++ +  +T+I++ I      +TF+ +RN   
Sbjct  297   TSVDSIYHLRLGFASLSSHPLSSRFYLFLLFLMKPFTLILSFILTSFSSRTFVFERNRFR  356

Query  1153  KIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGE  974
              + L + ++P++   Y+   Q + IN +IE AI+EAE KGVKV+SLGL+NQ EELN  GE
Sbjct  357   DLTLHTHLLPKFPSHYMSPEQKECINKMIESAILEAEKKGVKVMSLGLMNQGEELNGYGE  416

Query  973   FYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKV  794
              Y++K+PK+KI++VDGSSLA A +V ++IP  T EVL R  + KV+ +I  +L Q  IKV
Sbjct  417   MYVRKHPKLKIRIVDGSSLA-AEVVLHSIPVRTREVLFRGQVTKVARAIVFSLCQNAIKV  475

Query  793   VTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQI  620
             +   ++++  L   L  + K N VL+ ++   +WLVG+G++ +EQ  A +GT+F+P SQ 
Sbjct  476   MVLRKEEHSMLAEFLDDSCKENLVLTTNYNPMIWLVGDGVSTKEQKMAKEGTMFLPFSQF  535

Query  619   PPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG-  443
             PP K R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVH+LEGW  HECG 
Sbjct  536   PPDKLRKDCVYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGL  595

Query  442   -EKMCDIDKVWEAALSHGFRPL  380
                + +  +VWEAAL +GF+PL
Sbjct  596   DNSILNSPRVWEAALRNGFQPL  617



>ref|XP_002881545.1| hypothetical protein ARALYDRAFT_321478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57804.1| hypothetical protein ARALYDRAFT_321478 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/623 (55%), Positives = 450/623 (72%), Gaps = 10/623 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+  GFLTDWPW PLG+FKY+VL+P V  S+YS+ T     RD+   +I+   + R++H
Sbjct  1     MASRSGFLTDWPWTPLGSFKYIVLAPLVIDSIYSYATM----RDHEKLMIVALAVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR++TA G  RIV+K IEF+QVDRE  WDDQ++ N L+ YL    +   + + 
Sbjct  57    SQIWISFSRYQTAKGTKRIVNKSIEFDQVDREQTWDDQIIFNSLILYLTKLYVLGTNTIS  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRTDGLILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  +P+  TL  GT S  S+L Y TYID MNNMGHCNFE IP+ LFSI PPLK+
Sbjct  177   HIGYTLILGLPLTMTLLCGTVSAVSILIYATYIDFMNNMGHCNFELIPRSLFSILPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT D+ +D+LYETSL++ E+ PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTTDECSDSLYETSLEKEEDKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMW-PVT-LWTMIINCIYGQTFILDRNILEKI  1148
             T+ +S+Y +RLG ++ +  P S   Y+++M  P T + + I+      TF+ +RN    +
Sbjct  297   TSLDSIYHLRLGLASLSLHPLSSQCYLFIMMKPFTHIISFILTSFSFPTFVFERNRFRDL  356

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
              L S ++P++   Y+ + Q + IN +IE AI+EAE KGVKV+SLGLLNQ EELN  GE Y
Sbjct  357   TLHSHLLPKFSSHYMSQQQKECINKMIEAAILEAEKKGVKVMSLGLLNQGEELNGYGEMY  416

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
             ++K+PK+KI++VDGSSLA A +V ++IP GT EVL R  + KV+ +I  +L Q  IKV+ 
Sbjct  417   VRKHPKLKIRIVDGSSLA-AEVVLHSIPVGTNEVLFRGQITKVARAIVFSLCQNAIKVMV  475

Query  787   SCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPP  614
               ++++      L  N K N VL+ ++   +WLVG+GL+K+EQ  A + TLF+P SQ PP
Sbjct  476   LRKEEHSMFAEFLDDNCKENLVLTTNYYPMIWLVGDGLSKKEQKMAKERTLFLPFSQFPP  535

Query  613   KKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG-EK  437
              K R+DC YH  PAM+ P + HN+ +CENWL RR MSA RV GIVHALEGW  HECG E 
Sbjct  536   TKLRKDCFYHTTPAMIIPHAAHNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGFES  595

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             + +  +VW+AAL +GF+PL LP+
Sbjct  596   IINPPRVWDAALRNGFQPLLLPS  618



>emb|CDX79754.1| BnaC03g20900D [Brassica napus]
Length=614

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/623 (54%), Positives = 444/623 (71%), Gaps = 19/623 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LT+WPW PLG+FKY+VL+P V  S+YS+ T     RD    LIL  ++ R++H
Sbjct  1     MASRPGLLTEWPWTPLGSFKYLVLAPLVIDSIYSYATM----RDVDKLLILVVMVGRVVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS++R++TA G  RIV+K IEF QVDRE  WDDQV+ N L+ YL    +   + LP
Sbjct  57    SQMWISFARYKTAKGTKRIVNKSIEFNQVDRERTWDDQVIFNTLVIYLAKVYVLGTNTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DGV+    +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGVVQVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  IP++TTL  GT S +S+  Y+TYID MNN+GHCNFE IP+  FS+FPP+KY
Sbjct  177   HIGYTLILGIPLVTTLLCGTVSAASVTLYITYIDFMNNLGHCNFELIPRSFFSLFPPIKY  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYE+ L++ EE P+ +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYESLLEQEEEKPEAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIK  1145
              + +S+Y +RLGF+++++ P S  +Y+ LM P+TL  + ++     +TF+ +RN    + 
Sbjct  297   ISLDSIYHLRLGFASFSSHPLSSRFYLVLMKPITLIISFVLTSFSSRTFVFERNRFGDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y  + Q ++IN LIE AI+EAE K V         + EELN  GE Y+
Sbjct  357   LHSHLLPKFSSHYKSQQQKESINKLIETAILEAEKKDV---------RGEELNGYGEMYV  407

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +KYPK+KIK+VDG+SLA A++V ++IP GT EVL R  + KV+ +I  +L Q GIKV+  
Sbjct  408   RKYPKLKIKIVDGTSLAAAVVV-HSIPAGTREVLFRGQITKVARAIVISLCQSGIKVMVL  466

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              ++++  L   +  + K N VL+ +    +WLVG+GL+K+EQ  A K TLFIP SQ PP+
Sbjct  467   HKEEHCMLARFIGGDCKENLVLTTNDYPMIWLVGDGLSKKEQKLARKRTLFIPYSQFPPR  526

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK--  437
             + R++C YH  PAM  P S  N+ +CENWL RR MSA RV GIVHALEGW  HECG +  
Sbjct  527   ELRKNCFYHTTPAMTIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLEVP  586

Query  436   MCDIDKVWEAALSHGFRPLPLPN  368
             M +  +VWEAAL +GF+PL  P+
Sbjct  587   MVNPPRVWEAALRNGFKPLVFPS  609



>ref|XP_004510148.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Cicer arietinum]
Length=512

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/506 (65%), Positives = 402/506 (79%), Gaps = 3/506 (1%)
 Frame = -3

Query  1885  LAKGSRLPAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPIT  1706
             + +  +LP WRTDGV++T+ +H GPVEF+YYWLH+ALHHHFLYSRYHSHHHSSIVTEPIT
Sbjct  3     IEESRKLPIWRTDGVIITILLHAGPVEFLYYWLHKALHHHFLYSRYHSHHHSSIVTEPIT  62

Query  1705  SVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLF  1526
             SVIHPF EHIAYF+LFAIP+ TT  T TAS +S  GY+ YID MNN+GHCNFEFIP  LF
Sbjct  63    SVIHPFAEHIAYFMLFAIPLYTTAITKTASIASFAGYLAYIDFMNNLGHCNFEFIPMKLF  122

Query  1525  SIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESP  1346
             SIFP LKYLMYTPS+HSLHHTQFRTNYSLFMP YDYIYGT+D +TDT YETSLK+ E SP
Sbjct  123   SIFPFLKYLMYTPSFHSLHHTQFRTNYSLFMPIYDYIYGTVDNATDTTYETSLKKEEASP  182

Query  1345  DVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDR  1166
             DVVHLTHLTTPES+Y +RLGFS+ A+ PQS  WY++LMWP T  +++    YGQTF+L+R
Sbjct  183   DVVHLTHLTTPESIYHLRLGFSSLASTPQSSKWYLYLMWPFTFASVLATWFYGQTFVLER  242

Query  1165  NILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELN  986
             N    + LQSWVIPR+ VQYL +WQ + +N LIEEAI+EAE   VKVLSLGL NQ + LN
Sbjct  243   NSFNMLNLQSWVIPRFHVQYLFKWQRETLNKLIEEAILEAELSKVKVLSLGLSNQGDLLN  302

Query  985   RNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQR  806
             R+GE YI++YP++K+K+VDGSSL VAI++ N+IPK   +VLL   L+KVS +I +AL +R
Sbjct  303   RHGELYIKRYPQLKLKIVDGSSLVVAIVL-NSIPKEANQVLLCGRLDKVSYAIVNALCER  361

Query  805   GIKVVTSCEDDYE--KLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIP  632
             G KV T   DDYE  +L+L++ SK N V     + K+WLVG+   + EQ KA KG+LFIP
Sbjct  362   GTKVTTMYTDDYENLQLRLSSESKKNLVSPGFNSSKIWLVGDQCDEVEQKKAPKGSLFIP  421

Query  631   MSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVH  452
              SQ PPKK R+DC Y   PAM+ PP L N+ +CENWLPRR MSA R++GI+HALEGWN+H
Sbjct  422   FSQFPPKKLRKDCFYGSTPAMITPPDLVNVDSCENWLPRRVMSAWRIAGILHALEGWNIH  481

Query  451   ECGEKMCDIDKVWEAALSHGFRPLPL  374
             ECGE M  I+KVW+A+L HGFRPL +
Sbjct  482   ECGESMFSIEKVWKASLQHGFRPLKI  507



>ref|XP_009141683.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=619

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/622 (54%), Positives = 446/622 (72%), Gaps = 10/622 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL P V  S+YS+     + RD+   L++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLVPLVIDSIYSYA----AMRDHEKLLVMALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIV+K IEF+QVDRE  WDDQ++ N L+ YL    L     LP
Sbjct  57    SQVWISFSRYRTAKGTKRIVNKSIEFDQVDRERTWDDQIIFNTLVAYLAKVYLIGTDTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+++   +H GP EFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGLVLVALLHAGPAEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY L+  +P++TT   GT S  S+  Y+TYID MNN+GHCNFE IP++ FSIFPPLK+
Sbjct  177   HIAYSLILVMPLVTTFLCGTVSIISIALYITYIDFMNNLGHCNFELIPRFFFSIFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ EE PD ++LTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEQDEEKPDAIYLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLW-TMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLG ++ ++ P S   Y+ LM P TL  + I+  +  ++F  +RN    + 
Sbjct  297   TSLDSIYHLRLGSASLSSHPLSSRCYLLLMRPFTLMLSFILTFLSFRSFAFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L S ++P++   Y  + Q ++IN +IE AI+EAE  GV+V+SLGLLNQ EELN  GE Y+
Sbjct  357   LHSHLLPKFSSHYKSQKQKESINKMIETAILEAEKNGVRVMSLGLLNQGEELNGYGEVYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA  +++ ++IP G  EVL R  + KV+ +I  +L Q GIKV+  
Sbjct  417   RKHPKLKIRIVDGSSLAAQVVI-HSIPVGIKEVLFRGQITKVARAIVRSLCQNGIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              E+++  L   L  +   N +L+ + +  +WLVG+ L+ EEQ  A +GT F+P SQ PP 
Sbjct  476   REEEHCMLAEFLGGHCMENLILTTNHSPMIWLVGDSLSNEEQKMAEEGTHFLPFSQFPPT  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEK--  437
             + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RVSGIVHALEGW  HECG    
Sbjct  536   ELRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVSGIVHALEGWEEHECGLDVP  595

Query  436   MCDIDKVWEAALSHGFRPLPLP  371
             M +  + WEAAL HGF+PL LP
Sbjct  596   MVNPHRAWEAALRHGFQPLVLP  617



>gb|AAC23640.1| CER1-like protein [Arabidopsis thaliana]
Length=635

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/637 (54%), Positives = 452/637 (71%), Gaps = 24/637 (4%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY++L+P V  S+YS+ T     RD+   LI+   + R++H
Sbjct  1     MASRPGFLTDWPWTPLGSFKYLLLAPLVFDSIYSYATI----RDHEKLLIVAVTVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA G  RI++K IEF+QVDRE  WDDQ++ N L+ YL    ++  S +P
Sbjct  57    SQIWISLSRYQTAKGTKRILNKSIEFDQVDRERTWDDQIIFNTLIVYLTKVYVSGTSTIP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPIT--------  1706
              WRTDGV++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPIT        
Sbjct  117   FWRTDGVILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITLCATNSKP  176

Query  1705  -----SVIHPFGEHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFI  1541
                  +V+HPF EHI Y L+  +P++TT   GT S  S+  Y+TYID MNNMGHCNFE I
Sbjct  177   WVLIVAVVHPFAEHIGYTLILGLPLITTFMCGTVSVVSIALYLTYIDFMNNMGHCNFELI  236

Query  1540  PKWLFSIFPPLKYLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKR  1361
             PK+LFS+ PPLK+L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT D+ +D+LYETSL++
Sbjct  237   PKFLFSLLPPLKFLCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTTDECSDSLYETSLEK  296

Query  1360  GEESPDVVHLTHLTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQ  1184
              EE PD +HLTHLT+ +S+Y +RLGF++ ++ P S   Y++LM P  L  + I+     Q
Sbjct  297   EEEKPDAIHLTHLTSLDSIYHLRLGFASLSSHPLSSRCYLFLMKPFALILSFILRSFSFQ  356

Query  1183  TFILDRNILEKIKLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLN  1004
             TF+++RN    + L S ++P++   Y+   Q + IN +IE AI+EA+ KGVKV+SLGLLN
Sbjct  357   TFVVERNRFRDLTLHSHLLPKFSSHYMSHQQKECINKMIEAAILEADKKGVKVMSLGLLN  416

Query  1003  QSEELNRNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIA  824
             Q EELN  GE Y++++PK+KI++VDG SLA A +V ++IP GT EVL R  + KV+ +I 
Sbjct  417   QGEELNGYGEMYVRRHPKLKIRIVDGGSLA-AEVVLHSIPVGTKEVLFRGQITKVARAIV  475

Query  823   SALTQRGIKVVTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATK  650
              +L Q  IKV+   ++++  L   L    K N VL+ ++   +WLVG+GL+ +EQ  A  
Sbjct  476   FSLCQNAIKVMVLRKEEHSMLAEFLDDKCKENLVLTTNYYPMIWLVGDGLSTKEQKMAKD  535

Query  649   GTLFIPMSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHAL  470
             GTLF+P SQ PPK  R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVHAL
Sbjct  536   GTLFLPFSQFPPKTLRKDCFYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHAL  595

Query  469   EGWNVHECG---EKMCDIDKVWEAALSHGFRPLPLPN  368
             EGW  HECG     + +  +VWEAAL +GF+PL LP+
Sbjct  596   EGWKEHECGLDDNSIINPPRVWEAALRNGFQPLLLPS  632



>ref|XP_004170720.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus]
Length=507

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/507 (64%), Positives = 411/507 (81%), Gaps = 3/507 (1%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+TPG LTDWPW PLG FKYVVL+P   +S+Y ++  +E+ERD ++ +I+P LL RM+H
Sbjct  1     MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVKDEAERDTSSLVIIPLLLWRMIH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRHRTA G  RIVDK +EF+QVDRE NWDDQ++LNG+LFYL + + AKG  LP
Sbjct  61    NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVSNLTAKGRNLP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDGV++T  +H GPVEF+YYWLHRALHHH+LYSRYHSHHHSSIVTEPITSVIHPF E
Sbjct  121   LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             H+ YFLLFAIP+LT LFTG +S +  + Y+TYID MNNMGHCNFE IP  LF++FPPLKY
Sbjct  181   HLTYFLLFAIPMLTVLFTGISSLAVYIFYLTYIDFMNNMGHCNFEIIPNRLFTLFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
              +YTPS+HSLHHTQFRTNYSLFMP YDYIYGT+D S+D+LYE SLKR EE  DVVHLTHL
Sbjct  241   FLYTPSFHSLHHTQFRTNYSLFMPLYDYIYGTLDNSSDSLYEKSLKREEEVADVVHLTHL  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLWTMIINCIYGQTFILDRNILEKIKL  1142
             TTPES+Y +RLGF+  A+ P +  WY WL+ P+T+ +M++  IYG+TF+++RN  EK+K+
Sbjct  301   TTPESIYHLRLGFADLASRPHTSTWYTWLLSPITMGSMLLTWIYGRTFVVERNQFEKLKM  360

Query  1141  QSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYIQ  962
             Q+W IP++ VQY L+WQ QAINS+IE+AI+EA+ KG KV SLGLLNQ EELN  G  Y+Q
Sbjct  361   QTWAIPKFNVQYFLQWQKQAINSMIEDAIVEADQKGCKVFSLGLLNQGEELNIYGGLYVQ  420

Query  961   KYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTSC  782
             + PK+++++VDGSSLAVA+++ N+IPK  T+VLLR  L KV+ +++ +L QRGI+V    
Sbjct  421   RNPKLRVRVVDGSSLAVAVVL-NSIPKSATQVLLRGKLTKVAYALSYSLCQRGIQVAVLH  479

Query  781   EDDYEKLKLATNSK--GNFVLSRSFTQ  707
             E++Y KL  + N+K   N VLS+ ++Q
Sbjct  480   EEEYRKLNKSFNTKFESNPVLSKGYSQ  506



>gb|EMT07276.1| Protein WAX2 [Aegilops tauschii]
Length=604

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/617 (53%), Positives = 435/617 (71%), Gaps = 19/617 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MAT PG LT+WPW  +G+FKY+V +P    + Y  VT    + +     ILP LL RMLH
Sbjct  1     MATRPGPLTEWPWHWMGSFKYLVFAPVALQTAYRVVTKGWGDMNLAYAAILPALLLRMLH  60

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             NQ+WIS SRH+TA  K+ IVD+ +EFEQVDRE +WDDQ++L+GL FYL    +     +P
Sbjct  61    NQIWISLSRHQTARRKHIIVDRSLEFEQVDRERSWDDQIILSGLYFYLAYAAIPSVRLMP  120

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              W T G ++   +H GPVEF+YYW HRALHHHFLYSRYHSHHH+SIVTEPITSVIHPF E
Sbjct  121   MWETKGAIIMALLHAGPVEFLYYWFHRALHHHFLYSRYHSHHHASIVTEPITSVIHPFAE  180

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
              + YFLLF IP+L  +  G  S   ++ YV YID MNNMGHCNFE +PKW+F +FPPLKY
Sbjct  181   MLVYFLLFLIPMLIPILMGYGSILGIVLYVAYIDFMNNMGHCNFELLPKWIFQVFPPLKY  240

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             LMYTPSYHSLHHT+FRTNYSL MP YDYI+ TMDKSTD LYE +L   EE+PDVVHLTH+
Sbjct  241   LMYTPSYHSLHHTKFRTNYSLAMPIYDYIFNTMDKSTDELYERTLIGTEETPDVVHLTHM  300

Query  1321  TTPESVYSIRLGFSTWAAVPQSHN-WYVWLMWPVTLWTMIINCIYGQT-FILDRNILEKI  1148
             TT +S Y +R+G ++ A+ P  +  WYVW++WP+   +M++  IYG + F+++   L+K 
Sbjct  301   TTLQSTYHLRVGIASIASRPSDNPVWYVWMIWPMAWLSMVLAWIYGSSAFVVESLKLKKF  360

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFY  968
             K+Q+WVIPRY  QY L  + ++IN LIE+AI++A               +++LN NGE +
Sbjct  361   KMQTWVIPRYNFQYGLIRERESINRLIEKAILDA--------------DAKQLNGNGELF  406

Query  967   IQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVT  788
               KYPK+ ++LVDGS LA A+++  +IP  T  V L    +KV  +IA+AL +RG++V+ 
Sbjct  407   THKYPKLGVRLVDGSGLATAVVL-KSIPSDTKHVFLCGGSSKVERAIATALCERGVQVIM  465

Query  787   SCED-DYEKLKLATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
             + ++ D  KL+++ +S      S   T ++W +G+ +  ++QM A KG  FIP SQ P K
Sbjct  466   NQKEYDMLKLRVSESSIAYLKFSSDETPQIW-IGDIIDDKQQMGAPKGATFIPTSQFPLK  524

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECGEKMC  431
             + R+DC+Y   PAM  P ++ N+H CENWLPRR MSA R++G+VHALEGW++HECG+ M 
Sbjct  525   RMRKDCTYLSSPAMKIPEAMQNVHTCENWLPRRVMSAWRIAGMVHALEGWDMHECGDDMM  584

Query  430   DIDKVWEAALSHGFRPL  380
             DI+KVW AA+ HGF PL
Sbjct  585   DIEKVWSAAIKHGFTPL  601



>ref|XP_010517046.1| PREDICTED: protein CER1-like 2 isoform X1 [Camelina sativa]
Length=623

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/619 (55%), Positives = 453/619 (73%), Gaps = 10/619 (2%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PGFLTDWPW PLG+FKY++L+P V  S+YS+ T     RDY   L++   + R++H
Sbjct  1     MASRPGFLTDWPWAPLGSFKYLLLAPLVIDSIYSYATM----RDYEKLLVVAMTVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS SR++TA G  RI++K IEF+QVDRE +WDDQ++ N L+ YL    +     LP
Sbjct  57    SQVWISLSRYQTAKGTKRILNKSIEFDQVDRERSWDDQIIFNSLIVYLAKVYVLGTDTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WRTDG+++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRTDGLILVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HI Y L+  +P++TTL  GTAS  S+  Y+TYID MNNMGHCNFE IP++LFS+ PPLK+
Sbjct  177   HIGYTLILGLPLVTTLLCGTASVVSIFLYITYIDFMNNMGHCNFELIPRFLFSLLPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDY+YGT D+ +D+LYE SL++ EE PD +HLTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYMYGTTDECSDSLYEKSLEKEEEKPDAIHLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTL-WTMIINCIYGQTFILDRNILEKIK  1145
             T+ ES+Y +RLGF++ ++ P S  +Y++LM P TL  + I+     +TF+ +RN    + 
Sbjct  297   TSVESIYHLRLGFASLSSHPLSSRFYLFLMKPFTLILSFILTSFSSRTFVFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQSEELNRNGEFYI  965
             L + +IP++   Y+ + Q + IN +IE AI+EAE KGVKV+SLGLLNQ EELN  GE Y+
Sbjct  357   LHTHLIPKFPSHYMSQQQKECINKMIESAILEAEKKGVKVMSLGLLNQGEELNGYGEMYV  416

Query  964   QKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQRGIKVVTS  785
             +K+PK+KI++VDGSSLA A +V ++IP  T EVL R  + KV+ +I  +L Q  IKV+  
Sbjct  417   RKHPKLKIRIVDGSSLA-AEVVLHSIPVRTREVLFRGQVTKVARAIVFSLCQNAIKVMVL  475

Query  784   CEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIPMSQIPPK  611
              ++++  L   L  + K N VL+ ++   +WLVG+G++ +EQ  A +GTLF+P SQ PP 
Sbjct  476   RKEEHSMLAEFLDDSCKENLVLTTNYNPMIWLVGDGVSTKEQKMAKEGTLFLPFSQFPPD  535

Query  610   KHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVHECG--EK  437
             K R+DC YH  PAM+ P S  N+ +CENWL RR MSA RV GIVH+LEGW  HECG    
Sbjct  536   KLRKDCVYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNS  595

Query  436   MCDIDKVWEAALSHGFRPL  380
             + +  +VWEAAL +GF+PL
Sbjct  596   VLNSPRVWEAALRNGFQPL  614



>emb|CDY55893.1| BnaA04g29140D [Brassica napus]
Length=626

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/629 (54%), Positives = 448/629 (71%), Gaps = 17/629 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL P V  S+YS+     + RD+   L++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLVPLVIDSIYSYA----AMRDHEKLLVMALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNTVLAKGSRLP  1862
             +Q+WIS+SR+RTA G  RIV+K IEF+QVDRE  WDDQ++ N L+ YL    L     LP
Sbjct  57    SQVWISFSRYRTAKGTKRIVNKSIEFDQVDRERTWDDQIIFNTLVAYLAKVYLIGTDTLP  116

Query  1861  AWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFGE  1682
              WR DG+++   +H GP EFIYYW HRALHHHFLYSRYHSHHHSSIVTEPITSV+HPF E
Sbjct  117   FWRLDGLVLVALLHAGPAEFIYYWFHRALHHHFLYSRYHSHHHSSIVTEPITSVVHPFAE  176

Query  1681  HIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLKY  1502
             HIAY L+  +P++TT   GT S  S+  Y+TYID MNN+GHCNFE IP++ FSIFPPLK+
Sbjct  177   HIAYSLILVMPLVTTFLCGTVSIISIALYITYIDFMNNLGHCNFELIPRFFFSIFPPLKF  236

Query  1501  LMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTHL  1322
             L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL++ EE PD ++LTHL
Sbjct  237   LCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLEQDEEKPDAIYLTHL  296

Query  1321  TTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVTLW-TMIINCIYGQTFILDRNILEKIK  1145
             T+ +S+Y +RLGF++ ++ P S   Y+ LM P TL  + I+  +  ++F  +RN    + 
Sbjct  297   TSLDSIYHLRLGFASLSSHPLSSRCYLLLMRPFTLMLSFILTFLSFRSFAFERNRFRDLT  356

Query  1144  LQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQS-------EELN  986
             L S ++P++   Y  + Q ++IN +IE AI+EAE  GV+V+SLGLLNQ+       EELN
Sbjct  357   LHSHLLPKFSSHYKSQKQKESINKMIETAILEAEKNGVRVMSLGLLNQACNMHQLGEELN  416

Query  985   RNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQR  806
               GE Y++K+PK+KI++VDGSSLA  +++ ++IP G  EVL R  + KV+ +I  +L Q 
Sbjct  417   GYGEVYVRKHPKLKIRIVDGSSLAAQVVI-HSIPVGIKEVLFRGQITKVARAIVRSLCQN  475

Query  805   GIKVVTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIP  632
             GIKV+   E+++  L   L  +   N +L+ + +  +WLVG+ L+ EEQ  A +GT F+P
Sbjct  476   GIKVMVLREEEHCMLAEFLGGHCMENLILTTNHSPMIWLVGDSLSNEEQKMAEEGTHFLP  535

Query  631   MSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVH  452
              SQ PP + R+DC YH  PAM+ P S  N+ +CENWL RR MSA RVSGIVHALEGW  H
Sbjct  536   FSQFPPTELRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVSGIVHALEGWEEH  595

Query  451   ECGEK--MCDIDKVWEAALSHGFRPLPLP  371
             ECG    M +  + WEAAL HGF+PL LP
Sbjct  596   ECGLDVPMVNPHRAWEAALRHGFQPLVLP  624



>emb|CDX93352.1| BnaC04g45440D [Brassica napus]
Length=632

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/630 (54%), Positives = 457/630 (73%), Gaps = 17/630 (3%)
 Frame = -3

Query  2221  MATTPGFLTDWPWKPLGNFKYVVLSPWVAHSLYSFVTSEESERDYTNFLILPFLLSRMLH  2042
             MA+ PG LTDWPW PLG+FKY+VL+P V  S+YS+       RD+   L++  ++ R++H
Sbjct  1     MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYAII----RDHEKLLVMALMVWRIVH  56

Query  2041  NQLWISYSRHRTANGKNRIVDKPIEFEQVDRESNWDDQVVLNGLLFYLFNT-VLAKGSRL  1865
             +Q+WIS+SR++TA G  RIVDK IEF+QVDRE  WDDQ++ N L+ YL    ++     L
Sbjct  57    SQVWISFSRYQTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLTKVYMIGTDHTL  116

Query  1864  PAWRTDGVLMTVAIHVGPVEFIYYWLHRAlhhhflysryhshhhsSIVTEPITSVIHPFG  1685
             P WR DG+++   +H GPVEFIYYW HRALHHHFLYSRYHSHHHSSIV+EPITSV+HPF 
Sbjct  117   PFWRLDGLVLVALLHAGPVEFIYYWFHRALHHHFLYSRYHSHHHSSIVSEPITSVVHPFA  176

Query  1684  EHIAYFLLFAIPVLTTLFTGTASNSSLLGYVTYIDLMNNMGHCNFEFIPKWLFSIFPPLK  1505
             EHIAY L+   P++TTL  GT S  S+  Y+TY+D MNN+GHCNFE IPK  FS+FPPLK
Sbjct  177   EHIAYTLILLTPLITTLVCGTISVVSIALYITYVDFMNNLGHCNFELIPKSFFSLFPPLK  236

Query  1504  YLMYTPSYHSLHHTQFRTNYSLFMPFYDYIYGTMDKSTDTLYETSLKRGEESPDVVHLTH  1325
             +L YTPS+HSLHHTQFRTNYSLFMP YDYIYGT DK +D+LYETSL + EE PD ++LTH
Sbjct  237   FLCYTPSFHSLHHTQFRTNYSLFMPMYDYIYGTNDKCSDSLYETSLGQDEEKPDAIYLTH  296

Query  1324  LTTPESVYSIRLGFSTWAAVPQSHNWYVWLMWPVT-LWTMIINCIYGQTFILDRNILEKI  1148
             LT+ +S+Y +RLGF++ ++ P S   Y++LM P T + + I++ +  ++F  +RN    +
Sbjct  297   LTSLDSIYHLRLGFASLSSHPLSSRCYLFLMRPFTIILSFILSFLSFRSFAFERNRFRDL  356

Query  1147  KLQSWVIPRYKVQYLLEWQSQAINSLieeaiieaEgkgvkvlslglLNQS------EELN  986
              L S ++P++   +  + Q ++IN +IE AI+EAE KGV+V+SLGLLNQ+      +ELN
Sbjct  357   TLHSHLVPKFSSHFKSQQQKESINKMIETAILEAEKKGVRVMSLGLLNQASFITMYKELN  416

Query  985   RNGEFYIQKYPKMKIKLVDGSSLAVAIIVANTIPKGTTEVLLRANLNKVSISIASALTQR  806
               GE Y++K+PK+KI++VDGSSLA  ++V ++IP GT EVL R  + KV+ +I ++L Q 
Sbjct  417   GYGEMYVRKHPKLKIRIVDGSSLAAQVVV-HSIPVGTREVLFRGQITKVARAIVTSLCQN  475

Query  805   GIKVVTSCEDDYEKLK--LATNSKGNFVLSRSFTQKVWLVGEGLTKEEQMKATKGTLFIP  632
             G+KV+   E+++  L   L+ + K N VL+ ++   +WLVG+ ++KEEQ +A KGT F+P
Sbjct  476   GVKVMVLREEEHCMLARFLSGHCKENLVLTTNYYPMIWLVGDRISKEEQKRAAKGTRFLP  535

Query  631   MSQIPPKKHRRDCSYHHPPAMLAPPSLHNLHACENWLPRRAMSAARVSGIVHALEGWNVH  452
              SQ PP + R+DC YH  PAM+ P +  N+ +CENWL RR MSA RV GIVHALEGW+ H
Sbjct  536   FSQFPPTQLRKDCFYHTTPAMIIPDTAENIDSCENWLGRRVMSAWRVGGIVHALEGWDEH  595

Query  451   ECGEK--MCDIDKVWEAALSHGFRPLPLPN  368
             ECG    M     VWEAAL +GF+PL LP+
Sbjct  596   ECGLDVPMVSPHGVWEAALRNGFQPLVLPS  625



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7324233958648