BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77783_g1_i1 len=1471 path=[1:0-1470]

Length=1471
                                                                      Score     E

ref|NP_001234486.1|  galactinol synthase 1                              361   8e-118   
ref|XP_006344792.1|  PREDICTED: galactinol synthase 1-like              359   3e-117   
ref|XP_009587954.1|  PREDICTED: galactinol synthase 1 isoform X1        358   1e-116   
gb|ADW78846.1|  galactinol synthase                                     357   3e-116   
ref|XP_009759072.1|  PREDICTED: galactinol synthase 1-like              356   7e-116   
gb|ADW78838.1|  galactinol synthase                                     356   9e-116   
ref|XP_002882112.1|  ATGOLS1                                            335   2e-107   
emb|CDY27505.1|  BnaC04g51460D                                          334   4e-107   
gb|KFK37461.1|  hypothetical protein AALP_AA4G260100                    333   1e-106   
ref|XP_006296514.1|  hypothetical protein CARUB_v10025703mg             332   2e-106   
gb|KDP23361.1|  hypothetical protein JCGZ_23194                         331   4e-106   
gb|ADW78848.1|  galactinol synthase                                     331   8e-106   
ref|XP_006349161.1|  PREDICTED: galactinol synthase 1-like              331   1e-105   
ref|XP_007221488.1|  hypothetical protein PRUPE_ppa007982mg             331   1e-105   
ref|NP_182240.1|  galactinol synthase 1                                 330   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227808.1|  PREDICTED: galactinol synthase 1                   330   2e-105   
emb|CDP15228.1|  unnamed protein product                                330   2e-105   
ref|XP_010518411.1|  PREDICTED: galactinol synthase 1                   330   2e-105   
gb|AIE11286.1|  galactinol synthase                                     329   3e-105   
ref|XP_002512546.1|  conserved hypothetical protein                     329   3e-105   Ricinus communis
ref|XP_009118881.1|  PREDICTED: galactinol synthase 1-like              329   4e-105   
ref|XP_006397910.1|  hypothetical protein EUTSA_v10001530mg             329   5e-105   
ref|XP_010507920.1|  PREDICTED: galactinol synthase 1                   329   5e-105   
ref|XP_003626005.1|  Galactinol synthase                                328   7e-105   
gb|KDP28299.1|  hypothetical protein JCGZ_14070                         328   8e-105   
ref|XP_009792096.1|  PREDICTED: galactinol synthase 2                   328   1e-104   
gb|AGC51778.1|  galactinol synthase                                     328   1e-104   
emb|CDY37792.1|  BnaC04g00330D                                          328   1e-104   
gb|ACJ15472.1|  galactinol synthase                                     328   2e-104   Brassica napus [oilseed rape]
ref|XP_002279114.2|  PREDICTED: galactinol synthase 1                   327   2e-104   Vitis vinifera
gb|AAD26116.1|AF106954_1  galactinol synthase                           327   2e-104   Brassica napus [oilseed rape]
ref|XP_002515233.1|  conserved hypothetical protein                     327   2e-104   Ricinus communis
emb|CAN79630.1|  hypothetical protein VITISV_039943                     327   2e-104   Vitis vinifera
emb|CDX80084.1|  BnaA05g00720D                                          327   3e-104   
ref|XP_006340652.1|  PREDICTED: galactinol synthase 2-like              326   4e-104   
ref|XP_009588228.1|  PREDICTED: galactinol synthase 2-like              326   4e-104   
gb|AIE11287.1|  galactinol synthase                                     325   8e-104   
emb|CDP15226.1|  unnamed protein product                                325   8e-104   
gb|AIE11285.1|  galactinol synthase                                     325   9e-104   
ref|XP_009383943.1|  PREDICTED: galactinol synthase 1-like              325   1e-103   
ref|XP_009142558.1|  PREDICTED: galactinol synthase 1                   325   2e-103   
gb|ABQ44212.1|  galactinol synthase                                     324   3e-103   Capsicum annuum
gb|AIE11288.1|  galactinol synthase                                     324   3e-103   
ref|XP_002512547.1|  conserved hypothetical protein                     324   3e-103   Ricinus communis
gb|AHM22934.1|  galactinol synthase 2                                   324   3e-103   
gb|KHN14150.1|  Glycogenin-2                                            324   3e-103   
ref|XP_003521604.1|  PREDICTED: galactinol synthase 1                   324   4e-103   
ref|NP_001234668.1|  galactinol synthase 2                              324   4e-103   
ref|XP_011040723.1|  PREDICTED: galactinol synthase 2-like              324   4e-103   
ref|XP_006302453.1|  hypothetical protein CARUB_v10020539mg             324   5e-103   
ref|XP_004229370.1|  PREDICTED: galactinol synthase 1                   324   5e-103   
ref|XP_010511303.1|  PREDICTED: galactinol synthase 2                   323   6e-103   
ref|XP_010506746.1|  PREDICTED: galactinol synthase 1-like              323   7e-103   
ref|XP_002320958.2|  putative galactinol synthase family protein        323   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010523902.1|  PREDICTED: galactinol synthase 1                   322   1e-102   
gb|ADW78840.1|  galactinol synthase                                     322   1e-102   
ref|XP_008343193.1|  PREDICTED: galactinol synthase 1-like              323   1e-102   
ref|XP_006444560.1|  hypothetical protein CICLE_v10021027mg             322   2e-102   
ref|NP_176053.1|  galactinol synthase 2                                 322   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008353871.1|  PREDICTED: galactinol synthase 1-like              322   2e-102   
ref|XP_010094413.1|  hypothetical protein L484_018780                   322   2e-102   
ref|XP_011079512.1|  PREDICTED: galactinol synthase 1                   322   2e-102   
ref|XP_009763726.1|  PREDICTED: galactinol synthase 1-like              322   3e-102   
ref|XP_002319472.1|  galactinol synthase family protein                 322   3e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010480275.1|  PREDICTED: galactinol synthase 2-like              322   3e-102   
emb|CDY69393.1|  BnaCnng63310D                                          321   4e-102   
ref|XP_007051210.1|  Galactinol synthase 1                              321   4e-102   
gb|ADW78849.1|  galactinol synthase                                     321   5e-102   
gb|KFK22550.1|  hypothetical protein AALP_AAs68488U001100               321   5e-102   
ref|XP_006472243.1|  PREDICTED: galactinol synthase 2-like              321   6e-102   
ref|XP_003554564.1|  PREDICTED: galactinol synthase 1-like              320   9e-102   
ref|XP_009113368.1|  PREDICTED: galactinol synthase 2                   320   1e-101   
ref|XP_010270867.1|  PREDICTED: galactinol synthase 2-like              320   1e-101   
ref|XP_009367176.1|  PREDICTED: galactinol synthase 1-like              320   1e-101   
gb|AEJ87260.1|  galactinol synthase 2-1                                 320   1e-101   
ref|XP_009599613.1|  PREDICTED: galactinol synthase 1-like              320   2e-101   
ref|XP_007222498.1|  hypothetical protein PRUPE_ppa008264mg             319   2e-101   
gb|KDP26601.1|  hypothetical protein JCGZ_17759                         319   3e-101   
gb|KHG03186.1|  Glycogenin-1                                            318   3e-101   
gb|ADW78842.1|  galactinol synthase                                     318   4e-101   
gb|ADM92589.1|  galactinol synthase                                     318   4e-101   
ref|XP_010415009.1|  PREDICTED: galactinol synthase 2-like              318   4e-101   
ref|XP_010069751.1|  PREDICTED: galactinol synthase 2-like              318   4e-101   
ref|XP_009619498.1|  PREDICTED: galactinol synthase 2                   318   5e-101   
gb|AFG26331.1|  galactinol synthase                                     318   7e-101   
ref|XP_002891985.1|  hypothetical protein ARALYDRAFT_474819             318   9e-101   
ref|XP_004984579.1|  PREDICTED: galactinol synthase 2-like              318   1e-100   
ref|XP_006433574.1|  hypothetical protein CICLE_v10001308mg             320   1e-100   
ref|XP_004494448.1|  PREDICTED: galactinol synthase 1-like              317   1e-100   
ref|XP_010910683.1|  PREDICTED: galactinol synthase 2-like              318   1e-100   
gb|KHG28122.1|  Glycogenin-1                                            317   2e-100   
gb|AGW51291.1|  putative galactinol synthase                            317   2e-100   
dbj|BAE99313.1|  hypothetical protein                                   317   2e-100   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74708.1|  hypothetical protein VITISV_018010                     317   2e-100   Vitis vinifera
ref|XP_011023828.1|  PREDICTED: galactinol synthase 2-like              317   2e-100   
ref|XP_010042161.1|  PREDICTED: galactinol synthase 2-like              317   2e-100   
ref|XP_008801762.1|  PREDICTED: galactinol synthase 2-like isofor...    317   2e-100   
gb|ACI62176.1|  galactinol synthase                                     317   2e-100   Dorcoceras hygrometricum
ref|XP_010042153.1|  PREDICTED: galactinol synthase 2-like              317   2e-100   
ref|XP_002279157.1|  PREDICTED: galactinol synthase 2                   317   3e-100   Vitis vinifera
ref|XP_006392406.1|  hypothetical protein EUTSA_v10024122mg             317   3e-100   
ref|NP_001049939.1|  Os03g0316200                                       317   3e-100   Oryza sativa Japonica Group [Japonica rice]
gb|ACA04032.1|  galactinol synthase 3                                   317   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_010475767.1|  PREDICTED: galactinol synthase 3-like              316   3e-100   
ref|XP_011023826.1|  PREDICTED: galactinol synthase 2-like              316   3e-100   
ref|XP_002319473.2|  galactinol synthase family protein                 316   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_010039524.1|  PREDICTED: galactinol synthase 2-like              316   3e-100   
ref|NP_176250.1|  galactinol synthase 4                                 316   3e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AEJ87261.1|  galactinol synthase 2-2                                 316   4e-100   
ref|XP_010039532.1|  PREDICTED: galactinol synthase 2-like              316   4e-100   
ref|XP_006382305.1|  galactinol synthase family protein                 316   4e-100   
ref|NP_172406.1|  galactinol synthase 3                                 316   4e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KDP27974.1|  hypothetical protein JCGZ_19054                         315   5e-100   
gb|AEN74906.1|  galactinol synthase II                                  316   5e-100   
ref|XP_010914664.1|  PREDICTED: galactinol synthase 1-like              316   6e-100   
ref|XP_008221834.1|  PREDICTED: galactinol synthase 1                   315   6e-100   
ref|XP_002314975.1|  galactinol synthase family protein                 315   6e-100   Populus trichocarpa [western balsam poplar]
ref|XP_002280616.1|  PREDICTED: galactinol synthase 2                   315   8e-100   Vitis vinifera
ref|XP_010938189.1|  PREDICTED: galactinol synthase 2-like isofor...    315   8e-100   
ref|XP_010489936.1|  PREDICTED: galactinol synthase 3                   315   8e-100   
ref|XP_002281304.1|  PREDICTED: galactinol synthase 2                   315   8e-100   Vitis vinifera
ref|XP_010674554.1|  PREDICTED: galactinol synthase 2-like              315   9e-100   
ref|XP_009118321.1|  PREDICTED: galactinol synthase 3                   316   9e-100   
ref|XP_010039533.1|  PREDICTED: galactinol synthase 2-like              315   1e-99    
ref|XP_004288353.1|  PREDICTED: galactinol synthase 2-like              315   1e-99    
ref|XP_006305301.1|  hypothetical protein CARUB_v10009676mg             315   1e-99    
ref|XP_010674553.1|  PREDICTED: galactinol synthase 2-like              314   1e-99    
ref|XP_002889744.1|  ATGOLS3                                            315   1e-99    
gb|EYU44029.1|  hypothetical protein MIMGU_mgv1a019439mg                315   1e-99    
ref|XP_002262651.1|  PREDICTED: galactinol synthase 2                   314   1e-99    Vitis vinifera
emb|CDY64774.1|  BnaC08g50010D                                          314   2e-99    
gb|EAY89768.1|  hypothetical protein OsI_11309                          315   2e-99    Oryza sativa Indica Group [Indian rice]
gb|KHN16038.1|  Glycogenin-1                                            314   2e-99    
gb|ADF43063.1|  galactinol synthase                                     314   2e-99    
ref|XP_010243067.1|  PREDICTED: galactinol synthase 1-like isofor...    314   2e-99    
ref|XP_008812591.1|  PREDICTED: galactinol synthase 1-like              314   2e-99    
ref|XP_010039534.1|  PREDICTED: galactinol synthase 2-like              314   3e-99    
ref|XP_002519283.1|  conserved hypothetical protein                     313   3e-99    Ricinus communis
ref|XP_006649987.1|  PREDICTED: galactinol synthase 2-like              314   3e-99    
sp|Q9XGN4.1|GOLS1_AJURE  RecName: Full=Galactinol synthase 1; Sho...    313   3e-99    Ajuga reptans
ref|XP_007031210.1|  Galactinol synthase 2                              314   3e-99    
gb|ABF66656.1|  galactinol synthase                                     313   4e-99    Ammopiptanthus mongolicus
ref|XP_010276500.1|  PREDICTED: galactinol synthase 2-like              313   4e-99    
ref|XP_011086583.1|  PREDICTED: galactinol synthase 1                   313   4e-99    
ref|XP_002265947.1|  PREDICTED: galactinol synthase 1                   313   4e-99    Vitis vinifera
ref|XP_009411607.1|  PREDICTED: galactinol synthase 1                   313   4e-99    
ref|XP_007145022.1|  hypothetical protein PHAVU_007G203400g             313   5e-99    
ref|XP_009804615.1|  PREDICTED: galactinol synthase 2-like              313   5e-99    
ref|NP_001238027.1|  galactinol synthase                                313   6e-99    
gb|AEQ54921.1|  galactinol synthase 3                                   313   7e-99    
ref|XP_004495634.1|  PREDICTED: galactinol synthase 2-like              312   8e-99    
ref|XP_010038308.1|  PREDICTED: galactinol synthase 2                   313   8e-99    
ref|XP_010544948.1|  PREDICTED: galactinol synthase 1-like isofor...    313   8e-99    
gb|AAM96870.1|  fagopyritol synthase 1                                  312   9e-99    Fagopyrum esculentum
ref|XP_002281369.1|  PREDICTED: galactinol synthase 2                   312   9e-99    Vitis vinifera
ref|XP_006302526.1|  hypothetical protein CARUB_v10020626mg             312   1e-98    
gb|EYU46845.1|  hypothetical protein MIMGU_mgv1a009552mg                312   1e-98    
ref|XP_010921393.1|  PREDICTED: galactinol synthase 2-like              313   1e-98    
ref|NP_001105748.1|  galactinol synthase 1                              312   1e-98    Zea mays [maize]
ref|XP_010510947.1|  PREDICTED: galactinol synthase 4                   312   1e-98    
emb|CAB51130.1|  putative galactinol synthase                           312   1e-98    Pisum sativum [garden pea]
ref|XP_006346965.1|  PREDICTED: galactinol synthase 2-like              311   2e-98    
ref|XP_011003180.1|  PREDICTED: galactinol synthase 1                   312   2e-98    
ref|XP_002467954.1|  hypothetical protein SORBIDRAFT_01g037090          312   2e-98    Sorghum bicolor [broomcorn]
ref|XP_002525364.1|  conserved hypothetical protein                     311   2e-98    Ricinus communis
ref|XP_007163208.1|  hypothetical protein PHAVU_001G215300g             311   2e-98    
ref|XP_003591231.1|  Galactinol synthase                                311   2e-98    
gb|ADM92588.1|  galactinol synthase                                     311   3e-98    
ref|XP_010039527.1|  PREDICTED: galactinol synthase 2-like              311   3e-98    
gb|ADW78844.1|  putative galactinol synthase                            311   3e-98    
emb|CAN66209.1|  hypothetical protein VITISV_035072                     311   3e-98    Vitis vinifera
ref|XP_010473225.1|  PREDICTED: galactinol synthase 4-like              311   4e-98    
ref|XP_010417980.1|  PREDICTED: galactinol synthase 4-like              311   4e-98    
gb|ADM92590.1|  galactinol synthase                                     311   4e-98    
gb|AHI44616.1|  galactinol synthase-2                                   310   4e-98    
ref|XP_010679458.1|  PREDICTED: galactinol synthase 1                   311   4e-98    
gb|KCW45877.1|  hypothetical protein EUGRSUZ_L00245                     311   5e-98    
ref|XP_003555792.1|  PREDICTED: galactinol synthase 2                   310   5e-98    
ref|XP_011087511.1|  PREDICTED: galactinol synthase 2-like              311   5e-98    
ref|XP_010039530.1|  PREDICTED: galactinol synthase 2-like              310   6e-98    
ref|XP_010458217.1|  PREDICTED: galactinol synthase 3-like isofor...    310   7e-98    
ref|XP_009789360.1|  PREDICTED: galactinol synthase 1-like              310   8e-98    
gb|KFK43233.1|  hypothetical protein AALP_AA1G097300                    310   8e-98    
gb|ACM50915.1|  galactinol synthase                                     310   8e-98    Medicago falcata [sickle alfalfa]
ref|XP_009416551.1|  PREDICTED: galactinol synthase 1-like              310   9e-98    
ref|XP_010251224.1|  PREDICTED: galactinol synthase 1-like              310   9e-98    
gb|ACA04033.1|  galactinol synthase 4                                   310   1e-97    Populus trichocarpa x Populus deltoides
ref|XP_007205502.1|  hypothetical protein PRUPE_ppa008294mg             310   1e-97    
ref|XP_002301531.2|  putative galactinol synthase family protein        310   1e-97    Populus trichocarpa [western balsam poplar]
gb|ABK27907.1|  galactinol synthase                                     310   1e-97    Xerophyta viscosa
ref|XP_004139524.1|  PREDICTED: galactinol synthase 2-like              309   1e-97    
ref|XP_010924270.1|  PREDICTED: galactinol synthase 1                   310   1e-97    
emb|CDO98726.1|  unnamed protein product                                310   1e-97    
ref|XP_010925832.1|  PREDICTED: galactinol synthase 1-like              310   1e-97    
emb|CCD74513.1|  galactinol synthase 4                                  310   1e-97    
gb|AHA36621.1|  galactinol synthase 1                                   310   1e-97    
gb|AGQ44777.1|  galactinol synthase                                     310   1e-97    
gb|AIJ00873.1|  GolS7                                                   309   2e-97    
ref|XP_008801761.1|  PREDICTED: galactinol synthase 2-like isofor...    310   2e-97    
ref|XP_006483875.1|  PREDICTED: galactinol synthase 1-like              309   2e-97    
gb|ACF88041.1|  unknown                                                 310   2e-97    Zea mays [maize]
ref|XP_010092949.1|  hypothetical protein L484_018886                   309   2e-97    
emb|CDY06355.1|  BnaA09g48480D                                          309   2e-97    
ref|XP_010045367.1|  PREDICTED: galactinol synthase 2-like              309   2e-97    
ref|XP_010098783.1|  hypothetical protein L484_026164                   309   2e-97    
ref|XP_007044673.1|  Galactinol synthase 4                              309   2e-97    
ref|XP_002886616.1|  ATGOLS4                                            309   2e-97    
ref|XP_010039591.1|  PREDICTED: galactinol synthase 2-like              309   2e-97    
ref|XP_011071091.1|  PREDICTED: galactinol synthase 1-like              309   2e-97    
gb|AAM97493.1|  galactinol synthase                                     308   2e-97    Medicago sativa [alfalfa]
ref|XP_006417581.1|  hypothetical protein EUTSA_v10008154mg             308   3e-97    
ref|XP_006841604.1|  hypothetical protein AMTR_s00003p00211130          308   3e-97    
ref|XP_002281261.1|  PREDICTED: galactinol synthase 2                   308   3e-97    Vitis vinifera
gb|AEQ54920.1|  galactinol synthase 2                                   308   3e-97    
ref|XP_008800725.1|  PREDICTED: galactinol synthase 1-like              308   4e-97    
gb|EYU22497.1|  hypothetical protein MIMGU_mgv1a009966mg                308   4e-97    
ref|XP_011011015.1|  PREDICTED: LOW QUALITY PROTEIN: galactinol s...    308   4e-97    
gb|ACG39512.1|  galactinol synthase 3                                   309   4e-97    Zea mays [maize]
ref|XP_010100446.1|  hypothetical protein L484_027758                   308   4e-97    
ref|XP_008246233.1|  PREDICTED: galactinol synthase 2                   308   5e-97    
ref|XP_004233531.1|  PREDICTED: galactinol synthase 2-like              308   5e-97    
gb|KCW50133.1|  hypothetical protein EUGRSUZ_K03563                     308   5e-97    
ref|XP_003554611.1|  PREDICTED: galactinol synthase 2-like isoform 1    308   6e-97    
ref|XP_008801763.1|  PREDICTED: galactinol synthase 2-like isofor...    308   6e-97    
ref|XP_007035901.1|  Galactinol synthase 1                              309   7e-97    
gb|KEH24464.1|  galactinol synthase                                     307   7e-97    
gb|EPS65482.1|  hypothetical protein M569_09295                         306   1e-96    
ref|NP_001105750.1|  LOC606405                                          307   1e-96    Zea mays [maize]
gb|AGT50336.1|  galactinol synthase 8                                   307   1e-96    
gb|KDO72072.1|  hypothetical protein CISIN_1g037698mg                   306   1e-96    
ref|XP_010039526.1|  PREDICTED: galactinol synthase 2-like              307   1e-96    
ref|XP_002312306.1|  galactinol synthase family protein                 306   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011019276.1|  PREDICTED: galactinol synthase 2-like              306   2e-96    
gb|AGT50333.1|  galactinol synthase 5                                   306   2e-96    
ref|XP_009113209.1|  PREDICTED: galactinol synthase 4                   306   2e-96    
ref|XP_006438367.1|  hypothetical protein CICLE_v10032043mg             306   2e-96    
gb|AAM96868.1|  fagopyritol synthase 2                                  307   2e-96    Fagopyrum esculentum
ref|XP_006392163.1|  hypothetical protein EUTSA_v10023585mg             306   2e-96    
ref|XP_007163306.1|  hypothetical protein PHAVU_001G223700g             306   3e-96    
ref|XP_007201909.1|  hypothetical protein PRUPE_ppa015580mg             305   3e-96    
ref|XP_004302294.1|  PREDICTED: galactinol synthase 2-like              306   4e-96    
ref|XP_011039081.1|  PREDICTED: uncharacterized protein LOC105135748    316   5e-96    
ref|XP_004302295.1|  PREDICTED: galactinol synthase 2-like isoform 1    305   5e-96    
ref|XP_006488980.1|  PREDICTED: galactinol synthase 2-like              305   6e-96    
gb|ACA04028.1|  galactinol synthase 1                                   305   8e-96    Populus trichocarpa x Populus deltoides
ref|XP_008781185.1|  PREDICTED: galactinol synthase 2-like              305   9e-96    
emb|CDY47222.1|  BnaC09g14710D                                          305   1e-95    
gb|AAU43781.1|  galactinol synthase                                     304   1e-95    
ref|XP_006840727.1|  hypothetical protein AMTR_s00096p00114120          305   2e-95    
ref|XP_010544149.1|  PREDICTED: galactinol synthase 2-like              304   2e-95    
gb|EYU28447.1|  hypothetical protein MIMGU_mgv1a009861mg                303   2e-95    
gb|EPS69759.1|  galactinol synthase                                     302   2e-95    
gb|AHI44615.1|  galactinol synthase-1                                   303   3e-95    
ref|XP_011087512.1|  PREDICTED: galactinol synthase 2-like              302   3e-95    
ref|XP_002311774.1|  galactinol synthase family protein                 303   3e-95    Populus trichocarpa [western balsam poplar]
ref|XP_003521658.1|  PREDICTED: galactinol synthase 2                   303   3e-95    
gb|ABQ12641.1|  galactinol synthase 2                                   303   3e-95    Verbascum phoeniceum [purple mullein]
ref|NP_001060697.1|  Os07g0687900                                       303   3e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010039525.1|  PREDICTED: galactinol synthase 2-like              303   4e-95    
gb|ADW78851.1|  putative galactinol synthase                            303   4e-95    
ref|XP_010039528.1|  PREDICTED: galactinol synthase 2-like              303   4e-95    
ref|XP_011012947.1|  PREDICTED: galactinol synthase 1-like              302   7e-95    
gb|EAZ05203.1|  hypothetical protein OsI_27402                          302   7e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_010549306.1|  PREDICTED: galactinol synthase 2-like              302   8e-95    
ref|XP_008463593.1|  PREDICTED: galactinol synthase 2-like              301   1e-94    
ref|XP_008370361.1|  PREDICTED: LOW QUALITY PROTEIN: galactinol s...    302   1e-94    
gb|ACA04029.1|  galactinol synthase 1                                   302   1e-94    Populus trichocarpa x Populus deltoides
ref|XP_006419298.1|  hypothetical protein CICLE_v10006683mg             301   1e-94    
ref|XP_010024152.1|  PREDICTED: galactinol synthase 2                   302   1e-94    
ref|XP_010023545.1|  PREDICTED: galactinol synthase 1-like              301   2e-94    
ref|XP_004295038.1|  PREDICTED: galactinol synthase 2-like              301   2e-94    
ref|XP_004494525.1|  PREDICTED: galactinol synthase 2-like              301   3e-94    
ref|XP_010098779.1|  hypothetical protein L484_026160                   300   3e-94    
ref|XP_009337626.1|  PREDICTED: galactinol synthase 2-like              301   3e-94    
ref|XP_002314613.2|  galactinol synthase family protein                 301   3e-94    Populus trichocarpa [western balsam poplar]
ref|XP_003558046.1|  PREDICTED: galactinol synthase 1                   301   3e-94    
ref|XP_004150838.1|  PREDICTED: galactinol synthase 1-like              301   3e-94    
gb|KGN58545.1|  hypothetical protein Csa_3G680120                       301   3e-94    
ref|XP_009406297.1|  PREDICTED: galactinol synthase 1-like              300   3e-94    
ref|XP_011071647.1|  PREDICTED: galactinol synthase 2-like              299   3e-94    
ref|XP_006658162.1|  PREDICTED: galactinol synthase 2-like              300   3e-94    
ref|XP_004297477.1|  PREDICTED: galactinol synthase 1-like              301   4e-94    
gb|KHN02817.1|  Glycogenin-1                                            298   5e-94    
gb|ACA04031.1|  galactinol synthase 2                                   300   6e-94    
gb|ABQ12640.1|  galactinol synthase 1                                   300   6e-94    
gb|AEJ87262.1|  galactinol synthase 2-3                                 300   7e-94    
gb|AAL78686.1|  galactinol synthase                                     300   7e-94    
ref|XP_007035902.1|  Galactinol synthase 1 isoform 1                    299   8e-94    
ref|XP_011034124.1|  PREDICTED: galactinol synthase 1-like              300   8e-94    
ref|XP_008447007.1|  PREDICTED: galactinol synthase 1-like              300   8e-94    
ref|XP_008235088.1|  PREDICTED: galactinol synthase 1-like              298   1e-93    
ref|XP_010548787.1|  PREDICTED: galactinol synthase 10-like             299   1e-93    
ref|XP_011092179.1|  PREDICTED: galactinol synthase 2-like              302   1e-93    
ref|XP_010448303.1|  PREDICTED: galactinol synthase 6-like              299   2e-93    
gb|KFK40787.1|  hypothetical protein AALP_AA2G041000                    299   2e-93    
dbj|BAF99254.1|  galactinol synthase                                    299   2e-93    
ref|XP_008223433.1|  PREDICTED: galactinol synthase 2                   298   2e-93    
ref|XP_004135252.1|  PREDICTED: galactinol synthase 1-like              298   2e-93    
gb|KHN43351.1|  Glycogenin-1                                            296   2e-93    
ref|XP_010544947.1|  PREDICTED: galactinol synthase 1-like isofor...    300   2e-93    
gb|EYU38403.1|  hypothetical protein MIMGU_mgv1a009667mg                298   2e-93    
ref|XP_006301870.1|  hypothetical protein CARUB_v10022341mg             298   2e-93    
ref|XP_008447460.1|  PREDICTED: galactinol synthase 2                   298   3e-93    
ref|XP_008458318.1|  PREDICTED: galactinol synthase 2                   298   3e-93    
gb|ABK23436.1|  unknown                                                 298   3e-93    
ref|XP_009372074.1|  PREDICTED: galactinol synthase 2                   298   3e-93    
gb|EPS61420.1|  galactinol synthase                                     296   4e-93    
ref|XP_004292649.1|  PREDICTED: galactinol synthase 2-like              300   4e-93    
gb|AGW51290.1|  putative galactinol synthase                            298   5e-93    
emb|CCD74516.1|  galactinol synthase                                    298   5e-93    
ref|XP_004167568.1|  PREDICTED: galactinol synthase 1-like              298   5e-93    
gb|EMS59147.1|  Glycogenin-2                                            299   5e-93    
gb|ABR17981.1|  unknown                                                 298   6e-93    
gb|AAL78687.1|  galactinol synthase                                     297   7e-93    
ref|XP_008389661.1|  PREDICTED: galactinol synthase 1-like              297   8e-93    
gb|EMT01352.1|  Glycogenin-2                                            296   8e-93    
ref|NP_001267603.1|  uncharacterized protein LOC101208382               297   8e-93    
ref|XP_009117119.1|  PREDICTED: galactinol synthase 5-like              297   9e-93    
gb|KGN45608.1|  hypothetical protein Csa_6G000080                       296   1e-92    
ref|XP_007222631.1|  hypothetical protein PRUPE_ppa008521mg             296   1e-92    
emb|CDY34764.1|  BnaA09g41310D                                          296   1e-92    
gb|KFK40788.1|  hypothetical protein AALP_AA2G041100                    295   2e-92    
ref|XP_004958744.1|  PREDICTED: galactinol synthase 2-like              296   2e-92    
gb|AEN74905.1|  galactinol synthase I                                   296   2e-92    
ref|XP_002886618.1|  predicted protein                                  296   2e-92    
ref|NP_176248.1|  galactinol synthase 7                                 296   2e-92    
gb|ABK22810.1|  unknown                                                 296   2e-92    
gb|ABK22947.1|  unknown                                                 296   3e-92    
ref|XP_010659719.1|  PREDICTED: galactinol synthase 2-like              295   3e-92    
gb|KFK37002.1|  hypothetical protein AALP_AA4G199700                    295   3e-92    
gb|ACT34765.1|  galactinol synthase                                     295   4e-92    
gb|EMS60105.1|  Glycogenin-2                                            296   4e-92    
ref|XP_006395044.1|  hypothetical protein EUTSA_v10004562mg             294   1e-91    
gb|KDO72070.1|  hypothetical protein CISIN_1g020230mg                   293   2e-91    
ref|XP_006419299.1|  hypothetical protein CICLE_v10005406mg             293   2e-91    
gb|KCW59841.1|  hypothetical protein EUGRSUZ_H02584                     292   2e-91    
ref|XP_006285132.1|  hypothetical protein CARUB_v10006472mg             293   3e-91    
emb|CDX76806.1|  BnaC08g33920D                                          293   3e-91    
ref|XP_010558459.1|  PREDICTED: galactinol synthase 5-like              293   3e-91    
gb|EMT30758.1|  Glycogenin-2                                            293   3e-91    
sp|Q9XGN3.1|GOLS2_AJURE  RecName: Full=Galactinol synthase 2; Sho...    291   5e-91    
ref|XP_006285293.1|  hypothetical protein CARUB_v10006670mg             292   6e-91    
gb|EPS71626.1|  hypothetical protein M569_03131                         291   7e-91    
gb|EMT06435.1|  Glycogenin-2                                            292   7e-91    
ref|XP_006392165.1|  hypothetical protein EUTSA_v10023858mg             290   8e-91    
emb|CDY34112.1|  BnaC01g28520D                                          291   1e-90    
dbj|BAF51565.1|  galactinol synthase                                    291   2e-90    
ref|XP_010437185.1|  PREDICTED: galactinol synthase 6-like              291   2e-90    
ref|XP_010446623.1|  PREDICTED: galactinol synthase 5 isoform X1        291   2e-90    
ref|XP_010098782.1|  hypothetical protein L484_026163                   290   2e-90    
gb|KFK37605.1|  hypothetical protein AALP_AA3G004900                    290   3e-90    
ref|XP_008351137.1|  PREDICTED: galactinol synthase 2-like              290   3e-90    
ref|XP_009113210.1|  PREDICTED: galactinol synthase 4-like              289   4e-90    
dbj|BAF51566.1|  galactinol synthase                                    290   4e-90    
ref|XP_010534030.1|  PREDICTED: galactinol synthase 4-like              289   6e-90    
ref|XP_003559767.1|  PREDICTED: galactinol synthase 2-like              290   6e-90    
ref|XP_009103773.1|  PREDICTED: galactinol synthase 7-like              289   9e-90    
ref|XP_006415165.1|  hypothetical protein EUTSA_v10009767mg             289   1e-89    
ref|XP_002869619.1|  ATGOLS6                                            289   1e-89    
emb|CBI36994.3|  unnamed protein product                                284   5e-89    
ref|NP_001105749.1|  galactinol synthase2                               288   5e-89    
ref|NP_567741.2|  galactinol synthase 6                                 287   5e-89    
gb|EMS53636.1|  Glycogenin-2                                            286   8e-89    
ref|XP_010547837.1|  PREDICTED: LOW QUALITY PROTEIN: galactinol s...    286   1e-88    
emb|CDY47223.1|  BnaC09g14720D                                          285   1e-88    
ref|XP_010098781.1|  hypothetical protein L484_026162                   289   1e-88    
ref|NP_197768.1|  galactinol synthase 5                                 286   1e-88    
gb|EMT01112.1|  Glycogenin-2                                            285   2e-88    
emb|CDY14312.1|  BnaA08g14430D                                          286   2e-88    
ref|XP_002461242.1|  hypothetical protein SORBIDRAFT_02g043450          286   2e-88    
emb|CBI36995.3|  unnamed protein product                                282   3e-88    
gb|KFK35290.1|  hypothetical protein AALP_AA5G265600                    285   5e-88    
ref|XP_009109184.1|  PREDICTED: galactinol synthase 5-like              285   7e-88    
ref|XP_007035904.1|  Galactinol synthase 1 isoform 3                    284   1e-87    
emb|CDY59178.1|  BnaC08g50120D                                          284   1e-87    
emb|CDY50006.1|  BnaC08g12130D                                          283   2e-87    
gb|AAC24075.1|  Strong similarity to water stress-induced protein...    283   2e-87    
ref|XP_003591230.1|  Galactinol synthase                                282   2e-87    
ref|XP_002874149.1|  predicted protein                                  281   1e-86    
ref|XP_009118639.1|  PREDICTED: galactinol synthase 6-like isofor...    281   1e-86    
ref|XP_009118641.1|  PREDICTED: galactinol synthase 6-like isofor...    280   2e-86    
emb|CDY53194.1|  BnaAnng12190D                                          280   3e-86    
gb|KHN43432.1|  Glycogenin-2                                            276   5e-86    
ref|XP_010436218.1|  PREDICTED: galactinol synthase 5-like              275   5e-84    
emb|CBI22838.3|  unnamed protein product                                271   6e-84    
emb|CBI25967.3|  unnamed protein product                                270   1e-83    
emb|CBI39629.3|  unnamed protein product                                270   1e-83    
ref|XP_008340049.1|  PREDICTED: galactinol synthase 1-like              271   3e-83    
ref|XP_008654184.1|  PREDICTED: galactinol synthase 2-like              271   3e-83    
emb|CAB38954.1|  putative protein                                       273   4e-83    
gb|AFR79417.1|  eukaryotic galactinol synthase                          270   5e-83    
gb|KHN03918.1|  Hypothetical protein glysoja_022604                     272   5e-83    
emb|CBI28547.3|  unnamed protein product                                268   9e-83    
gb|EAZ26716.1|  hypothetical protein OsJ_10624                          268   8e-82    
emb|CBI39632.3|  unnamed protein product                                263   4e-81    
ref|NP_850902.1|  galactinol synthase 10                                266   4e-81    
gb|EMT27747.1|  Glycogenin-2                                            265   6e-81    
emb|CDP13174.1|  unnamed protein product                                263   8e-81    
gb|EAZ41152.1|  hypothetical protein OsJ_25649                          261   5e-80    
gb|KCW44662.1|  hypothetical protein EUGRSUZ_L01804                     263   5e-80    
gb|EYU38404.1|  hypothetical protein MIMGU_mgv1a009667mg                263   6e-80    
gb|KCW59842.1|  hypothetical protein EUGRSUZ_H02584                     260   9e-80    
gb|AAM96869.1|  fagopyritol synthase 3                                  260   1e-79    
emb|CAN66320.1|  hypothetical protein VITISV_040624                     262   1e-79    
ref|XP_010446624.1|  PREDICTED: galactinol synthase 6 isoform X2        262   2e-79    
gb|KFK40785.1|  hypothetical protein AALP_AA2G040600                    262   2e-79    
gb|KCW59843.1|  hypothetical protein EUGRSUZ_H02584                     257   1e-78    
emb|CBI39631.3|  unnamed protein product                                257   2e-78    
emb|CAN74047.1|  hypothetical protein VITISV_012617                     253   4e-77    
gb|AAL06547.1|AF412094_1  At1g56600/F25P12_16                           252   7e-77    
gb|KDO81602.1|  hypothetical protein CISIN_1g024367mg                   253   1e-76    
gb|KEH24438.1|  galactinol synthase                                     253   2e-76    
ref|XP_010041075.1|  PREDICTED: galactinol synthase 2-like              253   5e-76    
gb|EYU44028.1|  hypothetical protein MIMGU_mgv1a024625mg                248   2e-75    
ref|XP_009118640.1|  PREDICTED: galactinol synthase 6-like isofor...    251   2e-75    
gb|AGL76446.1|  galactinol synthase 4                                   246   9e-75    
ref|XP_002965247.1|  hypothetical protein SELMODRAFT_83323              248   2e-74    
ref|XP_002986570.1|  hypothetical protein SELMODRAFT_124303             248   2e-74    
gb|KEH32643.1|  galactinol synthase                                     248   3e-74    
gb|KEH43121.1|  galactinol synthase                                     245   9e-74    
tpg|DAA64190.1|  TPA: hypothetical protein ZEAMMB73_253369              246   2e-73    
gb|EYU44025.1|  hypothetical protein MIMGU_mgv1a0115662mg               239   1e-72    
ref|XP_009338935.1|  PREDICTED: galactinol synthase 2-like              244   7e-72    
ref|XP_009587955.1|  PREDICTED: galactinol synthase 1 isoform X2        240   1e-71    
ref|XP_004302296.1|  PREDICTED: galactinol synthase 2-like isoform 2    240   1e-71    
ref|XP_009369638.1|  PREDICTED: galactinol synthase 2-like              243   2e-71    
ref|XP_008780456.1|  PREDICTED: galactinol synthase 2-like              239   2e-71    
ref|XP_002987384.1|  hypothetical protein SELMODRAFT_235277             238   3e-70    
ref|XP_008348687.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    250   5e-70    
ref|XP_010674611.1|  PREDICTED: putative pentatricopeptide repeat...    248   3e-69    
ref|XP_004167846.1|  PREDICTED: galactinol synthase 1-like              233   3e-69    
ref|XP_002979905.1|  hypothetical protein SELMODRAFT_112084             234   5e-69    
ref|XP_008385041.1|  PREDICTED: galactinol synthase 2-like              234   2e-68    
ref|XP_007035903.1|  Galactinol synthase 2 isoform 2                    229   3e-68    
gb|KDO72071.1|  hypothetical protein CISIN_1g020230mg                   229   1e-67    
gb|KCW58189.1|  hypothetical protein EUGRSUZ_H00902                     230   3e-67    
gb|AFD50393.1|  galactinol synthase                                     224   1e-66    
gb|EYU44023.1|  hypothetical protein MIMGU_mgv1a024099mg                223   5e-66    
gb|AFD50395.1|  galactinol synthase                                     222   7e-66    
gb|AFD50394.1|  galactinol synthase                                     222   8e-66    
ref|XP_010938190.1|  PREDICTED: galactinol synthase 1-like isofor...    224   2e-65    
ref|XP_010243068.1|  PREDICTED: galactinol synthase 1-like isofor...    224   3e-65    
ref|XP_010098778.1|  hypothetical protein L484_026159                   227   4e-65    
ref|XP_006413216.1|  hypothetical protein EUTSA_v10027432mg             220   1e-63    
gb|AFD50389.1|  galactinol synthase                                     215   2e-63    
gb|KEH43120.1|  galactinol synthase                                     216   7e-63    
gb|AFD50392.1|  galactinol synthase                                     214   7e-63    
emb|CBI39628.3|  unnamed protein product                                214   7e-63    
gb|AFD50391.1|  galactinol synthase                                     211   9e-62    
dbj|BAK04875.1|  predicted protein                                      213   2e-61    
ref|XP_010026049.1|  PREDICTED: galactinol synthase 2-like              214   5e-61    
gb|AFD50390.1|  galactinol synthase                                     209   6e-61    
ref|XP_008360240.1|  PREDICTED: galactinol synthase 2-like              206   3e-59    
ref|XP_010042539.1|  PREDICTED: galactinol synthase 2-like              202   3e-58    
gb|AFD50396.1|  galactinol synthase                                     198   6e-57    
gb|AAO20083.1|  galactinol synthase 3                                   190   7e-54    
gb|EMT12381.1|  hypothetical protein F775_25473                         193   2e-53    
gb|AAN52770.1|  galactinol synthase 1                                   187   7e-53    
gb|AAN52771.1|  galactinol synthase 2                                   186   2e-52    
gb|EYU19410.1|  hypothetical protein MIMGU_mgv1a0100842mg               187   5e-52    
gb|ABK55686.1|  galactinol synthase                                     184   2e-51    
gb|ABK93450.1|  unknown                                                 182   4e-51    
gb|EYU19409.1|  hypothetical protein MIMGU_mgv1a0100842mg               181   3e-50    
gb|AEX11333.1|  hypothetical protein 0_13271_01                         179   4e-50    
gb|AEX11332.1|  hypothetical protein 0_13271_01                         178   8e-50    
gb|AEX11324.1|  hypothetical protein 0_13271_01                         177   2e-49    
gb|KEH43122.1|  galactinol synthase                                     179   5e-49    
emb|CBI39635.3|  unnamed protein product                                172   1e-47    
gb|AFK41072.1|  unknown                                                 171   3e-47    
ref|XP_010041076.1|  PREDICTED: galactinol synthase 2-like              172   3e-46    
gb|ACN39995.1|  unknown                                                 163   5e-44    
gb|AFG58348.1|  hypothetical protein 2_9509_01                          162   1e-43    
gb|EMS59148.1|  hypothetical protein TRIUR3_24943                       162   2e-43    
gb|AFG58347.1|  hypothetical protein 2_9509_01                          160   2e-43    
gb|AFG58346.1|  hypothetical protein 2_9509_01                          160   5e-43    
gb|AAT45006.1|  galactinol synthase                                     160   1e-42    
dbj|BAK02820.1|  predicted protein                                      157   1e-41    
ref|XP_010445115.1|  PREDICTED: galactinol synthase 5-like              154   8e-41    
emb|CAF21715.1|  galactinol synthase 2                                  145   5e-38    
gb|AGT17184.1|  hypothetical protein SHCRBa_069_M12_F_180               142   1e-36    
gb|ACR36593.1|  unknown                                                 147   6e-36    
gb|AAD55726.1|  galactinol synthase                                     142   1e-35    
emb|CBI39634.3|  unnamed protein product                                133   6e-33    
ref|XP_007208507.1|  hypothetical protein PRUPE_ppa026497mg             130   1e-32    
gb|ACU23116.1|  unknown                                                 132   1e-32    
gb|KCW44664.1|  hypothetical protein EUGRSUZ_L01806                     128   3e-31    
gb|AEX12105.1|  hypothetical protein 0_3894_01                          126   1e-30    
gb|ACU18470.1|  unknown                                                 126   4e-30    
gb|EYU19411.1|  hypothetical protein MIMGU_mgv1a0100841mg               120   4e-29    
gb|KHG07102.1|  Glycogenin-1                                            117   1e-27    
gb|KHG13499.1|  Glycogenin-1                                            116   3e-27    
ref|WP_031591299.1|  glycosyl transferase                               119   5e-27    
ref|WP_033767728.1|  glycosyl transferase                               118   1e-26    
ref|XP_008349660.1|  PREDICTED: galactinol synthase 1-like              114   1e-26    
ref|WP_022624984.1|  glycosyl transferase                               117   2e-26    
ref|WP_010247974.1|  MULTISPECIES: glycosyl transferase                 117   3e-26    
ref|WP_033778851.1|  glycosyl transferase                               117   3e-26    
ref|WP_033758327.1|  glycosyl transferase                               117   4e-26    
ref|WP_033772164.1|  glycosyl transferase                               115   1e-25    
gb|AGT17186.1|  hypothetical protein SHCRBa_069_M12_R_220               113   1e-25    



>ref|NP_001234486.1| galactinol synthase 1 [Solanum lycopersicum]
 sp|Q947G8.1|GOLS1_SOLLC RecName: Full=Galactinol synthase 1; Short=GolS-1; Short=SlGolS1 
[Solanum lycopersicum]
 gb|AAL26804.1|AF311943_1 putative galactinol synthase 1 [Solanum lycopersicum]
 gb|AAO72744.1|AF447452_1 galactinol synthase [Solanum lycopersicum]
Length=318

 Score =   361 bits (926),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 202/330 (61%), Positives = 240/330 (73%), Gaps = 12/330 (4%)
 Frame = +3

Query  63    MAPDASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdv  242
             MAP+  +G  +         AYVTFLAGNGDYVKGVVGL KGL K  S YP+VVA+ PDV
Sbjct  1     MAPEFESGTKMATTIQKSSCAYVTFLAGNGDYVKGVVGLAKGLIKAKSMYPLVVAILPDV  60

Query  243   paEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSD  422
             P EHR +L   GCIV+E+EPL PS +    +AR YYVLNYSKL+ W+F EYSKM+YLD D
Sbjct  61    PEEHRMILTRHGCIVKEIEPLAPSLQSLDKYARSYYVLNYSKLRIWEFVEYSKMVYLDGD  120

Query  423   MQVFENLDHLFDLADGYFYAVPDCVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQ  602
             MQVFEN+DHLF+L D Y YAV DC+C+ +GEPC E+LPWP  L G RPS+YFN GMF+FQ
Sbjct  121   MQVFENIDHLFELPDKYLYAVADCICDMYGEPCDEVLPWPKEL-GPRPSVYFNAGMFVFQ  179

Query  603   PNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSK  782
             PN S Y RLLN  K+TPPT FAEQDFLNM+F+D YKP+PY YNML+ MLWRHP+K+E++K
Sbjct  180   PNPSVYVRLLNTLKVTPPTQFAEQDFLNMYFKDVYKPIPYTYNMLLAMLWRHPEKIEVNK  239

Query  783   AKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGG  962
             AK VHYC  GAKPW+YTGKE +M RE++KMLVKKWW+IYND +LD+K          L G
Sbjct  240   AKAVHYCSPGAKPWKYTGKEEHMDREDIKMLVKKWWDIYNDTTLDHKAQGSTVEANRLRG  299

Query  963   AAHEVETAVPRFSNTGNLTEPRYIKGPPAA  1052
             AA         FS+T       YI  P AA
Sbjct  300   AA---------FSDTN--ISALYITSPSAA  318



>ref|XP_006344792.1| PREDICTED: galactinol synthase 1-like [Solanum tuberosum]
Length=321

 Score =   359 bits (922),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 234/307 (76%), Gaps = 12/307 (4%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGL K  S YP+VVA+ PDVP EHR +L   GCIV+E+EPL P
Sbjct  27    TFLAGNGDYVKGVVGLAKGLIKAKSMYPLVVAILPDVPEEHRMILTRHGCIVKEIEPLAP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             S +    +AR YYVLNYSKL+ WQF EYSKM+YLD DMQVFEN+DHLF+L D Y YAV D
Sbjct  87    SLQSSDKYARSYYVLNYSKLRIWQFVEYSKMVYLDGDMQVFENIDHLFELPDKYLYAVAD  146

Query  492   CVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAE  671
             C+C+ +GEPC E+LPWP  + G RPS+YFN GMF+FQPN+S Y RLLN  K+TPPT FAE
Sbjct  147   CICDMYGEPCAEVLPWPKEM-GPRPSVYFNAGMFVFQPNLSIYVRLLNTLKVTPPTQFAE  205

Query  672   QDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNM  851
             QDFLNM+F+DEYKP+PY YN+L+ MLWRHP+K+E++KAK VHYC  GAKPW+YTGKE +M
Sbjct  206   QDFLNMYFKDEYKPIPYTYNLLLAMLWRHPEKIEVNKAKAVHYCSPGAKPWKYTGKEEHM  265

Query  852   GREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRFSNTGNLTEPRY  1031
              RE++KMLV KWW+IYND +LD   +K + S  E    A+ ++ A    SN   L    Y
Sbjct  266   DREDIKMLVTKWWDIYNDTTLD---HKAQGSTVE----ANRLKEAAFSDSNISAL----Y  314

Query  1032  IKGPPAA  1052
             I  P AA
Sbjct  315   ITSPSAA  321



>ref|XP_009587954.1| PREDICTED: galactinol synthase 1 isoform X1 [Nicotiana tomentosiformis]
Length=321

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/308 (63%), Positives = 233/308 (76%), Gaps = 6/308 (2%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG GDYVKGVVGL KGL K  S YP+VVA+ PDVP EHR LL + GCIVRE+EPL P
Sbjct  19    TFLAGKGDYVKGVVGLAKGLIKAKSLYPLVVAILPDVPEEHRLLLRSHGCIVREIEPLSP  78

Query  312   S-DEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVP  488
             S    +  +AR YYVLNYSKL+ WQF E+SKM+YLD DMQVFEN+DHLF+L D +FYAV 
Sbjct  79    SLQSSDNKYARSYYVLNYSKLRIWQFVEFSKMVYLDGDMQVFENIDHLFNLPDNHFYAVA  138

Query  489   DCVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFA  668
             DC+CE +G+ C E+LPWP  L G+RP +YFN GMF+FQPN+S Y  LLN  K+TPPT FA
Sbjct  139   DCICEMYGQSCPEVLPWPKDL-GSRPPIYFNAGMFVFQPNLSIYADLLNTLKVTPPTQFA  197

Query  669   EQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENN  848
             EQDFLNMFF+D+YKP+ YVYN+L+ MLWRHP+K+ELSKAK VHYC  GAKPW+YTGKE N
Sbjct  198   EQDFLNMFFKDKYKPISYVYNLLLAMLWRHPEKIELSKAKAVHYCSPGAKPWKYTGKEEN  257

Query  849   MGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRFSNTGNLTEPR  1028
             M RE++KMLVKKWW+IYNDQ+LD+K      +  E    A+ V  A    +N   L    
Sbjct  258   MDREDIKMLVKKWWDIYNDQTLDHKQSSIHIAGVEGEVEANRVMAAAFSDANISTL----  313

Query  1029  YIKGPPAA  1052
             Y+  P AA
Sbjct  314   YVTSPSAA  321



>gb|ADW78846.1| galactinol synthase [Solanum tuberosum]
 gb|ADW78847.1| galactinol synthase [Solanum tuberosum]
Length=318

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 198/330 (60%), Positives = 243/330 (74%), Gaps = 12/330 (4%)
 Frame = +3

Query  63    MAPDASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdv  242
             MAP+  +G     +     RAYVTFLAGNGDYVKGVVGL KGL K  S Y +VVA+ PDV
Sbjct  1     MAPELESGTKKAQKDIELGRAYVTFLAGNGDYVKGVVGLAKGLIKAKSMYSLVVAILPDV  60

Query  243   paEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSD  422
             P EHR +L+  GCIV+E+EPL PS +    +AR YYVLNYSKL+ WQF EYSKM+YLD D
Sbjct  61    PEEHRMILMRHGCIVKEIEPLAPSLQSSDKYARSYYVLNYSKLRIWQFVEYSKMVYLDGD  120

Query  423   MQVFENLDHLFDLADGYFYAVPDCVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQ  602
             MQVF+N+DHLF+L D Y YAV DC+C+ +GEPC E+LPWP  + G RPS+YFN GMF+FQ
Sbjct  121   MQVFDNIDHLFELPDKYLYAVADCICDMYGEPCAEVLPWPKEM-GPRPSVYFNAGMFVFQ  179

Query  603   PNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSK  782
             PN+S Y RLLN  K+TPPT FAEQDFLNM+F+D+YKP+PY YN+L+ MLWRHP+K+E++K
Sbjct  180   PNLSIYVRLLNTLKVTPPTQFAEQDFLNMYFKDKYKPIPYTYNLLLAMLWRHPEKIEVNK  239

Query  783   AKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGG  962
             AK VHYC  GAKPW+YTGKE  M R+++KMLV KWW+IYND +LD   +K + S  E   
Sbjct  240   AKAVHYCSPGAKPWKYTGKEEQMDRQDIKMLVTKWWDIYNDTTLD---HKAQGSTVE---  293

Query  963   AAHEVETAVPRFSNTGNLTEPRYIKGPPAA  1052
              A+ +  A    SN   L    YI  P AA
Sbjct  294   -ANRLREAAFSDSNISAL----YITSPSAA  318



>ref|XP_009759072.1| PREDICTED: galactinol synthase 1-like [Nicotiana sylvestris]
Length=320

 Score =   356 bits (913),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 234/311 (75%), Gaps = 12/311 (4%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGL K  S YP+VVA+ PDVP EHR LL + GCIVRE+EPL P
Sbjct  18    TFLAGNGDYVKGVVGLAKGLIKAKSMYPLVVAILPDVPEEHRLLLRSHGCIVREIEPLSP  77

Query  312   S-DEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVP  488
             S    +  +AR YYVLNYSKL  WQF E+SKM+YLD DMQVFEN+DHLF+L D +FYAV 
Sbjct  78    SLKSSDNKYARSYYVLNYSKLCIWQFVEFSKMVYLDGDMQVFENVDHLFNLPDNHFYAVA  137

Query  489   DCVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFA  668
             DC+CE +G+ C E+LPWP  L G+RP +YFN GMF+FQPN+S Y  LLN  KLTPPT FA
Sbjct  138   DCICEMYGQSCPEVLPWPKEL-GSRPPIYFNAGMFVFQPNLSIYADLLNTLKLTPPTQFA  196

Query  669   EQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENN  848
             EQDFLNMFF+D+YKP+ YVYN+L+ MLWRHP+K+EL+KAK VHYC  GAKPW+YTGKE N
Sbjct  197   EQDFLNMFFKDKYKPISYVYNLLLAMLWRHPEKIELNKAKAVHYCSPGAKPWKYTGKEEN  256

Query  849   MGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVET---AVPRFSNTGNLT  1019
             M RE++KMLVKKWW+IYNDQ+LD+K          + G   EVE+       FS+    T
Sbjct  257   MDREDIKMLVKKWWDIYNDQTLDHK-----QGCIHIAGVEGEVESNRLMAAAFSDANIST  311

Query  1020  EPRYIKGPPAA  1052
                Y+  P AA
Sbjct  312   --LYVTSPSAA  320



>gb|ADW78838.1| galactinol synthase [Solanum commersonii]
 gb|ADW78839.1| galactinol synthase [Solanum commersonii]
Length=322

 Score =   356 bits (913),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 191/307 (62%), Positives = 233/307 (76%), Gaps = 12/307 (4%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGL K  S YP++VA+ PDVP EHR +L   GCIV+E+EPL P
Sbjct  28    TFLAGNGDYVKGVVGLAKGLIKAKSMYPLLVAILPDVPEEHRMILTRHGCIVKEIEPLAP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             S +    +AR YYVLNYSKL+ WQF EYSKM+YLD DMQVF+N+DHLF+L D Y YAV D
Sbjct  88    SLQSSDKYARSYYVLNYSKLRIWQFVEYSKMVYLDGDMQVFDNIDHLFELPDKYLYAVAD  147

Query  492   CVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAE  671
             C+C+ +GEPC E+LPWP  + G RPS+YFN GMF+FQPN+S Y RLLN  K+TPPT FAE
Sbjct  148   CICDMYGEPCAEVLPWPKEM-GPRPSVYFNAGMFVFQPNLSIYVRLLNTLKVTPPTQFAE  206

Query  672   QDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNM  851
             QDFLNM+F+D+YKP+PY YN+L+ MLWRHP+K+E++KAK VHYC  GAKPW+YTGKE  M
Sbjct  207   QDFLNMYFKDKYKPIPYTYNLLLAMLWRHPEKIEVNKAKAVHYCSPGAKPWQYTGKEEQM  266

Query  852   GREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRFSNTGNLTEPRY  1031
              RE++KMLV KWW+IYND +LD+K   Q ++V      A+ +  A    SN   L    Y
Sbjct  267   DREDIKMLVTKWWDIYNDTTLDHK--AQGSTV-----KANRLREAAFSDSNISAL----Y  315

Query  1032  IKGPPAA  1052
             I  P AA
Sbjct  316   ITSPSAA  322



>ref|XP_002882112.1| ATGOLS1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58371.1| ATGOLS1 [Arabidopsis lyrata subsp. lyrata]
Length=344

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/318 (60%), Positives = 231/318 (73%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  34    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRILMEQGCIVREIEPVYP  93

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  94    P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  152

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C++ + WP A LG  P++YFN GMF+F+PN+ TY  LL  
Sbjct  153   CFCEKTWSHTPQYKIGYCQQCRDKVQWPKAELGEPPALYFNAGMFLFEPNLETYEDLLRT  212

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  213   LKITPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELGKVKVVHYCAAGSK  272

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK       V  +G  A  V    P  
Sbjct  273   PWRYTGKEANMDREDIKMLVKKWWDIYNDESLDYK-----KPVAVVGTEADPVNLK-PFI  326

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +         Y+  P AA
Sbjct  327   TALTEAGRVNYVTAPSAA  344



>emb|CDY27505.1| BnaC04g51460D [Brassica napus]
Length=342

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 193/318 (61%), Positives = 230/318 (72%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  32    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRILVEQGCIVREIEPVYP  91

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DGYFYAV D
Sbjct  92    P-ETQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFENIDHLFDLPDGYFYAVMD  150

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG  P++YFN GMF+F+P + TY  LL  
Sbjct  151   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKAELGEPPALYFNAGMFVFEPGLDTYEDLLRT  210

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211   LKITPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  270

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND SLDYK      SV +L   + +V    P  
Sbjct  271   PWRYTGKEANMEREDIKMLVNKWWDIYNDDSLDYK-----KSVGDLVEES-DVVNLKPLI  324

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S        +Y+  P AA
Sbjct  325   SALTEAGPVKYVTAPSAA  342



>gb|KFK37461.1| hypothetical protein AALP_AA4G260100 [Arabis alpina]
Length=342

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 231/318 (73%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  32    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHRRILVEQGCIVREIEPVYP  91

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  92    P-ENQTEFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  150

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP + LG  P++YFN GMF+++PN+ TY  LL  
Sbjct  151   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKSELGEPPALYFNAGMFLYEPNLDTYEDLLKT  210

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211   LKVIPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  270

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IYND SLD   YK+   V        +++  +   
Sbjct  271   PWRYTGKEENMQREDIKMLVKKWWDIYNDDSLD---YKKSVDVVNTETELVKLKPFIVAL  327

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +  G +   +Y+  P AA
Sbjct  328   TEAGQV---KYVTAPSAA  342



>ref|XP_006296514.1| hypothetical protein CARUB_v10025703mg [Capsella rubella]
 gb|EOA29412.1| hypothetical protein CARUB_v10025703mg [Capsella rubella]
Length=344

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 230/318 (72%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S+YP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  34    TFLAGNGDYVKGVVGLAKGLRKVKSSYPLVVAILPDVPEEHRRILVEQGCIVREIEPVYP  93

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  94    PDN-QTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  152

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG  P++YFN GMF+F+PN+ TY  LL  
Sbjct  153   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKAELGEPPALYFNAGMFLFEPNLETYEDLLKT  212

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  213   LQITPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  272

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IY D SLD   YK+   V E       ++  +   
Sbjct  273   PWRYTGKEANMDREDIKMLVNKWWDIYKDDSLD---YKKPLGVAETEADLVNLKPFITAL  329

Query  999   SNTGNLTEPRYIKGPPAA  1052
             ++ G +    Y+  P AA
Sbjct  330   TDVGRV---NYVTAPSAA  344



>gb|KDP23361.1| hypothetical protein JCGZ_23194 [Jatropha curcas]
 gb|AIC83905.1| galactinol synthase [Jatropha curcas]
Length=335

 Score =   331 bits (849),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 250/345 (72%), Gaps = 25/345 (7%)
 Frame = +3

Query  63    MAPD----ASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvav  230
             MAPD    AS    +V +A+    AYVTFLAGNGDY+KGVVGL KGLRKV S YP+VVA+
Sbjct  1     MAPDPTTAASTNSRLVKQASISSCAYVTFLAGNGDYIKGVVGLAKGLRKVKSKYPLVVAI  60

Query  231   wpdvpaEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIY  410
              PDVP +HR++LV+QGCIV+E+EP+YP  E +  FA  YYV+NYSKL+ W+F EYSKMIY
Sbjct  61    LPDVPEDHRKILVSQGCIVKEIEPVYPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIY  119

Query  411   LDSDMQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLG  557
             LD D+QVFEN+DHLFDL DGYFYAV DC CE+           + + C + + WP A LG
Sbjct  120   LDGDIQVFENIDHLFDLQDGYFYAVMDCYCEKTWSHSVQHKIGYCQQCPDRVKWP-AELG  178

Query  558   ARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNML  737
               P +YFN GMF+++P++STY  LL   K+TPPT FAEQDFLNMFF+D YKP+P +YN++
Sbjct  179   PAPPLYFNAGMFVYEPSLSTYDDLLKTLKVTPPTPFAEQDFLNMFFKDIYKPIPPIYNLV  238

Query  738   VNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLD  917
             + ++WRHP+ +E++KAKVVHYC  G+KPWRYTGKE NM RE++KMLV+KWW+IYND+SLD
Sbjct  239   LALIWRHPENIEVNKAKVVHYCAAGSKPWRYTGKEENMDREDIKMLVQKWWDIYNDESLD  298

Query  918   YKYYKQRASVYELGGAAHEVETAVPRFSNTGNLTEPRYIKGPPAA  1052
             Y     R +V   GG    ++  +   S  G +    Y+  P AA
Sbjct  299   Y-----RNTVAAAGGDEGGMQPFLAALSEAGVV---HYVNAPSAA  335



>gb|ADW78848.1| galactinol synthase [Solanum tuberosum]
Length=347

 Score =   331 bits (849),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 187/321 (58%), Positives = 237/321 (74%), Gaps = 18/321 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGV+GL KGLRKV S YP+VVAV PDVPAEHRR+L  QGCIVRE+EP+YP
Sbjct  31    TFLAGNGDYVKGVIGLAKGLRKVKSEYPLVVAVLPDVPAEHRRMLEEQGCIVREIEPVYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QV++N+DHLFDLADGYFYAV D
Sbjct  91    P-ENQTQFAMDYYVINYSKLRIWEFVEYKKMIYLDGDIQVYDNIDHLFDLADGYFYAVMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP+  LG  PS+YFN GMF+F+P++ TY  LL  
Sbjct  150   CFCEKTWSHTPQYKIGYCQQCPDKVKWPSEELGQPPSLYFNAGMFVFEPSLHTYQDLLKK  209

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F++ Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  210   LQITPPTPFAEQDFLNMYFKNIYRPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  269

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELG--GAAHEVETAV-  989
             PWRYTGKE NM RE++K+LVKKWW+IYND+SLDYK       V  +G  GA ++++  + 
Sbjct  270   PWRYTGKEENMEREDIKLLVKKWWDIYNDESLDYKRSVGMNQVNVIGAAGAVNQLQPLIA  329

Query  990   PRFSNTGNLTEPRYIKGPPAA  1052
                S  G +   +Y+  P AA
Sbjct  330   AAMSQAGAV---KYVTAPSAA  347



>ref|XP_006349161.1| PREDICTED: galactinol synthase 1-like [Solanum tuberosum]
Length=347

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 237/321 (74%), Gaps = 18/321 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGV+GL KGLRKV S YP+VVAV PDVPAEHRR+L  QGC+VRE+EP+YP
Sbjct  31    TFLAGNGDYVKGVIGLAKGLRKVKSEYPLVVAVLPDVPAEHRRMLEEQGCVVREIEPVYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QV++N+DHLFDLADGYFYAV D
Sbjct  91    P-ENQTQFAMAYYVINYSKLRMWEFVEYKKMIYLDGDIQVYDNIDHLFDLADGYFYAVMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP+  LG  PS+YFN GMF+F+P++ TY  LL  
Sbjct  150   CFCEKTWSHTPQYKIGYCQQCPDRIKWPSDELGQPPSLYFNAGMFVFEPSLRTYQDLLKK  209

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F++ Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  210   LQITPPTPFAEQDFLNMYFKNIYRPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  269

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELG--GAAHEVETAV-  989
             PWRYTGKE NM RE++K+LVKKWW+IYND+SLDYK       V  +G  GA ++++  + 
Sbjct  270   PWRYTGKEENMEREDIKLLVKKWWDIYNDESLDYKRSVGMNQVNVIGAAGAVNQLQPLIA  329

Query  990   PRFSNTGNLTEPRYIKGPPAA  1052
                S  G +   +Y+  P AA
Sbjct  330   AAMSQAGAV---KYVTAPSAA  347



>ref|XP_007221488.1| hypothetical protein PRUPE_ppa007982mg [Prunus persica]
 gb|EMJ22687.1| hypothetical protein PRUPE_ppa007982mg [Prunus persica]
Length=349

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 192/325 (59%), Positives = 233/325 (72%), Gaps = 21/325 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRR+L +QGCIVRE+EP+ P
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPQEHRRILESQGCIVREIEPVCP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DG+FYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGHFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP + LG  PS+YFN GMF+F+P++ TY  LLN 
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPEKVQWPASELGPPPSLYFNAGMFVFEPDLETYHDLLNT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD+LNMFFR  YKP+P  YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207   LKVTPPTPFAEQDYLNMFFRKIYKPIPLAYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK-------YYKQRASVYELGGAAHEV  977
             PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK           RA+V  +GGA  E 
Sbjct  267   PWRYTGKEENMEREDIKMLVKKWWDIYNDKSLDYKKPSAPGARAGTRAAV--VGGAEGEG  324

Query  978   ETAVPRFSNTGNLTEPRYIKGPPAA  1052
                 P           +Y+  P AA
Sbjct  325   VNMQPFIEALSEAGVVQYVTAPSAA  349



>ref|NP_182240.1| galactinol synthase 1 [Arabidopsis thaliana]
 sp|O22893.1|GOLS1_ARATH RecName: Full=Galactinol synthase 1; Short=AtGolS1; Short=GolS-1 
[Arabidopsis thaliana]
 gb|AAB63818.1| putative galactinol synthase [Arabidopsis thaliana]
 gb|AAL07218.1| putative galactinol synthase [Arabidopsis thaliana]
 dbj|BAB78530.1| galactinol synthase [Arabidopsis thaliana]
 gb|AAM15468.1| putative galactinol synthase [Arabidopsis thaliana]
 gb|AAM14365.1| putative galactinol synthase [Arabidopsis thaliana]
 gb|AAM61564.1| putative galactinol synthase [Arabidopsis thaliana]
 gb|AEC10811.1| galactinol synthase 1 [Arabidopsis thaliana]
 gb|AHL38791.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=344

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 232/318 (73%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  34    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHRRILVDQGCIVREIEPVYP  93

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGY YAV D
Sbjct  94    P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYLYAVMD  152

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A LG  P++YFN GMF+++PN+ TY  LL  
Sbjct  153   CFCEKTWSHTPQYKIRYCQQCPDKVQWPKAELGEPPALYFNAGMFLYEPNLETYEDLLRT  212

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  213   LKITPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELGKVKVVHYCAAGSK  272

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IY+D+SLD   YK+  +V +       ++  +   
Sbjct  273   PWRYTGKEANMEREDIKMLVKKWWDIYDDESLD---YKKPVTVVDTEVDLVNLKPFITAL  329

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +  G L    Y+  P AA
Sbjct  330   TEAGRLN---YVTAPSAA  344



>ref|XP_008227808.1| PREDICTED: galactinol synthase 1 [Prunus mume]
Length=345

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 192/321 (60%), Positives = 232/321 (72%), Gaps = 17/321 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRR+L +QGCIV E+EP+ P
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPQEHRRILESQGCIVGEIEPVCP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DG+FYAV D
Sbjct  88    P-ENQTRFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGHFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WPT+ LG  PS+YFN GMF+F+P++ TY  LLN 
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPEKVQWPTSELGPPPSLYFNAGMFVFEPDLETYHDLLNT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD+LNMFFR  YKP+P  YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207   LKVTPPTPFAEQDYLNMFFRKIYKPIPLAYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYK---QRASVYELGGAAHEVETAV  989
             PWRYTGKE NM RE++KMLVKKWW+IYND SLDYK       RA+V  +GGA  E     
Sbjct  267   PWRYTGKEENMEREDIKMLVKKWWDIYNDTSLDYKKPSAPGARAAV--VGGAEGEGVNMQ  324

Query  990   PRFSNTGNLTEPRYIKGPPAA  1052
             P           +Y+  P AA
Sbjct  325   PFIEALSEAGVVQYVTAPSAA  345



>emb|CDP15228.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 234/318 (74%), Gaps = 20/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRRILVNQGCIVREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  87    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVKD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP  L G +P +YFN GMF+++P++ TY  LL  
Sbjct  146   CFCEKTWSHTPQYKIGYCQQCPDKVQWPEEL-GPKPPLYFNAGMFVYEPSLPTYDDLLRT  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFFRD Y+P+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  205   LEITPPSPFAEQDFLNMFFRDVYRPIPPIYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW+IY+D++LDYK    R+    +G AA    T +   
Sbjct  265   PWRYTGQEQNMHREDIKMLVKKWWDIYDDETLDYK----RSLTSSIGTAA---ATGIEAE  317

Query  999   SNTGNLTEPRYIKGPPAA  1052
             + T      RYI  P AA
Sbjct  318   AQTLKPRPARYIAAPSAA  335



>ref|XP_010518411.1| PREDICTED: galactinol synthase 1 [Camelina sativa]
Length=343

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 228/318 (72%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAY +VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  33    TFLAGNGDYVKGVVGLAKGLRKVKSAYSLVVAILPDVPEEHRRILVEQGCIVREIEPVYP  92

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F +YSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  93    P-ENQTQFAMAYYVINYSKLRIWKFVDYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  151

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG  P +YFN GMF+F+P + TY  LL  
Sbjct  152   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKAELGEPPDLYFNAGMFLFEPKLETYENLLET  211

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  212   LKITPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  271

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND SL+   YK+  +V +       ++  +   
Sbjct  272   PWRYTGKEANMNREDIKMLVNKWWDIYNDDSLN---YKKPVAVVDTEADLVNLKPFITAL  328

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +  G +    Y+  P AA
Sbjct  329   TEAGRVN---YVTAPSAA  343



>gb|AIE11286.1| galactinol synthase [Manihot esculenta]
Length=335

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 233/318 (73%), Gaps = 21/318 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S YP+VVA+ PDVP EHR++LV+QGCIV+E+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKVRSKYPLVVAILPDVPDEHRKILVSQGCIVKEIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFY V D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLQDGYFYGVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G +P +YFN GMF+F+P++STY  LL  
Sbjct  147   CFCEQTWSFSPQYKIGYCQQCPDRVQWP-AEMGPKPPLYFNAGMFVFEPSLSTYDDLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT FAEQDFLNMFF+D Y+PLP +YN+++ MLWRHP+ +EL K KVVHYC  G+K
Sbjct  206   VKVTTPTLFAEQDFLNMFFKDIYRPLPPIYNLVLAMLWRHPENIELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++K+LVKKWW+IYND+SLDYK      +V   GG   +++  +   
Sbjct  266   PWRYTGKEENMDREDIKILVKKWWDIYNDESLDYK-----NTVVAAGGTEADLQPFLAAL  320

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G      Y+  P AA
Sbjct  321   SEAG---VAHYLTAPSAA  335



>ref|XP_002512546.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49998.1| conserved hypothetical protein [Ricinus communis]
Length=338

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 237/319 (74%), Gaps = 22/319 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGL KGLRKV S YP+VVA+ PDVP +HR++LV+QGCIV+E+EP+YP
Sbjct  30    TFLAGDGDYVKGVVGLAKGLRKVKSKYPLVVAILPDVPEDHRKILVSQGCIVKEIEPVYP  89

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL +GYFYAV D
Sbjct  90    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLQNGYFYAVMD  148

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G +P +YFN GMF+F+P++STY  LLN 
Sbjct  149   CFCEKTWSHSPQYKIGYCQQCPDRVKWP-AEMGPKPPLYFNAGMFVFEPSLSTYDDLLNT  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              KLTPPT FAEQDFLNMFF+D Y+P+P +YN+++ +LWRHP+ +E  K KVVHYC  G+K
Sbjct  208   VKLTPPTPFAEQDFLNMFFKDIYRPIPPIYNLVLALLWRHPENIEFEKVKVVHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAH-EVETAVPR  995
             PWRYTGKE+NM RE++KMLVKKWW+IY D+SLDYK      +V   GGA   E++  +  
Sbjct  268   PWRYTGKEDNMDREDIKMLVKKWWDIYEDESLDYK-----NTVAATGGATEGELQPFLAA  322

Query  996   FSNTGNLTEPRYIKGPPAA  1052
              S  G +    Y+  P AA
Sbjct  323   LSEAGVV---HYVTAPSAA  338



>ref|XP_009118881.1| PREDICTED: galactinol synthase 1-like [Brassica rapa]
 gb|ADG03603.1| galactinol synthase [Brassica napus]
Length=342

 Score =   329 bits (843),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 192/318 (60%), Positives = 228/318 (72%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  32    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRVLVEQGCIVREIEPVYP  91

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  92    P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  150

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP   LG  PS+YFN GMF+F+P + TY  LL  
Sbjct  151   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKEELGEPPSLYFNAGMFVFEPGLDTYEDLLRT  210

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211   LKITPPTPFAEQDFLNMYFEKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  270

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND SLDYK      SV +L   + +V    P  
Sbjct  271   PWRYTGKEANMEREDIKMLVNKWWDIYNDDSLDYK-----KSVGDLVEES-DVVNLKPFI  324

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S        +Y+  P AA
Sbjct  325   SALTEAGPVKYVTAPSAA  342



>ref|XP_006397910.1| hypothetical protein EUTSA_v10001530mg [Eutrema salsugineum]
 gb|ESQ39363.1| hypothetical protein EUTSA_v10001530mg [Eutrema salsugineum]
Length=343

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 230/318 (72%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SA+P+VVAV PDVP EHRRLLV QGCIVRE+EP+YP
Sbjct  33    TFLAGNGDYVKGVVGLAKGLRKVKSAHPLVVAVLPDVPEEHRRLLVEQGCIVREIEPVYP  92

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSK+IYLD D+QV++N+DHLFDL DGYFYAV D
Sbjct  93    P-ENQTQFAMAYYVINYSKLRIWKFVEYSKLIYLDGDIQVYDNIDHLFDLDDGYFYAVMD  151

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG  P++YFN GMF+F+P+++TY  LL  
Sbjct  152   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKAELGEPPALYFNAGMFVFEPDLNTYEDLLRT  211

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  212   LKITPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  271

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND SLDY       SV +L   +  V    P  
Sbjct  272   PWRYTGKETNMEREDIKMLVNKWWDIYNDDSLDYT-----KSVADLERDSDMVNLK-PFI  325

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +        +Y+  P AA
Sbjct  326   TALTEAGRVKYVTAPSAA  343



>ref|XP_010507920.1| PREDICTED: galactinol synthase 1 [Camelina sativa]
Length=341

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 215/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  33   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRILVEQGCIVREIEPVYP  92

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  93   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  151

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A  G  P++YFN GMF+F+P + TY  LL  
Sbjct  152  CFCEKTWSHTPQYKIGYCQQCPEKVQWPKAEFGEPPALYFNAGMFLFEPKLETYEDLLKT  211

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL+K KVVHYC  G+K
Sbjct  212  LKITPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELAKVKVVHYCAAGSK  271

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWW+IYND SL+YK
Sbjct  272  PWRYTGKEANMDREDIKMLVNKWWDIYNDDSLNYK  306



>ref|XP_003626005.1| Galactinol synthase [Medicago truncatula]
 gb|AES82223.1| galactinol synthase [Medicago truncatula]
Length=339

 Score =   328 bits (842),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 231/318 (73%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGV+GL KGLRKV +AYP+VVAV PDVP EHR +L AQGCIVRE+EP+ P
Sbjct  29    TFLAGNGDYVKGVIGLAKGLRKVMTAYPLVVAVLPDVPEEHREMLEAQGCIVREIEPVNP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DG+FYAV D
Sbjct  89    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYENIDHLFDLPDGHFYAVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE            + + C E + WP  + G  PS+YFN GMF+F+P+I TY  LL  
Sbjct  148   CFCERTWSHTPQYKIGYCQQCPEKVHWPKEM-GQPPSLYFNAGMFLFEPSIDTYHDLLKT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+D YKP+P+VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207   LKVTPPTPFAEQDFLNMYFKDIYKPIPFVYNLVLAMLWRHPENVELHKVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE+++MLVKKWW+IYND SLDY   K  +   E+     E+E  V   
Sbjct  267   PWRYTGKEENMQREDIRMLVKKWWDIYNDSSLDYN--KNLSGSGEVQTNGFEIEPFVQAL  324

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +   +Y+  P AA
Sbjct  325   SEVGRV---QYVTAPSAA  339



>gb|KDP28299.1| hypothetical protein JCGZ_14070 [Jatropha curcas]
Length=336

 Score =   328 bits (841),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 232/318 (73%), Gaps = 20/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDY+KGVVGL KGLRKV +AYP+VVA+ PDVP EHRR+L +QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYIKGVVGLAKGLRKVKTAYPLVVAILPDVPEEHRRILESQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DGYFYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A LG  P++YFN GMF+F+P+ISTY  LL  
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPDRVKWP-AELGQPPALYFNAGMFVFEPSISTYHDLLRT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT+FAEQDFLNM+F+D YKPLP VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LKVTTPTSFAEQDFLNMYFKDIYKPLPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK       V    G A  V    P  
Sbjct  266   PWRYTGKEENMQREDIKMLVKKWWDIYNDESLDYK------KVPAADGDAEPVNLQ-PFI  318

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +        +Y+  P AA
Sbjct  319   AALSEAGAVQYVTAPSAA  336



>ref|XP_009792096.1| PREDICTED: galactinol synthase 2 [Nicotiana sylvestris]
 gb|AIE16185.1| galactinol synthase 2 [Nicotiana tabacum]
Length=333

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 185/309 (60%), Positives = 228/309 (74%), Gaps = 17/309 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  SAYP+VVA+ PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKAKSAYPLVVAILPDVPEEHRRILINQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFY V D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYGVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + W T  LG +P +YFN GMF+F+P++STY  LL  
Sbjct  147   CFCEKTWSHTPQYKVGYCQQCPDEVQW-TEDLGPKPPLYFNAGMFVFEPSLSTYDDLLTT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD LNMFFRD YKP+P  YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LKVTPPTPFAEQDLLNMFFRDVYKPIPNNYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW+IYND+SLDYK     A+V  +   A + + A+ + 
Sbjct  266   PWRYTGEEENMDREDIKMLVKKWWDIYNDESLDYK----NANVTAVDAEADKFKAALTKA  321

Query  999   SNTGNLTEP  1025
                  +T P
Sbjct  322   GVVHYITAP  330



>gb|AGC51778.1| galactinol synthase [Manihot esculenta]
Length=335

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 220/275 (80%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY+KGVVGL KGLRKV +AYP+VVAV PDVP EHRR+L +QGC+VRE+EP+YP
Sbjct  28   TFLAGNGDYIKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRRILESQGCLVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DGY YAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLPDGYLYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  PS+YFN GMF+F+P++STY  LL  
Sbjct  147  CFCEKTWSHTAQYKIGYCQQCPDRVKWP-AEMGQPPSLYFNAGMFVFEPSVSTYHDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  206  VKITPPTSFAEQDFLNMYFKDIYKPIPLVYNLVLAMLWRHPENVELDEVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  266  PWRYTGKEENMQREDIKMLVKKWWDIYNDESLDYK  300



>emb|CDY37792.1| BnaC04g00330D [Brassica napus]
Length=338

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 182/286 (64%), Positives = 217/286 (76%), Gaps = 12/286 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  32   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRILVEQGCIVREIEPVYP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  92   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  150

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C E + WP A LG  P++YFN GMF+F+P + TY  LL  
Sbjct  151  CFCERTWSHTPQYKIGYCQQCPEKVQWPKAELGEPPALYFNAGMFVFEPGLDTYEDLLRT  210

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211  LKVTPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  270

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYEL  956
            PWRYTGKE NM RE++KMLV KWW+IY D SLDYK  +  + +  L
Sbjct  271  PWRYTGKEANMEREDIKMLVNKWWDIYKDDSLDYKKSEAESDLVNL  316



>gb|ACJ15472.1| galactinol synthase [Brassica napus]
 emb|CDY51416.1| BnaA04g26930D [Brassica napus]
Length=342

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 226/318 (71%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  32    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRVLVEQGCIVREIEPVYP  91

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKM+YLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  92    P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMLYLDGDIQVYENIDHLFDLPDGYFYAVMD  150

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP   LG  PS+YFN GMF+F+P + TY  LL  
Sbjct  151   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKEELGEPPSLYFNAGMFVFEPGLDTYEDLLRT  210

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211   LKITPPTPFAEQDFLNMYFEKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  270

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND SLDYK  K    + E      +V    P  
Sbjct  271   PWRYTGKEANMEREDIKMLVNKWWDIYNDDSLDYK--KSVGDLVE----ESDVVNLKPFI  324

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S        +Y+  P AA
Sbjct  325   SALTEAGPVKYVTAPSAA  342



>ref|XP_002279114.2| PREDICTED: galactinol synthase 1 [Vitis vinifera]
Length=342

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 235/320 (73%), Gaps = 18/320 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
              FLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHRR L +QGCIVRE+EP+YP
Sbjct  28    AFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPVEHRRELESQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLF+L DG+FYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFELPDGHFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG  PS+YFN GMF+F+P++STY  LL  
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPEKVQWP-AELGQPPSLYFNAGMFVFEPSLSTYEDLLET  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TP T FAEQDFLNM+F D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LRITPATPFAEQDFLNMYFSDVYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYE--LGGAAHEVETAVP  992
             PWRYTGKE+NM RE++KMLV KWWEIYND+SLDYK  +  A+ Y   L G    +E  + 
Sbjct  266   PWRYTGKEDNMQREDIKMLVNKWWEIYNDKSLDYKKTRMMANDYSSVLPGEQVNLEPFIA  325

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               S  G++    +++ P AA
Sbjct  326   ALSEVGHV---EFVRAPSAA  342



>gb|AAD26116.1|AF106954_1 galactinol synthase [Brassica napus]
Length=341

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 226/318 (71%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  31    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRVLVEQGCIVREIEPVYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKM+YLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  91    P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMLYLDGDIQVYENIDHLFDLPDGYFYAVMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP   LG  PS+YFN GMF+F+P + TY  LL  
Sbjct  150   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKEELGEPPSLYFNAGMFVFEPGLDTYEDLLRT  209

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  210   LKITPPTPFAEQDFLNMYFEKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  269

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND SLDYK  K    + E      +V    P  
Sbjct  270   PWRYTGKEANMEREDIKMLVNKWWDIYNDDSLDYK--KSVGDLVE----ESDVVNLKPFI  323

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S        +Y+  P AA
Sbjct  324   SALTEAGPVKYVTAPSAA  341



>ref|XP_002515233.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47217.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 224/282 (79%), Gaps = 15/282 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY+KGVVGL KGLRKV +AYP+VVAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  28   TFLAGNGDYIKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRKILESQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DG+FYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGHFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A LG  PS+YFN GMF+F+P+ISTY  LL  
Sbjct  147  CFCEKTWSHTPQYKIGYCQQCPDRVKWP-AKLGQPPSLYFNAGMFVFEPSISTYHDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNM+FRD YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  VQITPPTPFAEQDFLNMYFRDIYKPIPVVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRAS  944
            PWRYTGKE NM RE++KM+VKKWW++YND+SLDYK  KQ A+
Sbjct  266  PWRYTGKEENMEREDIKMVVKKWWDVYNDESLDYK--KQPAA  305



>emb|CAN79630.1| hypothetical protein VITISV_039943 [Vitis vinifera]
Length=342

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 235/320 (73%), Gaps = 18/320 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
              FLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHRR L +QGCIVRE+EP+YP
Sbjct  28    AFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPVEHRRELESQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLF+L DG+FYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFELPDGHFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG  PS+YFN GMF+F+P++STY  LL  
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPEKVQWP-AELGQPPSLYFNAGMFVFEPSLSTYEDLLET  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TP T FAEQDFLNM+F D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LRITPATPFAEQDFLNMYFXDVYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYE--LGGAAHEVETAVP  992
             PWRYTGKE+NM RE++KMLV KWWEIYND+SLDYK  +  A+ Y   L G    +E  + 
Sbjct  266   PWRYTGKEDNMQREDIKMLVNKWWEIYNDKSLDYKKTRMMANDYSSVLPGEQVNLEPFIA  325

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               S  G++    +++ P AA
Sbjct  326   ALSEVGHV---EFVRAPSAA  342



>emb|CDX80084.1| BnaA05g00720D [Brassica napus]
Length=338

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 214/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  32   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRILVEQGCIVREIEPVYP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  92   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  150

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A LG  P++YFN GMF+F+P + TY  LL  
Sbjct  151  CFCEKTWSHTPQYKIGYCQQCPERVQWPKAELGEPPALYFNAGMFVFEPGLDTYEDLLRT  210

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211  LKVTPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  270

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWW+IY D SLDYK
Sbjct  271  PWRYTGKEANMEREDIKMLVNKWWDIYKDGSLDYK  305



>ref|XP_006340652.1| PREDICTED: galactinol synthase 2-like [Solanum tuberosum]
Length=337

 Score =   326 bits (836),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 230/318 (72%), Gaps = 19/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDY KGVVGLVKGLRK  SAYP+VVA  PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYWKGVVGLVKGLRKAKSAYPLVVACLPDVPEEHRRILINQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + W T  LG +PS+YFN GMF+++PN+STY  LL  
Sbjct  147   CFCEKTWSHTPQYKVGYCQQCPDKVQW-TQDLGPKPSLYFNAGMFVYEPNLSTYDDLLKT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+FRD YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   VKVTPPTPFAEQDFLNMYFRDVYKPIPNNYNLVLAMLWRHPENVDLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KML+KKWW+IY+D SLDYK       +  + G   E E  +   
Sbjct  266   PWRYTGKEENMDREDIKMLIKKWWDIYDDVSLDYK--NSNVVMTAVDGEV-EAEKFMAAL  322

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +    YI  P AA
Sbjct  323   SEAGVV---HYITAPSAA  337



>ref|XP_009588228.1| PREDICTED: galactinol synthase 2-like [Nicotiana tomentosiformis]
Length=329

 Score =   326 bits (835),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 229/318 (72%), Gaps = 28/318 (9%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHR +++ QGCIVRE+EP+YP
Sbjct  29    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPDEHRHIVINQGCIVREIEPVYP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                 +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL D YFYAV D
Sbjct  89    PQN-QTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLPDAYFYAVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP   LG +PS+YFN GMF+F+P++ TY  LL  
Sbjct  148   CFCEKSWTNSPQYSIGYCQQCPDKVQWPEEELGPKPSLYFNAGMFVFEPSLPTYDDLLKT  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT+FAEQDFLNMFFRD YKP+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  208   LKVTPPTSFAEQDFLNMFFRDIYKPIPNIYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKW +IYND+SLDYK     ASV             +P  
Sbjct  268   PWRYTGEEENMDREDIKMLVKKWRDIYNDESLDYK----NASV---------TNKFLPAL  314

Query  999   SNTGNLTEPRYIKGPPAA  1052
                G +   RY+  P AA
Sbjct  315   QKGGVV---RYVTAPSAA  329



>gb|AIE11287.1| galactinol synthase [Manihot esculenta]
Length=335

 Score =   325 bits (834),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/275 (65%), Positives = 219/275 (80%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY+KGVVGL KGLRKV +AYP+VVAV PDVP EHRR+L +QGC+VRE+EP+YP
Sbjct  28   TFLAGNGDYIKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRRILESQGCLVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYL  D+QVFEN+DHLFDL DGY YAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLGGDIQVFENIDHLFDLPDGYLYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  PS+YFN GMF+F+P+ISTY  LL  
Sbjct  147  CFCEKTWSHTAQYKIGYCQQCPDRVKWP-AEMGQPPSLYFNAGMFVFEPSISTYHDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  206  VKITPPTSFAEQDFLNMYFKDIYKPIPLVYNLVLAMLWRHPENVELDEVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  266  PWRYTGKEENMQREDIKMLVKKWWDIYNDESLDYK  300



>emb|CDP15226.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   325 bits (834),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/291 (62%), Positives = 222/291 (76%), Gaps = 14/291 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV + YP+VVAV PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKTVYPLVVAVLPDVPEEHRRILLNQGCIVREIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKM+YLD D+QVFEN+DHLFDL DGYFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMVYLDGDIQVFENIDHLFDLPDGYFYAVKD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + W   L G RP +YFN GMF+++P++ TY  LL+ 
Sbjct  145  CFCEKTWSHTPQYQIGYCQQCPDKVQWQEEL-GQRPPLYFNAGMFVYEPSLPTYDELLST  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNMFFRD Y+P+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LKITPPTPFAEQDFLNMFFRDVYRPIPPIYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAH  971
            PWRYTGKE+NM RE++K+LVK WW+IYND++LDYK      S   +GG A 
Sbjct  264  PWRYTGKEDNMDREDIKVLVKNWWDIYNDETLDYKRSAANISA-TIGGEAE  313



>gb|AIE11285.1| galactinol synthase [Manihot esculenta]
Length=337

 Score =   325 bits (834),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 218/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVA+ PDVP EHR++LV+QGCIV+E+EP+YP
Sbjct  28   TFLAGNGDYVKGVVGLAKGLRKVDSKYPLVVAILPDVPEEHRKILVSQGCIVKEIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV EN+DHLF+L DGYFY V D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVLENIDHLFELEDGYFYGVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A LG +P +YFN GMF+F+PN+STY  LL  
Sbjct  147  CFCEQTWSNSPQYKIGYCQQCPDRVQWP-AELGPKPPLYFNAGMFVFEPNLSTYHDLLTT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFFRD+Y+P+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  VKVTTPTLFAEQDFLNMFFRDKYRPIPPIYNLVLAMLWRHPENVELDKLKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGK+ NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  266  PWRYTGKDANMDREDIKMLVKKWWDIYNDESLDYK  300



>ref|XP_009383943.1| PREDICTED: galactinol synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=341

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 182/318 (57%), Positives = 229/318 (72%), Gaps = 14/318 (4%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKG VGL KGLRKVGSAYP+VVAV PDVP  HRRLL +QGCI+RE+EP+YP
Sbjct  27    TFLAGDGDYVKGAVGLSKGLRKVGSAYPLVVAVLPDVPQSHRRLLASQGCIIREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KM+YLD+D+QV+EN+DHLFDL DG+FYAV D
Sbjct  87    P-ESQTQFAMAYYVINYSKLRIWEFVEYQKMVYLDADIQVYENIDHLFDLPDGHFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C   + WP   LG  P++YFN GMF+ +P+++T   LL+ 
Sbjct  146   CFCEKTWSHTPQYKIGYCQQCPGRVAWPADELGPPPALYFNAGMFVHEPSLATCESLLST  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNMFF+D YKP+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LKVTPPTPFAEQDFLNMFFKDIYKPIPLIYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++K+LVK+WW++YND SLDYK       V  +  AA E E   P  
Sbjct  266   PWRYTGKEANMDREDIKILVKRWWDVYNDTSLDYKGAAATEGV--VVPAAAEEERKQPLL  323

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +        +Y+  P AA
Sbjct  324   AALSEAGAIKYVTAPSAA  341



>ref|XP_009142558.1| PREDICTED: galactinol synthase 1 [Brassica rapa]
Length=338

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/286 (64%), Positives = 217/286 (76%), Gaps = 12/286 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  32   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEEHRRILVEQGCIVREIEPVYP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL D YFYAV D
Sbjct  92   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDRYFYAVMD  150

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A LG  P++YFN GMF+F+P + TY  LL  
Sbjct  151  CFCEKTWSHTPQYKIGYCQQCPERVQWPKAELGEPPALYFNAGMFVFEPGLDTYEDLLRT  210

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211  LKVTPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  270

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYEL  956
            PWRYTGKE NM RE++KMLV KWW+IY D SLDYK  +  + +  L
Sbjct  271  PWRYTGKEANMEREDIKMLVNKWWDIYKDGSLDYKKSEAESDLVNL  316



>gb|ABQ44212.1| galactinol synthase [Capsicum annuum]
Length=336

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 188/321 (59%), Positives = 233/321 (73%), Gaps = 26/321 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDY +GVVGLVKGLRK  SAYP+VVA  PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYWQGVVGLVKGLRKAKSAYPLVVACLPDVPEEHRRILINQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + W T  LG +PS+YFN GMF+++P++STY  LL  
Sbjct  147   CFCEKTWSHTPQYKVGYCQQCPDKVQW-TQDLGPKPSLYFNAGMFVYEPSLSTYDDLLKT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+FRD YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   LKVTPPTPFAEQDFLNMYFRDVYKPIPNNYNLVLAMLWRHPENVDLDKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KML+KKWW+IYND +LDYK       V +    A+++ TA+   
Sbjct  266   PWRYTGKEENMDREDIKMLIKKWWDIYNDITLDYK-NANVTPVVDDQVEANKLMTAI---  321

Query  999   SNTGNLTEP---RYIKGPPAA  1052
                   +EP    YI  P AA
Sbjct  322   ------SEPDVLHYITAPSAA  336



>gb|AIE11288.1| galactinol synthase [Manihot esculenta]
Length=338

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 231/320 (72%), Gaps = 24/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+  DVP EHR++L +QGCIVRE+EP+YP
Sbjct  30    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILSDVPDEHRQILKSQGCIVREIEPIYP  89

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QVFEN+DHLFD  DGYFYAV D
Sbjct  90    P-EHQIQFAMAYYVVNYSKLRIWNFEEYSKMMYLDADIQVFENIDHLFDAPDGYFYAVMD  148

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WPT + G+ P +YFN GMF+F+P+  TY  LL+ 
Sbjct  149   CFCEKTWSHSAQYSIGYCQQCPDRVTWPTDM-GSPPPLYFNAGMFVFEPSRLTYDNLLHT  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNMFF   YKPLP VYN+++ MLWRHP+ VE+ K KV HYC  G+K
Sbjct  208   LKITPPTPFAEQDFLNMFFEKTYKPLPLVYNLVLAMLWRHPENVEVEKVKVAHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWWEIYND+SLD K         E   A  E ET + R 
Sbjct  268   PWRYTGKEANMDREDIKMLVKKWWEIYNDESLDLK--------PENSVAVAEDET-LTRT  318

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   YI  P AA
Sbjct  319   SIMASMPEPAISYIPAPSAA  338



>ref|XP_002512547.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49999.1| conserved hypothetical protein [Ricinus communis]
Length=339

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 229/318 (72%), Gaps = 19/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S YP+VVA+ PDVP +HR++LV+QGCI++E+EP+YP
Sbjct  30    TFLAGNGDYVKGVVGLAKGLRKVNSKYPLVVAILPDVPEDHRKILVSQGCIIKEIEPVYP  89

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DGYFYAV D
Sbjct  90    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLQDGYFYAVMD  148

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G +P +YFN GMF+F+P++ TY  LLN 
Sbjct  149   CFCEKTWSHSPQYKIGYCQQCPDRVKWP-AEMGPKPPLYFNAGMFVFEPSLPTYDDLLNT  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              KLTPPT FAEQDFLNMFF+D Y+P+P +YN+++ +LWRHP+ +EL K KVVHYC  G+K
Sbjct  208   VKLTPPTPFAEQDFLNMFFKDIYRPIPPIYNLVLALLWRHPENIELEKVKVVHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++K LVKKWW+IY D+SLDYK     A+               P  
Sbjct  268   PWRYTGKEENMDREDIKTLVKKWWDIYEDESLDYKNTAAAATGGATEAGLQ------PLL  321

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +     +E  YI  P AA
Sbjct  322   AAMSEASEVHYITAPSAA  339



>gb|AHM22934.1| galactinol synthase 2 [Nicotiana tabacum]
Length=333

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 184/309 (60%), Positives = 226/309 (73%), Gaps = 17/309 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  SAYP+VVA+ PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKAKSAYPLVVAILPDVPEEHRRILINQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFY V D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYGVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + W T  LG +P +YFN GMF F+P++STY  LL  
Sbjct  147   CFCEKTWSHTPQYKVGYCQQCPDEVQW-TEDLGPKPPLYFNAGMFFFEPSLSTYDDLLTT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD LNMFFRD YKP+P  YN+++ MLWRHP+ VEL K KVVHYC   +K
Sbjct  206   LKVTPPTPFAEQDLLNMFFRDVYKPIPNNYNLVLAMLWRHPENVELEKVKVVHYCAARSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW+IYND+SLDYK     A+V  +   A + + A+ + 
Sbjct  266   PWRYTGEEENMDREDIKMLVKKWWDIYNDESLDYK----NANVTAVDAEADKFKAALTKA  321

Query  999   SNTGNLTEP  1025
                  +T P
Sbjct  322   GVVHYITAP  330



>gb|KHN14150.1| Glycogenin-2 [Glycine soja]
Length=334

 Score =   324 bits (830),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 233/318 (73%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  24    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRKILESQGCIVREIEPVYP  83

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D++V+EN+DHLFDL DG FYAV D
Sbjct  84    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIEVYENIDHLFDLPDGNFYAVMD  142

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WPT L G  PS+YFN GMF+F+PNI+TY  LL  
Sbjct  143   CFCEKTWSHTPQYKVGYCQQCPEKVRWPTEL-GQPPSLYFNAGMFVFEPNIATYHDLLKT  201

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++T PT+FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ V+L + KVVHYC  G+K
Sbjct  202   VQVTTPTSFAEQDFLNMYFKDIYKPIPLNYNLVLAMLWRHPENVKLDQVKVVHYCAAGSK  261

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IYND SLDYK     +      G   ++E  V   
Sbjct  262   PWRYTGKEENMQREDIKMLVKKWWDIYNDASLDYKPLMNASEAPAADGV--DIEQFVQAL  319

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G++   +Y+  P AA
Sbjct  320   SEVGHV---QYVTAPSAA  334



>ref|XP_003521604.1| PREDICTED: galactinol synthase 1 [Glycine max]
Length=339

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 233/318 (73%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  29    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRKILESQGCIVREIEPVYP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D++V+EN+DHLFDL DG FYAV D
Sbjct  89    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIEVYENIDHLFDLPDGNFYAVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WPT L G  PS+YFN GMF+F+PNI+TY  LL  
Sbjct  148   CFCEKTWSHTPQYKVGYCQQCPEKVRWPTEL-GQPPSLYFNAGMFVFEPNIATYHDLLKT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++T PT+FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ V+L + KVVHYC  G+K
Sbjct  207   VQVTTPTSFAEQDFLNMYFKDIYKPIPLNYNLVLAMLWRHPENVKLDQVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IYND SLDYK     +      G   ++E  V   
Sbjct  267   PWRYTGKEENMQREDIKMLVKKWWDIYNDASLDYKPLMNASEAPAADGV--DIEQFVQAL  324

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G++   +Y+  P AA
Sbjct  325   SEVGHV---QYVTAPSAA  339



>ref|NP_001234668.1| galactinol synthase 2 [Solanum lycopersicum]
 sp|C7G304.1|GOLS2_SOLLC RecName: Full=Galactinol synthase 2; Short=GolS-2; Short=SlGolS2 
[Solanum lycopersicum]
 dbj|BAH98060.1| galactinol synthase [Solanum lycopersicum]
Length=338

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 228/318 (72%), Gaps = 19/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDY KGVVGLVKGLRK  SAYP+VVA  PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYWKGVVGLVKGLRKAKSAYPLVVACLPDVPEEHRRILINQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                 +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  88    PHN-QTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + W T  LG +PS+YFN GMF+++P++STY  LL  
Sbjct  147   CFCEKTWSHTPQYKVGYCQQCPDKVQW-TEDLGPKPSLYFNAGMFVYEPSLSTYDDLLKT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+FRD YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   LKVTPPTPFAEQDFLNMYFRDVYKPIPNDYNLVLAMLWRHPENVDLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KML+KKWW+IY+D+SLD   YK    V        E +  +   
Sbjct  266   PWRYTGKEENMDREDIKMLIKKWWDIYDDESLD---YKNSNVVMNAVDGEVEAQKIMEAL  322

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +    YI  P AA
Sbjct  323   SEAGVV---HYITAPSAA  337



>ref|XP_011040723.1| PREDICTED: galactinol synthase 2-like [Populus euphratica]
Length=336

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 233/318 (73%), Gaps = 20/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP++VAV PDVP EHRR+L +QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLIVAVLPDVPEEHRRILESQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKM+YLD D+QV++N+DHLFDL DG+FYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMMYLDGDIQVYDNIDHLFDLPDGHFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G  PS+YFN GMF+F+P+ISTY  LL  
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPDKVNWP-AEMGQPPSLYFNAGMFVFEPSISTYHDLLKT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LKVTPPTPFAEQDFLNMYFKDIYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KWW IYND+SLDY  +        +      ++T +   
Sbjct  266   PWRYTGKEENMQREDIKMLVEKWWGIYNDESLDYVKFVADG----IDAEPVNLQTFIAAL  321

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +   +Y+  P AA
Sbjct  322   SEAGAV---QYVTAPSAA  336



>ref|XP_006302453.1| hypothetical protein CARUB_v10020539mg, partial [Capsella rubella]
 gb|EOA35351.1| hypothetical protein CARUB_v10020539mg, partial [Capsella rubella]
Length=358

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 231/323 (72%), Gaps = 30/323 (9%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  50    TFLAGNGDYVKGVVGLAKGLRKAESKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYP  109

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  110   P-ENQTEFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFENIDHLFDLPDGQFYAVMD  168

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A LG +P +YFN GMF+++PN+STY  LL  
Sbjct  169   CFCEKTWSHSPQYKIGYCQQCPDKVTWPEAELGPKPPLYFNAGMFVYEPNLSTYHNLLET  228

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++ PPT FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ +EL + KVVHYC  GAK
Sbjct  229   LQVVPPTLFAEQDFLNMYFKDIYKPIPSAYNLVLAMLWRHPENIELDQVKVVHYCAAGAK  288

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKY-----YKQRASVYELGGAAHEVET  983
             PWR+TG+E NM RE++KMLVKKWW+IYND+SLDYK      YK++ +  +          
Sbjct  289   PWRFTGEEENMDREDIKMLVKKWWDIYNDESLDYKNIIGDGYKKQQTFQQF---------  339

Query  984   AVPRFSNTGNLTEPRYIKGPPAA  1052
              V   S  G L   +Y+K P AA
Sbjct  340   -VEALSEAGVL---QYVKAPSAA  358



>ref|XP_004229370.1| PREDICTED: galactinol synthase 1 [Solanum lycopersicum]
Length=347

 Score =   324 bits (830),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 232/320 (73%), Gaps = 16/320 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGV+GL KGLRKV S YP+VVAV PDVP EHRR+L  QGCIVRE+EP+YP
Sbjct  31    TFLAGNGDYVKGVIGLAKGLRKVKSVYPLVVAVLPDVPPEHRRMLEEQGCIVREIEPVYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY K+IYLD D+QV++N+DHLFDL DGY YAV D
Sbjct  91    P-ENQTQFAMAYYVINYSKLRIWEFVEYKKLIYLDGDIQVYDNIDHLFDLPDGYLYAVMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP+  LG  PS+YFN GMF+F+P++ TY  LL  
Sbjct  150   CFCEKTWSHTPQYKIGYCQQCPDKVKWPSEDLGQPPSLYFNAGMFVFEPSLRTYHDLLKK  209

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F++ Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  210   LQITPPTPFAEQDFLNMYFKNIYRPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  269

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELG--GAAHEVETAVP  992
             PWRYTGKE NM RE++K+LVKKWW+IYND+SLDY        V  +G  GA ++++  + 
Sbjct  270   PWRYTGKEENMEREDIKLLVKKWWDIYNDESLDYNRSVGMNQVNVIGAAGAVNQLQPLIA  329

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
                +  +    +Y+  P AA
Sbjct  330   AAMSQASAV--KYVTAPSAA  347



>ref|XP_010511303.1| PREDICTED: galactinol synthase 2 [Camelina sativa]
Length=336

 Score =   323 bits (828),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 232/322 (72%), Gaps = 28/322 (9%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKAESKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVF+N+DHLFDL DG FYAV D
Sbjct  88    P-ENQTEFAMAYYVINYSKLRIWKFVEYNKMIYLDGDIQVFDNIDHLFDLPDGQFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG +P +YFN GMF+++PN+STY  LL+ 
Sbjct  147   CFCEKTWSHSPQYKIGYCQQCPEKVTWPEAKLGPKPPLYFNAGMFVYEPNLSTYHNLLDT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++ PPT FAEQDFLNM+F+D YKP+P VYN+++ M+WRHP+ +EL + KVVHYC  GAK
Sbjct  207   VRVVPPTLFAEQDFLNMYFKDIYKPIPSVYNLVLAMIWRHPENIELEQVKVVHYCAAGAK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TG+E NM R ++KMLVKKWW+IYND+SLDYK          + G  H+ + A  +F
Sbjct  267   PWRFTGEEENMNRADIKMLVKKWWDIYNDESLDYK---------NIIGDGHKKQQAFQQF  317

Query  999   ----SNTGNLTEPRYIKGPPAA  1052
                 S  G L   + +K P AA
Sbjct  318   VEALSQAGVL---QSVKAPSAA  336



>ref|XP_010506746.1| PREDICTED: galactinol synthase 1-like [Camelina sativa]
Length=343

 Score =   323 bits (829),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 213/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHRR+LV QGCIVRE+EP+YP
Sbjct  33   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRRILVEQGCIVREIEPVYP  92

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKM+YLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  93   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMVYLDGDIQVYENIDHLFDLPDGYFYAVMD  151

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A LG  P++YFN GMF+F+P +  Y  LL  
Sbjct  152  CFCEKTWSHTPQYKIGYCQQCPEKVQWPKAELGEPPALYFNAGMFLFEPKLEIYEDLLKS  211

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+ PPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  212  LKIIPPTPFAEQDFLNMYFKKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  271

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV +WW+IYND +L+YK
Sbjct  272  PWRYTGKEANMDREDIKMLVNRWWDIYNDDTLNYK  306



>ref|XP_002320958.2| putative galactinol synthase family protein [Populus trichocarpa]
 gb|AGT50334.1| galactinol synthase 6 [Populus trichocarpa]
 gb|EEE99273.2| putative galactinol synthase family protein [Populus trichocarpa]
Length=336

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 232/318 (73%), Gaps = 20/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP++VAV PDVP EHRR+L +QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLIVAVLPDVPEEHRRILESQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DG+FYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGHFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G  PS+YFN GMF+F+P+ISTY  LL  
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPDKVNWP-AEMGQPPSLYFNAGMFVFEPSISTYHDLLKT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LKVTPPTPFAEQDFLNMYFKDIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KWW IYND+SLDY  +               +++ +   
Sbjct  266   PWRYTGKEENMQREDIKMLVEKWWGIYNDESLDYMKFVADG----FDAEPVNLQSFIAAL  321

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +   +Y+  P AA
Sbjct  322   SEAGAV---QYVTAPSAA  336



>ref|XP_010523902.1| PREDICTED: galactinol synthase 1 [Tarenaya hassleriana]
Length=336

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 229/318 (72%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGL KGLR V SAYP+VVAV PDVP EHRRLL  QGCIVRE+EP+YP
Sbjct  26    TFLAGDGDYVKGVVGLAKGLRMVKSAYPLVVAVLPDVPEEHRRLLTEQGCIVREIEPVYP  85

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  +  FA  YYV+NYSKL+ W+F EY KM+YLD D+QV+ N+DHLFDL DG FYAV D
Sbjct  86    PDN-QTQFAMAYYVINYSKLRIWKFVEYDKMVYLDGDIQVYGNIDHLFDLPDGSFYAVMD  144

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A LG  P++YFN GMF+F+P++ +Y  LL  
Sbjct  145   CFCEKTWSHTPQYKIGYCQQCPDKVKWP-AELGEPPALYFNAGMFVFEPDLVSYHDLLRT  203

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+FR +YKP+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204   LEITPPTPFAEQDFLNMYFRKKYKPIPLIYNLVMAMLWRHPENVELDKVKVVHYCAAGSK  263

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW+IYND+SLDYK    ++S     G    V+   P F
Sbjct  264   PWRYTGEEENMDREDIKMLVKKWWDIYNDESLDYK----KSSAVAGNGETEPVKLQ-PLF  318

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +        +Y+  P AA
Sbjct  319   AALSEAGRVKYVTAPSAA  336



>gb|ADW78840.1| galactinol synthase [Solanum commersonii]
 gb|ADW78841.1| galactinol synthase [Solanum commersonii]
Length=336

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 233/321 (73%), Gaps = 18/321 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGV+GL KGLRKV S YP+VVAV PDVPAEHRR+L  QGCIVRE+EP+YP
Sbjct  20    TFLAGNGDYVKGVIGLAKGLRKVKSEYPLVVAVLPDVPAEHRRMLDEQGCIVREIEPVYP  79

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QV++N+DHLFDLADGYFYAV D
Sbjct  80    P-ENQTQFAMAYYVINYSKLRIWEFVEYKKMIYLDGDIQVYDNIDHLFDLADGYFYAVMD  138

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP+   G  PS+YFN GMF+F+P++ TY  LL  
Sbjct  139   CFCEKTWSHTPQYKIGYCQQCPDRIKWPSDEFGQPPSLYFNAGMFVFEPSLHTYQDLLKK  198

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F+  Y+P+  VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  199   LQITPPTPFAEQDFLNMYFKSIYRPISLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  258

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK--YYKQRASVYELGGAAHEVETAV-  989
             PWRYTGKE NM RE++K+LVKKWW+I ND+SLDYK      + +V    GA ++++  + 
Sbjct  259   PWRYTGKEENMEREDIKLLVKKWWDICNDESLDYKRPVGMNQVNVIGAAGAVNQLQPLIA  318

Query  990   PRFSNTGNLTEPRYIKGPPAA  1052
                S  G +   +Y+  P AA
Sbjct  319   AAMSQAGAV---KYVTAPSAA  336



>ref|XP_008343193.1| PREDICTED: galactinol synthase 1-like [Malus domestica]
Length=347

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 216/275 (79%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP +HRR+L +QGCIVRE+EP+YP
Sbjct  28   TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEDHRRILESQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D++ ++N+DHLFDL DG+FYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYEKMIYLDGDIEXYDNIDHLFDLPDGHFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WPT+ LG  PS+YFN GMF+F+P + TY  LL  
Sbjct  147  CFCEKTWSHTPQYQIGYCQQCPEKVQWPTSELGPPPSLYFNAGMFVFEPGLETYHDLLRT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNM+FR  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  LRVTPPTPFAEQDFLNMYFRKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  267  PWRYTGKEENMQREDIKMLVKKWWDIYNDESLDYK  301



>ref|XP_006444560.1| hypothetical protein CICLE_v10021027mg [Citrus clementina]
 ref|XP_006492376.1| PREDICTED: galactinol synthase 1-like [Citrus sinensis]
 gb|ESR57800.1| hypothetical protein CICLE_v10021027mg [Citrus clementina]
 gb|KDO86882.1| hypothetical protein CISIN_1g019647mg [Citrus sinensis]
Length=337

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 218/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  30   TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRNILESQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  +A  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DGYFYAV D
Sbjct  90   PDN-QTQYAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLPDGYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  P++YFN GMF+F+P+ISTY  LL  
Sbjct  149  CFCEKTWSKTPQYKIGYCQQCPDRVRWP-AEMGEPPALYFNAGMFVFEPSISTYHDLLET  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  208  VKVTPPTTFAEQDFLNMYFKHIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TG+E NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  268  PWRFTGEEENMQREDVKMLVKKWWDIYNDESLDYK  302



>ref|NP_176053.1| galactinol synthase 2 [Arabidopsis thaliana]
 sp|Q9FXB2.1|GOLS2_ARATH RecName: Full=Galactinol synthase 2; Short=AtGolS2; Short=GolS-2 
[Arabidopsis thaliana]
 gb|AAG09103.1|AC009323_14 Putative galactinol synthase [Arabidopsis thaliana]
 gb|AAK91426.1| At1g56600/F25P12_16 [Arabidopsis thaliana]
 gb|AAL15412.1| At1g56600/F25P12_16 [Arabidopsis thaliana]
 dbj|BAB78531.1| galactinol synthase [Arabidopsis thaliana]
 gb|AEE33413.1| galactinol synthase 2 [Arabidopsis thaliana]
 gb|AHL38900.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=335

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 233/322 (72%), Gaps = 27/322 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG GDYVKGVVGL KGLRK  S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  26    TFLAGTGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYP  85

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVF+N+DHLFDL +G FYAV D
Sbjct  86    P-ENQTEFAMAYYVINYSKLRIWEFVEYNKMIYLDGDIQVFDNIDHLFDLPNGQFYAVMD  144

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A LG +P +YFN GMF+++PN+STY  LL  
Sbjct  145   CFCEKTWSHSPQYKIGYCQQCPDKVTWPEAKLGPKPPLYFNAGMFVYEPNLSTYHNLLET  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL + KVVHYC  GAK
Sbjct  205   VKIVPPTLFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELDQVKVVHYCAAGAK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TG+E NM RE++KMLVKKWW+IYND+SLDYK          + G +H+ +  + +F
Sbjct  265   PWRFTGEEENMDREDIKMLVKKWWDIYNDESLDYKNV--------VIGDSHKKQQTLQQF  316

Query  999   ----SNTGNLTEPRYIKGPPAA  1052
                 S  G L   +Y+K P AA
Sbjct  317   IEALSEAGAL---QYVKAPSAA  335



>ref|XP_008353871.1| PREDICTED: galactinol synthase 1-like [Malus domestica]
Length=347

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 216/275 (79%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP +HRR+L +QGCIVRE+EP+YP
Sbjct  28   TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEDHRRILESQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D++ ++N+DHLFDL DG+FYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYEKMIYLDGDIEXYDNIDHLFDLPDGHFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WPT+ LG  PS+YFN GMF+F+P + TY  LL  
Sbjct  147  CFCEKTWSHTPQYQIGYCQQCPEKVQWPTSELGPPPSLYFNAGMFVFEPGLETYHDLLRT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNM+FR  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  LRVTPPTPFAEQDFLNMYFRKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  267  PWRYTGKEENMQREDIKMLVKKWWDIYNDESLDYK  301



>ref|XP_010094413.1| hypothetical protein L484_018780 [Morus notabilis]
 gb|EXB55994.1| hypothetical protein L484_018780 [Morus notabilis]
Length=340

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 217/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRR+L +QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRRILESQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  F+  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLF+L DG+ YAV D
Sbjct  89   P-ESQTQFSMAYYVINYSKLRIWEFGEYSKMIYLDGDIQVYENIDHLFELEDGHLYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + WPT   G  P++YFN GM +F+P++STY  LLN 
Sbjct  148  CFCEKTWSHTPQYKIGYCQQCPNNVQWPTES-GPPPALYFNAGMLVFEPSLSTYHDLLNT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+FRD YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  VKITPPTPFAEQDFLNMYFRDMYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  267  PWRYTGKEENMEREDIKMLVKKWWDIYNDESLDYK  301



>ref|XP_011079512.1| PREDICTED: galactinol synthase 1 [Sesamum indicum]
Length=340

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 233/321 (73%), Gaps = 22/321 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVV L KGLRKV SAYP++VAV PDVPA+HRRLL+ QGCIVRE++P+YP
Sbjct  28    TFLAGNGDYVKGVVALAKGLRKVKSAYPLLVAVLPDVPADHRRLLLDQGCIVREIDPIYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KM+YLD D+QV++N+DHLF+L DGYFYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYKKMVYLDGDIQVYDNIDHLFELEDGYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP+ + G  P++YFN GMF+F+PNIS Y +LL  
Sbjct  147   CFCEKTWSHTPQYKLGYCQQCPEKVRWPSEM-GHPPALYFNAGMFVFEPNISVYEKLLYT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNMFF+D YKP+P VYN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  206   LKITPPTPFAEQDFLNMFFKDIYKPIPNVYNLVLAMLWRHPENVELDQVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRY G E+NM RE++KMLVKKWW++YND+SLD K    +  V+  G  A E  T  P  
Sbjct  266   PWRYAGTEDNMQREDIKMLVKKWWDVYNDESLDSK----KPVVHNDG--AMESGTLQPLI  319

Query  999   S---NTGNLTEPRYIKGPPAA  1052
             +      N    +Y+  P AA
Sbjct  320   AAAMTEANAPAVKYVAAPSAA  340



>ref|XP_009763726.1| PREDICTED: galactinol synthase 1-like [Nicotiana sylvestris]
Length=343

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 214/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGV GL KGLRKV SAYP+VVAV PDVP EHRR+L AQGCIVRE+EP+YP
Sbjct  27   TFLAGNGDYVKGVGGLAKGLRKVKSAYPLVVAVLPDVPVEHRRILEAQGCIVREIEPVYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QV++N+DHLFDL DGYFYAV D
Sbjct  87   P-ENQTQFAMAYYVINYSKLRIWEFVEYKKMIYLDGDIQVYDNIDHLFDLPDGYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WPT  LG  PS+YFN GMF+F+P++  Y  LL  
Sbjct  146  CFCEKTWSHTPQYKIGYCQQCPDEVKWPTEELGQPPSLYFNAGMFVFEPSLHIYDDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TP T FAEQDFLNM+F++ YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  LQITPSTPFAEQDFLNMYFKEIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K+LVKKWW+IY D+SLDYK
Sbjct  266  PWRYTGKEENMQREDIKLLVKKWWDIYKDESLDYK  300



>ref|XP_002319472.1| galactinol synthase family protein [Populus trichocarpa]
 gb|EEE95395.1| galactinol synthase family protein [Populus trichocarpa]
Length=334

 Score =   322 bits (824),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 234/314 (75%), Gaps = 18/314 (6%)
 Frame = +3

Query  63   MAPD-----ASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvva  227
            MAPD     A+N   +V +A+    AYVTFLAG+GDY KGVVGL KGLRK  S YP+VVA
Sbjct  1    MAPDITTPLANNATTLVKQASISSCAYVTFLAGDGDYWKGVVGLAKGLRKAESKYPLVVA  60

Query  228  vwpdvpaEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMI  407
            + PDVP EHR++LV+QGCIVRE+EP++P  E +  FA PYYV+NYSKL+ W+F EYSKMI
Sbjct  61   ILPDVPEEHRKILVSQGCIVREIEPVHPP-ENQTRFAMPYYVINYSKLRIWEFVEYSKMI  119

Query  408  YLDSDMQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALL  554
            YLD D+QVF+N+DHLFD+ DG FYAV DC CE+           + + C + + WP A +
Sbjct  120  YLDGDIQVFDNIDHLFDMPDGCFYAVMDCFCEKTWSNSPQYKIGYCQQCPDKVQWP-AEM  178

Query  555  GARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNM  734
            G +P +YFN GMF+++PN+STY  LL   K+T PT FAEQDFLNMFFRD YKP+P  YN+
Sbjct  179  GPKPPLYFNAGMFVYEPNLSTYHDLLETLKITSPTLFAEQDFLNMFFRDVYKPIPSDYNL  238

Query  735  LVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSL  914
            ++ MLWRHP+ + L K KVVHYC  G+KPWRYTGKE NM RE++KMLV+KWW+IYND+SL
Sbjct  239  VLAMLWRHPENINLDKVKVVHYCAAGSKPWRYTGKEENMDREDIKMLVQKWWDIYNDESL  298

Query  915  DYKYYKQRASVYEL  956
            D+K     +S  EL
Sbjct  299  DHKNTVVASSGSEL  312



>ref|XP_010480275.1| PREDICTED: galactinol synthase 2-like [Camelina sativa]
Length=336

 Score =   322 bits (824),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 231/322 (72%), Gaps = 28/322 (9%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKAESKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVF+N+DHLF+L DG FYAV D
Sbjct  88    P-ENQTEFAMAYYVINYSKLRIWKFVEYNKMIYLDGDIQVFDNIDHLFELPDGQFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG +P +YFN GMF+++PN+STY  LL+ 
Sbjct  147   CFCEKTWIHSPQYKIGYCQQCPEKVTWPEAKLGPKPPLYFNAGMFVYEPNLSTYHNLLDT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ +EL + KVVHYC  GAK
Sbjct  207   VKVVPPTLFAEQDFLNMYFKDIYKPIPSAYNLVLAMLWRHPENIELDQVKVVHYCAAGAK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TG+E NM R ++KMLVKKWW+IYND+SLDYK          + G  H+ + A  +F
Sbjct  267   PWRFTGEEENMNRADIKMLVKKWWDIYNDESLDYK---------NIIGDGHKKQEAFQQF  317

Query  999   ----SNTGNLTEPRYIKGPPAA  1052
                 S  G L   + +K P AA
Sbjct  318   VEALSQAGVL---QSVKAPSAA  336



>emb|CDY69393.1| BnaCnng63310D [Brassica napus]
Length=330

 Score =   321 bits (823),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 233/318 (73%), Gaps = 22/318 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGD+VKGVVGL KGLRKV S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  24    TFLAGNGDFVKGVVGLAKGLRKVKSMYPLVVAVLPDVPEDHRKQLVEQGCVVKEIEPVYP  83

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD+D+QVF+N+DHLFDL  G+FYAV D
Sbjct  84    P-ESQTEFAMVYYVINYSKLRIWKFVEYSKMIYLDADIQVFQNIDHLFDLPSGHFYAVKD  142

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP+ L G +P +YFN GMF+++PN+ TY  LL  
Sbjct  143   CFCEKTWSHTPQNKIGYCQQCPEKVTWPSEL-GPQPPLYFNAGMFVYEPNLYTYYNLLET  201

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT FAEQDFLNM+FRD YKP+P +YN+++ MLWRHP+ VEL K KV HYC  G+K
Sbjct  202   LKVVPPTPFAEQDFLNMYFRDIYKPIPGIYNLVMAMLWRHPENVELDKVKVAHYCAAGSK  261

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TGKE NMGRE++KMLVKKWW+IYND++LDYK         + GG  H+ +  V   
Sbjct  262   PWRFTGKEPNMGREDIKMLVKKWWDIYNDETLDYKNISG-----DKGGDDHK-KQFVKAL  315

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G L   +Y+K P AA
Sbjct  316   SEAGVL---QYVKAPSAA  330



>ref|XP_007051210.1| Galactinol synthase 1 [Theobroma cacao]
 gb|EOX95367.1| Galactinol synthase 1 [Theobroma cacao]
Length=336

 Score =   321 bits (823),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 232/318 (73%), Gaps = 20/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHRR+L  QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEEHRRVLENQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYS+MIYLD D+QVF+N+DHLFDL DG+ YAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSRMIYLDGDIQVFDNIDHLFDLPDGHCYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G  PS+YFN GMF+F+P++ TY  LL  
Sbjct  147   CFCEKTWSHTQQYKIGYCQQCPDKVKWP-AEMGQPPSLYFNAGMFVFEPSLFTYKNLLET  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD LNMFFRD YKP+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LKITPPTPFAEQDLLNMFFRDIYKPIPLLYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TGKE NM RE++KMLV+KWW+IYND+SLDYK    + +V E  GAA  V    P  
Sbjct  266   PWRWTGKEENMHREDIKMLVQKWWDIYNDESLDYK----KPTVAE--GAAEPVNPQ-PFL  318

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +        +Y+  P AA
Sbjct  319   AALSEAGAVQYVTAPSAA  336



>gb|ADW78849.1| galactinol synthase [Solanum tuberosum]
 gb|ADW78850.1| galactinol synthase [Solanum tuberosum]
Length=334

 Score =   321 bits (822),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY KGVVGLVKGLRK  SAYP+VVA  PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  28   TFLAGNGDYWKGVVGLVKGLRKAKSAYPLVVACLPDVPEEHRRILINQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + W T  LG +PS+YFN GMF+++P++S Y  LL  
Sbjct  147  CFCEKTWSHTPQYKVGYCQQCPDKVQW-TQDLGPKPSLYFNAGMFVYEPSLSIYDDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+FRD YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206  VKVTPPTPFAEQDFLNMYFRDVYKPIPNHYNLVLAMLWRHPENVDLDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KML+KKWW+IY+D SLDYK
Sbjct  266  PWRYTGKEENMDREDIKMLIKKWWDIYDDVSLDYK  300



>gb|KFK22550.1| hypothetical protein AALP_AAs68488U001100 [Arabis alpina]
Length=330

 Score =   321 bits (822),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/322 (57%), Positives = 233/322 (72%), Gaps = 24/322 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HR+ L+ QGC+V+E++P+YP
Sbjct  18    TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEDHRKQLLDQGCVVKEIQPVYP  77

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DG FYAV D
Sbjct  78    P-ENQTDFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFDNIDHLFDLPDGQFYAVMD  136

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP   LG +P +YFN GMF+++P++STY  LL  
Sbjct  137   CFCEKTWSHSPQYKIGYCQQCPDKVTWPETELGPKPPLYFNAGMFVYEPSLSTYHNLLET  196

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT+FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL + KVVHYC  GAK
Sbjct  197   LKVVPPTSFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENVELDQIKVVHYCAAGAK  256

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TG+E NM RE++KMLVKKWW+IYND+SLDYK       + E GG + +      +F
Sbjct  257   PWRFTGEEENMEREDIKMLVKKWWDIYNDESLDYKNL-----IGEQGGDSLKKNQKFQQF  311

Query  999   ----SNTGNLTEPRYIKGPPAA  1052
                 S  G L   +Y+K P AA
Sbjct  312   LEALSEAGVL---QYVKAPSAA  330



>ref|XP_006472243.1| PREDICTED: galactinol synthase 2-like [Citrus sinensis]
Length=339

 Score =   321 bits (822),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/277 (62%), Positives = 220/277 (79%), Gaps = 13/277 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGLVKGLRK  S YP++VA+ PDVP EHR++L+ QGCI+RE+EP+YP
Sbjct  29   TFLAGDGDYWKGVVGLVKGLRKAKSKYPLLVAMLPDVPEEHRKILIEQGCILREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A LG +P++YFN GMF+F+P++STY  LL  
Sbjct  148  CFCEKTWSHTPQFKIGYCQQCPDKVKWP-AELGPKPALYFNAGMFVFEPSLSTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLNM+FRD Y+P+P +YN++V MLWRHP+ VE  KAKVVHYC  G+K
Sbjct  207  VQITTPTSFAEQDFLNMYFRDIYRPIPPIYNLVVAMLWRHPENVEADKAKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYY  929
            PWR+TGKE NM RE++KMLV+KWW+I+ND+SLDYK Y
Sbjct  267  PWRFTGKEENMQREDIKMLVQKWWDIFNDESLDYKNY  303



>ref|XP_003554564.1| PREDICTED: galactinol synthase 1-like [Glycine max]
Length=335

 Score =   320 bits (820),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 232/318 (73%), Gaps = 17/318 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP +HR++L +QGCIVRE+EP+YP
Sbjct  24    TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEDHRKILESQGCIVREIEPVYP  83

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QV+EN+DHLFDL  GYFYAV D
Sbjct  84    P-ENQTQFAMAYYVINYSKLRIWEFVEYTKMIYLDGDIQVYENIDHLFDLPGGYFYAVMD  142

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WPT L G  PS+YFN GMF+F+P+I+TY  LL  
Sbjct  143   CFCEKTWSHTPQYKVGYCQQCPEKVQWPTEL-GQPPSLYFNAGMFVFEPSIATYHDLLKT  201

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++T PT+FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ V+L + KVVHYC  G+K
Sbjct  202   VQVTTPTSFAEQDFLNMYFKDIYKPIPLNYNLVLAMLWRHPENVKLDQVKVVHYCAAGSK  261

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IYND SLDYK     AS          +E  V   
Sbjct  262   PWRYTGKEENMQREDIKMLVKKWWDIYNDASLDYKPL-MSASEAPAPDGVDNIEPFVQAL  320

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G++   +Y+  P AA
Sbjct  321   SEVGHV---QYVTAPSAA  335



>ref|XP_009113368.1| PREDICTED: galactinol synthase 2 [Brassica rapa]
 emb|CDY41701.1| BnaA09g15290D [Brassica napus]
Length=330

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 231/318 (73%), Gaps = 22/318 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
              FLAGNGD+VKG+VGL KGLRKV S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  24    AFLAGNGDFVKGMVGLAKGLRKVKSMYPLVVAVLPDVPEDHRKQLVEQGCVVKEIEPVYP  83

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF N+DHLFDL +G+FYAV D
Sbjct  84    P-ESQTEFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFHNIDHLFDLPNGHFYAVKD  142

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG +P +YFN GMF+++PN+ TY  LL  
Sbjct  143   CFCEKTWSHTPQNKIGYCQQCPEKVTWP-AELGPKPPLYFNAGMFVYEPNLYTYHNLLET  201

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT FAEQDFLNM+FRD YKP+P +YN+++ MLWRHP+ VEL K KV HYC  G+K
Sbjct  202   LKVVPPTPFAEQDFLNMYFRDIYKPIPGIYNLVMAMLWRHPENVELDKVKVAHYCAAGSK  261

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TGKE NMGRE++KMLVKKWW+IYND++LDYK         + GG  H+ +  V   
Sbjct  262   PWRFTGKEPNMGREDIKMLVKKWWDIYNDETLDYKNISG-----DKGGDDHK-KQFVKAL  315

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G L   +Y+K P AA
Sbjct  316   SEAGVL---QYVKAPSAA  330



>ref|XP_010270867.1| PREDICTED: galactinol synthase 2-like [Nelumbo nucifera]
Length=340

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 218/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY+KGVVGL KGLRKV SAYP+VVAV PDVPAEHRR+L +QGCIV+E+E +YP
Sbjct  28   TFLAGNGDYIKGVVGLAKGLRKVKSAYPLVVAVLPDVPAEHRRILESQGCIVKEIELVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD+D+QV++N+DHLFDL  GYFYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDADIQVYDNIDHLFDLPGGYFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  PS+YFN GMF+F+P++ST   LL  
Sbjct  147  CFCEKTWSHTPQYKIGYCQQCPDKVKWP-AEMGQPPSLYFNAGMFVFEPSLSTCDDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNMFFRD YKP+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  LKVTPPTPFAEQDFLNMFFRDVYKPIPLIYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW++YND+SL YK
Sbjct  266  PWRYTGKEENMQREDIKMLVKKWWDVYNDESLGYK  300



>ref|XP_009367176.1| PREDICTED: galactinol synthase 1-like [Pyrus x bretschneideri]
Length=347

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 216/275 (79%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNG+YVKGVVGL KGLRKV +AYP+VVAV PDVP +HRR+L  QGCIVRE+EP+YP
Sbjct  28   TFLAGNGEYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEDHRRILEFQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D++V++N+DHLFDL DG+FYAV D
Sbjct  88   P-ENQTHFAMAYYVINYSKLRIWEFVEYEKMIYLDGDIEVYDNIDHLFDLPDGHFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WPT+ LG  PS+YFN GMF+F+P + TY  LL  
Sbjct  147  CFCEKTWSHTPQYQIGYCQQCPEKVQWPTSELGPPPSLYFNAGMFVFEPGLETYHDLLRT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNM+FR  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  LRVTPPTPFAEQDFLNMYFRKIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWWEIYND+SLDY+
Sbjct  267  PWRYTGKEENMQREDIKMLVKKWWEIYNDESLDYR  301



>gb|AEJ87260.1| galactinol synthase 2-1 [Populus trichocarpa]
 gb|AGT50329.1| galactinol synthase 1 [Populus trichocarpa]
Length=334

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 233/314 (74%), Gaps = 18/314 (6%)
 Frame = +3

Query  63   MAPD-----ASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvva  227
            MAPD     A+N   +V +A+    AYVTFLAGNGDY KGVVGL KGLRK  S YP+VVA
Sbjct  1    MAPDITTPLANNATTLVKQASISSCAYVTFLAGNGDYWKGVVGLAKGLRKAESKYPLVVA  60

Query  228  vwpdvpaEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMI  407
            + PDVP EHR++LV+QGCIVRE+EP++P  E +  FA PYYV+NYSKL+ W+F EYSKMI
Sbjct  61   ILPDVPEEHRKILVSQGCIVREIEPVHPP-ENQTRFAMPYYVINYSKLRIWEFVEYSKMI  119

Query  408  YLDSDMQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALL  554
            YLD D+Q F+N+DHLFD+ DG FYAV DC CE+           + + C + + WP A +
Sbjct  120  YLDGDIQAFDNIDHLFDMPDGCFYAVMDCFCEKTWSNSPQYRIGYCQQCPDKVQWP-AEM  178

Query  555  GARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNM  734
            G +P +YFN GMF+++PN+STY  LL   K+T PT FAEQDFLNMFFR  YKP+P  YN+
Sbjct  179  GPKPPLYFNAGMFVYEPNLSTYHDLLETLKITSPTLFAEQDFLNMFFRGVYKPIPSDYNL  238

Query  735  LVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSL  914
            ++ MLWRHP+ ++L K KVVHYC  G+KPWRYTGKE NM RE++KMLV+KWW+IYND+SL
Sbjct  239  VLAMLWRHPENIDLDKVKVVHYCAAGSKPWRYTGKEENMDREDIKMLVQKWWDIYNDESL  298

Query  915  DYKYYKQRASVYEL  956
            D+K     +S  EL
Sbjct  299  DHKNTVVASSGSEL  312



>ref|XP_009599613.1| PREDICTED: galactinol synthase 1-like [Nicotiana tomentosiformis]
Length=343

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 216/275 (79%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVPAEHRR+L AQGCIVRE+EP+YP
Sbjct  27   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPAEHRRILEAQGCIVREIEPVYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY K IYLD D+QV++N+DHLFDL DGYFYAV D
Sbjct  87   P-ENQTRFAMAYYVINYSKLRIWEFVEYKKTIYLDGDIQVYDNIDHLFDLPDGYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WPT  LG  PS+YFN GMF+F+P++  Y  LL  
Sbjct  146  CFCEKTWSHTPQYKIGYCQQCPDKVKWPTEELGQPPSLYFNAGMFVFEPSLHIYDDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TP T FAEQDFLN++F+D Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  LQITPSTPFAEQDFLNIYFKDIYRPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PW+YTGKE NM RE++K+L+KKWW+IYND+SLDYK
Sbjct  266  PWKYTGKEENMQREDIKLLMKKWWDIYNDESLDYK  300



>ref|XP_007222498.1| hypothetical protein PRUPE_ppa008264mg [Prunus persica]
 gb|EMJ23697.1| hypothetical protein PRUPE_ppa008264mg [Prunus persica]
Length=339

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 227/320 (71%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  32    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHREILRSQGCIVREIEPIYP  91

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKMIYLD+D+QV+EN+DHLFD  DGYFYAV D
Sbjct  92    P-ENQIKFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVYENIDHLFDTPDGYFYAVMD  150

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A LG+ P +YFN GMF+F+P+  TY  LL  
Sbjct  151   CFCEKTWSHSPQYKVGYCQQCPDKVSWP-AELGSPPPLYFNAGMFVFEPSRLTYDSLLQT  209

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++ PPT FAEQDFLNMFF+  YKP+P VYN+++ MLWRHP+ VEL K  VVHYC  G+K
Sbjct  210   LQIVPPTPFAEQDFLNMFFQKTYKPIPLVYNLVLAMLWRHPENVELDKVNVVHYCAAGSK  269

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWWE+YND++LD+K              A   E A  R 
Sbjct  270   PWRYTGKEANMDREDIKMLVAKWWEVYNDETLDFK----------AENPADAEEEAFARS  319

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   YI  P AA
Sbjct  320   SIMASMPEPAISYIPAPSAA  339



>gb|KDP26601.1| hypothetical protein JCGZ_17759 [Jatropha curcas]
Length=337

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 230/323 (71%), Gaps = 31/323 (10%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGL KGLRKV SAYP+VVA+  DVP EHR++L +QGCIVRE++P+YP
Sbjct  30    TFLAGDGDYVKGVVGLAKGLRKVKSAYPLVVAILGDVPDEHRQILESQGCIVREIDPIYP  89

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E  + FA  YYV+NYSKL+ W F EYSKMIYLD+D+QVFEN+DHLFD  DGYFYAV D
Sbjct  90    P-ENHIQFAHAYYVINYSKLRIWNFEEYSKMIYLDADIQVFENIDHLFDTPDGYFYAVMD  148

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + +PWP A +G+ P +YFN GMF+F+P+  TY  LL+ 
Sbjct  149   CFCEKVWNYSLQYKIGYCQQCPDRVPWP-ADMGSPPPLYFNAGMFVFEPSRLTYENLLHS  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNMFF   YKPLP VYN+++ MLWRHP+ VE  K KVVHYC  G+K
Sbjct  208   LKITPPTPFAEQDFLNMFFEKTYKPLPPVYNLVLAMLWRHPENVEFEKVKVVHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++K LVKKWW+IYND+SLD +             A + V+T    F
Sbjct  268   PWRYTGKEVNMDREDIKTLVKKWWDIYNDESLDLR-------------AENSVQTGEETF  314

Query  999   SNT---GNLTEP--RYIKGPPAA  1052
             S T    ++ EP   YI  P AA
Sbjct  315   SRTSIMASMPEPAIAYIPAPSAA  337



>gb|KHG03186.1| Glycogenin-1 [Gossypium arboreum]
Length=330

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 178/318 (56%), Positives = 230/318 (72%), Gaps = 19/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP +H+++LV QGCIV+E++P+YP
Sbjct  21    TFLAGNGDYVKGVVGLAKGLRKVKSKYPLVVAVLPDVPDDHKKILVDQGCIVKEIDPVYP  80

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  81    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDMEDGYFYAVMD  139

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP+ L G +P +YFN GMF+++PN+S Y  LL  
Sbjct  140   CFCEKTWSHTPQYKIGYCQQCPDKVQWPSRL-GPKPPLYFNAGMFVYEPNLSVYDDLLTT  198

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD+LNM+FRD Y+P+P +YN+++ MLWRHP+ +EL K KVVHYC  G+K
Sbjct  199   LKVTPPTPFAEQDYLNMYFRDIYRPIPPIYNLVLAMLWRHPENIELEKVKVVHYCAAGSK  258

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TGKE+NM R+++K LV KWW+IYND+SLDY      A+    G A  E     P  
Sbjct  259   PWRFTGKEDNMDRKDIKTLVTKWWDIYNDESLDY------ANAVGYGEAEDEQTGLEPFL  312

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +   +    +YI  P AA
Sbjct  313   AAMSDACVVQYINAPSAA  330



>gb|ADW78842.1| galactinol synthase [Solanum commersonii]
 gb|ADW78843.1| galactinol synthase [Solanum commersonii]
Length=334

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 229/318 (72%), Gaps = 22/318 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDY KGVVGLVKGLRK  SAYP+VVA  PDVP EHRR+L+ QGCI+RE+EP+YP
Sbjct  28    TFLAGNGDYWKGVVGLVKGLRKAKSAYPLVVACLPDVPEEHRRILINQGCIIREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + W T  LG +PS YFN GMF+++P++S Y  LL  
Sbjct  147   CFCEKTWSHTPQYKVGYCQQCPDKVQW-TQELGPKPSPYFNAGMFVYEPSLSIYDDLLKT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNM+FRD YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   VKVTPPTPFAEQDFLNMYFRDVYKPIPNHYNLVLAMLWRHPENVDLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KML+KKWW+IY+D SLDYK     ++V   G    E +  +   
Sbjct  266   PWRYTGKEENMDREDIKMLIKKWWDIYDDVSLDYK----NSNVVIDGEV--EADKLMAAL  319

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +    YI  P AA
Sbjct  320   SEAGAVN---YITAPSAA  334



>gb|ADM92589.1| galactinol synthase [Coffea arabica]
 emb|CDP15227.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 178/289 (62%), Positives = 219/289 (76%), Gaps = 13/289 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRR+LV QGCIVRE+EP++P
Sbjct  28   TFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDVPEEHRRILVNQGCIVREIEPVHP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLF+L  GYFYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFELPGGYFYAVKD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP  L G +P +YFN GMF+++P++ TY  LL+ 
Sbjct  147  CFCEKTWSHTPQYQIGYCQQCPDKVQWPQEL-GPKPPLYFNAGMFVYEPSLPTYDDLLST  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNMFFRD Y+P+P  YN+++ MLWRH + VEL K KVVHYC  G+K
Sbjct  206  LKITPPTPFAEQDFLNMFFRDVYRPIPPTYNLVLAMLWRHRENVELEKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGA  965
            PWRYTGKE NM RE++K+LVK WW+IYND++LDYK      +V   G A
Sbjct  266  PWRYTGKEANMDREDIKVLVKNWWDIYNDEALDYKRSSANVAVTTRGEA  314



>ref|XP_010415009.1| PREDICTED: galactinol synthase 2-like [Camelina sativa]
Length=336

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 230/322 (71%), Gaps = 28/322 (9%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKAESKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVF+N+DHLFDL DG FYAV D
Sbjct  88    P-ENQTEFAMAYYVINYSKLRIWKFVEYNKMIYLDGDIQVFDNIDHLFDLPDGQFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A LG +P +YFN GMF+++P++ TY  LL+ 
Sbjct  147   CFCEKTWSHSPQYKIGYCQQCPEKVTWPEAKLGPKPPLYFNAGMFVYEPSLPTYHNLLDT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ +EL + KVVHYC  GAK
Sbjct  207   VKVVPPTLFAEQDFLNMYFKDIYKPIPSAYNLVLAMLWRHPENIELDQVKVVHYCAAGAK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TG+E NM R ++KMLVKKWW+IYND+SLDYK          + G  H+ +  + +F
Sbjct  267   PWRFTGEEENMNRADIKMLVKKWWDIYNDESLDYK---------NIIGDGHKKQETLQQF  317

Query  999   ----SNTGNLTEPRYIKGPPAA  1052
                 S  G L   + +K P AA
Sbjct  318   VEALSQAGVL---QSVKAPSAA  336



>ref|XP_010069751.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW58191.1| hypothetical protein EUGRSUZ_H00906 [Eucalyptus grandis]
Length=337

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 232/318 (73%), Gaps = 16/318 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG GDYVKGVVGL KGLR+  SAYP+VVAV PDVPAEHR +L  QGC+VRE+EP+YP
Sbjct  25    TFLAGTGDYVKGVVGLAKGLRRARSAYPLVVAVLPDVPAEHRLILEEQGCVVREIEPVYP  84

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  85    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLEDGYFYAVMD  143

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP  + G  P++YFN GMF+++P+++TY  LL+ 
Sbjct  144   CFCEKTWSHTPQYAIGYCQQCPDRVRWPDEM-GPPPALYFNAGMFVYEPSLATYHDLLSA  202

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT+FAEQDFLNM+FR+ YKP+P  YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  203   VKVTPPTSFAEQDFLNMYFRNVYKPIPLAYNLILAMLWRHPENVELEKVKVVHYCAAGSK  262

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IY D+SLDYK     A+  +  G A  V    P F
Sbjct  263   PWRYTGKEENMQREDIKMLVKKWWDIYEDESLDYKKKAAVAAAAQ--GEAEPVNME-PFF  319

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +      E +Y+  P AA
Sbjct  320   AALSEAGEVQYVTAPSAA  337



>ref|XP_009619498.1| PREDICTED: galactinol synthase 2 [Nicotiana tomentosiformis]
Length=334

 Score =   318 bits (815),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 225/309 (73%), Gaps = 17/309 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  SAYP+VVA+ PDVP EHRR+L+ QGCIVRE+EP+YP
Sbjct  29    TFLAGNGDYVKGVVGLAKGLRKAKSAYPLVVAILPDVPEEHRRILINQGCIVREIEPVYP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL D YFY V D
Sbjct  89    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDDYFYGVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + W T  LG +P +YFN GMF+F+P++S Y  LL  
Sbjct  148   CFCEKTWSHTPQYKVGYCQQCPDKVQW-TEELGPKPPLYFNAGMFVFEPSLSIYDDLLTT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD LNMFFR  YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  207   LKVTPPTPFAEQDLLNMFFRVVYKPIPNKYNLVLAMLWRHPENVDLDKVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW+IYND+SL+YK     A+V  +   A + + A+ + 
Sbjct  267   PWRYTGEEENMDREDIKMLVKKWWDIYNDESLNYK----NANVTAVDAEADKFKAALTKA  322

Query  999   SNTGNLTEP  1025
                  +T P
Sbjct  323   GVVHYITAP  331



>gb|AFG26331.1| galactinol synthase [Gossypium hirsutum]
Length=343

 Score =   318 bits (815),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 217/274 (79%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP +HR++LVAQGCIV+++EP+ P
Sbjct  33   TFLAGNGDYVKGVVGLAKGLRKVKSKYPLVVAVLPDVPEDHRKILVAQGCIVKQIEPVLP  92

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  93   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFDNIDHLFDVEDGYFYAVMD  151

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A LG +P +YFN GMF+++PN+STY +LL  
Sbjct  152  CFCEKTWSHTPQYKIGYCQQCPDKVEWP-AHLGPKPPLYFNAGMFVYEPNLSTYYQLLAT  210

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
            FK+TPPT FAEQD+LNMFFRD Y+P+P +YN+++ MLWRHP+ V+  KAKVVHYC  G+K
Sbjct  211  FKVTPPTPFAEQDYLNMFFRDIYRPIPPIYNLVMAMLWRHPENVDAEKAKVVHYCAAGSK  270

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWR+TGKE NM RE++K LV KWW+IYND SLDY
Sbjct  271  PWRFTGKEENMDREDIKKLVTKWWDIYNDASLDY  304



>ref|XP_002891985.1| hypothetical protein ARALYDRAFT_474819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68244.1| hypothetical protein ARALYDRAFT_474819 [Arabidopsis lyrata subsp. 
lyrata]
Length=338

 Score =   318 bits (814),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 232/323 (72%), Gaps = 28/323 (9%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG GDYVKGVVGL KGLRK  S YP+VVAV PDVP +HR+ LV QGC+V+E+EP+YP
Sbjct  28    TFLAGTGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL +G FYAV D
Sbjct  88    P-ENQTEFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFDNIDHLFDLPNGQFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTA-LLGARPSMYFNGGMFMFQPNISTYTRLLN  635
             C CE+           + + C + + WP A L+G +P +YFN GMF+++PN+STY  LL 
Sbjct  147   CFCEKTWSHSPQYKIGYCQQCPDKVTWPEAELIGPKPPLYFNAGMFVYEPNLSTYHSLLE  206

Query  636   HFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGA  815
               K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL + KVVHYC  GA
Sbjct  207   TVKVVPPTLFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELDQVKVVHYCAAGA  266

Query  816   KPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPR  995
             KPWR+TG+E NM RE++ MLVKKWW+IYND+SLDYK          + G  H+ +  + +
Sbjct  267   KPWRFTGEEENMDREDINMLVKKWWDIYNDESLDYKNV--------VIGDGHKKQQTLQQ  318

Query  996   F----SNTGNLTEPRYIKGPPAA  1052
             F    S  G L   +Y+K P AA
Sbjct  319   FIEALSEAGVL---QYVKAPSAA  338



>ref|XP_004984579.1| PREDICTED: galactinol synthase 2-like [Setaria italica]
Length=340

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 233/321 (73%), Gaps = 22/321 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDY KGVVGL KGLRKVGSAYP+VVAV PDVP  HRR+LV+QGCIVRE+EP+YP
Sbjct  28    TFLAGDGDYWKGVVGLAKGLRKVGSAYPLVVAVLPDVPESHRRILVSQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVFEN+D LF+L  G FYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFENIDELFELEKGSFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WPTA LG  P++YFN GMF+ +P+++T   LL+ 
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPDRVAWPTAELGPPPALYFNAGMFVHEPSMATAKALLDT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNMFFR++YKP+P VYN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  207   LRVTPPTPFAEQDFLNMFFREQYKPIPNVYNLVLAMLWRHPENVQLEKVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW IYND+SLD+K       +  L   A EVE AV + 
Sbjct  267   PWRYTGKEANMDREDIKMLVNKWWNIYNDESLDFK------GLPALPADADEVE-AVAKK  319

Query  999   SNTGNLTEP---RYIKGPPAA  1052
                  L E    +Y+  P AA
Sbjct  320   PIRAALAEAGTMKYVTAPSAA  340



>ref|XP_006433574.1| hypothetical protein CICLE_v10001308mg [Citrus clementina]
 gb|ESR46814.1| hypothetical protein CICLE_v10001308mg [Citrus clementina]
Length=416

 Score =   320 bits (821),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 172/277 (62%), Positives = 219/277 (79%), Gaps = 13/277 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGLVKGLRK  S YP++VA+ PDVP EHR++L+ QGC +RE+EP+YP
Sbjct  106  TFLAGDGDYWKGVVGLVKGLRKAKSKYPLLVAMLPDVPEEHRKILIEQGCFLREIEPVYP  165

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  166  P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  224

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A LG +P++YFN GMF+F+P++STY  LL  
Sbjct  225  CFCEKTWSHTPQFKIGYCQQCPDKVKWP-AELGPKPALYFNAGMFVFEPSLSTYHDLLET  283

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLNM+FRD Y+P+P +YN++V MLWRHP+ VE  KAKVVHYC  G+K
Sbjct  284  VQITTPTSFAEQDFLNMYFRDIYRPIPPIYNLVVAMLWRHPENVEADKAKVVHYCAAGSK  343

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYY  929
            PWR+TGKE NM RE++KMLV+KWW+I+ND+SLDYK Y
Sbjct  344  PWRFTGKEENMQREDIKMLVQKWWDIFNDESLDYKNY  380



>ref|XP_004494448.1| PREDICTED: galactinol synthase 1-like [Cicer arietinum]
Length=339

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 226/318 (71%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGV+GL KGLRKV +AYP+VVAV PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  29    TFLAGNGDYVKGVIGLAKGLRKVKTAYPLVVAVLPDVPEEHREMLESQGCIVREIEPVYP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGY Y V D
Sbjct  89    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYENIDHLFDLQDGYLYGVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C   + WP  + G  PS+YFN GMF+F+P+I TY  LLN 
Sbjct  148   CFCEKTWSHTPQYKIGYCQQCPNKVQWPKEM-GQPPSLYFNAGMFVFEPSIETYHDLLNT  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP  VEL K KVVHYC  G+K
Sbjct  207   LQVTPPTPFAEQDFLNMYFKDIYKPIPLDYNLVLAMLWRHPQNVELRKVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KWW++YND SLDY   K      E      E E  V   
Sbjct  267   PWRYTGKEENMQREDIKMLVQKWWDVYNDSSLDYS--KSLNGSSETQRNDVENEPFVHAL  324

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G++   +Y+  P AA
Sbjct  325   SEVGHV---QYVTAPSAA  339



>ref|XP_010910683.1| PREDICTED: galactinol synthase 2-like [Elaeis guineensis]
Length=347

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 214/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRKV SAYP+VVAV PDVP +HRR+L +QGC+VRE+EP+YP
Sbjct  30   TFLAGDGDYWKGVVGLAKGLRKVRSAYPLVVAVLPDVPEDHRRILRSQGCLVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD+D+QV++N+DHLFDL  GYFYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWEFVEYQKMIYLDADIQVYDNIDHLFDLPGGYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP   LG  P++YFN GMF+ +P+++T   LL  
Sbjct  149  CFCEKTWSHTPQYKIGYCQQCPDKVSWPEDKLGPPPALYFNAGMFVHEPSLATAESLLKT  208

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K TPPT FAEQDFLNMFF+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  209  VKSTPPTPFAEQDFLNMFFKDIYKPIPGVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  268

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWWEIYND+SLDYK
Sbjct  269  PWRYTGKEANMDREDIKMLVKKWWEIYNDESLDYK  303



>gb|KHG28122.1| Glycogenin-1 [Gossypium arboreum]
Length=343

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 216/274 (79%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP +HR++LVAQGCIV+++EP+ P
Sbjct  33   TFLAGNGDYVKGVVGLAKGLRKVKSKYPLVVAVLPDVPEDHRKILVAQGCIVKQIEPVLP  92

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  93   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFDNIDHLFDVEDGYFYAVMD  151

Query  492  CVCEEH-----------GEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+             + C + + WP A LG +P +YFN GMF+++PN+STY +LL  
Sbjct  152  CFCEKTWSHTPQYKIGFCQQCPDKVEWP-AHLGPKPPLYFNAGMFVYEPNLSTYYQLLAT  210

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
            FK+TPPT FAEQD+LNMFFRD Y+P+P +YN+++ MLWRHP+ V+  KAKVVHYC  G+K
Sbjct  211  FKVTPPTPFAEQDYLNMFFRDIYRPIPPIYNLVMAMLWRHPENVDAEKAKVVHYCAAGSK  270

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWR+TGKE NM RE++K LV KWW+IYND SLDY
Sbjct  271  PWRFTGKEENMDREDIKKLVTKWWDIYNDASLDY  304



>gb|AGW51291.1| putative galactinol synthase [Vicia hirsuta]
Length=325

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV + YP+VVAV PDVPAEHR +L +QGCIVRE+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVQTIYPLVVAVLPDVPAEHRDILTSQGCIVREIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W F EY KMIYLD D+QVFEN+DHLFDL + YFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWAFEEYEKMIYLDGDIQVFENIDHLFDLPNDYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C   + WPT L G +P +YFN GMF++QPN+ TY  LL  
Sbjct  145  CFCEATWGHTKQYEIGYCQQCPNKVHWPTHL-GPKPPLYFNAGMFVYQPNMDTYRDLLQK  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             +LT PT+FAEQDFLNM+F D+YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LQLTKPTSFAEQDFLNMYFSDKYKPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NMGRE++KMLVKKWW++Y D++LDYK
Sbjct  264  PWRYTGEEENMGREDIKMLVKKWWDVYEDETLDYK  298



>dbj|BAE99313.1| hypothetical protein [Arabidopsis thaliana]
Length=334

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 225/320 (70%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC+VRE+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVVREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSKMIYLD+D+QVF+N+DHLFDL+D YFYAV D
Sbjct  87    QDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFDLSDAYFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSPLTYESLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND+SLD+K                + E  V + 
Sbjct  266   PWRYTGEEANMDREDIKMLVDKWWDVYNDESLDFK-----------SKIPADAEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EP   Y   P AA
Sbjct  315   SILASVLEPEMTYFPAPSAA  334



>emb|CAN74708.1| hypothetical protein VITISV_018010 [Vitis vinifera]
Length=325

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 225/298 (76%), Gaps = 13/298 (4%)
 Frame = +3

Query  63   MAPDASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdv  242
            MAP  ++   +   A+   RAYVTFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDV
Sbjct  1    MAPTLASATGLAKAASISSRAYVTFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDV  60

Query  243  paEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSD  422
            PAEHRR+L  QGC+VRE+EP+ P  E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D
Sbjct  61   PAEHRRILEDQGCVVREIEPVNPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGD  119

Query  423  MQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLGARPS  569
            +QVF N+DHLFDL DGYFYAV DC CE+           + + C E + WP A +G  P 
Sbjct  120  IQVFSNIDHLFDLDDGYFYAVMDCFCEKTWSNSPQYKIGYCQQCPEKVKWP-AEMGPAPP  178

Query  570  MYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNML  749
            +YFN GMF+F+P +S Y  LL   K+T PT+FAEQD+LNMFFRD YKP+P  YN+++ ML
Sbjct  179  LYFNAGMFVFEPCLSVYDDLLTTLKITTPTSFAEQDYLNMFFRDIYKPIPPTYNLVLAML  238

Query  750  WRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            WRHP+ ++L +  VVHYC  G+KPWRYTGKE NM RE++KMLVKKWW+IYND+SLDY+
Sbjct  239  WRHPENIDLQRTNVVHYCAAGSKPWRYTGKEENMDREDIKMLVKKWWDIYNDESLDYR  296



>ref|XP_011023828.1| PREDICTED: galactinol synthase 2-like [Populus euphratica]
Length=334

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/286 (60%), Positives = 219/286 (77%), Gaps = 13/286 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRK  S YP+VVA+ PDVP EHRR+LV+QGCIVRE+EP++P
Sbjct  29   TFLAGDGDYWKGVVGLAKGLRKAESRYPLVVAILPDVPEEHRRILVSQGCIVREIEPVHP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D++VF+++DHLFD+ DG+FYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIKVFDSIDHLFDMPDGFFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G +P +YFN GMF+++PN+STY  LL  
Sbjct  148  CFCEKTWSNSPQNKIVYCQQCPDKVQWP-AEMGPKPPLYFNAGMFVYEPNLSTYHDLLEA  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNMFFRD YKP+P  YN+ + +LWRHP+ + L K KVVHYC  G+K
Sbjct  207  LKITPPTLFAEQDFLNMFFRDVYKPIPSAYNLELALLWRHPENINLDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYEL  956
            PWRYTGKE NM RE++KMLV+KWW+IYND+SLD+K     +S  EL
Sbjct  267  PWRYTGKEENMDREDIKMLVQKWWDIYNDESLDHKNTVVASSGSEL  312



>ref|XP_010042161.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW84968.1| hypothetical protein EUGRSUZ_B01793 [Eucalyptus grandis]
Length=332

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 227/318 (71%), Gaps = 20/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP EHR++LV QGC+VRE+EP+YP
Sbjct  24    TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEEHRKILVDQGCVVREIEPVYP  83

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL +G FYAV D
Sbjct  84    P-ENQTQFAMAYYVINYSKLRIWEFLEYSKMIYLDGDIQVFDNIDHLFDLPNGSFYAVMD  142

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP    G +PS+YFN GMF+++PN+ TY  LL  
Sbjct  143   CFCEKTWSHTPQFQIGYCQQCPDKIQWPDHA-GPKPSLYFNAGMFVYEPNLKTYRDLLEK  201

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT+FAEQDFLN +F+D YKP+P VYN ++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  202   LKITPPTSFAEQDFLNEYFKDIYKPIPNVYNFVLAMLWRHPENVELDKVKVVHYCAAGSK  261

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW+IY+D+SLDY+    R    +       +E  +   
Sbjct  262   PWRYTGEEQNMDREDIKMLVKKWWDIYDDESLDYRNIVAR----DEAAKRANLERFLAAL  317

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +    Y+  P AA
Sbjct  318   SEAGVVP---YVPAPSAA  332



>ref|XP_008801762.1| PREDICTED: galactinol synthase 2-like isoform X2 [Phoenix dactylifera]
Length=345

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 210/275 (76%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKG VGL KGLRKVGSAYP+VVAV PDVP +HRRLL +QGCIVRE+EP+YP
Sbjct  27   TFLAGAGDYVKGAVGLAKGLRKVGSAYPLVVAVLPDVPEDHRRLLESQGCIVREIEPIYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKM+YLD+D+QV+EN+D LFDL DGYFYAV D
Sbjct  87   P-ENQTKFAMAYYVINYSKLRIWEFVEYSKMVYLDADIQVYENIDELFDLPDGYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C E  PWP   LG  PS+YFN GMF+F+P I+T   LL  
Sbjct  146  CFCERTWSHTAQYRVGYCQQCPERAPWPADELGPPPSLYFNAGMFVFEPGIATADALLAT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T P  FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  LKVTEPAPFAEQDFLNMFFRDIYKPIPLGYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM R ++K LV++WW+IYND+SLDYK
Sbjct  266  PWRYTGKEENMDRADIKELVRRWWDIYNDESLDYK  300



>gb|ACI62176.1| galactinol synthase [Boea hygrometrica]
Length=334

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/303 (60%), Positives = 224/303 (74%), Gaps = 21/303 (7%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKV S YP+VVAV PDVPAEHRR+LV QGCIVRE+EP+YP
Sbjct  30   TFLAGDGDYVKGVVGLAKGLRKVDSVYPLVVAVLPDVPAEHRRILVEQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL +GYFYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLENGYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP  + G +PS+YFN GMF+F+P++  Y  LL+ 
Sbjct  149  CFCEKTWSHTTQYKIGYCQQCPEKVQWPKHV-GPKPSLYFNAGMFVFEPSLPIYHDLLHI  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNMFF+D Y+P+P VYN+++ MLWRHP+ V L + KVVHYC  G+K
Sbjct  208  LKITPPTPFAEQDFLNMFFKDIYRPIPNVYNLVLAMLWRHPENVNLEEVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKY--------YKQRASVYELGGAAHE  974
            PWRYTG+E NM RE++KMLVKKW EIY D++LDY +         KQ  +V    G  H 
Sbjct  268  PWRYTGQEANMQREDIKMLVKKWTEIYEDETLDYTFDSAVQAVPEKQLTAVLTDAGGVHF  327

Query  975  VET  983
            + T
Sbjct  328  IAT  330



>ref|XP_010042153.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW84967.1| hypothetical protein EUGRSUZ_B01791 [Eucalyptus grandis]
Length=332

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP EHR++LV QGC+VRE+EP+YP
Sbjct  24   TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEEHRKILVDQGCVVREIEPVYP  83

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSK+IYLD D+QVF+N+DHLFDL +G+FYAV D
Sbjct  84   P-ENQTQFAMAYYVINYSKLRIWEFLEYSKLIYLDGDIQVFDNIDHLFDLPNGFFYAVMD  142

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP    G +PS+YFN GMF+++PN+ TY  LL  
Sbjct  143  CFCEKTWSHTPQYQIGYCQQCPDRIQWPDHA-GPKPSLYFNAGMFVYEPNLKTYRDLLEK  201

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLN +F+D YKP+P VYN ++ MLWRHP  VEL+K KVVHYC  G+K
Sbjct  202  LKITPPTSFAEQDFLNEYFKDIYKPIPNVYNFVLAMLWRHPKNVELNKVKVVHYCAAGSK  261

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++KMLVKKWW+IY+D+SLDY+
Sbjct  262  PWRYTGEEQNMDREDIKMLVKKWWDIYDDESLDYR  296



>ref|XP_002279157.1| PREDICTED: galactinol synthase 2 [Vitis vinifera]
Length=340

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 230/320 (72%), Gaps = 20/320 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
              FLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP EH R L +QGCIVRE+ P+Y 
Sbjct  28    AFLAGNGDYVKGVVGLAKGLRKVKSDYPLVVAVLPDVPVEHSRELESQGCIVREIVPVYK  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             +   +  FA  YYV+NYSK++ W+F EYSKMIYLD D+QV++N+DHLF+L DG+FYAV D
Sbjct  88    N---QTQFAMAYYVINYSKIRIWEFVEYSKMIYLDGDIQVYDNIDHLFELPDGHFYAVMD  144

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+             + C E + WP A LG  PS+YFN GMF+F+P++STY  L   
Sbjct  145   CFCEKTWSHTPQYKIGDCQQCPEKVQWP-AELGQPPSLYFNAGMFVFEPSLSTYEDLWET  203

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TP T FAEQDFLNM+FRD YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204   LRITPATPFAEQDFLNMYFRDVYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  263

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYE--LGGAAHEVETAVP  992
             PWRYTGKE+NM RE++KMLV KWWEIYND+SLDYK  +  A+ Y   L G    +E  + 
Sbjct  264   PWRYTGKEDNMQREDIKMLVNKWWEIYNDKSLDYKKTRMMANDYSSVLPGEQVNLEPFIA  323

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               S  G++    +++ P AA
Sbjct  324   ALSEVGHV---EFVRAPSAA  340



>ref|XP_006392406.1| hypothetical protein EUTSA_v10024122mg [Eutrema salsugineum]
 gb|AAM19710.1|AF499723_1 galactinol synthase-like protein [Eutrema halophilum]
 gb|ESQ29692.1| hypothetical protein EUTSA_v10024122mg [Eutrema salsugineum]
Length=337

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 228/319 (71%), Gaps = 21/319 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
              FLAGNGD+VKGVV L KGLRK  S YP+VVAV PDVP +H++ LV QGC+++E+EP+YP
Sbjct  28    AFLAGNGDFVKGVVALAKGLRKAKSKYPLVVAVLPDVPEDHQKQLVEQGCVIKEIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL +G+FYA  D
Sbjct  88    P-ENQTDFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFENIDHLFDLPNGHFYAAKD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A LG +P +YFN GMF+++PN+ TY  LL  
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPDKVTWPEAELGPKPPLYFNAGMFVYEPNLYTYQNLLET  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT+FAEQDFLNM+F+D Y P+P VYN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  207   LKVVPPTSFAEQDFLNMYFKDIYTPIPGVYNLVMAMLWRHPENVELEQVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAH-EVETAVPR  995
             PWR+TGKE NM RE++K+LVKKWW+IYND+SLDYK       + E GG      +  V  
Sbjct  267   PWRFTGKEENMEREDIKVLVKKWWDIYNDKSLDYK-----NVIGEKGGNPDLHKKQLVEA  321

Query  996   FSNTGNLTEPRYIKGPPAA  1052
              S  G L   +Y+K P AA
Sbjct  322   LSEAGVL---QYVKAPSAA  337



>ref|NP_001049939.1| Os03g0316200 [Oryza sativa Japonica Group]
 gb|ABF95621.1| galactinol synthase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11853.1| Os03g0316200 [Oryza sativa Japonica Group]
 dbj|BAG92707.1| unnamed protein product [Oryza sativa Japonica Group]
Length=341

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 233/320 (73%), Gaps = 18/320 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDY KGVVGL KGLRKVGSAYP+VVAV PDVP  HRR+L++QGCIVRE+EP+YP
Sbjct  27    TFLAGDGDYWKGVVGLAKGLRKVGSAYPLVVAVLPDVPESHRRILISQGCIVREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVF+N+D LF+L  G+FYAV D
Sbjct  87    P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFDNIDELFELPKGHFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WPTA LG  P++YFN GMF+ +P+++T   LL+ 
Sbjct  146   CFCEKTWSHTPQYQIGYCQQCPDKVAWPTAELGPPPALYFNAGMFVHEPSMATAKSLLDT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++T PT FAEQDFLNMFFR++YKP+P +YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   LRVTTPTPFAEQDFLNMFFREQYKPIPLIYNLVLAMLWRHPENVQLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAV--P  992
             PWRYTGKE NM RE++KMLVKKWW++YND SLD+K     A+  +    A EVE A   P
Sbjct  266   PWRYTGKEANMDREDIKMLVKKWWDVYNDGSLDFKGLPPIAAADD----ADEVEAAAKKP  321

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               +        +Y+  P AA
Sbjct  322   LRAALAEARTVKYVTAPSAA  341



>gb|ACA04032.1| galactinol synthase 3 [Populus trichocarpa]
Length=337

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRK  S YP+VVA+ PDVP EHR +LV+QGCIVRE+EP++P
Sbjct  29   TFLAGDGDYWKGVVGLAKGLRKAKSKYPLVVAILPDVPEEHRMILVSQGCIVREIEPVHP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA PYYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  89   P-ENQTQFAMPYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDMPDGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G +P +YFN GMF+++PN+STY  LL  
Sbjct  148  CFCEKTWSNSPQYKIGYCQQCPDKVQWP-AEMGPKPPLYFNAGMFVYEPNLSTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ + L K KVVHYC  G+K
Sbjct  207  VKVTSPTLFAEQDFLNMFFRDVYKPIPSDYNLVLAMLWRHPENINLDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++KM+V KWW+IY D+SLDYK
Sbjct  267  PWRFTGKEENMDREDIKMVVNKWWDIYRDESLDYK  301



>ref|XP_010475767.1| PREDICTED: galactinol synthase 3-like [Camelina sativa]
 ref|XP_010475768.1| PREDICTED: galactinol synthase 3-like [Camelina sativa]
 ref|XP_010475769.1| PREDICTED: galactinol synthase 3-like [Camelina sativa]
Length=336

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 218/276 (79%), Gaps = 13/276 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVPA+HRR LV QGCIV++++P+YP
Sbjct  21   TFLAGNGDYVKGVVGLAKGLRKANSKYPLVVAVLPDVPADHRRQLVDQGCIVKDIQPVYP  80

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYVLNYSKL+ W+F EYS++IYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  81   PDN-QTQFAMAYYVLNYSKLRIWEFVEYSRLIYLDGDIQVFENIDHLFDLPDGSFYAVKD  139

Query  492  CVCEE-----------HGEPCKEILPWP-TALLGARPSMYFNGGMFMFQPNISTYTRLLN  635
            C CE+           + + C + + WP T  +G +P +YFN GMF+++P++STY  LL 
Sbjct  140  CFCEKTWSHTPQYKIGYCQQCPDKVTWPETEQVGPKPPLYFNAGMFVYEPSLSTYYNLLE  199

Query  636  HFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGA  815
              K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL++AKVVHYC  GA
Sbjct  200  TLKVVPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELNEAKVVHYCAAGA  259

Query  816  KPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            KPWR+TG+E NM RE++KMLV+KWW+IYND+SLDYK
Sbjct  260  KPWRFTGQEENMEREDIKMLVEKWWDIYNDESLDYK  295



>ref|XP_011023826.1| PREDICTED: galactinol synthase 2-like [Populus euphratica]
Length=336

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 214/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRK  S YP+VVA+ PDVP EHR +LV+QGCIVRE+EP++P
Sbjct  29   TFLAGDGDYWKGVVGLAKGLRKAKSKYPLVVAILPDVPEEHRMILVSQGCIVREIEPVHP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA PYYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  89   P-ENQTRFAMPYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDMPDGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G +P +YFN GMF+++PN+STY  LL  
Sbjct  148  CFCEKTWSNSPQYKIGYCQQCPDKVHWP-AEMGPKPPLYFNAGMFVYEPNLSTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ + L K KVVHYC  G+K
Sbjct  207  VKVTSPTLFAEQDFLNMFFRDVYKPIPSDYNLVLAMLWRHPENINLDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++KMLV KWW+IY+D+SLDYK
Sbjct  267  PWRFTGKEENMDREDIKMLVNKWWDIYHDESLDYK  301



>ref|XP_002319473.2| galactinol synthase family protein [Populus trichocarpa]
 gb|EEE95396.2| galactinol synthase family protein [Populus trichocarpa]
Length=337

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRK  S YP+VVA+ PDVP EHR +LV+QGCIVRE+EP++P
Sbjct  29   TFLAGDGDYWKGVVGLAKGLRKAKSKYPLVVAILPDVPEEHRMILVSQGCIVREIEPVHP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA PYYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  89   P-ENQTRFAMPYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDMPDGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G +P +YFN GMF+++PN+STY  LL  
Sbjct  148  CFCEKTWSNSPQYKIGYCQQCPDKVQWP-AEMGPKPPLYFNAGMFVYEPNLSTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ + L K KVVHYC  G+K
Sbjct  207  VKVTSPTLFAEQDFLNMFFRDVYKPIPSDYNLVLAMLWRHPENINLDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++KM+V KWW+IY D+SLDYK
Sbjct  267  PWRFTGKEENMDREDIKMVVNKWWDIYQDESLDYK  301



>ref|XP_010039524.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW45871.1| hypothetical protein EUGRSUZ_L00234 [Eucalyptus grandis]
Length=332

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP EHR++LV QGC+VRE+EP+YP
Sbjct  24   TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEEHRKILVDQGCVVREIEPVYP  83

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSK+IYLD D+QVF+N+DHLFDL +G+FYAV D
Sbjct  84   P-ENQTQFAMAYYVINYSKLRIWEFLEYSKLIYLDGDIQVFDNIDHLFDLPNGFFYAVMD  142

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP    G +PS+YFN GMF+++PN+ TY  LL  
Sbjct  143  CFCEKTWSHTPQFQIGYCQQCPDKIQWPDHA-GPKPSLYFNAGMFVYEPNLKTYRDLLEK  201

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLN +F+D YKP+P VYN ++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  202  LKITPPTSFAEQDFLNEYFKDIYKPIPNVYNFVLAMLWRHPENVELDKVKVVHYCAAGSK  261

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++KMLVKKWW+IY+D+SLDY+
Sbjct  262  PWRYTGEEQNMDREDIKMLVKKWWDIYDDESLDYR  296



>ref|NP_176250.1| galactinol synthase 4 [Arabidopsis thaliana]
 sp|O22693.1|GOLS4_ARATH RecName: Full=Galactinol synthase 4; Short=AtGolS4; Short=GolS-4 
[Arabidopsis thaliana]
 gb|AAB71970.1| nearly identical to rice water stress induced protein gp|D26537|537404 
[Arabidopsis thaliana]
 gb|AAY56403.1| At1g60470 [Arabidopsis thaliana]
 gb|AEE33692.1| galactinol synthase 4 [Arabidopsis thaliana]
 gb|AHL38898.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=334

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 225/320 (70%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC+VRE+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVVREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSKMIYLD+D+QVF+N+DHLFDL+D YFYAV D
Sbjct  87    PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFDLSDAYFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSPLTYESLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND+SLD+K                + E  V + 
Sbjct  266   PWRYTGEEANMDREDIKMLVDKWWDVYNDESLDFK-----------SKIPADAEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EP   Y   P AA
Sbjct  315   SILASVLEPEMTYFPAPSAA  334



>gb|AEJ87261.1| galactinol synthase 2-2 [Populus trichocarpa]
 gb|AGT50330.1| galactinol synthase 2 [Populus trichocarpa]
Length=337

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRK  S YP+VVA+ PDVP EHR +LV+QGCIVRE+EP++P
Sbjct  29   TFLAGDGDYWKGVVGLAKGLRKAKSKYPLVVAILPDVPEEHRMMLVSQGCIVREIEPVHP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA PYYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  89   P-ENQTRFAMPYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDMPDGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G +P +YFN GMF+++PN+STY  LL  
Sbjct  148  CFCEKTWSNSPQYKIGYCQQCPDKVQWP-AEMGPKPPLYFNAGMFVYEPNLSTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ + L K KVVHYC  G+K
Sbjct  207  VKVTSPTLFAEQDFLNMFFRDVYKPIPSDYNLVLAMLWRHPENINLDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++KM+V KWW+IY D+SLDYK
Sbjct  267  PWRFTGKEENMDREDIKMVVNKWWDIYQDESLDYK  301



>ref|XP_010039532.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW45879.1| hypothetical protein EUGRSUZ_L00248 [Eucalyptus grandis]
Length=337

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 217/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVA+ PDVPA+HR++LV QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKANSKYPLVVAILPDVPADHRKILVDQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL +G+FYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPNGFFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP  + G +PS+YFN GMF+++PN+ TY  LL  
Sbjct  148  CFCEKTWSHTPQYEVGYCQQCPDKVQWPDHV-GPKPSLYFNAGMFVYEPNLDTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPTAFAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  VKITPPTAFAEQDFLNMYFKDIYKPIPNAYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM R+++KMLVKKW +IY+D+SLDYK
Sbjct  267  PWRYTGEEQNMDRDDIKMLVKKWRDIYDDESLDYK  301



>ref|XP_006382305.1| galactinol synthase family protein [Populus trichocarpa]
 gb|AGT50331.1| galactinol synthase 3 [Populus trichocarpa]
 gb|ERP60102.1| galactinol synthase family protein [Populus trichocarpa]
Length=334

 Score =   316 bits (809),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 190/346 (55%), Positives = 242/346 (70%), Gaps = 28/346 (8%)
 Frame = +3

Query  63    MAPD-----ASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvva  227
             MAPD     A+N   +V +A+    AYVTFLAG+GDY KGVVGL KGLRK    YP+VVA
Sbjct  1     MAPDITATLANNTNSLVKQASISSCAYVTFLAGDGDYWKGVVGLAKGLRKAKCNYPLVVA  60

Query  228   vwpdvpaEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMI  407
             + PDVP EHR++L +QGCIVRE+EP+ P  E +  FA  YYV+NYSKL+ W+F EYSKMI
Sbjct  61    ILPDVPEEHRKILASQGCIVREIEPVNPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMI  119

Query  408   YLDSDMQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALL  554
             YLD D+QVF+++DHLFD+ DGYFYA  DC CE+           + + C + + WP A +
Sbjct  120   YLDGDIQVFDSIDHLFDMPDGYFYAAMDCFCEKTWSNSPQYKIGYCQQCPDKVHWP-AEM  178

Query  555   GARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNM  734
             G +P +YFN GMF+++PN+STY  LL   K+TPPT FAEQDFLNMFFRD YKP+P  YN+
Sbjct  179   GPKPPLYFNAGMFVYEPNLSTYHDLLETLKVTPPTLFAEQDFLNMFFRDVYKPIPSDYNL  238

Query  735   LVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSL  914
             ++ +LWRHP+ + L K KVVHYC  G+KPWRYTGKE+NM RE++KMLV KWW+IY+D+SL
Sbjct  239   VLALLWRHPENINLDKVKVVHYCAAGSKPWRYTGKEDNMDREDIKMLVNKWWDIYHDESL  298

Query  915   DYKYYKQRASVYELGGAAHEVETAVPRFSNTGNLTEPRYIKGPPAA  1052
             DYK      +V    GA  E++  +   S  G      YI  P AA
Sbjct  299   DYK-----NTVVAAAGA--ELQPFLAALSEAG---IAHYITAPSAA  334



>ref|NP_172406.1| galactinol synthase 3 [Arabidopsis thaliana]
 sp|O80518.1|GOLS3_ARATH RecName: Full=Galactinol synthase 3; Short=AtGolS3; Short=GolS-3 
[Arabidopsis thaliana]
 gb|AAK48973.1|AF370546_1 water stress induced protein-like protein [Arabidopsis thaliana]
 gb|AAC33195.1| Similar to rice water stress induced protein gi|537404 [Arabidopsis 
thaliana]
 dbj|BAB78532.1| galactinol synthase [Arabidopsis thaliana]
 gb|AAM10014.1| similar to rice water stress induced protein [Arabidopsis thaliana]
 gb|AEE28432.1| galactinol synthase 3 [Arabidopsis thaliana]
 gb|AHL38957.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=334

 Score =   316 bits (809),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 223/300 (74%), Gaps = 15/300 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKGVVGL KGLRK  S YP+VVAV PDVPA+HRR L+ QGC+++E++P+YP
Sbjct  20   TFLAGTGDYVKGVVGLAKGLRKTKSKYPLVVAVLPDVPADHRRQLLDQGCVIKEIQPVYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYVLNYSKL+ W+F EYSK+IYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  80   PDN-QTQFAMAYYVLNYSKLRIWKFVEYSKLIYLDGDIQVFENIDHLFDLPDGNFYAVKD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP + LG +P +YFN GMF+++P++ TY  LL  
Sbjct  139  CFCEKTWSHTPQYKIGYCQQCPDKVTWPESELGPKPPLYFNAGMFVYEPSLPTYYNLLET  198

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL++AKVVHYC  GAK
Sbjct  199  LKVVPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELNEAKVVHYCAAGAK  258

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
            PWR+TG+E NM RE++KMLV+KWW+IYND+SLDYK +       E     H     +P+F
Sbjct  259  PWRFTGQEGNMEREDIKMLVEKWWDIYNDESLDYKNFNVHCGQKE---DVHRKPKTLPQF  315



>gb|KDP27974.1| hypothetical protein JCGZ_19054 [Jatropha curcas]
Length=323

 Score =   315 bits (808),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  +AYP+VVAV PDVP EHR++L +QGCI+RE+EP+YP
Sbjct  19   TFLAGNGDYVKGVVGLAKGLRKTKTAYPLVVAVLPDVPEEHRQILESQGCIIREIEPVYP  78

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVFEN+DHLFD  +GYFYAV D
Sbjct  79   P-ENQTQFAMAYYVINYSKLRIWEFVEYEKMIYLDGDIQVFENIDHLFDSPNGYFYAVMD  137

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E  PWP  + G+ P +YFN GMF+F+PN+ TY  LL  
Sbjct  138  CFCEKTWSYSPQYKVGYCQQCPERAPWPKEM-GSPPPLYFNAGMFLFEPNLLTYFDLLET  196

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TP T+FAEQDFLNMFF+D YKP+P +YN+++ MLWRHP+ VE+ K KVVHYC  G+K
Sbjct  197  LKVTPTTSFAEQDFLNMFFKDVYKPIPPIYNLVLAMLWRHPENVEMDKVKVVHYCAAGSK  256

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K  VKKWWEIY D+SLDYK
Sbjct  257  PWRYTGKEENMDREDIKTFVKKWWEIYEDESLDYK  291



>gb|AEN74906.1| galactinol synthase II [Populus alba x Populus grandidentata]
Length=337

 Score =   316 bits (809),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRK  S YP+VVA+ PDVP EHR +LV+QGCIVRE+EP++P
Sbjct  29   TFLAGDGDYWKGVVGLAKGLRKAKSKYPLVVAILPDVPEEHRMILVSQGCIVREIEPVHP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA PYYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD+ DG+FYAV D
Sbjct  89   P-ENQTRFAMPYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDMPDGHFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G +P +YFN GMF+++PN+STY  LL  
Sbjct  148  CFCEKTWSNSPQYKIGYCQQCPDKVQWP-AEMGPKPPLYFNAGMFVYEPNLSTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ + L K KVVHYC  G+K
Sbjct  207  VKVTSPTLFAEQDFLNMFFRDVYKPIPSDYNLVLAMLWRHPENINLDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM REE+KM+V KWW+IY D+SLDYK
Sbjct  267  PWRFTGKEENMDREEIKMVVNKWWDIYQDESLDYK  301



>ref|XP_010914664.1| PREDICTED: galactinol synthase 1-like [Elaeis guineensis]
Length=340

 Score =   316 bits (809),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 184/319 (58%), Positives = 230/319 (72%), Gaps = 17/319 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG GDYVKG VGL +GLRKVGSAYP+VVAV PDVP  HRRLL +QGCIVRE+EP++P
Sbjct  27    TFLAGAGDYVKGAVGLAQGLRKVGSAYPLVVAVLPDVPECHRRLLESQGCIVREIEPIHP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KM+YLD+D+QV+EN+D LFDL DG+FYAV D
Sbjct  87    P-ENQTKFAMAYYVINYSKLRIWEFVEYGKMVYLDADIQVYENIDELFDLPDGHFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE            + + C E + WP A LG  PS+YFN GMF+F+P+I+T   LL  
Sbjct  146   CFCERTWSHTPQYRVGYCQQCPERVAWPAAELGPPPSLYFNAGMFVFEPSIATADALLAT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT FAEQDFLNMFFRD YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LKVTEPTPFAEQDFLNMFFRDIYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETA-VPR  995
             PWRYTG+  NM R ++K LV++WW++YND+SL+   YK+ A+V + GG+   VE    P 
Sbjct  266   PWRYTGEGENMDRADIKELVRRWWDVYNDESLN---YKKPAAVLD-GGSVVAVEAERRPF  321

Query  996   FSNTGNLTEPRYIKGPPAA  1052
              +        +YIK P AA
Sbjct  322   LAALSEAGTVKYIKAPSAA  340



>ref|XP_008221834.1| PREDICTED: galactinol synthase 1, partial [Prunus mume]
Length=332

 Score =   315 bits (808),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SA+P+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  32   TFLAGNGDYVKGVVGLAKGLRKVKSAHPLVVAILPDVPEEHREILRSQGCIVREIEPIYP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E ++ FA  YYV+NYSKL+ W F EYSKMIYLD+D+QV+EN+DHLFD  DGYFYAV D
Sbjct  92   P-ENQIKFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVYENIDHLFDTPDGYFYAVMD  150

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A LG+ P +YFN GMF+F+P+  TY  LL  
Sbjct  151  CFCEKTWSHSSQYKVGYCQQCPDKVSWP-AELGSPPPLYFNAGMFVFEPSRLTYDSLLQT  209

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++ PPT FAEQDFLNMFF+  YKP+P VYN+++ MLWRHP+ VEL K  VVHYC  G+K
Sbjct  210  LQIVPPTPFAEQDFLNMFFQKTYKPIPLVYNLVLAMLWRHPENVELDKVNVVHYCAAGSK  269

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWWE+YND++LD+K
Sbjct  270  PWRYTGKEANMDREDIKMLVAKWWEVYNDETLDFK  304



>ref|XP_002314975.1| galactinol synthase family protein [Populus trichocarpa]
 gb|EEF01146.1| galactinol synthase family protein [Populus trichocarpa]
 gb|AGT50335.1| galactinol synthase 7 [Populus trichocarpa]
Length=325

 Score =   315 bits (807),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S+YP++VA+ PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  20   TFLAGNGDYVKGVVGLAKGLRKAKSSYPLMVAILPDVPEEHRKILESQGCIVREIEPVYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYV+NYSKL+ W+F +Y KMIYLD D+QVF+N+DHLFD  +GYFYAV D
Sbjct  80   PDN-QTQFAMAYYVINYSKLRIWEFVDYEKMIYLDGDIQVFDNIDHLFDEPNGYFYAVMD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP  + G+ P +YFN GMF+F+P + TY  LL  
Sbjct  139  CFCEKTWSSTPQYQIGYCQQCPEKVRWPKEM-GSPPPLYFNAGMFVFEPKLLTYFDLLET  197

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNMFFRD YKP+P VYN++  MLWRHP+  EL K KVVHYC  GAK
Sbjct  198  LKVTPPTSFAEQDFLNMFFRDVYKPIPAVYNLVSAMLWRHPENFELDKVKVVHYCAAGAK  257

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++++LVKKWWEIY D+SLDYK
Sbjct  258  PWRYTGKEENMDREDIQVLVKKWWEIYEDESLDYK  292



>ref|XP_002280616.1| PREDICTED: galactinol synthase 2 [Vitis vinifera]
Length=318

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VV V PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  11   TFLAGNGDYVKGVVGLAKGLRKVRSLYPLVVPVLPDVPEEHRQILKSQGCIVREIEPVYP  70

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  F+  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFD  DG+FYAV D
Sbjct  71   P-ENQTQFSMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDSQDGHFYAVKD  129

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + W  A LG  P +YFN GMF+F+P++STY+ LL+ 
Sbjct  130  CFCEQTWSHSTQYKIGYCQQCPNKVEW-KAELGPPPPLYFNAGMFVFEPSLSTYSNLLDT  188

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNMFFRD Y P+P  YN+++ MLWRHP+ V+L+KAKVVHYC  G+K
Sbjct  189  LKVTPPTSFAEQDFLNMFFRDVYVPIPSEYNLVLAMLWRHPENVDLTKAKVVHYCAAGSK  248

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++K LV+KWWEIY D++LDYK
Sbjct  249  PWRFTGKEENMEREDIKELVRKWWEIYEDETLDYK  283



>ref|XP_010938189.1| PREDICTED: galactinol synthase 2-like isoform X1 [Elaeis guineensis]
Length=337

 Score =   315 bits (808),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 214/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRKV SAYP+VVAV PDVP +HRR+L +QGC+VRE+EP+YP
Sbjct  30   TFLAGDGDYWKGVVGLAKGLRKVRSAYPLVVAVLPDVPEDHRRILRSQGCLVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD+D+QV++N+DHLFDL  GYFYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWEFVEYQKMIYLDADIQVYDNIDHLFDLPGGYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP   LG  P++YFN GMF+ +P+++T   LL  
Sbjct  149  CFCEKTWSHTPQYQIGYCQQCPDKVSWPEDKLGPPPALYFNAGMFVHEPSLATAESLLKT  208

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K TPPT FAEQDFLNMFF+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  209  VKSTPPTPFAEQDFLNMFFKDIYKPIPGVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  268

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWWEIYN++SLDYK
Sbjct  269  PWRYTGKEANMDREDIKMLVKKWWEIYNNESLDYK  303



>ref|XP_010489936.1| PREDICTED: galactinol synthase 3 [Camelina sativa]
Length=336

 Score =   315 bits (808),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 217/276 (79%), Gaps = 13/276 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVPA+HRR LV QGCIV++++P+YP
Sbjct  21   TFLAGNGDYVKGVVGLAKGLRKANSKYPLVVAVLPDVPADHRRQLVDQGCIVKDIQPVYP  80

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYVLNYSKL+ W+F EYS++IYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  81   PDN-QTQFAMAYYVLNYSKLRIWEFVEYSRLIYLDGDIQVFENIDHLFDLPDGSFYAVKD  139

Query  492  CVCEE-----------HGEPCKEILPWP-TALLGARPSMYFNGGMFMFQPNISTYTRLLN  635
            C CE+           + + C + + WP T  LG +P +YFN GMF+++P++ TY  LL 
Sbjct  140  CFCEKTWSHTPQYKIGYCQQCPDKVTWPETGQLGPKPPLYFNAGMFVYEPSLPTYYNLLE  199

Query  636  HFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGA  815
              K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL++AKVVHYC  GA
Sbjct  200  TLKVVPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELNEAKVVHYCAAGA  259

Query  816  KPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            KPWR+TG+E NM RE++KMLV+KWW+IYND+SLDYK
Sbjct  260  KPWRFTGQEENMEREDIKMLVEKWWDIYNDESLDYK  295



>ref|XP_002281304.1| PREDICTED: galactinol synthase 2 [Vitis vinifera]
Length=325

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 224/298 (75%), Gaps = 13/298 (4%)
 Frame = +3

Query  63   MAPDASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdv  242
            MAP  ++   +   A+   RAYVTFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDV
Sbjct  1    MAPTLASATGLAKAASISSRAYVTFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDV  60

Query  243  paEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSD  422
            PAEHRR+L  QGC+VRE+EP+ P  E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D
Sbjct  61   PAEHRRILEDQGCVVREIEPVNPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGD  119

Query  423  MQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLGARPS  569
            +QVF N+DHLFDL DGYFYAV DC CE+           + + C E + WP A +G  P 
Sbjct  120  IQVFSNIDHLFDLDDGYFYAVMDCFCEKTWSNSPQYKIGYCQQCPEKVKWP-AEMGPAPP  178

Query  570  MYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNML  749
            +YFN GMF+F+P +S Y  LL   K+T PT+FAEQD+LNMFFRD YKP+P  YN+++ ML
Sbjct  179  LYFNAGMFVFEPCLSVYDDLLTTLKITTPTSFAEQDYLNMFFRDIYKPIPPTYNLVLAML  238

Query  750  WRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            WRHP+ ++L    VVHYC  G+KPWRYTGKE NM RE++KMLVKKWW+IYND+SLDY+
Sbjct  239  WRHPENIDLQITNVVHYCAAGSKPWRYTGKEENMDREDIKMLVKKWWDIYNDESLDYR  296



>ref|XP_010674554.1| PREDICTED: galactinol synthase 2-like [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   315 bits (807),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 215/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY+KGVVGL KGLRK  +AYP+VVAV PDVP EHRR+LV+QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYIKGVVGLAKGLRKARAAYPLVVAVLPDVPEEHRRILVSQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QV++N+DHLFDL +GYFYAV D
Sbjct  89   PDN-QTQFAMAYYVINYSKLRIWEFVEYTKMIYLDGDIQVYDNIDHLFDLPNGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + +     + WP   LG +P+ YFN GMF+F+P++STY  LLN 
Sbjct  148  CFCEKTWNHTPQYKIGYCQQSPNRVCWPEEELGPKPAKYFNAGMFVFEPSLSTYLDLLNT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNM+F+D YKP+P +YN+++ MLWRHP+ + L + KVVHYC  G+K
Sbjct  208  LQVTPPTPFAEQDFLNMYFKDIYKPIPSIYNLVMAMLWRHPENINLEEVKVVHYCANGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K+LV KW +IYND+SLDYK
Sbjct  268  PWRYTGKEENMDREDIKLLVNKWLDIYNDESLDYK  302



>ref|XP_009118321.1| PREDICTED: galactinol synthase 3 [Brassica rapa]
Length=366

 Score =   316 bits (810),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 226/318 (71%), Gaps = 12/318 (4%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HRR L+ QGC+V E++P+ P
Sbjct  50    TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPVDHRRQLLEQGCLVNEIQPVCP  109

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  +  FA  YYVLNYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  110   PDN-QTQFAMAYYVLNYSKLRIWKFVEYSKMIYLDGDIQVFENIDHLFDLPDGNFYAVKD  168

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP + LG +P +YFN GMF+++P++ TY  LL  
Sbjct  169   CFCEKTWSHTPQYKIGYCQQCPDKVTWPESELGPKPPLYFNAGMFVYEPSLPTYYNLLET  228

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+  PT FAEQDFLN++F+D YKP+P VYN+++ MLWRHP+ +EL KAKV+HYC  G+K
Sbjct  229   LKVVSPTPFAEQDFLNIYFKDIYKPIPPVYNLVLAMLWRHPENIELDKAKVIHYCAAGSK  288

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TG+E NM R+++KMLV+KWW+IYND+SLDYK    R+   E      +  T    F
Sbjct  289   PWRFTGQEENMERKDIKMLVEKWWDIYNDESLDYKNINVRSKQEEEDVHRKQQTTMSQFF  348

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +++       Y K P AA
Sbjct  349   TDSSEAGVFHYAKAPSAA  366



>ref|XP_010039533.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW45880.1| hypothetical protein EUGRSUZ_L00249 [Eucalyptus grandis]
Length=337

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 216/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVA+ PDVPA+HR++LV QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAILPDVPADHRKILVDQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL +G+FYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPNGFFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP  + G +PS+YFN GMF+++PN+ TY  LL  
Sbjct  148  CFCEKTWSHTPQYEIGYCQQCPDKVQWPDHV-GPKPSLYFNAGMFVYEPNLDTYHDLLET  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPTAFAEQD LNM+F+D YKP+P VYN ++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  LKITPPTAFAEQDLLNMYFKDIYKPIPNVYNFVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM R+++KMLVKKW +IY+D+SLDYK
Sbjct  267  PWRYTGEEQNMDRDDIKMLVKKWRDIYDDESLDYK  301



>ref|XP_004288353.1| PREDICTED: galactinol synthase 2-like [Fragaria vesca subsp. 
vesca]
Length=341

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 188/321 (59%), Positives = 230/321 (72%), Gaps = 21/321 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP +HRR+L +QGCIVRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKVNTAYPLVVAVLPDVPEDHRRILESQGCIVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QV++N+DHLFDL DG FYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYDKMIYLDGDIQVYDNIDHLFDLPDGNFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + W   L G  PS+YFN GMF+F+P++ TY  LL  
Sbjct  147   CFCEKTWSHTPQYKIGYCQQCPERVKWDFEL-GPPPSLYFNAGMFVFEPSVLTYQDLLKT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++ P T FAEQDFLNM+FRD YKP+P VYN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   LRVAPTTPFAEQDFLNMYFRDIYKPIPNVYNLVLAMLWRHPENVQLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KWWEIYND+SLDYK  +    V     AA E E AV   
Sbjct  266   PWRYTGKEENMEREDIKMLVQKWWEIYNDESLDYKKPQSSTVV-----AAVEAEQAVDMQ  320

Query  999   SNTGNLTEP---RYIKGPPAA  1052
                  L+E    +Y+  P AA
Sbjct  321   PFIEALSEAGAFQYVNVPSAA  341



>ref|XP_006305301.1| hypothetical protein CARUB_v10009676mg [Capsella rubella]
 gb|EOA38199.1| hypothetical protein CARUB_v10009676mg [Capsella rubella]
Length=335

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 217/276 (79%), Gaps = 13/276 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HRR LV QGC+++++ P+YP
Sbjct  20   TFLAGNGDYVKGVVGLAKGLRKANSKYPLVVAVLPDVPLDHRRQLVDQGCLIKDIHPVYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYVLNYSKL+ W+F EYSK+IYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  80   PDN-QTQFAMAYYVLNYSKLRIWEFVEYSKLIYLDGDIQVFENIDHLFDLPDGSFYAVKD  138

Query  492  CVCEE-----------HGEPCKEILPWP-TALLGARPSMYFNGGMFMFQPNISTYTRLLN  635
            C CE+           + + C + + WP T  LG +P +YFN GMF+++P+++TY  LL+
Sbjct  139  CFCEKTWSHTPQYKIGYCQQCPDKVTWPDTEQLGPKPPLYFNAGMFVYEPSLATYYNLLD  198

Query  636  HFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGA  815
              K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL++AKVVHYC  GA
Sbjct  199  TLKVIPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELNEAKVVHYCAAGA  258

Query  816  KPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            KPWR+TG+E NM RE++KMLV+KWW+IYND+SLDYK
Sbjct  259  KPWRFTGQEQNMEREDIKMLVEKWWDIYNDESLDYK  294



>ref|XP_010674553.1| PREDICTED: galactinol synthase 2-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 220/296 (74%), Gaps = 14/296 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP EHR +LV+QGC+VRE+EP+YP
Sbjct  22   TFLAGNGDYVKGVVGLAKGLRKAKSRYPLVVAVLPDVPPEHRNILVSQGCVVREIEPVYP  81

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E    FA PYYV+NYSKL+ W+F E+SKMIYLD D+QVF+N+DHLFDL DGYFYAV D
Sbjct  82   P-ENHTQFAMPYYVINYSKLRIWEFVEFSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMD  140

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + W    LG +P++YFN GMF+F+P +STY  LLN 
Sbjct  141  CFCEKTWSHTPQYKIGYCQQCPNKVQWAEDKLGPKPALYFNAGMFVFEPKMSTYHDLLNT  200

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K T PT FAEQDFLNM+F++ YKP+P +YN+++ MLWRHP+ + L+ AKVVHYC  G+K
Sbjct  201  VKTTTPTPFAEQDFLNMYFKNIYKPIPPIYNLVLAMLWRHPENIVLNDAKVVHYCAAGSK  260

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETA  986
            PWRYTG+E NM RE++++LVKKWW+IY+D+SLDY    + A +  L  A  E   A
Sbjct  261  PWRYTGEEENMEREDIQILVKKWWDIYDDKSLDYN--TEEAKLQLLKAALSEFNNA  314



>ref|XP_002889744.1| ATGOLS3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66003.1| ATGOLS3 [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 173/300 (58%), Positives = 222/300 (74%), Gaps = 15/300 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKGVVGL KGLRK  S YP+VVAV PDVP +HRR L+ QGC+++E++P+YP
Sbjct  20   TFLAGTGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPVDHRRQLLDQGCVIKEIQPVYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYVLNYSKL+ W+F EYSK+IYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  80   P-ENQTQFAMAYYVLNYSKLRIWKFVEYSKLIYLDGDIQVFENIDHLFDLPDGNFYAVKD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP   LG +P +YFN GMF+++P++ TY  LL  
Sbjct  139  CFCEKTWSHTPQYKIGYCQQCPDKVTWPETELGPKPPLYFNAGMFVYEPSLPTYYNLLET  198

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL +AKVVHYC  GAK
Sbjct  199  LKVVPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELDEAKVVHYCAAGAK  258

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
            PWR+TG+E NM RE++KMLV+KWW+IYND+SLDYK +       E     H+ +  +P+F
Sbjct  259  PWRFTGQEENMEREDIKMLVEKWWDIYNDESLDYKNFHVHCGQKE---DVHKKQQTLPQF  315



>gb|EYU44029.1| hypothetical protein MIMGU_mgv1a019439mg [Erythranthe guttata]
Length=344

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 215/266 (81%), Gaps = 3/266 (1%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGV+GL KGLRKVG+AYP+VVAV PDVP EHRRLLV QGC++R + P++P
Sbjct  41   TFLAGDGDYVKGVIGLAKGLRKVGAAYPLVVAVLPDVPVEHRRLLVDQGCLLRLIHPVFP  100

Query  312  --SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAV  485
              +   + PF RPY+V+NY KL+ W+F EY+KMIYLD+D+QVF+N+DHLFDL +G FY V
Sbjct  101  PAATGDDCPFVRPYFVVNYCKLRLWEFVEYNKMIYLDADIQVFDNIDHLFDLPNGSFYGV  160

Query  486  PDCVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAF  665
             DC+CE +G PC + + WP  L G  P+ YFNGGMFMF+PN++TY  LL    +TPPT F
Sbjct  161  VDCLCEMYGPPCPQKIRWPKEL-GPEPAFYFNGGMFMFEPNLNTYDELLRTLDVTPPTPF  219

Query  666  AEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKEN  845
            AEQDFLNMFFR+  KPL  +YNMLV M+WRH + ++L K KVVHYCV G+KPWRYTGKE 
Sbjct  220  AEQDFLNMFFREVSKPLLPIYNMLVAMMWRHSEMMDLDKVKVVHYCVGGSKPWRYTGKEE  279

Query  846  NMGREEMKMLVKKWWEIYNDQSLDYK  923
            NM R ++KMLV++WW+I+ND+SLD+K
Sbjct  280  NMDRADIKMLVERWWDIFNDESLDFK  305



>ref|XP_002262651.1| PREDICTED: galactinol synthase 2 [Vitis vinifera]
Length=317

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 214/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VV V PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  11   TFLAGNGDYVKGVVGLAKGLRKARSLYPLVVPVLPDVPEEHRQILKSQGCIVREIEPVYP  70

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  F+  Y+V+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFD  DG+FYAV D
Sbjct  71   P-ENQTQFSMAYFVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDSQDGHFYAVKD  129

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + W  A LG  P +YFN GMF+F+P++STY+ LL+ 
Sbjct  130  CFCEQTWSHSTQYKIGYCQQCPNKVEW-KAELGPPPPLYFNAGMFVFEPSLSTYSNLLDT  188

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNMFFRD Y P+P  YN+++ MLWRHP+ V+L+KAKV+HYC  G+K
Sbjct  189  LKVTPPTSFAEQDFLNMFFRDVYVPIPSEYNLVLAMLWRHPENVDLTKAKVIHYCAAGSK  248

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++K LV+KWWEIY D++LDYK
Sbjct  249  PWRFTGKEENMDREDIKELVRKWWEIYEDETLDYK  283



>emb|CDY64774.1| BnaC08g50010D [Brassica napus]
Length=330

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 227/319 (71%), Gaps = 20/319 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HRR L+ QGC+V+E++P+ P
Sbjct  20    TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPVDHRRQLLDQGCLVKEIQPVCP  79

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYVLNYSKL+ W+F EYS MIYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  80    P-ENQTQFAMAYYVLNYSKLRIWKFVEYSTMIYLDGDIQVFENIDHLFDLPDGNFYAVKD  138

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP + LG +P +YFN GMF+++P++ TY  LL  
Sbjct  139   CFCEKTWSHTPQYKIGYCQQCPEKVTWPESELGPKPPLYFNAGMFVYEPSLPTYYNLLET  198

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
               + PPT FAEQDFLNM+F+D YKP+P  YN+++ MLWRHP+ VEL KAKVVHYC  G+K
Sbjct  199   LNVVPPTPFAEQDFLNMYFKDIYKPIPPAYNLVLAMLWRHPENVELDKAKVVHYCAAGSK  258

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPR-  995
             PWR+TGKE NM R+++KMLVKKWW+IYND+SLDYK          +     + +T +P+ 
Sbjct  259   PWRFTGKEENMERQDIKMLVKKWWDIYNDESLDYKN-------INVQDVHRKQQTTMPQF  311

Query  996   FSNTGNLTEPRYIKGPPAA  1052
             F+++       Y K P AA
Sbjct  312   FTDSSEAGVFHYAKAPSAA  330



>gb|EAY89768.1| hypothetical protein OsI_11309 [Oryza sativa Indica Group]
Length=341

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 232/320 (73%), Gaps = 18/320 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDY KGVVGL KGLRKVGSAYP+VVAV PDVP  HRR+L++QGCIVRE+EP+YP
Sbjct  27    TFLAGDGDYWKGVVGLAKGLRKVGSAYPLVVAVLPDVPESHRRILISQGCIVREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVF+N+D LF+L  G FYAV D
Sbjct  87    P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFDNIDELFELPKGPFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WPTA LG  P++YFN GMF+ +P+++T   LL+ 
Sbjct  146   CFCEKTWSHTPQYQIGYCQQCPDKVAWPTAELGPPPALYFNAGMFVHEPSMATAKSLLDT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++T PT FAEQDFLNMFFR++YKP+P +YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   LRVTTPTPFAEQDFLNMFFREQYKPIPLIYNLVLAMLWRHPENVQLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAV--P  992
             PWRYTGKE NM RE++KMLVKKWW++YND SLD+K     A+  +    A EVE A   P
Sbjct  266   PWRYTGKEANMDREDIKMLVKKWWDVYNDGSLDFKGLPPIAAADD----ADEVEAAAKKP  321

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               +        +Y+  P AA
Sbjct  322   LRAALAEARTVKYVTAPSAA  341



>gb|KHN16038.1| Glycogenin-1 [Glycine soja]
Length=328

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 213/274 (78%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP +HR +L +QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKVKSMYPLVVAVLPDVPQDHRNILTSQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL D YFYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDNYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C   + WPT   G +P +YFN GMF+++PN++TY  LL  
Sbjct  148  CFCEPTWGHTKQYQIGYCQQCPHKVQWPTHF-GPKPPLYFNAGMFVYEPNLATYRDLLQT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLNM+F+D+Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  VQVTQPTSFAEQDFLNMYFKDKYRPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWRYTGKE NM RE++KMLVKKWW+IY D++LDY
Sbjct  267  PWRYTGKEENMEREDIKMLVKKWWDIYEDETLDY  300



>gb|ADF43063.1| galactinol synthase [Ammopiptanthus nanus]
Length=328

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 222/293 (76%), Gaps = 17/293 (6%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKVKSVYPLVVAVLPDVPEEHRKILNSQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL D YFYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLPDNYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP+   G +P +YFN GMF+++PN+ TY  LL  
Sbjct  148  CFCEKSWTHTPQYQIGYCQQCPDKVEWPSNF-GPKPPLYFNAGMFVYEPNLVTYRDLLEA  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLN+FFR++YKP+P VYN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  207  LQVTKPTSFAEQDFLNIFFREKYKPIPNVYNLVLAMLWRHPENVELDKVQVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY----KYYKQRASVYELGGA  965
            PWRYTGKE NM RE++KM VKKWW+IY D++LDY       +  A++ + GGA
Sbjct  267  PWRYTGKEENMEREDIKMFVKKWWDIYEDETLDYDNPLNVERLTAALLKAGGA  319



>ref|XP_010243067.1| PREDICTED: galactinol synthase 1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010243069.1| PREDICTED: galactinol synthase 1-like isoform X1 [Nelumbo nucifera]
Length=338

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 229/320 (72%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  31    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHREILTSQGCIVREIEPIYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QVF+N+DHLFD  DGY YAV D
Sbjct  91    P-ENQIQFAMAYYVINYSKLRIWDFEEYSKMVYLDADIQVFDNIDHLFDGPDGYLYAVMD  149

Query  492   CVCE-----------EHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE           ++ + C + + WP A +G+ P +YFN GMF+F+P+  TY  LL  
Sbjct  150   CFCEKTWSHSPQYSIDYCQQCPDKVTWP-AEMGSPPPLYFNAGMFVFEPSHLTYENLLQA  208

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNMFF++ YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  209   LQITPPTPFAEQDFLNMFFQNMYKPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  268

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IY+D+SLD+K             +  E ET   + 
Sbjct  269   PWRYTGKEANMDREDIKMLVAKWWDIYDDESLDFK----------AEDSVPEEETFSRQS  318

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S    + EP   YI  P AA
Sbjct  319   SIMAAMPEPEMAYILAPSAA  338



>ref|XP_008812591.1| PREDICTED: galactinol synthase 1-like [Phoenix dactylifera]
Length=335

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/275 (65%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKV SAYP+VVAV PDVPA HR+LL  QGCIVRE+EP+YP
Sbjct  28   TFLAGDGDYVKGVVGLAKGLRKVSSAYPLVVAVLPDVPAAHRQLLREQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W F EYSKMIYLD+D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFDMPDGYFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A +GA P +YFN GMF+F+PN  TY  LL  
Sbjct  147  CFCEKTWSHSRQYSIGYCQQCPEKVAWP-AEMGAPPPLYFNAGMFVFEPNHLTYENLLET  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K TPPT FAEQDFLNMFF   Y+P+P  YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  LKFTPPTPFAEQDFLNMFFEKTYRPIPLAYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV+KWW+IYND+SLD+K
Sbjct  266  PWRYTGKEANMDREDIKMLVEKWWDIYNDESLDFK  300



>ref|XP_010039534.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW45882.1| hypothetical protein EUGRSUZ_L00251 [Eucalyptus grandis]
Length=338

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 216/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVA+ PDVPA+HR++LV QGCIVRE+EP+YP
Sbjct  30   TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAILPDVPADHRKILVDQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVF+N+DHLFDL +G+FYAV D
Sbjct  90   P-ESQTQFAMAYYVINYSKLRIWEFVEYKKMIYLDGDIQVFDNIDHLFDLQNGFFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP  + G +P +YFN GMF+++P++ TY  LL  
Sbjct  149  CFCEKTWSHTPQHKIGYCQQCPDKVQWPDHV-GPKPPLYFNAGMFVYEPDLDTYHDLLET  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQD LNM+F+D Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  208  LKITPPTSFAEQDLLNMYFKDIYRPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++KMLVKKWW+IY+D+SLDYK
Sbjct  268  PWRYTGEEENMDREDIKMLVKKWWDIYDDESLDYK  302



>ref|XP_002519283.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43147.1| conserved hypothetical protein [Ricinus communis]
Length=318

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 209/275 (76%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  +AYP+VVAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  14   TFLAGNGDYVKGVVGLAKGLRKTKTAYPLVVAVLPDVPEEHRQILESQGCIVREIEPVYP  73

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVFEN+DHLFD   GY YAV D
Sbjct  74   P-ENQTQFAMAYYVINYSKLRIWEFVEYEKMIYLDGDIQVFENIDHLFDSPSGYLYAVMD  132

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP  + G  P +YFN GMF+F+PN+ TY  LL  
Sbjct  133  CFCEQTWSYSPQYKIGYCQQCPERVQWPKEM-GLPPPLYFNAGMFLFEPNLLTYDDLLET  191

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLN FF+D YKP+P VYN+++ MLWRHP+ VE  K KVVHYC  GAK
Sbjct  192  VKVTPPTLFAEQDFLNKFFKDVYKPIPPVYNLVLAMLWRHPENVEFEKVKVVHYCAAGAK  251

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IY D+SLDYK
Sbjct  252  PWRYTGKEENMDREDIKMLVKKWWDIYEDESLDYK  286



>ref|XP_006649987.1| PREDICTED: galactinol synthase 2-like [Oryza brachyantha]
Length=342

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 234/320 (73%), Gaps = 19/320 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDY KGVVGL KGLRKVGSAYP+VVAV PDVP  HRR+L++QGCIVRE+EP+YP
Sbjct  29    TFLAGDGDYWKGVVGLAKGLRKVGSAYPLVVAVLPDVPESHRRILISQGCIVREIEPVYP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVFEN+D LFDL  G FYAV D
Sbjct  89    P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFENIDELFDLPKGRFYAVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE            + + C + + WPTA LG  P++YFN GMF+ +P+++T   LL+ 
Sbjct  148   CFCERTWSHTPQYKIGYCQQCPDKVAWPTAELGPPPALYFNAGMFVHEPSMATAKALLDT  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++T PT FAEQDFLNMFFR++YKP+P +YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  208   LRVTTPTPFAEQDFLNMFFREQYKPIPLIYNLVLAMLWRHPENVQLKKVKVVHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYK--QRASVYELGGAAHEVETAVP  992
             PWRYTGKE NM RE++KMLVKKWW+IYND++LD++     + A+  E+  AA +   A  
Sbjct  268   PWRYTGKEENMDREDIKMLVKKWWDIYNDETLDFRGLPPVEAANTDEVEVAAKKPLRAA-  326

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               +  G +   +Y+  P AA
Sbjct  327   -LAEAGTV---KYVTAPSAA  342



>sp|Q9XGN4.1|GOLS1_AJURE RecName: Full=Galactinol synthase 1; Short=ArGolS1; Short=GolS-1 
[Ajuga reptans]
 emb|CAB51533.1| galactinol synthase, isoform GolS-1 [Ajuga reptans]
Length=333

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 229/320 (72%), Gaps = 26/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR LL +QGCIV+E+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRELLRSQGCIVKEIEPIYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                 ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QV+EN+DHL D  DGYFYAV D
Sbjct  87    PAN-QIQFAMAYYVINYSKLRIWNFEEYSKMVYLDADIQVYENIDHLLDTPDGYFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C   + WP A +G+ P +YFN GMF+F+P+ +TY  LL+ 
Sbjct  146   CFCEKTWSHSRQFSIGYCQQCPNKVTWP-AQMGSPPPLYFNAGMFVFEPSKTTYQTLLHT  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  205   LRITPPTPFAEQDFLNMFFEPIYKPIPLVYNLVLAMLWRHPENVELEKVQVVHYCAAGSK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW++YND+SLD+K              A E   ++P F
Sbjct  265   PWRYTGQEANMDREDIKMLVKKWWDVYNDESLDFK---------AEDSIAGEETFSMPSF  315

Query  999   SNTGNLTEP--RYIKGPPAA  1052
                 +L EP   YI  P AA
Sbjct  316   --IASLPEPAVSYIPAPSAA  333



>ref|XP_007031210.1| Galactinol synthase 2 [Theobroma cacao]
 gb|EOY11712.1| Galactinol synthase 2 [Theobroma cacao]
Length=348

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 177/318 (56%), Positives = 225/318 (71%), Gaps = 15/318 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S YP++VA+ PDVP +HR++LV QGCIV+E+EP+YP
Sbjct  35    TFLAGNGDYVKGVVGLAKGLRKVKSQYPLLVAILPDVPEDHRKILVDQGCIVKEIEPVYP  94

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVFEN+DHLFD+ DG FYAV D
Sbjct  95    P-ENQTQFAMAYYVINYSKLRIWEFVEYCKMIYLDGDIQVFENIDHLFDMEDGSFYAVMD  153

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP+ L G +P +YFN GMF+++P++  Y  LL  
Sbjct  154   CFCEKTWSHTPQYKIGYCQQCPDKVQWPSQL-GPKPPLYFNAGMFVYEPSLRVYDELLRT  212

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQD+LNMFFRD YKP+P VYN+++ MLWRHP+ +EL K KV HYC  G+K
Sbjct  213   LKVTPPTPFAEQDYLNMFFRDIYKPIPPVYNLVMAMLWRHPENIELEKVKVAHYCAAGSK  272

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TGKE NM RE++KMLV KWW+IYND+SLDYK +               ++  +   
Sbjct  273   PWRFTGKEENMDREDIKMLVSKWWDIYNDESLDYKNFVASGEAEVDRDERTGLQPFLAAL  332

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +    YI  P AA
Sbjct  333   SEAGVVD--HYINAPSAA  348



>gb|ABF66656.1| galactinol synthase [Ammopiptanthus mongolicus]
 gb|ABU41005.1| galactinol synthase [Ammopiptanthus mongolicus]
Length=328

 Score =   313 bits (802),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 215/274 (78%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S +P+VVAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKVKSVHPLVVAVLPDVPEEHRKILNSQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  +A  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL D YFYAV D
Sbjct  89   P-ENQTQYAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLPDNYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP+   G +P +YFN GMF+++PN+ TY  LL  
Sbjct  148  CFCEKSWTHTPQYQIGYCQQCPDKVEWPSNF-GPKPPLYFNAGMFVYEPNLVTYRDLLEA  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLN+FFR++YKP+P VYN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  207  LQVTKPTSFAEQDFLNIFFREKYKPIPNVYNLVLAMLWRHPENVELDKVQVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWRYTGKE NM RE++KMLVKKWW+IY D++LDY
Sbjct  267  PWRYTGKEENMEREDIKMLVKKWWDIYEDETLDY  300



>ref|XP_010276500.1| PREDICTED: galactinol synthase 2-like [Nelumbo nucifera]
Length=340

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 228/302 (75%), Gaps = 17/302 (6%)
 Frame = +3

Query  63   MAPDASNgglvvar----aaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvav  230
            MAP+ SN    +A     A+   RAYVTFLAG+G+Y KG VGL KGLR V S YP+VVAV
Sbjct  1    MAPNISNTAAKIASLVKPASIPSRAYVTFLAGDGNYYKGAVGLAKGLRNVKSVYPLVVAV  60

Query  231  wpdvpaEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIY  410
              DVP EHR++L +QGCIVRE++P+YP  E +  FA  YYV+NYSKL+ W+F EYSKMIY
Sbjct  61   LSDVPEEHRQILESQGCIVREIQPVYPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIY  119

Query  411  LDSDMQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLG  557
            LDSD+QV++N+DHLFDL  G+FYAV DC CE+           + + C + + WP A LG
Sbjct  120  LDSDIQVYDNIDHLFDLPGGHFYAVMDCFCEKTWSNTPQFKIGYCQQCPDKVKWP-AELG  178

Query  558  ARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNML  737
              PS+YFN GMF+F+P++ST   LL   ++TP T+FAEQDFLNMFF+D YKP+P VYN++
Sbjct  179  PPPSLYFNAGMFVFEPSLSTCDDLLKTLQVTPATSFAEQDFLNMFFKDIYKPIPLVYNLV  238

Query  738  VNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLD  917
            + MLWRHP+ V+L K KVVHYC  G+KPWRYTGKE NM RE++KMLVKKWW++YND+SL+
Sbjct  239  LAMLWRHPENVDLDKVKVVHYCAAGSKPWRYTGKEENMHREDIKMLVKKWWDVYNDESLN  298

Query  918  YK  923
            YK
Sbjct  299  YK  300



>ref|XP_011086583.1| PREDICTED: galactinol synthase 1 [Sesamum indicum]
Length=333

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 229/320 (72%), Gaps = 26/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP +HR LL AQGCIV+E+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEDHRELLRAQGCIVKEIEPIYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QV++N+DHL D+ DG+FYAV D
Sbjct  87    P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMVYLDADIQVYDNIDHLLDMPDGHFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C   + WP A +G+ P +YFN GMF+F+P+ +TY  LL  
Sbjct  146   CFCEKTWSHSPQYSIGYCQQCPNKVTWP-AEMGSPPPLYFNAGMFVFEPSKATYENLLET  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  205   LRITPPTPFAEQDFLNMFFEPIYKPIPLVYNLVLAMLWRHPENVELEKVQVVHYCAAGSK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KWWE+YND++LD+K     A            E A  R 
Sbjct  265   PWRYTGKEANMDREDIKMLVEKWWEVYNDETLDFKPEDSIAG-----------EEAFSRP  313

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   YI  P AA
Sbjct  314   SIMASMPEPAVSYIPAPSAA  333



>ref|XP_002265947.1| PREDICTED: galactinol synthase 1 [Vitis vinifera]
Length=336

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 185/320 (58%), Positives = 232/320 (73%), Gaps = 26/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCI+RE+EP+YP
Sbjct  30    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILKSQGCIIREIEPIYP  89

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QV++N+DHL D  DGYFYAV D
Sbjct  90    P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMVYLDADIQVYDNIDHLMDAPDGYFYAVMD  148

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G+ P +YFN GMF+F+P+  TY  LL+ 
Sbjct  149   CFCEKTWSHTPQYSVGYCQQCPDKVTWP-AEMGSPPPLYFNAGMFVFEPSRLTYESLLHT  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPTAFAEQDFLNMFF+  YKP+P VYN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  208   LRITPPTAFAEQDFLNMFFQHMYKPIPLVYNLVLAMLWRHPENVELDQVKVVHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND+SLD   +K   SV E  G +        R 
Sbjct  268   PWRYTGKEANMEREDIKMLVAKWWDIYNDKSLD---FKAEDSVPEGEGFS--------RP  316

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   YI  P AA
Sbjct  317   SIMASMPEPAISYIPAPSAA  336



>ref|XP_009411607.1| PREDICTED: galactinol synthase 1 [Musa acuminata subsp. malaccensis]
Length=326

 Score =   313 bits (802),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 215/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKG VGL KGLRKVGSAYP+VVAV PDVP  HRRLL AQGCIVRE+EP+YP
Sbjct  24   TFLAGDGDYVKGAVGLAKGLRKVGSAYPLVVAVLPDVPESHRRLLAAQGCIVREIEPVYP  83

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KM+YLD+D+QVFEN+DHLFDL DG+FYAV D
Sbjct  84   P-ESQTRFAMAYYVINYSKLRLWEFVEYKKMVYLDADIQVFENIDHLFDLPDGHFYAVMD  142

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP+  LG  PS+YFN GMF+ +P+++T   LL  
Sbjct  143  CFCEKTWSHSPQYKIGYCQQCPDRVAWPSDELGPPPSLYFNAGMFVHEPSLATSESLLAA  202

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFF+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  203  LKITCPTPFAEQDFLNMFFKDIYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  262

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM R+++ +LVK+WW++Y+D+SLDYK
Sbjct  263  PWRFTGKEANMDRKDINVLVKRWWDVYHDESLDYK  297



>ref|XP_007145022.1| hypothetical protein PHAVU_007G203400g [Phaseolus vulgaris]
 gb|ESW17016.1| hypothetical protein PHAVU_007G203400g [Phaseolus vulgaris]
Length=326

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 223/292 (76%), Gaps = 17/292 (6%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVPAEHR +L++QGCIVRE++P+YP
Sbjct  27   TFLAGNGDYVKGVVGLAKGLRKVKSMYPLVVAVLPDVPAEHRNILISQGCIVREIKPVYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVF+N+DHLFDL D YFYAV D
Sbjct  87   P-ENQTQFAMAYYVINYSKLRIWEFVEYTKMIYLDGDIQVFDNIDHLFDLPDNYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C + + WPT L G +P +YFN GMF+++PN++TY  LL  
Sbjct  146  CFCEPTWAHTPQYEIGYCQQCPDKVHWPTNL-GPKPPLYFNAGMFVYEPNLATYHDLLQT  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLNM+F+D+Y+ +P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  205  VQVTKPTSFAEQDFLNMYFKDKYRAIPNVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY--KYYKQR--ASVYELGG  962
            PWRY+GKE NM RE++KMLVKKWW+IY D+SLDY      QR  A + E GG
Sbjct  265  PWRYSGKEENMEREDIKMLVKKWWDIYEDKSLDYNNSLNAQRLAAPLLEAGG  316



>ref|XP_009804615.1| PREDICTED: galactinol synthase 2-like [Nicotiana sylvestris]
Length=328

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHR +L+ QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPDEHRHILINQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL D YFYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENVDHLFDLPDAYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + +   + + W   L G +PS+YFN GMF+F P++ TY  LL  
Sbjct  148  CFCEKSWSNSPQYNIGYCQQSPDKVQWAEEL-GPKPSLYFNAGMFVFMPSLPTYDDLLKT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNMFFRD YKP+P +YN+++ MLWRHP+ VEL K  VVHYC  G+K
Sbjct  207  LKVTPPTSFAEQDFLNMFFRDIYKPIPNIYNLVLAMLWRHPENVELDKVNVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++K LVKKW +IYND+SLDYK
Sbjct  267  PWRYTGEEENMDREDIKRLVKKWRDIYNDESLDYK  301



>ref|NP_001238027.1| galactinol synthase [Glycine max]
 gb|AAM96867.1| galactinol synthase [Glycine max]
Length=328

 Score =   313 bits (801),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 213/274 (78%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP +HR +L +QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKVKSMYPLVVAVLPDVPQDHRNILTSQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL D YFYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDNYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C   + WPT   G +P +YFN GMF+++PN++TY  LL  
Sbjct  148  CFCEPTWGHTKQYQIGYCQQCPHKVQWPTHF-GPKPPLYFNAGMFVYEPNLATYRDLLQT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLN++F+D+Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  VQVTQPTSFAEQDFLNIYFKDKYRPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWRYTGKE NM RE++KMLVKKWW+IY D++LDY
Sbjct  267  PWRYTGKEENMEREDIKMLVKKWWDIYEDETLDY  300



>gb|AEQ54921.1| galactinol synthase 3 [Salvia miltiorrhiza]
Length=331

 Score =   313 bits (801),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 175/277 (63%), Positives = 217/277 (78%), Gaps = 15/277 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRR L  +GCIVRE+ P+YP
Sbjct  21   TFLAGNGDYVKGVVGLAKGLRKVKAAYPLVVAVLPDVPEEHRRTLEEEGCIVREIVPVYP  80

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F +Y+KMIYLD D+QV+EN+DHLFDL DGY YAV D
Sbjct  81   P-ENQTQFAMAYYVINYSKLRIWEFVDYTKMIYLDGDIQVYENIDHLFDLEDGYLYAVVD  139

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A +GA P++YFN GMF+F+P+++TY  LL+ 
Sbjct  140  CFCEKPWSHTRQYKIGYCQQCPEKVTWP-AEMGAPPALYFNAGMFVFEPSLATYESLLDT  198

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYC--VEG  812
             K+T PT FAEQDFLNMFF+D YKP+P VYN+++ MLWRHP+ V+L + KVVHYC  V G
Sbjct  199  LKITTPTCFAEQDFLNMFFKDVYKPIPNVYNLVLAMLWRHPENVQLEQVKVVHYCAAVSG  258

Query  813  AKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            +KPWRYTGKE NM RE++KMLV+KWW+IYND+SLD K
Sbjct  259  SKPWRYTGKEENMQREDIKMLVEKWWDIYNDESLDLK  295



>ref|XP_004495634.1| PREDICTED: galactinol synthase 2-like [Cicer arietinum]
Length=325

 Score =   312 bits (800),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGLVKGLRKV + YP+VVAV PDVP EHR +L +QGCIVRE++P+YP
Sbjct  26   TFLAGNGDYVKGVVGLVKGLRKVKTIYPLVVAVLPDVPQEHRNILTSQGCIVREIQPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W F EY KMIYLD D+QVFEN+DHLFDL + YFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWAFEEYDKMIYLDGDIQVFENIDHLFDLPNDYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C + + WPT   GA+P +YFN G F+++PN++TY  LL  
Sbjct  145  CFCEATWGHTKQYEIGYCQQCPDKVQWPTNF-GAKPPLYFNAGFFVYEPNMATYHDLLQK  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             KLT PT+FAEQD+LNM+F+D+YKP+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LKLTKPTSFAEQDYLNMYFKDKYKPIPNIYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG E NM RE++KMLVKKWW+IY D+SLDYK
Sbjct  264  PWRYTGVEENMEREDIKMLVKKWWDIYEDESLDYK  298



>ref|XP_010038308.1| PREDICTED: galactinol synthase 2 [Eucalyptus grandis]
 gb|KCW50132.1| hypothetical protein EUGRSUZ_K03563 [Eucalyptus grandis]
Length=337

 Score =   313 bits (801),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 183/323 (57%), Positives = 231/323 (72%), Gaps = 29/323 (9%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  +AYP+VVAV PDVP EHR++L +QGC+VRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGLAKGLRKAKAAYPLVVAVLPDVPEEHRQILESQGCVVREIEPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFD  DGYFYAV D
Sbjct  88    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDQPDGYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + +   + + WP A +G  P++YFN GMF+F+P+I+TY  LL+ 
Sbjct  147   CFCEKTWSHSPQYKVGYCQQSPDRVKWP-AEMGEPPALYFNAGMFVFEPSIATYVDLLDT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT+FAEQD+LNM+FR+ YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   LKITAPTSFAEQDYLNMYFRNIYKPIPLDYNLVLAMLWRHPENVDLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KW +IYND+SLDYK           G     VE AV   
Sbjct  266   PWRYTGKEENMQREDIKMLVQKWRDIYNDESLDYK-----------GTEVEAVEKAVTVE  314

Query  999   SNTGNLTE-----PRYIKGPPAA  1052
                 +L+E      +Y+  P AA
Sbjct  315   PFIASLSEVPTAPVQYVTAPSAA  337



>ref|XP_010544948.1| PREDICTED: galactinol synthase 1-like isoform X2 [Tarenaya hassleriana]
Length=340

 Score =   313 bits (801),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 227/320 (71%), Gaps = 23/320 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHRR+L  QGCIVRE+EP+YP
Sbjct  31    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEEHRRILEEQGCIVREIEPVYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL+ G+FYAV D
Sbjct  91    P-ENQTGFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLSGGHFYAVMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP  L G  P++YFN GMF+F+P++ TY  LL  
Sbjct  150   CFCEKTWSHTPQYKIGYCQQCSDKVQWPGEL-GDPPALYFNAGMFVFEPDLDTYEDLLRT  208

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F+  YKP+P +YN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  209   LEITPPTPFAEQDFLNMYFKKIYKPIPLIYNLVLAMLWRHPENVELGQVKVVHYCAAGSK  268

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETA--VP  992
             PWRYTG+E NM RE+MKMLV KWW+IY D SLDYK      SV    G A  V     + 
Sbjct  269   PWRYTGEEENMEREDMKMLVNKWWDIYGDDSLDYK-----KSVAAGDGEAEPVNLKPFID  323

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               S  G L    ++  P AA
Sbjct  324   ALSEAGQLN---FVTAPSAA  340



>gb|AAM96870.1| fagopyritol synthase 1 [Fagopyrum esculentum]
Length=333

 Score =   312 bits (800),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRRLL AQGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLAKGLRKVKAAYPLVVAVLPDVPLEHRRLLEAQGCIVREIEPIYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E    FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFD  DGYFYAV D
Sbjct  89   P-ENNCEFAHAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYQNIDHLFDQPDGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C E + WP    G +PS+YFN G F+++P++ TY  L++ 
Sbjct  148  CFCEPSWSKTIQYKIGYCQQCPEKVAWPLEA-GPKPSLYFNAGFFVYEPSLETYKDLIDT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT+FAEQDFLNM+F+D++KPLP  YN+++  LWRHP+KV+L++ KVVHYC  G+K
Sbjct  207  LKVTTPTSFAEQDFLNMYFKDKFKPLPIDYNLVLAFLWRHPEKVDLNRVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K+LVKKWW+IYND+SLD K
Sbjct  267  PWRYTGKEENMDREDIKLLVKKWWDIYNDESLDLK  301



>ref|XP_002281369.1| PREDICTED: galactinol synthase 2 [Vitis vinifera]
 emb|CBI39626.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   312 bits (799),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 181/298 (61%), Positives = 224/298 (75%), Gaps = 13/298 (4%)
 Frame = +3

Query  63   MAPDASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdv  242
            MAP  ++   +   A+   RAYVTFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDV
Sbjct  1    MAPTLASATGLAKAASISSRAYVTFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDV  60

Query  243  paEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSD  422
            PAEHRR+L  QGC+VRE+EP+ P  E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D
Sbjct  61   PAEHRRILEDQGCVVREIEPVNPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGD  119

Query  423  MQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLGARPS  569
            +QVF N+DHLFDL DGYFYAV DC CE+           + + C E + WP A +G  P 
Sbjct  120  IQVFGNIDHLFDLDDGYFYAVMDCFCEKTWSNSPQYKIGYCQQCPEKVKWP-AEMGPAPP  178

Query  570  MYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNML  749
            +YFN GMF+F+P +S Y  LL   K+T PT+FAEQD+LNMFFRD Y+P+P  YN+++ ML
Sbjct  179  LYFNAGMFVFEPCLSVYDDLLTTLKITTPTSFAEQDYLNMFFRDIYRPIPPTYNLVLAML  238

Query  750  WRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            WRHP+ ++L +  VVHYC  G+KPWRYTGKE NM RE++KMLVKKWW+ YND+SLDY+
Sbjct  239  WRHPENIDLQRTNVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDTYNDESLDYR  296



>ref|XP_006302526.1| hypothetical protein CARUB_v10020626mg [Capsella rubella]
 gb|EOA35424.1| hypothetical protein CARUB_v10020626mg [Capsella rubella]
Length=334

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 226/320 (71%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC+VRE+EP++P
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVVREIEPVHP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSKMIYLD+D+QVF+N+DHLF+L DGYF+AV D
Sbjct  87    PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFELPDGYFHAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSPLTYESLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND++LD+K                +VE  V + 
Sbjct  266   PWRYTGEETNMDREDIKMLVDKWWDVYNDETLDFK-----------SKNPADVEGTVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EP   Y   P AA
Sbjct  315   SILASVHEPEITYFPAPSAA  334



>gb|EYU46845.1| hypothetical protein MIMGU_mgv1a009552mg [Erythranthe guttata]
Length=338

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SA+P+VVA+ PDVP +HR LL  QGCIVRE+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKSAHPLVVALLPDVPLDHRLLLEDQGCIVREIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA PYYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL DG F+AV D
Sbjct  86   P-ENQTRFAMPYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLEDGRFHAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A +G  P++YFN GMF+F+P +STY  LLN 
Sbjct  145  CFCEKTWSHTPQYKIGYCQQCPEKVTWP-AEMGHPPALYFNAGMFVFEPGLSTYGSLLNA  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
               T PT FAEQDFLNMFF+D YKP+P +YN+++ MLWRHP+ V+L + KVVHYC  G+K
Sbjct  204  LHTTTPTPFAEQDFLNMFFKDVYKPIPNLYNLVLAMLWRHPENVKLDQVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KM+V KWW+IYND+ LDYK
Sbjct  264  PWRYTGKEENMEREDIKMVVNKWWDIYNDECLDYK  298



>ref|XP_010921393.1| PREDICTED: galactinol synthase 2-like [Elaeis guineensis]
Length=349

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 212/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRKV SAYP+VVAV PDVP +HRR+L +QGC+VRE+EP+YP
Sbjct  31   TFLAGDGDYWKGVVGLAKGLRKVKSAYPLVVAVLPDVPEDHRRILRSQGCLVREIEPVYP  90

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD+D+QV++N+DHLFDL DG FYAV D
Sbjct  91   P-ENQTQFAMAYYVINYSKLRIWEFVEYQKMIYLDADIQVYDNIDHLFDLPDGDFYAVMD  149

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP   LG RP++YFN GMF+ +P+++T   LL  
Sbjct  150  CFCEKTWSHTPQYEIGYCQQCPDKVSWPEDKLGPRPALYFNAGMFVHEPSLATAESLLKA  209

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             + TPPT FAEQDFLNMFF+D Y P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  210  VRSTPPTPFAEQDFLNMFFKDVYTPIPGVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  269

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K LVKKWWE YND+SLDYK
Sbjct  270  PWRYTGKEANMDREDIKTLVKKWWETYNDESLDYK  304



>ref|NP_001105748.1| galactinol synthase 1 [Zea mays]
 gb|AAQ07248.1|AF497507_1 galactinol synthase 1 [Zea mays]
Length=344

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 214/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY KGVVGL KGLRKVGSAYP+VVA+ PDVP  HRR+LV+QGCI+RE+EP+YP
Sbjct  29   TFLAGNGDYWKGVVGLAKGLRKVGSAYPLVVALLPDVPESHRRILVSQGCILREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KM+YLD+D+QVFEN+D LF+L  GYFYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYEKMVYLDADIQVFENIDELFELEKGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WPT  LG  P +YFN GMF  +P+++T   LL+ 
Sbjct  148  CFCEKTWSHTPQYKIGYCQQCPDKVTWPTTELGPPPPLYFNAGMFAHEPSMATAKALLDT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFFRD+Y+P+P VYN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  208  LRVTPPTPFAEQDFLNMFFRDQYRPIPNVYNLVLPMLWRHPENVQLEKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++K LV KWW+IYND+SLD+K
Sbjct  268  PWRFTGKEANMDREDIKSLVNKWWDIYNDESLDFK  302



>ref|XP_010510947.1| PREDICTED: galactinol synthase 4 [Camelina sativa]
Length=334

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 226/320 (71%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC+VRE+EP++P
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVVREIEPVHP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSKMIYLD+D+QVF+N+D+LFDL DGYF+AV D
Sbjct  87    PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFDNIDNLFDLPDGYFHAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSPLTYETLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND++LD+K                +VE  V + 
Sbjct  266   PWRYTGEETNMDREDIKMLVDKWWDVYNDETLDFK-----------SKIPADVEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EP   Y   P AA
Sbjct  315   SILASVLEPEITYFPAPSAA  334



>emb|CAB51130.1| putative galactinol synthase [Pisum sativum]
Length=334

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 229/318 (72%), Gaps = 19/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGV+GL KGLRKV +AYP+VVAV PDVP EHR +L +QGCIVRE++P+YP
Sbjct  25    TFLAGNGDYVKGVIGLAKGLRKVKTAYPLVVAVLPDVPEEHREMLESQGCIVREIQPVYP  84

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV+EN+DHLFDL DGYFYAV D
Sbjct  85    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYENIDHLFDLPDGYFYAVMD  143

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  + G  PS+YFN GMF+F+P++ TY  LL  
Sbjct  144   CFCEKTWSHTPQYKIGYCQQCPEKVQWPKEM-GEPPSLYFNAGMFLFEPSVETYDDLLKT  202

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++T PT FA+QDFLNM+F+D Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  203   CQVTAPTPFADQDFLNMYFKDIYRPIPLVYNLVLAMLWRHPENVELRKVKVVHYCAAGSK  262

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KW +IY+D SLDYK  K  +   E      E E  V   
Sbjct  263   PWRYTGKEENMQREDIKMLVQKWLDIYSDSSLDYK--KNLSGNCETQRNDVE-EPFVQAL  319

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G +   RY+  P AA
Sbjct  320   SEVGRV---RYVTAPSAA  334



>ref|XP_006346965.1| PREDICTED: galactinol synthase 2-like [Solanum tuberosum]
Length=327

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 214/274 (78%), Gaps = 12/274 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHR +L+ QGCIVRE+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEEHRHILINQGCIVREIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL +GYFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFKNIDHLFDLPNGYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + +   E + WP   LG +P++YFN GMF+FQP++ TY  LL+ 
Sbjct  145  CFCEKTWSHTPQYNIGYCQQSPEKVQWPEQDLGPKPNLYFNAGMFVFQPSLLTYDDLLSF  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT+FAEQD LNMFF+D YKP+P  YN+++ MLWRHP+ VE+ K KVVHYC  G+K
Sbjct  205  LEVTPPTSFAEQDLLNMFFKDIYKPIPNKYNLVLAMLWRHPENVEIDKVKVVHYCAAGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWRYTG+E NM R+++KMLVK W EIYND+SLDY
Sbjct  265  PWRYTGEEENMDRQDIKMLVKNWTEIYNDESLDY  298



>ref|XP_011003180.1| PREDICTED: galactinol synthase 1 [Populus euphratica]
Length=337

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 216/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKV +AYP++VAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  28   TFLAGDGDYVKGVVGLAKGLRKVNTAYPLIVAVLPDVPEEHRQILESQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DG FYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGRFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  PS YFN GMF+F+P+I+TY  LL  
Sbjct  147  CFCEKTWSHTPQYKIGYCQQCPDKVNWP-AEMGQPPSPYFNAGMFVFEPSIATYHDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+D Y P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206  LKVTPPTPFAEQDFLNMYFKDIYTPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM R+++KMLVKKWW+IY+D+SLD +
Sbjct  266  PWRYTGKEENMQRDDIKMLVKKWWDIYSDESLDSR  300



>ref|XP_002467954.1| hypothetical protein SORBIDRAFT_01g037090 [Sorghum bicolor]
 gb|EER94952.1| hypothetical protein SORBIDRAFT_01g037090 [Sorghum bicolor]
Length=349

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 216/276 (78%), Gaps = 13/276 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRK  SAYP+VVAV PDVP  HRR+LV+QGCIVRE+EP+YP
Sbjct  32   TFLAGDGDYWKGVVGLAKGLRKARSAYPLVVAVLPDVPESHRRILVSQGCIVREIEPVYP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVFEN+D LF+L  GYFYAV D
Sbjct  92   P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFENVDELFELEKGYFYAVMD  150

Query  492  CVCEE-----------HGEPCKEILPWP-TALLGARPSMYFNGGMFMFQPNISTYTRLLN  635
            C CE+           + + C + + WP TA LG  P++YFN GMF+ +P+++T   LL+
Sbjct  151  CFCEKTWSHTPQYKIGYCQQCPDKVAWPATAELGPPPALYFNAGMFVHEPSMATAKALLD  210

Query  636  HFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGA  815
              ++TPPT FAEQDFLNMFFRD+Y+P+P VYN+++ MLWRHP+ V+L K K VHYC  G+
Sbjct  211  TLRVTPPTPFAEQDFLNMFFRDQYRPIPNVYNLVLAMLWRHPENVQLEKVKAVHYCAAGS  270

Query  816  KPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            KPWR+TGKE NM RE++KMLVKKWW+IYND++LD+K
Sbjct  271  KPWRFTGKEPNMDREDIKMLVKKWWDIYNDETLDFK  306



>ref|XP_002525364.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37002.1| conserved hypothetical protein [Ricinus communis]
Length=335

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 224/320 (70%), Gaps = 24/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDY+KGVVGL KGLRKV SAYP+VVA+  DVP EHR +L +QGCIVRE+EP+YP
Sbjct  27    TFLAGNGDYIKGVVGLAKGLRKVRSAYPLVVAILGDVPEEHREILRSQGCIVREIEPIYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QVFEN+DHLFD+ DGY YA  D
Sbjct  87    P-ENQVEFAMAYYVINYSKLRIWNFLEYSKMVYLDADIQVFENIDHLFDMPDGYLYAAMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + +PWP A +G+ P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSRQYKIGYCQQCPDRVPWP-ADMGSPPPLYFNAGMFVFEPSRLTYENLLRT  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNMFF   YKPLP VYN+++ MLWRHP+ +++ K KV HYC  G+K
Sbjct  205   LEITPPTPFAEQDFLNMFFEKTYKPLPLVYNLVLAMLWRHPENIDVQKVKVAHYCAAGSK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW IYND+SLD     Q A+           E    R 
Sbjct  265   PWRYTGKEANMEREDIKMLVAKWWNIYNDESLDL----QPAT-----SVTTAEEETFSRT  315

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   YI  P AA
Sbjct  316   SIMASMPEPIISYIPAPSAA  335



>ref|XP_007163208.1| hypothetical protein PHAVU_001G215300g [Phaseolus vulgaris]
 gb|ESW35202.1| hypothetical protein PHAVU_001G215300g [Phaseolus vulgaris]
Length=335

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 214/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL+KGLRKV +AYP+VVAV PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  29   TFLAGNGDYVKGVVGLIKGLRKVKAAYPLVVAVLPDVPEEHREILKSQGCIVREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENVDHLFDLPDGNFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WPT L G  P++YFN GMF+F+PN+ TY  LL  
Sbjct  148  CFCEKTWSHTPQYKAGYCQQCPEKVQWPTEL-GQPPALYFNAGMFLFEPNMVTYHDLLKT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT+FAEQDFLNM+F++ YKP+P  YN+++ MLWRHP+ V L + KVVHYC  G+K
Sbjct  207  LKVTTPTSFAEQDFLNMYFKNIYKPIPVSYNLVLAMLWRHPENVNLEEVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++KMLV KWW+IYND SLDYK
Sbjct  267  PWRYTGQEENMQREDIKMLVHKWWDIYNDVSLDYK  301



>ref|XP_003591231.1| Galactinol synthase [Medicago truncatula]
 gb|AES61482.1| galactinol synthase [Medicago truncatula]
Length=325

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV + YP+VVAV PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKTMYPLVVAVLPDVPQEHRNILTSQGCIVREIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W F EY KMIYLD D+QVFEN+DHLFDL + YFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWAFEEYDKMIYLDGDIQVFENIDHLFDLPNNYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C + + WP A  G +P +YFN GMF+++PN++TY  LL  
Sbjct  145  CFCEASWRHTKQYEIGYCQQCPDKVQWP-ANFGPKPPLYFNAGMFVYEPNMATYHDLLQK  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLN++F+D+YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LQVTKPTSFAEQDFLNIYFKDKYKPIPNVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG E NM RE++KMLVKKWW++Y D+SLDYK
Sbjct  264  PWRYTGVEENMQREDIKMLVKKWWDVYEDESLDYK  298



>gb|ADM92588.1| galactinol synthase [Coffea arabica]
Length=338

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 214/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  32   TFLAGNGDYVKGVVGLAKGLRKVNSAYPLVVAILPDVPEEHREILRSQGCIVREIEPIYP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E ++ FA  YYV+NYSKL+ W F EYSKMIYLD+D+QV++N+DHLFD ADGYFYAV D
Sbjct  92   P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVYDNIDHLFDAADGYFYAVMD  150

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G+ P +YFN GMF+F+P+  TY  LL  
Sbjct  151  CFCEKTWSNSPQYSIGYCQQCPDKVTWP-ADMGSPPPLYFNAGMFVFEPSRLTYENLLET  209

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFF+  YKP+   YN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  210  LQITPPTLFAEQDFLNMFFQTTYKPISLAYNLVLAMLWRHPENVELDEVKVVHYCAAGSK  269

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV+KWW++YND SLD+K
Sbjct  270  PWRYTGKEANMDREDIKMLVQKWWDVYNDASLDFK  304



>ref|XP_010039527.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 ref|XP_010042475.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW45875.1| hypothetical protein EUGRSUZ_L00241 [Eucalyptus grandis]
Length=338

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 231/319 (72%), Gaps = 22/319 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRK  S YP+VVA+ PDVPA+HR++LV QGCIVRE+EP+YP
Sbjct  30    TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAILPDVPADHRKILVDQGCIVREIEPVYP  89

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFDL +G+F+AV D
Sbjct  90    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPNGFFHAVMD  148

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP  + G +P  YFN GMF+++PN+ TY  LL  
Sbjct  149   CFCEKTWSHTPQYEIGYCQQCPDKVQWPDHV-GPKPPFYFNAGMFVYEPNLDTYHDLLET  207

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT+FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL K KVVHYC  G+K
Sbjct  208   LKITPPTSFAEQDFLNMYFKDIYKPIPNVYNLVLAMLWRHPENIELDKVKVVHYCAAGSK  267

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PW YTG+E +M R+++KMLVKKWW+IY+D+SLDYK    R +  +        +T   RF
Sbjct  268   PWWYTGEEQHMDRDDIKMLVKKWWDIYDDESLDYKNIVARDAAAK--------QTKWDRF  319

Query  999   -SNTGNLTEPRYIKGPPAA  1052
              +   +    R+I  P AA
Sbjct  320   LAALADAGAFRFITAPTAA  338



>gb|ADW78844.1| putative galactinol synthase [Solanum commersonii]
 gb|ADW78845.1| putative galactinol synthase [Solanum commersonii]
Length=327

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 213/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP EHR +L+ QGCIVRE+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEEHRHILINQGCIVREIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL  W+F EYSKMIYLD D+QVF+N+DHLFDL +GYFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLCIWEFVEYSKMIYLDGDIQVFKNIDHLFDLPNGYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + +   E + WP   LG +P++YFN GMF+FQP++ TY  LL+ 
Sbjct  145  CFCEKTWSHTPQYNIGYCQQSPEKVQWPEQDLGPKPNLYFNAGMFVFQPSLLTYDDLLSF  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT+FAEQD LNMFF+D YKP+P  YN+++ MLWRHP+ VE+ K KVVHYC  G+K
Sbjct  205  LQVTPPTSFAEQDLLNMFFKDIYKPIPNKYNLVLAMLWRHPENVEIDKVKVVHYCAAGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM R+++KMLVK W EIYND+SLDY 
Sbjct  265  PWRYTGEEENMDRQDIKMLVKNWTEIYNDESLDYN  299



>emb|CAN66209.1| hypothetical protein VITISV_035072 [Vitis vinifera]
Length=325

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 231/323 (72%), Gaps = 17/323 (5%)
 Frame = +3

Query  63   MAPDASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdv  242
            MAP  ++   +   A+   RAYVTFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDV
Sbjct  1    MAPTLASATGLAKAASISSRAYVTFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDV  60

Query  243  paEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSD  422
            PAEHRR+L  QGC+VRE+EP+ P  E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D
Sbjct  61   PAEHRRILEDQGCVVREIEPVNPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGD  119

Query  423  MQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLGARPS  569
            +QVF N+DHLFDL +GYFYAV DC CE+           + + C E + WP A +G  P 
Sbjct  120  IQVFGNIDHLFDLDNGYFYAVMDCFCEKTWSNSPQYKIGYCQQCPEKVQWP-AEMGPAPP  178

Query  570  MYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNML  749
            +YFN GMF+F+P +S Y  LL   K+T PT+FAEQD+LN+FFRD Y+P+P  YN+++ ML
Sbjct  179  LYFNAGMFVFEPCLSVYDDLLTTLKITTPTSFAEQDYLNIFFRDIYRPIPPTYNLVLAML  238

Query  750  WRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYY  929
            WRHP+ ++L +  VVHYC  G+KPWRYTGKE NM RE++KMLVKKWW+IYND+SLDY+  
Sbjct  239  WRHPENIDLQRTNVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYNDESLDYRNS  298

Query  930  KQRA----SVYELGGAAHEVETA  986
                    +V    G  H   TA
Sbjct  299  SANGQPFTAVLSEAGEVHHYITA  321



>ref|XP_010473225.1| PREDICTED: galactinol synthase 4-like [Camelina sativa]
Length=334

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 226/320 (71%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S+YP+VVA+ PDVP EHR +L +QGC+VRE+EP++P
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSSYPLVVAMLPDVPEEHREILRSQGCVVREIEPVHP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSKMIYLD+D+QVF+N+D+LFDL DGYF+AV D
Sbjct  87    PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFDNIDNLFDLPDGYFHAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P++ TY  LL  
Sbjct  146   CFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSLLTYESLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND++LD+                 +VE  V + 
Sbjct  266   PWRYTGEETNMDREDIKMLVDKWWDVYNDETLDFT-----------SKIPADVEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EP   +   P AA
Sbjct  315   SILASVLEPEITFFPAPSAA  334



>ref|XP_010417980.1| PREDICTED: galactinol synthase 4-like [Camelina sativa]
Length=335

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/275 (61%), Positives = 213/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC+VRE+EP++P
Sbjct  28   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVVREIEPVHP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  ++ FA  YYVLNYSKL+ W F EYSKMIYLD+D+QVF+N+D+LFDL DGYF+AV D
Sbjct  88   PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFDNIDNLFDLPDGYFHAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP  +    P +YFN GMF+F+P++ TY  LL  
Sbjct  147  CFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSLLTYESLLQT  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207  LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++KMLV KWW++YND++LD+K
Sbjct  267  PWRYTGEETNMDREDIKMLVGKWWDVYNDETLDFK  301



>gb|ADM92590.1| galactinol synthase [Coffea arabica]
Length=344

 Score =   311 bits (797),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 224/320 (70%), Gaps = 17/320 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDY KGVVGL KGLRK  +AYP+VVA  PDVP EHR++L +QGC+VRE+EP+YP
Sbjct  29    TFLAGSGDYWKGVVGLAKGLRKSNTAYPLVVAALPDVPEEHRQILESQGCVVREIEPVYP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLF+  DG FYAV D
Sbjct  89    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFEYPDGQFYAVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + +   + + WP  L GA P +YFN GMF+++PN+STY RLL  
Sbjct  148   CFCEKTWSNTIQYQIGYCQQSPQRVQWPEEL-GAPPPLYFNAGMFVYEPNLSTYHRLLET  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT FAEQDFLNMFFRD Y+P+P VYN+++ MLWRHP+ ++L   KVVHYC  G+K
Sbjct  207   VKITSPTTFAEQDFLNMFFRDIYRPIPPVYNLVLAMLWRHPENIDLDSFKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVY--ELGGAAHEVETAVP  992
             PWRYTGKE NM RE++KMLV+KWW+IY D+SLDY       S    E GG   + E  V 
Sbjct  267   PWRYTGKEENMQREDIKMLVEKWWDIYEDESLDYVNIADAPSKINKEGGGNDDQKEKTVA  326

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               S+   L    Y   P AA
Sbjct  327   ALSDAAGLV--HYATAPSAA  344



>gb|AHI44616.1| galactinol synthase-2 [Manihot esculenta]
Length=320

 Score =   310 bits (795),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  +AYP+VVAV PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  16   TFLAGNGDYVKGVVGLAKGLRKAKTAYPLVVAVLPDVPEEHRHILESQGCIVREIEPVYP  75

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVFEN+DHLFD  +GYFYAV D
Sbjct  76   P-ENQTQFAMAYYVINYSKLRIWEFVEYEKMIYLDGDIQVFENIDHLFDSPNGYFYAVMD  134

Query  492  CVCE-----------EHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C E + WP  + G+ P  YFN GMF+F+P + TY+ LL+ 
Sbjct  135  CFCEYNWRFSPQYKIGYCQQCPERVQWPKEM-GSPPPPYFNAGMFVFEPELLTYSHLLDT  193

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K TPPT+FAEQDFLN+FF+D YKP+P VYN+++ MLWRHP+ VE  K KVVHYC +GAK
Sbjct  194  LKDTPPTSFAEQDFLNVFFKDVYKPIPPVYNLVLAMLWRHPENVEFDKVKVVHYCADGAK  253

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K+LVKKWW+IY D+SLDYK
Sbjct  254  PWRYTGKEVNMEREDIKLLVKKWWDIYEDESLDYK  288



>ref|XP_010679458.1| PREDICTED: galactinol synthase 1 [Beta vulgaris subsp. vulgaris]
Length=339

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 227/318 (71%), Gaps = 19/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL+KGLRKV + YP++VAV PDVP +HR++LV+QGCIVRE+EP+YP
Sbjct  30    TFLAGNGDYVKGVVGLIKGLRKVKTIYPLIVAVLPDVPEDHRKILVSQGCIVREIEPVYP  89

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E    FA  YYV+NYSKL+ W+F EY K+IYLD D+QV++N+DHLFDL + YFYAV D
Sbjct  90    P-ENNTQFAHAYYVINYSKLRIWEFVEYEKLIYLDGDIQVYKNIDHLFDLPNEYFYAVMD  148

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE            + + C E + WPTA LG  PS+YFN G F+++P+ISTY  +L  
Sbjct  149   CFCEASWSKTPQYKIGYCQQCPEKVQWPTAELGPPPSIYFNAGFFVYEPSISTYHDILKT  208

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K  PPT+FAEQDFLNM+F D++KPLP  YN+++  LWRHP+KV+L+K KVVHYC  G+K
Sbjct  209   LKEIPPTSFAEQDFLNMYFNDKFKPLPIDYNLVLAFLWRHPEKVDLNKVKVVHYCAAGSK  268

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLVKKWW+IYND  LDY       +      AA +++      
Sbjct  269   PWRYTGEEENMDREDIKMLVKKWWDIYNDPCLDYNPVADPPT----EAAAVDMKPFREAL  324

Query  999   SNTGNLTEPRYIKGPPAA  1052
             S  G L    Y+  P AA
Sbjct  325   SKAGALN---YVTAPSAA  339



>gb|KCW45877.1| hypothetical protein EUGRSUZ_L00245 [Eucalyptus grandis]
Length=334

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 215/280 (77%), Gaps = 13/280 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVA+ PDVP +HR++LV QGCIVRE+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKAESKYPLVVAILPDVPVDHRKILVDQGCIVREIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVF+N+DHLFDL + +FYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWEFVEYDKMIYLDGDIQVFDNIDHLFDLPNSFFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP  + G +PS+YFN GMF+++PN+ TY  +L  
Sbjct  145  CFCEKTWSHTPQYEIGYCQQCPDKVQWPDHV-GPKPSLYFNAGMFVYEPNLYTYHDMLET  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LKITPPTPFAEQDFLNMYFKDIYKPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQR  938
            PWRYTG+E +M R+++KMLVK WW+IY+D+SLDYK    R
Sbjct  264  PWRYTGEEQHMDRDDIKMLVKNWWDIYDDESLDYKNIVAR  303



>ref|XP_003555792.1| PREDICTED: galactinol synthase 2 [Glycine max]
Length=324

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 211/274 (77%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVAV PDVP  HR +L +QGCIVRE+EP+YP
Sbjct  25   TFLAGNGDYVKGVVGLAKGLRKVKSMYPLVVAVLPDVPEHHRNILTSQGCIVREIEPVYP  84

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F E+SKMIYLD D+QVF+N+DHLFDL D YFYAV D
Sbjct  85   P-ENQTQFAMAYYVINYSKLRIWEFVEFSKMIYLDGDIQVFDNIDHLFDLPDNYFYAVMD  143

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C   + WPT   G +P +YFN GMF+++PN+ TY  LL  
Sbjct  144  CFCEPTWGHTLQYQIGYCQQCPHKVQWPTHF-GPKPPLYFNAGMFVYEPNLDTYRDLLQT  202

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLNM+F+D+Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  203  VQVTKPTSFAEQDFLNMYFKDKYRPIPNVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  262

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWRYTGKE NM RE++KMLVKKWW+IY D++LDY
Sbjct  263  PWRYTGKEENMEREDIKMLVKKWWDIYEDETLDY  296



>ref|XP_011087511.1| PREDICTED: galactinol synthase 2-like [Sesamum indicum]
Length=336

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 215/265 (81%), Gaps = 3/265 (1%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKVG+A+P+VVAV PDVPAEHRR+LV QGC++R++E ++P
Sbjct  32   TFLAGDGDYVKGVVGLAKGLRKVGAAFPLVVAVLPDVPAEHRRVLVEQGCLLRDIELVFP  91

Query  312  -SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVP  488
             S   E PF RPY+ +NY KL+ W+F EY+KMIY+D+D+QVF N+DHLFDL  G FY V 
Sbjct  92   PSTGKESPFVRPYFAVNYCKLRLWEFVEYNKMIYMDADIQVFHNIDHLFDLPSGCFYGVA  151

Query  489  DCVCEEHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFA  668
            DC+CE +  PC++ L WP  +LG +PS Y NGGMF+F+PN++TY +LL   ++TP T FA
Sbjct  152  DCLCEMYDTPCEQKLRWPE-VLGPQPSFYLNGGMFIFEPNLNTYDQLLGALEITPSTPFA  210

Query  669  EQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKV-ELSKAKVVHYCVEGAKPWRYTGKEN  845
            EQDFLNMFFRD  KP+P +YN+LV MLWRHP  V +L   KVVHYCV G+KPWRYTGKE 
Sbjct  211  EQDFLNMFFRDVSKPIPPIYNLLVAMLWRHPQWVDDLDNVKVVHYCVAGSKPWRYTGKEE  270

Query  846  NMGREEMKMLVKKWWEIYNDQSLDY  920
            NM R ++KMLV++WW+IYND++LD+
Sbjct  271  NMDRADIKMLVERWWDIYNDEALDF  295



>ref|XP_010039530.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
Length=338

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 215/280 (77%), Gaps = 13/280 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVA+ PDVP +HR++LV QGCIVRE+EP+YP
Sbjct  30   TFLAGNGDYVKGVVGLAKGLRKAESKYPLVVAILPDVPVDHRKILVDQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVF+N+DHLFDL + +FYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWEFVEYDKMIYLDGDIQVFDNIDHLFDLPNSFFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP  + G +PS+YFN GMF+++PN+ TY  +L  
Sbjct  149  CFCEKTWSHTPQYEIGYCQQCPDKVQWPDHV-GPKPSLYFNAGMFVYEPNLYTYHDMLET  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  208  LKITPPTPFAEQDFLNMYFKDIYKPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQR  938
            PWRYTG+E +M R+++KMLVK WW+IY+D+SLDYK    R
Sbjct  268  PWRYTGEEQHMDRDDIKMLVKNWWDIYDDESLDYKNIVAR  307



>ref|XP_010458217.1| PREDICTED: galactinol synthase 3-like isoform X1 [Camelina sativa]
 ref|XP_010458218.1| PREDICTED: galactinol synthase 3-like isoform X2 [Camelina sativa]
Length=336

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 172/276 (62%), Positives = 215/276 (78%), Gaps = 13/276 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNG YVKGVVGL KGLRK  S YP+VVAV PDVPA+HRR LV QGCIV++++P+ P
Sbjct  21   TFLAGNGGYVKGVVGLAKGLRKANSKYPLVVAVLPDVPADHRRQLVDQGCIVKDIQPVNP  80

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYVLNYSKL+ W+F EYS++IYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  81   PDN-QTQFAMAYYVLNYSKLRIWEFVEYSRLIYLDGDIQVFENIDHLFDLPDGSFYAVKD  139

Query  492  CVCEE-----------HGEPCKEILPWP-TALLGARPSMYFNGGMFMFQPNISTYTRLLN  635
            C CE+           + + C + + WP T  LG +P +YFN GMF+++P++ TY  LL 
Sbjct  140  CFCEKTWSHTPQYKIGYCQQCPDKVTWPETEQLGPKPPLYFNAGMFVYEPSLPTYYNLLE  199

Query  636  HFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGA  815
              K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL++AKVVHYC  GA
Sbjct  200  TLKVVPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELNEAKVVHYCAAGA  259

Query  816  KPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            KPWR+TG+E NM RE++KMLV+KWWEIYND+SLDYK
Sbjct  260  KPWRFTGQEENMEREDIKMLVEKWWEIYNDESLDYK  295



>ref|XP_009789360.1| PREDICTED: galactinol synthase 1-like [Nicotiana sylvestris]
Length=344

 Score =   310 bits (795),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 172/277 (62%), Positives = 216/277 (78%), Gaps = 14/277 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDVP EHRR+L AQGCI+RE+EP+YP
Sbjct  30   TFLAGNGDYVKGVVGLAKGLRKVHTAYPLVVAVLPDVPEEHRRILEAQGCILREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLDSD+QV++N+DHLFDLADG+FYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWKFVEYEKMIYLDSDIQVYDNIDHLFDLADGHFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPT--ALLGARPSMYFNGGMFMFQPNISTYTRLL  632
            C CE+           + + C + + WP      G  PS+YFN GMF+F+P + +Y  LL
Sbjct  149  CFCEKTWSHTPQYKIGYCQQCPDKVKWPNNDEEFGQPPSLYFNAGMFVFEPGLDSYQDLL  208

Query  633  NHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEG  812
               K+TPPT FAEQDFLNM+F++ YKP+P  YN+++ MLWRHP+ V+L++ KVVHYC  G
Sbjct  209  KTLKITPPTPFAEQDFLNMYFKNIYKPIPLDYNLVLAMLWRHPENVKLAEVKVVHYCAAG  268

Query  813  AKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            +KPWRY GKE+NM R+++KMLVKKWW+IY D+SLDYK
Sbjct  269  SKPWRYKGKEDNMQRDDIKMLVKKWWDIYEDKSLDYK  305



>gb|KFK43233.1| hypothetical protein AALP_AA1G097300 [Arabis alpina]
Length=336

 Score =   310 bits (794),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 212/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HRR LV QGCIV+E+EP+ P
Sbjct  20   TFLAGNGDYVKGVVGLAKGLRKTKSKYPLVVAVLPDVPVDHRRQLVEQGCIVKEIEPVCP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLF L +G FYAV D
Sbjct  80   P-ENQTQFAMAYYVINYSKLRIWKFVEYSKMIYLDGDIQVFENIDHLFGLPNGNFYAVKD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + W    LG +P +YFN GMF+++PN+ TY  LL +
Sbjct  139  CFCEKTWSHTPQYKIGYCQQCPDKVKWSEPELGPKPPLYFNAGMFVYEPNLPTYYNLLEN  198

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ + L++AKVVHYC  GAK
Sbjct  199  LKVIPPTPFAEQDFLNMYFQDIYKPIPPVYNLVLAMLWRHPENIVLNEAKVVHYCAAGAK  258

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TG+E NM RE++KMLVKKWW+IYND+SLDYK
Sbjct  259  PWRFTGQEENMDREDIKMLVKKWWDIYNDESLDYK  293



>gb|ACM50915.1| galactinol synthase [Medicago falcata]
Length=325

 Score =   310 bits (793),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 210/275 (76%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV + YP+VVAV PDVP EHR +L +QGCIVRE+ P+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKTMYPLVVAVLPDVPREHRNILTSQGCIVREIVPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W F +Y KMIYLD D+QVFEN+DHLFDL + YFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWAFEDYDKMIYLDGDIQVFENIDHLFDLPNNYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C + + WPT   G +P +YFN GMF+++PN++TY  LL  
Sbjct  145  CFCEASWRHTKQYEIGYCQQCPDKVQWPTNF-GPKPPLYFNAGMFVYEPNMATYHDLLQK  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT+FAEQDFLNM+F D+YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LKVTEPTSFAEQDFLNMYFNDKYKPIPNVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG E NM RE++KMLVKKWW++Y D+SLDYK
Sbjct  264  PWRYTGVEENMQREDIKMLVKKWWDVYEDESLDYK  298



>ref|XP_009416551.1| PREDICTED: galactinol synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 227/320 (71%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGLVKGLRKV S YP++VAV PDVP  HRRLL AQGCIVRE+EP++P
Sbjct  26    TFLAGDGDYVKGVVGLVKGLRKVKSGYPLIVAVLPDVPELHRRLLQAQGCIVREIEPVHP  85

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSK+IYLD+D+QV+EN+DHLFD+ DGYFYAV D
Sbjct  86    P-ENQVQFAMAYYVINYSKLRIWNFVEYSKIIYLDADIQVYENIDHLFDMPDGYFYAVMD  144

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G+ P +YFN GMF+ +P  STY  LL  
Sbjct  145   CFCEKTWSHSRQYSIGYCQQCPDKVAWP-AEMGSPPPLYFNAGMFVSEPAQSTYNSLLKA  203

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNM+F   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204   LRITPPTPFAEQDFLNMYFEKIYKPIPPVYNLVLAMLWRHPENVELGKVKVVHYCAAGSK  263

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWR+TGKE NM RE++KMLV KWW IYND SLD+K             A  E +T +   
Sbjct  264   PWRFTGKEANMDREDIKMLVAKWWNIYNDDSLDFKE----------EDAVPEGDTCLRST  313

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S  G ++E +  YI  P  A
Sbjct  314   SIMGTMSEQKINYIPAPSVA  333



>ref|XP_010251224.1| PREDICTED: galactinol synthase 1-like [Nelumbo nucifera]
Length=338

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 216/275 (79%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  32   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRQILRSQGCIVREIEPIYP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QV++N+DHLFD  DG+FYAV D
Sbjct  92   P-ENQIQFAMAYYVINYSKLRIWDFEEYSKMVYLDADIQVYDNIDHLFDRPDGFFYAVMD  150

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G+ P +YFN GMF+F+P+  TY  LL  
Sbjct  151  CFCEKTWSHSPQYSIGYCQQCPDKVTWP-AEMGSPPPLYFNAGMFVFEPSPLTYETLLET  209

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFF+  YKP+P VYN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  210  LQITPPTPFAEQDFLNMFFQHIYKPIPLVYNLVLAMLWRHPENVDLDKVKVVHYCAAGSK  269

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWW++YND+SLD+K
Sbjct  270  PWRYTGKEANMDREDIKMLVAKWWDMYNDESLDFK  304



>gb|ACA04033.1| galactinol synthase 4 [Populus trichocarpa x Populus deltoides]
Length=337

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKV +AYP++VAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  28   TFLAGDGDYVKGVVGLAKGLRKVKTAYPLIVAVLPDVPEEHRQILESQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DG FYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGRFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  PS YFN GM +F+P+I+TY  LL  
Sbjct  147  CFCEKTWSHTPQYKIGYCQQCPDKVNWP-AEMGQPPSPYFNAGMCVFEPSIATYHDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+D Y P+P VYN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  206  LKVTPPTPFAEQDFLNMYFKDIYTPIPLVYNLVLAMLWRHPENVELDRVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IY+D+SLD K
Sbjct  266  PWRYTGKEENMQREDIKMLVKKWWDIYSDESLDSK  300



>ref|XP_007205502.1| hypothetical protein PRUPE_ppa008294mg [Prunus persica]
 gb|EMJ06701.1| hypothetical protein PRUPE_ppa008294mg [Prunus persica]
Length=338

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 234/320 (73%), Gaps = 19/320 (6%)
 Frame = +3

Query  63   MAPD---ASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavw  233
            MAPD   A+        A+G  RAYVTFLAG GDYVKGVVGL KGLRKV S YP+VVA+ 
Sbjct  1    MAPDITTATTMVPATKAASGPSRAYVTFLAGTGDYVKGVVGLAKGLRKVKSKYPLVVAIL  60

Query  234  pdvpaEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYL  413
            PDVP EHR++LV+QGCIV+E+EP+YP    +  FA  YYV+NYSKL+ W+F EYSKMIYL
Sbjct  61   PDVPKEHRQILVSQGCIVKEIEPVYPPPN-QTQFAMAYYVINYSKLRIWEFVEYSKMIYL  119

Query  414  DSDMQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLGA  560
            D D+QVF+N+DHLFD  DGYFYAV DC CE+           + + C + + W    LG 
Sbjct  120  DGDIQVFQNIDHLFDYPDGYFYAVMDCFCEKTWSSSPQYKIGYCQQCPDKVQW-APELGP  178

Query  561  RPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLV  740
            RP +YFN GMF+++P++  Y  LL   +++P T+FAEQDFLN+FFRD+YKP+P  YN+++
Sbjct  179  RPPLYFNAGMFVYEPSLPVYHDLLRTLQVSPTTSFAEQDFLNVFFRDKYKPIPSNYNLVL  238

Query  741  NMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
             MLWRHP+ ++L + KVVHYC +G+KPWRYTGKE NM RE++KMLVKKWW+IY+D+SLD 
Sbjct  239  AMLWRHPENIQLDQVKVVHYCADGSKPWRYTGKEENMQREDIKMLVKKWWDIYDDESLD-  297

Query  921  KYYKQRASVYELGGAAHEVE  980
              +K   +  E G  A +V+
Sbjct  298  --FKNIVAAAEAGNGADQVD  315



>ref|XP_002301531.2| putative galactinol synthase family protein [Populus trichocarpa]
 gb|EEE80804.2| putative galactinol synthase family protein [Populus trichocarpa]
Length=337

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKV +AYP++VAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  28   TFLAGDGDYVKGVVGLAKGLRKVKTAYPLIVAVLPDVPEEHRQILESQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DG FYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGRFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  PS YFN GM +F+P+I+TY  LL  
Sbjct  147  CFCEKTWSHTPQYKIGYCQQCPDKVNWP-AEMGQPPSPYFNAGMCVFEPSIATYHDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+D Y P+P VYN+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  206  LKVTPPTPFAEQDFLNMYFKDIYTPIPLVYNLVLAMLWRHPENVELDRVKVVHYCAAGSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IY+D+SLD K
Sbjct  266  PWRYTGKEENMQREDIKMLVKKWWDIYSDESLDSK  300



>gb|ABK27907.1| galactinol synthase [Xerophyta viscosa]
Length=337

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 229/318 (72%), Gaps = 18/318 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG GDYVKGVVGL KGLRKVGSAYP+VVAV PDVP EHR+LLV+QGCIVR++EP+YP
Sbjct  27    TFLAGAGDYVKGVVGLAKGLRKVGSAYPLVVAVLPDVPDEHRKLLVSQGCIVRQIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD+D+QV++N+DHLFDL  G FYAV D
Sbjct  87    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDADIQVYDNIDHLFDLPGGRFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C   + WP A LG  P++YFN GMF+ +P+++T  +LL  
Sbjct  146   CFCEKTWSHTPQYKIGYCQQCPNKVTWP-AELGQPPALYFNAGMFVHEPSLATAEKLLAT  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ P T FAEQD+LNMFF+D Y+P+P  YN+++ MLWRHP+ VEL K  VVHYC  G+K
Sbjct  205   LKVAPTTPFAEQDYLNMFFKDIYRPIPLTYNLVLAMLWRHPENVELDKVMVVHYCAAGSK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+IYND SLD   YK  A+  +L   A  ++    + 
Sbjct  265   PWRYTGKEENMDREDIKMLVKKWWDIYNDDSLD---YKGPAATMDLEPEAPGLKQL--KL  319

Query  999   SNTGNLTEPRYIKGPPAA  1052
             +      E RY K P AA
Sbjct  320   AALSEAGEVRYTKAPSAA  337



>ref|XP_004139524.1| PREDICTED: galactinol synthase 2-like [Cucumis sativus]
 ref|XP_004172930.1| PREDICTED: galactinol synthase 2-like [Cucumis sativus]
 gb|KGN65020.1| hypothetical protein Csa_1G181330 [Cucumis sativus]
Length=326

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/278 (61%), Positives = 210/278 (76%), Gaps = 12/278 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP++VAV PDVP EHR LL  QGC+V+E++P+YP
Sbjct  17   TFLAGNGDYVKGVVGLAKGLRKVKSKYPLLVAVLPDVPEEHRELLRWQGCVVKEIQPVYP  76

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                   FA PYYV+NYSKL+ W+F EY K+IYLD D+QV EN+DHLF + D +FYAV D
Sbjct  77   PQN-HTQFAMPYYVINYSKLRIWEFVEYKKLIYLDGDIQVMENIDHLFQMEDSFFYAVMD  135

Query  492  CVCEEHGEPCKEI-----------LPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+      +            + WP + LG +P +YFN GMF+++PN+ TY  LL+ 
Sbjct  136  CFCEKTWSHTAQYEIGYCQQRPNEVQWPASELGPKPPLYFNAGMFVYEPNLETYHSLLST  195

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              +TPPT FAEQDFLNMFF+D+YKP+P VYN+++ MLWRHP+ +EL K KVVHYC  G+K
Sbjct  196  LNITPPTPFAEQDFLNMFFKDKYKPIPPVYNLVMAMLWRHPENIELHKVKVVHYCAAGSK  255

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYK  932
            PWRYTGKE NM RE++KMLVKKWWEIY+D++LDY  YK
Sbjct  256  PWRYTGKEENMDREDVKMLVKKWWEIYDDETLDYINYK  293



>ref|XP_010924270.1| PREDICTED: galactinol synthase 1 [Elaeis guineensis]
Length=337

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 175/275 (64%), Positives = 211/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRK  SAYP+VVAV PDVP  HR+LL  QGCIVRE+EP+YP
Sbjct  30   TFLAGDGDYVKGVVGLAKGLRKARSAYPLVVAVLPDVPVAHRQLLQGQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E    FA  ++V+NYSKL+ W F EYSKMIYLD+D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  90   P-ENHTQFAMAHFVINYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFDMPDGYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            +   C + + WP A +G+ P +YFN GMF+F+PN  TY RLL+ 
Sbjct  149  CFCEPIWSQTLQYSIGYCHQCPDRVHWP-AEMGSPPPLYFNAGMFVFEPNPLTYERLLDT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNMFF   Y+P+P VYN+++ MLWRHP+KVEL K KVVHYC  G+K
Sbjct  208  LKITQPTPFAEQDFLNMFFEKTYRPIPVVYNLVLAMLWRHPEKVELDKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWW+IYND+SLD+K
Sbjct  268  PWRYTGKEVNMDREDIKMLVAKWWDIYNDKSLDFK  302



>emb|CDO98726.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 223/320 (70%), Gaps = 17/320 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDY KGVVGL KGLRK  +AYP+VVA  PDVP EHR++L +QGC+VRE+EP+YP
Sbjct  26    TFLAGSGDYWKGVVGLAKGLRKSNTAYPLVVAALPDVPEEHRQILESQGCVVREIEPVYP  85

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLF+  DG FYAV D
Sbjct  86    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFEYPDGQFYAVMD  144

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + +   + + WP  L GA P +YFN GMF+++PN+STY RLL  
Sbjct  145   CFCEKTWSNTIQYQIGYCQQSPQRVQWPEEL-GAPPPLYFNAGMFVYEPNLSTYHRLLET  203

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT FAEQDFLNMFFRD Y+P+P VYN+++ MLWRHP+ ++L   KVVHYC  G+K
Sbjct  204   VKITSPTTFAEQDFLNMFFRDIYRPIPPVYNLVLAMLWRHPENIDLDSVKVVHYCAAGSK  263

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVY--ELGGAAHEVETAVP  992
             PWRYTGKE NM RE++KMLV+KWW+IY D+SLDY       S    E  G   + E  V 
Sbjct  264   PWRYTGKEENMQREDIKMLVEKWWDIYEDESLDYVNIADAPSKINKEGDGNDDQKEKTVA  323

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               S+   L    Y   P AA
Sbjct  324   ALSDAAGLV--HYATAPSAA  341



>ref|XP_010925832.1| PREDICTED: galactinol synthase 1-like [Elaeis guineensis]
Length=335

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 225/320 (70%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKG VGL KGLRKV S YP+VVAV PDVP  HR+LL  QGCIVRE+EP+YP
Sbjct  27    TFLAGDGDYVKGAVGLAKGLRKVKSMYPLVVAVLPDVPEAHRQLLRDQGCIVREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  ++V+NYSKL+ W F EYSKMIYLD+D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  87    P-ENQTQFAMAHFVINYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFDMPDGYFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A +G+ P +YFN GMF+F+PN  TY  LL  
Sbjct  146   CFCEKLWSQSPQYSIGYCQQCPEKVAWP-AEMGSPPPLYFNAGMFVFEPNHRTYENLLET  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT FAEQDFLNMFF   Y+P+  VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  205   LKITPPTPFAEQDFLNMFFEKTYRPIRLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW+IYND+SLD+K     A      G A  + +++   
Sbjct  265   PWRYTGKEVNMDREDVKMLVAKWWDIYNDESLDFKAEDMVAE-----GEAFSMSSSI---  316

Query  999   SNTGNLTEP--RYIKGPPAA  1052
                  + EP   YI  P AA
Sbjct  317   --MAGMPEPTINYIPAPSAA  334



>emb|CCD74513.1| galactinol synthase 4 [Arabidopsis halleri subsp. halleri]
Length=334

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 225/320 (70%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCI+RE+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCILREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYVLNYSKL+ W F EY KMIYLD+D+QVFEN+D LFDL DGYF+AV D
Sbjct  87    P-ENQVEFAMAYYVLNYSKLRIWNFEEYYKMIYLDADIQVFENIDELFDLPDGYFHAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P+  TY  LL+ 
Sbjct  146   CFCEKTWSHSLQYSIGYCQQCPERVTWPEDMESPPPPLYFNAGMFVFEPSPLTYESLLHT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC +G+K
Sbjct  206   LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCADGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND+SLD+K                + E  V + 
Sbjct  266   PWRYTGEEANMDREDIKMLVDKWWDVYNDESLDFK-----------SKIPADAEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EP   Y   P AA
Sbjct  315   SILASVLEPEITYFPAPSAA  334



>gb|AHA36621.1| galactinol synthase 1 [Camellia sinensis]
Length=339

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKGVVGL KGLRKV SAY +VVA+ PDVP EHR +L +QGCIV E+EP+YP
Sbjct  33   TFLAGTGDYVKGVVGLAKGLRKVKSAYRLVVAILPDVPEEHREILRSQGCIVHEIEPIYP  92

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E  + FA  YYV+NYSKL+ W F EYSKM+YLD+D+QVFEN+DHLFD+ADGYFYAV D
Sbjct  93   P-ENHVQFAMAYYVINYSKLRIWNFEEYSKMVYLDADIQVFENIDHLFDMADGYFYAVMD  151

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A +G+ P +YFN GMF+++P+  TY  LL  
Sbjct  152  CFCEKTWSHSAQYSIGYCQQCPEKVTWP-AEMGSPPPLYFNAGMFVYEPSRLTYESLLQT  210

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFF+ +YKP+P +YN+++ MLWRH + +EL K KVVHYC  G+K
Sbjct  211  LRITPPTPFAEQDFLNMFFQHKYKPIPPIYNLVLAMLWRHRENIELEKVKVVHYCAAGSK  270

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWW++YND+SLD+K
Sbjct  271  PWRYTGKEVNMDREDIKMLVAKWWDVYNDESLDFK  305



>gb|AGQ44777.1| galactinol synthase [Camellia sinensis]
Length=339

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKGVVGL KGLRKV SAY +VVA+ PDVP EHR +L +QGCIV E+EP+YP
Sbjct  33   TFLAGTGDYVKGVVGLAKGLRKVKSAYRLVVAILPDVPEEHREILRSQGCIVHEIEPIYP  92

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E  + FA  YYV+NYSKL+ W F EYSKM+YLD+D+QVFEN+DHLFD+ADGYFYAV D
Sbjct  93   P-ENHVQFAMAYYVINYSKLRIWNFEEYSKMVYLDADIQVFENIDHLFDMADGYFYAVMD  151

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A +G+ P +YFN GMF+++P+  TY  LL  
Sbjct  152  CFCEKTWSHSAQYSIGYCQQCPEKVTWP-AEMGSPPPLYFNAGMFVYEPSRLTYESLLQT  210

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFF+ +YKP+P +YN+++ MLWRH + +EL K KVVHYC  G+K
Sbjct  211  LRITPPTPFAEQDFLNMFFQHKYKPIPPIYNLVLAMLWRHRENIELEKVKVVHYCAAGSK  270

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWW++YND+SLD+K
Sbjct  271  PWRYTGKEVNMDREDIKMLVAKWWDVYNDESLDFK  305



>gb|AIJ00873.1| GolS7 [Manihot esculenta]
Length=334

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/317 (56%), Positives = 229/317 (72%), Gaps = 20/317 (6%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGN DYVKGVVGL KGLRKV S YP+VVA+ PDVP EHR++LV+QGC+V+E+ P+YP
Sbjct  28    TFLAGNEDYVKGVVGLAKGLRKVKSKYPLVVAMLPDVPEEHRQILVSQGCLVKEIAPVYP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  +YV+NYSKL+ W+  EYSKMIYLDSD+Q+F+N+DHLFDL  GY YAV D
Sbjct  88    P-ENQTKFAMAHYVINYSKLRLWKLVEYSKMIYLDSDIQLFDNIDHLFDLQGGYLYAVMD  146

Query  492   CVCE----------EHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNHF  641
             C CE           + + C + + WP A +G +P +YFN GMF+F+P++STY  LL   
Sbjct  147   CFCELWRFSPLHKIGYCQHCPDRVQWP-AEMGPKPPLYFNAGMFVFEPSLSTYNDLLKTV  205

Query  642   KLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAKP  821
             ++T PT FAEQDFLNMFF+D Y+PLP +YN+++++LWRHP+ +EL KAKVVHYC  G+KP
Sbjct  206   EVTTPTRFAEQDFLNMFFKDFYRPLPPIYNLILSLLWRHPENIELDKAKVVHYCAAGSKP  265

Query  822   WRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRFS  1001
             WRYTG+  NM RE++KM+VKKWW+IYND+SLDY       +V   GG   + E+ +   S
Sbjct  266   WRYTGEGENMDREDIKMMVKKWWDIYNDESLDY-----NNTVATAGGTEGDPESFLAALS  320

Query  1002  NTGNLTEPRYIKGPPAA  1052
               G      Y+  P AA
Sbjct  321   EAG---VAHYLTAPSAA  334



>ref|XP_008801761.1| PREDICTED: galactinol synthase 2-like isoform X1 [Phoenix dactylifera]
Length=353

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/283 (63%), Positives = 211/283 (75%), Gaps = 20/283 (7%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKG VGL KGLRKVGSAYP+VVAV PDVP +HRRLL +QGCIVRE+EP+YP
Sbjct  27   TFLAGAGDYVKGAVGLAKGLRKVGSAYPLVVAVLPDVPEDHRRLLESQGCIVREIEPIYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKM+YLD+D+QV+EN+D LFDL DGYFYAV D
Sbjct  87   P-ENQTKFAMAYYVINYSKLRIWEFVEYSKMVYLDADIQVYENIDELFDLPDGYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C E  PWP   LG  PS+YFN GMF+F+P I+T   LL  
Sbjct  146  CFCERTWSHTAQYRVGYCQQCPERAPWPADELGPPPSLYFNAGMFVFEPGIATADALLAT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCV----  806
             K+T P  FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ VEL K KVVHYC     
Sbjct  206  LKVTEPAPFAEQDFLNMFFRDIYKPIPLGYNLVLAMLWRHPENVELDKVKVVHYCAANWH  265

Query  807  ----EGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
                +G+KPWRYTGKE NM R ++K LV++WW+IYND+SLDYK
Sbjct  266  IDQRQGSKPWRYTGKEENMDRADIKELVRRWWDIYNDESLDYK  308



>ref|XP_006483875.1| PREDICTED: galactinol synthase 1-like [Citrus sinensis]
Length=336

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/276 (63%), Positives = 209/276 (76%), Gaps = 17/276 (6%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLR   SAYP+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  28   TFLAGSGDYVKGVVGLAKGLRNSKSAYPLVVAILPDVPEEHREVLRSQGCIVREIEPIYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E ++ FA  YYV+NYSKL+ W F EYSKMIYLD+D+QVFEN+DHLFDL DG+FYAV D
Sbjct  88   P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVFENIDHLFDLPDGFFYAVMD  146

Query  492  CVCEE-------------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLL  632
            C CE+                P K  + WP A +G+ P +YFN GMF+F+P+  TY  LL
Sbjct  147  CFCEKTWSHSPQYSIGYCQQRPNK--VTWP-AEMGSPPPLYFNAGMFVFEPSRLTYENLL  203

Query  633  NHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEG  812
               K+TPPT FAEQDFLNMFF+  YKP+P  YN++V MLWRHP+ VEL K K VHYC  G
Sbjct  204  QTLKITPPTPFAEQDFLNMFFQKTYKPIPLAYNLVVAMLWRHPENVELEKVKAVHYCAAG  263

Query  813  AKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            +KPWRYTGKE NM RE++KMLV KWW+IYND+SLD+
Sbjct  264  SKPWRYTGKEVNMDREDVKMLVTKWWDIYNDESLDF  299



>gb|ACF88041.1| unknown [Zea mays]
 gb|ACG34552.1| galactinol synthase 3 [Zea mays]
 tpg|DAA45086.1| TPA: galactinol synthase 1 [Zea mays]
Length=342

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 214/275 (78%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRKVGSAYP+VVA+ PDVP  HRR+LV+QGCI+RE+EP+YP
Sbjct  29   TFLAGDGDYWKGVVGLAKGLRKVGSAYPLVVALLPDVPESHRRILVSQGCILREIEPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVFEN+D LF+L  GYFYAV D
Sbjct  89   P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFENIDELFELEKGYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WPT  LG  P +YFN GMF  +P+++T   LL+ 
Sbjct  148  CFCEKTWSHTPQYRIGYCQQCPDKVAWPTTELGPPPPLYFNAGMFAHEPSMATAKALLDT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFFRD+Y+P+P VYN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  208  LRVTPPTPFAEQDFLNMFFRDQYRPIPNVYNLVLAMLWRHPENVQLEKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TGKE NM RE++K LV KWW+IYND++LD+K
Sbjct  268  PWRFTGKEANMDREDIKTLVNKWWDIYNDEALDFK  302



>ref|XP_010092949.1| hypothetical protein L484_018886 [Morus notabilis]
 gb|EXB53002.1| hypothetical protein L484_018886 [Morus notabilis]
Length=337

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 231/324 (71%), Gaps = 31/324 (10%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDY KGVVGL KGLRKV S YP+VVA+ PDVP +HRR+LV QGC++RE+EP++P
Sbjct  28    TFLAGDGDYWKGVVGLAKGLRKVKSKYPLVVAILPDVPEDHRRILVDQGCLIREIEPVHP  87

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF N+DHLF+  D YFYAV D
Sbjct  88    P-ENQTKFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFGNIDHLFNHPDSYFYAVMD  146

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C   + WP A +G +P +YFN GMF+F+P++ TY  LL+ 
Sbjct  147   CFCEKNWRDSPQYKIGYCQQCPNRVQWP-AHMGPKPPLYFNAGMFVFEPSLPTYHDLLST  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT FAEQDFLNMFF+D+YKP+P VYN+++ MLWRHP+ + L + KVVHYC  G+K
Sbjct  206   LKVTTPTLFAEQDFLNMFFKDKYKPIPSVYNLVLAMLWRHPENINLEEIKVVHYCANGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAH------EVE  980
             PWR+TGKE NM RE++KMLV KWW+IYND+SLDYK          + GAA+      ++E
Sbjct  266   PWRFTGKEENMDREDIKMLVNKWWDIYNDESLDYK---------NVTGAANAPTEQVKLE  316

Query  981   TAVPRFSNTGNLTEPRYIKGPPAA  1052
               +   S  G +   R+++ P AA
Sbjct  317   ALLAALSEAGAV---RHVRAPSAA  337



>emb|CDY06355.1| BnaA09g48480D [Brassica napus]
Length=330

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 212/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +HRR L+ QGC+V E++P+ P
Sbjct  20   TFLAGNGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPVDHRRQLLEQGCLVNEIQPVCP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYVLNYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFDL DG FYAV D
Sbjct  80   PDN-QTQFAMAYYVLNYSKLRIWKFVEYSKMIYLDGDIQVFENIDHLFDLPDGNFYAVKD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP + LG +P +YFN GMF+++P++ TY  LL  
Sbjct  139  CFCEKTWSHTPQYKIGYCQQCPDKVTWPESELGPKPPLYFNAGMFVYEPSLPTYYNLLET  198

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+  PT FAEQDFLN++F+D YKP+P VYN+++ MLWRHP+ +EL KAKV+HYC  G+K
Sbjct  199  LKVVSPTPFAEQDFLNIYFKDIYKPIPPVYNLVLAMLWRHPENIELDKAKVIHYCAAGSK  258

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TG+E NM R+++KMLV+KWW+IYND+SLDYK
Sbjct  259  PWRFTGQEENMERKDIKMLVEKWWDIYNDESLDYK  293



>ref|XP_010045367.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW87541.1| hypothetical protein EUGRSUZ_B03987 [Eucalyptus grandis]
Length=337

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/283 (60%), Positives = 214/283 (76%), Gaps = 13/283 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  +AYP+VVA  PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  30   TFLAGNGDYVKGVVGLAKGLRKSKAAYPLVVACLPDVPEEHRQILESQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVF+N+DHLFD  DG+FYAV D
Sbjct  90   P-ENQAQFAMAYYVINYSKLRIWEFVEYTKMIYLDGDIQVFDNIDHLFDAPDGFFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E +PW T  LG  P +YFN GMF+F+PN+ TY  LL  
Sbjct  149  CFCEKTWSSSLQYKVGYCQQCPERVPW-TPELGPPPPLYFNAGMFVFEPNLLTYLDLLKT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT+FAEQDFLNM+FRD YKP+P  YN+++ MLWRHP+ V++ + KVVHYC  G+K
Sbjct  208  VKVTSPTSFAEQDFLNMYFRDIYKPIPPTYNLVLAMLWRHPENVDVERVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASV  947
            PWRYTG E NM RE++KMLVKKWW+IY D++L+YK     +S 
Sbjct  268  PWRYTGLEENMQREDIKMLVKKWWDIYEDEALNYKNATSDSST  310



>ref|XP_010098783.1| hypothetical protein L484_026164 [Morus notabilis]
 gb|EXB75686.1| hypothetical protein L484_026164 [Morus notabilis]
Length=323

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             FLAGNGDY+KGVVGL KGLRK  + YP+VVAV PDVP +HRR+L +QGCIVRE+EP+YP
Sbjct  10   AFLAGNGDYIKGVVGLAKGLRKTNTPYPLVVAVLPDVPDDHRRILRSQGCIVREIEPVYP  69

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E E  F+  YYV+NYSKL+ W+F EY KM+YLD D+QVF+N+DHLFD  +GYFYAV D
Sbjct  70   P-ENETKFSMAYYVINYSKLRIWEFEEYEKMVYLDGDIQVFDNIDHLFDSPNGYFYAVMD  128

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G+ P +YFN GM +F+PN+ TY+ LL  
Sbjct  129  CFCEKTWSHSPQYKIGYCQQCPQKVEWP-ATMGSPPPLYFNAGMCVFEPNLVTYSNLLEA  187

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT+FAEQDFLNMFF+D YKP+P VYN+++ MLWRHP+ V++ K KVVHYC  G+K
Sbjct  188  LKVTLPTSFAEQDFLNMFFKDVYKPIPNVYNLVLAMLWRHPENVDIDKVKVVHYCAAGSK  247

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++KMLVKKWWEIY D+SLDY+
Sbjct  248  PWRYTGEEENMEREDIKMLVKKWWEIYEDKSLDYE  282



>ref|XP_007044673.1| Galactinol synthase 4 [Theobroma cacao]
 gb|EOY00505.1| Galactinol synthase 4 [Theobroma cacao]
Length=336

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 172/273 (63%), Positives = 211/273 (77%), Gaps = 13/273 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  27   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHREILRSQGCIVREIEPIYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                ++ FA  YYV+NYSKL+ W+F EYSKM+YLD+D+QV+EN+DHL D  DGYFYAV D
Sbjct  87   PQN-QVHFAMAYYVINYSKLRIWKFEEYSKMVYLDADIQVYENIDHLLDTPDGYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + WP A +G+ P +YFN GMF+F+P+  TY  LL  
Sbjct  146  CFCEKVWSHSRQYSIGYCQQCPGKVTWP-AEMGSPPPLYFNAGMFVFEPSCLTYDSLLET  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFF+  YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  205  LQITPPTPFAEQDFLNMFFQKVYKPIPLVYNLVLAMLWRHPENVELDKIKVVHYCAAGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLD  917
            PWRYTGKE NM RE++KMLV KWW+IYND+SLD
Sbjct  265  PWRYTGKEANMDREDVKMLVAKWWDIYNDESLD  297



>ref|XP_002886616.1| ATGOLS4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62875.1| ATGOLS4 [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 224/320 (70%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCI+RE+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCILREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYVLNYSKL+ W F EY KMIYLD+D+QVFEN+D LFDL DGYF+AV D
Sbjct  87    P-ENQVEFAMAYYVLNYSKLRIWNFEEYLKMIYLDADIQVFENIDELFDLPDGYFHAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP  +    P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSLQYSIGYCQQCPDKVTWPEDMESPPPPLYFNAGMFVFEPSPLTYESLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  206   LEITPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND+SLD+K                +VE  V + 
Sbjct  266   PWRYTGEEANMDREDIKMLVDKWWDVYNDESLDFK-----------SIIPADVEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EP   Y   P AA
Sbjct  315   SILASVLEPEITYFPAPSAA  334



>ref|XP_010039591.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW45881.1| hypothetical protein EUGRSUZ_L00250 [Eucalyptus grandis]
Length=338

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 215/280 (77%), Gaps = 13/280 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDY+KGVVGL KGLRK  S YP+VVAV  DVPA+HR++LV QGCIVRE++P+YP
Sbjct  30   TFLAGNGDYIKGVVGLAKGLRKAKSKYPLVVAVLLDVPADHRKILVDQGCIVREIKPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  +YV+NYSKL+ WQF EYSKMIYLD D+QVF+N+DHLFDL +G+FYAV D
Sbjct  90   P-ENQTQFAMAHYVINYSKLRIWQFVEYSKMIYLDGDIQVFDNIDHLFDLQNGFFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP  + G +P +YFN GMF+++PN+ TY  LL  
Sbjct  149  CFCEKTWSHTPQYEIGYCQQCPDKVQWPDHV-GLKPPLYFNAGMFVYEPNLDTYHDLLET  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQD LNM+F+D Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  208  LKITPPTPFAEQDLLNMYFKDIYRPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQR  938
            PWRYTG+E NM RE++KM+VKKW +IY+D+SLDYK    R
Sbjct  268  PWRYTGEEENMDREDIKMVVKKWCDIYDDESLDYKNIVAR  307



>ref|XP_011071091.1| PREDICTED: galactinol synthase 1-like [Sesamum indicum]
Length=339

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 228/320 (71%), Gaps = 26/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCIV+E+EP+YP
Sbjct  33    TFLAGSGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHREILRSQGCIVKEIEPIYP  92

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QV+EN+DHL D  DGYFYAV D
Sbjct  93    P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMVYLDADIQVYENIDHLLDTPDGYFYAVMD  151

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G+ P +YFN GMF+F+P+  TY  LL  
Sbjct  152   CFCEKTWSHSPQYSIGYCQQCPDRVKWP-AEMGSPPPLYFNAGMFVFEPSKVTYDNLLET  210

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
               +TPPT FAEQDFLNMFF+  YKP+P +YN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  211   LLITPPTPFAEQDFLNMFFQPIYKPIPLIYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  270

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM R+++KMLVKKWW++YND+SLD+K           G      E A  + 
Sbjct  271   PWRYTGEEANMDRDDIKMLVKKWWDVYNDESLDFK-----------GEDGVAGEEAFSKP  319

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   YI  P AA
Sbjct  320   SIMASMPEPAVSYIPAPSAA  339



>gb|AAM97493.1| galactinol synthase [Medicago sativa]
Length=325

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 210/275 (76%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV + YP+VVAV PDVP EHR +L +QGCIVRE+ P+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKTMYPLVVAVLPDVPQEHRNILTSQGCIVREIVPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W F +Y KMIYLD D+QVFEN+DHLFDL + YFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWAFEDYDKMIYLDGDIQVFENIDHLFDLPNNYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C + + WPT   G +P +YFN GMF+++PN++TY  LL  
Sbjct  145  CFCEASWRHTKQYEIGYCQQCPDKVQWPTNF-GPKPPLYFNAGMFVYEPNMATYHDLLQK  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLNM+F D+YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LQVTEPTSFAEQDFLNMYFNDKYKPIPNVYNLVLAMLWRHPENVELEKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG E NM RE++KMLVKKWW++Y D+SLDYK
Sbjct  264  PWRYTGVEENMQREDIKMLVKKWWDVYEDESLDYK  298



>ref|XP_006417581.1| hypothetical protein EUTSA_v10008154mg [Eutrema salsugineum]
 gb|ESQ35934.1| hypothetical protein EUTSA_v10008154mg [Eutrema salsugineum]
Length=333

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 213/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP +H+R L+ QGC+V+E++P+YP
Sbjct  17   TFLAGNGDYVKGVVGLAKGLRKSKSKYPLVVAVLPDVPVDHQRQLLEQGCVVKEIQPVYP  76

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYVLNYSKL+ W+  EYSKMIYLD D+QVF+N+DHLFDL DG FYAV D
Sbjct  77   P-ENQTQFAMAYYVLNYSKLRIWKLVEYSKMIYLDGDIQVFDNIDHLFDLPDGNFYAVKD  135

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + WP   LG +PS+YFN GMF+++P++STY  LL  
Sbjct  136  CFCEKTWSHTPQYKIGYCQQCPGKVTWPEPELGPKPSLYFNAGMFVYEPSLSTYYNLLET  195

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+  PT FAEQDFLNM+F+D YKP+P +YN+++ MLWRHP+ +EL +AKVVHYC  G+K
Sbjct  196  LKVVSPTPFAEQDFLNMYFKDIYKPIPPIYNIVLAMLWRHPENIELDEAKVVHYCAAGSK  255

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWR+TG+E NM RE++K+LV+KWW+IYND+SLDYK
Sbjct  256  PWRFTGQEENMEREDIKILVEKWWDIYNDESLDYK  290



>ref|XP_006841604.1| hypothetical protein AMTR_s00003p00211130 [Amborella trichopoda]
 gb|ERN03279.1| hypothetical protein AMTR_s00003p00211130 [Amborella trichopoda]
Length=333

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 215/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY+KG VGL KGLRKV +AYP++VAV PDVP EHRR+L +QGCIVRE+EP+YP
Sbjct  21   TFLAGDGDYIKGAVGLAKGLRKVKTAYPLIVAVLPDVPEEHRRILRSQGCIVREIEPIYP  80

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W++ EYSKM+YLD+D+QVFEN+DHLFDL +GYFYAV D
Sbjct  81   P-ENQTQFAMAYYVINYSKLRIWEYEEYSKMMYLDADIQVFENIDHLFDLPNGYFYAVMD  139

Query  492  CVCE-----------EHGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE           E+ + C + + WP+ L G  PS+YFN GMF+F+P+  TY  LL  
Sbjct  140  CFCEKTWSHTPQYKIEYCQQCPDRVQWPSHL-GDPPSLYFNAGMFVFEPSKLTYENLLQT  198

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT FAEQDFLNMFF+D YKP+P VYN+++ MLWRHP+ V+L   KVVHYC  G+K
Sbjct  199  LQVTTPTPFAEQDFLNMFFKDVYKPIPLVYNLVMAMLWRHPENVDLETVKVVHYCAAGSK  258

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K+LVKKW +IYND+SLD+K
Sbjct  259  PWRYTGKEENMQREDIKVLVKKWGDIYNDESLDFK  293



>ref|XP_002281261.1| PREDICTED: galactinol synthase 2 [Vitis vinifera]
Length=325

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 230/323 (71%), Gaps = 17/323 (5%)
 Frame = +3

Query  63   MAPDASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdv  242
            MAP  ++   +   A+   RAYVTFLAGNGDYVKGVVGL KGLRKV +AYP+VVAV PDV
Sbjct  1    MAPTLASATGLAKAASISSRAYVTFLAGNGDYVKGVVGLAKGLRKVKTAYPLVVAVLPDV  60

Query  243  paEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSD  422
            PAEHRR+L  QGC+VRE+EP+ P  E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D
Sbjct  61   PAEHRRILEDQGCVVREIEPVNPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGD  119

Query  423  MQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTALLGARPS  569
            +QVF N+DHLFDL +GYFYAV DC CE+           + + C E + WP A +G  P 
Sbjct  120  IQVFGNIDHLFDLDNGYFYAVMDCFCEKTWSNSPQYKIGYCQQCPEKVQWP-AEMGPAPP  178

Query  570  MYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNML  749
            +YFN GMF+F+P +S Y  LL   K+T PT+FAEQD+LN+FFRD Y+P+P  YN+++ ML
Sbjct  179  LYFNAGMFVFEPCLSVYDDLLTTLKITTPTSFAEQDYLNIFFRDIYRPIPPTYNLVLAML  238

Query  750  WRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYY  929
            W HP+ ++L +  VVHYC  G+KPWRYTGKE NM RE++KMLVKKWW+IYND+SLDY+  
Sbjct  239  WHHPENIDLQRTNVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYNDESLDYRNS  298

Query  930  KQRA----SVYELGGAAHEVETA  986
                    +V    G  H   TA
Sbjct  299  SANGQPFTAVLSEAGEVHHYITA  321



>gb|AEQ54920.1| galactinol synthase 2 [Salvia miltiorrhiza]
Length=330

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV + YP+VVAV PDVPA+HRR+LV QGCIVRE+EP+YP
Sbjct  30   TFLAGNGDYVKGVVGLAKGLRKVNTIYPLVVAVLPDVPADHRRILVDQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFD+ +GYFYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDMDNGYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + +   +   WP +L G +P  YFN GMF+F+P++ TY  LL  
Sbjct  149  CFCEKTWSHTPQFQIGYCQQSPDRARWPESL-GPKPPKYFNAGMFVFEPSLPTYHDLLQT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TP T FAEQDFLNMFFRD Y+P+P VYN+++ MLWRHP+ V L++ KVVHYC  G+K
Sbjct  208  LKITPATPFAEQDFLNMFFRDVYRPIPNVYNLVLAMLWRHPENVRLAEVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM R+++KM+V KWW+IYND +LDYK
Sbjct  268  PWRYTGEEENMDRDDIKMVVDKWWDIYNDDTLDYK  302



>ref|XP_008800725.1| PREDICTED: galactinol synthase 1-like [Phoenix dactylifera]
Length=337

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 210/275 (76%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKV S YP++V V PDVP  HRRLL  QGC+VRE+EP+YP
Sbjct  30   TFLAGDGDYVKGVVGLAKGLRKVRSVYPLLVVVLPDVPEAHRRLLQDQGCVVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W F EYSKMIYLD+D+QVF+N+DHLFD+ DGYFYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFDMPDGYFYAVMD  148

Query  492  CVCEEHGEPCKEI-----------LPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+     ++            + WP A +G+ P +YFN GMF+F+PN  TY  LL+ 
Sbjct  149  CFCEKTWSHSRQYSIGYCQQWPDKVAWP-AEMGSPPPLYFNAGMFVFEPNPLTYESLLDT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNMFF   Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  208  LKITPPTPFAEQDFLNMFFEKTYRPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV KWW+IY+D+SLD+K
Sbjct  268  PWRYTGKEANMDREDIKMLVAKWWDIYSDESLDFK  302



>gb|EYU22497.1| hypothetical protein MIMGU_mgv1a009966mg [Erythranthe guttata]
Length=326

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 169/275 (61%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP +HR LL +QGCIV+E+EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEDHRELLRSQGCIVKEIEPIYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                ++ FA  YYV+NYSKL+ W F EYSKM+YLD+D+QV+EN+DHL D  DGYFYAV D
Sbjct  86   PAN-QIQFAMAYYVINYSKLRIWNFLEYSKMVYLDADIQVYENIDHLLDAPDGYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + WP A +G  P +YFN GMF+++PN +TY  LL  
Sbjct  145  CFCEKTWSHSRQFSVGYCQQCPNKVTWP-AEMGPPPPLYFNAGMFVYEPNKTTYEALLET  203

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNMFF   Y+P+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  204  LQITPPTPFAEQDFLNMFFEKTYQPIPLVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  263

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM RE++KMLVKKWW++Y+D+SLD+K
Sbjct  264  PWRYTGEEANMDREDIKMLVKKWWDVYDDESLDFK  298



>ref|XP_011011015.1| PREDICTED: LOW QUALITY PROTEIN: galactinol synthase 2 [Populus 
euphratica]
Length=325

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 209/275 (76%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S+YP++VA+ PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  20   TFLAGNGDYVKGVVGLAKGLRKAKSSYPLMVAILPDVPEEHRKILESQGCIVREIEPVYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F +Y KMIYLD D+QVF+N+DHLFD  +GYFYAV D
Sbjct  80   P-ENQTQFAMAYYVINYSKLRIWEFVDYEKMIYLDGDIQVFDNIDHLFDEPNGYFYAVMD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + WP    G+ P +YFN GMF+F+P + TY  LL  
Sbjct  139  CFCEKTWSTTPQYQIGYCQQCPGKVXWPKGE-GSPPPLYFNAGMFVFEPKLLTYFDLLET  197

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNMFFRD YKP+P VYN++  MLWRHP+  E+ K KVVHYC  GAK
Sbjct  198  LKVTPPTSFAEQDFLNMFFRDVYKPIPPVYNLVSAMLWRHPENFEIDKVKVVHYCAAGAK  257

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE+++ LVKKWWEIY D+SLDYK
Sbjct  258  PWRYTGKEENMDREDIQFLVKKWWEIYEDESLDYK  292



>gb|ACG39512.1| galactinol synthase 3 [Zea mays]
Length=349

 Score =   309 bits (791),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 169/277 (61%), Positives = 215/277 (78%), Gaps = 14/277 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRKV SAYP+VVAV PDVP  HRR+LV+QGC+VRE+EP+YP
Sbjct  34   TFLAGDGDYWKGVVGLAKGLRKVRSAYPLVVAVLPDVPESHRRILVSQGCVVREIEPVYP  93

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVFEN+D LF+L  GYFYAV D
Sbjct  94   P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFENIDGLFELEKGYFYAVMD  152

Query  492  CVCEE-----------HGEPCKEILPWP--TALLGARPSMYFNGGMFMFQPNISTYTRLL  632
            C CE+           + + C + + WP  TA LG  PS+YFN GMF+ +P+++T   LL
Sbjct  153  CFCEKTWSHTPQYRIGYCQQCPDKVAWPAATAELGPPPSLYFNAGMFVHEPSVATAKALL  212

Query  633  NHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEG  812
            +  ++TPPT FAEQDFLNMFFRD+Y+P+P VYN+++ MLWRHP+ V+L K KVVHYC  G
Sbjct  213  DTLRVTPPTPFAEQDFLNMFFRDQYRPIPNVYNLVLAMLWRHPENVQLEKVKVVHYCAAG  272

Query  813  AKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            +KPWR+TGKE NM RE++  LVKKWW+IYND++LD K
Sbjct  273  SKPWRFTGKEANMDREDINALVKKWWDIYNDETLDLK  309



>ref|XP_010100446.1| hypothetical protein L484_027758 [Morus notabilis]
 gb|EXB82580.1| hypothetical protein L484_027758 [Morus notabilis]
Length=337

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 229/320 (72%), Gaps = 26/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGL KGLRKV SAYP+VVA+ PDVP +HR++L +QGCIVRE+ P+YP
Sbjct  31    TFLAGDGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEQHRQILRSQGCIVREIVPIYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKMIYLD+D+QV++N+DHLFD  DG FYAV D
Sbjct  91    P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVYDNIDHLFDTPDGLFYAVMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP A +G+ P +YFN GMF+F+PN  TY  LL  
Sbjct  150   CFCEKTWNHSPQYKIGYCQQCPDKVTWP-AEMGSPPPLYFNAGMFVFEPNPLTYQNLLQT  208

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNMFF++ YKP+P VYN+++  LWRHP+ VEL K KVVHYC  G+K
Sbjct  209   LEITPPTPFAEQDFLNMFFQNVYKPIPLVYNLVLANLWRHPENVELDKVKVVHYCAAGSK  268

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV KWW++YND+SLD+K                E ET   R 
Sbjct  269   PWRYTGKEVNMDREDIKMLVAKWWDVYNDESLDFK----------AENPVSEDET-FSRP  317

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             S   ++ EPR  YI  P AA
Sbjct  318   SIMASMPEPRISYIPAPSAA  337



>ref|XP_008246233.1| PREDICTED: galactinol synthase 2 [Prunus mume]
Length=338

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 220/294 (75%), Gaps = 16/294 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKGVVGL KGLRKV S YP+VVA+ PDVP EHR++LV+QGCIV+E+EP+YP
Sbjct  27   TFLAGTGDYVKGVVGLAKGLRKVKSKYPLVVAILPDVPKEHRQILVSQGCIVKEIEPVYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD  DGYFYAV D
Sbjct  87   PPN-QTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFQNIDHLFDYPDGYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + W    LG RP +YFN GMF+++P++  Y  LL  
Sbjct  146  CFCEKTWSSSPQYKIGYCQQCPDKVQW-APELGPRPPLYFNAGMFVYEPSLPVYHDLLRT  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             +++P T+FAEQDFLN+FFRD+YKP+P  YN+++ MLWRHP+ ++L + KVVHYC +G+K
Sbjct  205  LQVSPTTSFAEQDFLNVFFRDKYKPIPSNYNLVLAMLWRHPENIQLDQVKVVHYCADGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVE  980
            PWRYTGKE NM RE++KMLVKKWW+IY+D+SLD   +K   +  E G  A  V+
Sbjct  265  PWRYTGKEENMEREDIKMLVKKWWDIYDDESLD---FKNIVAAAEAGNGADHVD  315



>ref|XP_004233531.1| PREDICTED: galactinol synthase 2-like [Solanum lycopersicum]
Length=322

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 212/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGL+KV SAYP+V+AV PDVP E+R LL+ QGCIVR++EP+YP
Sbjct  26   TFLAGNGDYVKGVVGLAKGLKKVKSAYPLVMAVLPDVPEEYRHLLINQGCIVRKIEPVYP  85

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVFEN+DHLFDL +GYFYAV D
Sbjct  86   P-ENQTQFAMAYYVINYSKLRIWEFVEYQKMIYLDGDIQVFENIDHLFDLPNGYFYAVMD  144

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + +   E + WP   LG +P++YFN GMF+F+P++ TY  LL+ 
Sbjct  145  CFCEKTWSHTPQHNIGYCQQSPEKIQWPEENLGPKPNLYFNAGMFVFEPSLLTYHNLLSF  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQD LNMFF+D YKP+P  YN+++ MLWRHP+ VE+ K  VVHYC  G+K
Sbjct  205  LKVTPPTSFAEQDLLNMFFKDIYKPIPNKYNLVLAMLWRHPENVEVDKVNVVHYCAAGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTG+E NM R+++KMLVKKW EIYND SLDY 
Sbjct  265  PWRYTGEEENMDRDDIKMLVKKWTEIYNDGSLDYN  299



>gb|KCW50133.1| hypothetical protein EUGRSUZ_K03563 [Eucalyptus grandis]
Length=329

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 226/323 (70%), Gaps = 37/323 (11%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL        +AYP+VVAV PDVP EHR++L +QGC+VRE+EP+YP
Sbjct  28    TFLAGNGDYVKGVVGL--------AAYPLVVAVLPDVPEEHRQILESQGCVVREIEPVYP  79

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFD  DGYFYAV D
Sbjct  80    P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDQPDGYFYAVMD  138

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + +   + + WP A +G  P++YFN GMF+F+P+I+TY  LL+ 
Sbjct  139   CFCEKTWSHSPQYKVGYCQQSPDRVKWP-AEMGEPPALYFNAGMFVFEPSIATYVDLLDT  197

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+T PT+FAEQD+LNM+FR+ YKP+P  YN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  198   LKITAPTSFAEQDYLNMYFRNIYKPIPLDYNLVLAMLWRHPENVDLEKVKVVHYCAAGSK  257

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLV+KW +IYND+SLDYK           G     VE AV   
Sbjct  258   PWRYTGKEENMQREDIKMLVQKWRDIYNDESLDYK-----------GTEVEAVEKAVTVE  306

Query  999   SNTGNLTE-----PRYIKGPPAA  1052
                 +L+E      +Y+  P AA
Sbjct  307   PFIASLSEVPTAPVQYVTAPSAA  329



>ref|XP_003554611.1| PREDICTED: galactinol synthase 2-like isoform 1 [Glycine max]
Length=330

 Score =   308 bits (788),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 168/274 (61%), Positives = 211/274 (77%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  30   TFLAGNGDYVKGVVGLAKGLRKAKSMYPLVVAVLPDVPEEHREILKSQGCIVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY K IYLD D+QVF N+DHLFDL D YFYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWEFVEYKKTIYLDGDIQVFGNIDHLFDLPDNYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP+   G++P +YFN GMF+++PN+ TY  LL  
Sbjct  149  CFCEKTWSHTPQFQIGYCQQCPDKVQWPSHF-GSKPPLYFNAGMFVYEPNLDTYRDLLQT  207

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             +LT PT+FAEQDFLNM+F+D+YKP+P +YN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  208  VQLTKPTSFAEQDFLNMYFKDKYKPIPNMYNLVLAMLWRHPENVELDKVQVVHYCAAGSK  267

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWR+TGKE NM RE++KMLVKKWW+IY D++LDY
Sbjct  268  PWRFTGKEENMDREDIKMLVKKWWDIYEDETLDY  301



>ref|XP_008801763.1| PREDICTED: galactinol synthase 2-like isoform X3 [Phoenix dactylifera]
Length=342

 Score =   308 bits (789),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 176/275 (64%), Positives = 208/275 (76%), Gaps = 15/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDYVKG VGL KGLRKVGSAYP+VVAV PDVP +HRRLL +QGCIVRE+EP+YP
Sbjct  27   TFLAGAGDYVKGAVGLAKGLRKVGSAYPLVVAVLPDVPEDHRRLLESQGCIVREIEPIYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKM+YLD+D+QV+EN+D LFDL DGYFYAV D
Sbjct  87   P-ENQTKFAMAYYVINYSKLRIWEFVEYSKMVYLDADIQVYENIDELFDLPDGYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE            + + C E  PWP   LG  PS+YFN GMF+F+P I+T   LL  
Sbjct  146  CFCERTWSHTAQYRVGYCQQCPERAPWPADELGPPPSLYFNAGMFVFEPGIATADALLAT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T P  FAEQDFLNMFFRD YKP+P  YN+++ MLWRHP+ VEL K KVVHYC   A 
Sbjct  206  LKVTEPAPFAEQDFLNMFFRDIYKPIPLGYNLVLAMLWRHPENVELDKVKVVHYC---AA  262

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM R ++K LV++WW+IYND+SLDYK
Sbjct  263  PWRYTGKEENMDRADIKELVRRWWDIYNDESLDYK  297



>ref|XP_007035901.1| Galactinol synthase 1 [Theobroma cacao]
 gb|EOY06827.1| Galactinol synthase 1 [Theobroma cacao]
Length=366

 Score =   309 bits (791),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 212/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRK  S YP+VVAV PDVP EHR +L +QGC+VRE+EP+YP
Sbjct  62   TFLAGSGDYVKGVVGLAKGLRKAESVYPLVVAVLPDVPEEHREILRSQGCVVREIEPVYP  121

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVF+N+DHLFDLADGYFYAV D
Sbjct  122  P-ENQTQFAMAYYVINYSKLRIWEFVEYKKMIYLDGDIQVFDNIDHLFDLADGYFYAVMD  180

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + +   E + WP  + G+ P +YFN GMF+++P++ TY  LL  
Sbjct  181  CFCEKTWSSSPQYKIGYCQQSPEKVQWPVEM-GSPPPLYFNAGMFVYEPDLLTYHHLLET  239

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT+FAEQDFLNMFFR  YKP+P VYN+++ MLWRH + V+L K KVVHYC  GAK
Sbjct  240  LKVTPPTSFAEQDFLNMFFRGIYKPIPPVYNLVLAMLWRHRENVDLDKVKVVHYCAAGAK  299

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM R+++K+LVKKWW+IY D+SLDYK
Sbjct  300  PWRYTGKEENMERDDIKLLVKKWWDIYEDESLDYK  334



>gb|KEH24464.1| galactinol synthase [Medicago truncatula]
Length=328

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 219/292 (75%), Gaps = 17/292 (6%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGN DY+KGVVGL KGLRK  + YP+VVA+ PDVP EHR++LV+QGCIV+E+ P+YP
Sbjct  29   TFLAGNADYIKGVVGLAKGLRKTKTMYPLVVAILPDVPEEHRKILVSQGCIVKEIAPVYP  88

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
                +  FA  YYV+NYSKL+ ++F EYSKMIYLD D+QVFEN+DHLFDL D YFYAV D
Sbjct  89   PAN-QTEFAMAYYVINYSKLRIFEFEEYSKMIYLDGDIQVFENIDHLFDLPDDYFYAVMD  147

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP+   G +P +YFN GMF+FQPN++TY  LL  
Sbjct  148  CFCEKTWSHTPQYKIGYCQQCPDKVQWPSNF-GPKPPLYFNAGMFVFQPNVATYHDLLEK  206

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT FAEQDFLNM+F+D+YKP+P VYN+++ M+WRHP+ VEL K +VVHYC  G+K
Sbjct  207  VKITKPTPFAEQDFLNMYFKDKYKPIPNVYNLVLAMMWRHPENVELEKVQVVHYCAAGSK  266

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY----KYYKQRASVYELGG  962
            PWRYTG+E NM RE++KMLVKKW EIY D++LDY    +  +  A++ E GG
Sbjct  267  PWRYTGEEQNMDREDIKMLVKKWKEIYEDETLDYNNNVRVERFTAALLEAGG  318



>gb|EPS65482.1| hypothetical protein M569_09295, partial [Genlisea aurea]
Length=311

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 227/320 (71%), Gaps = 31/320 (10%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVAV PDVP +HR LL +QGCIVRE+EP+YP
Sbjct  10    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEDHRELLRSQGCIVREIEPIYP  69

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W FTEY KM+YLD+D+QV+EN+DHL D  DGYFYAV D
Sbjct  70    P-ENQIQFAMAYYVINYSKLRIWNFTEYEKMVYLDADIQVYENIDHLMDTPDGYFYAVMD  128

Query  492   CVCEE---HGEPCK--------EILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+   H    K        + + WP+ + G+ P +YFN GMF+ +P++ TY +LL+ 
Sbjct  129   CFCEKTWSHSPQYKIGYCQQRPDEVKWPSEM-GSPPPLYFNAGMFVHEPSVETYNKLLDV  187

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              + TPPT FAEQDFLNMFF+  YKP+P +YN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  188   LRATPPTPFAEQDFLNMFFQAIYKPIPLIYNLVLAMLWRHPENVELEKVQVVHYCAAGSK  247

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++K+LVKKWW++Y D SLDYK  ++  S                R 
Sbjct  248   PWRYTGKEANMDREDIKVLVKKWWDVYEDASLDYKGDQESVS----------------RP  291

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   +L EP   Y+  P AA
Sbjct  292   SILASLPEPAVSYVPAPSAA  311



>ref|NP_001105750.1| LOC606405 [Zea mays]
 gb|AAQ07250.1|AF497509_1 galactinol synthase 3 [Zea mays]
 gb|AAO48782.1| galactinol synthase 3 [Zea mays]
 gb|AFW88524.1| galactinol synthase 3 [Zea mays]
Length=345

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/277 (61%), Positives = 214/277 (77%), Gaps = 14/277 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRKV SAYP+VVAV PDVP  HRR+LV+QGC+VRE+EP+YP
Sbjct  30   TFLAGDGDYWKGVVGLAKGLRKVRSAYPLVVAVLPDVPESHRRILVSQGCVVREIEPVYP  89

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY +M+YLD+D+QVFEN+D LF+L  GYFYAV D
Sbjct  90   P-ENQTQFAMAYYVINYSKLRIWEFVEYERMVYLDADIQVFENIDGLFELEKGYFYAVMD  148

Query  492  CVCEE-----------HGEPCKEILPWP--TALLGARPSMYFNGGMFMFQPNISTYTRLL  632
            C CE+           + + C + + WP  TA LG  PS+YFN GMF+ +P+++T   LL
Sbjct  149  CFCEKTWSHTPQYRIGYCQQCPDKVAWPAATAELGPPPSLYFNAGMFVHEPSVATAKALL  208

Query  633  NHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEG  812
            +  ++TPPT FAEQDFLNMFFRD+Y+P+P VYN+++ MLWRHP+ V+L K KVVHYC  G
Sbjct  209  DTLRVTPPTPFAEQDFLNMFFRDQYRPIPNVYNLVLAMLWRHPENVQLEKVKVVHYCAAG  268

Query  813  AKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            +KPWR+TGKE NM RE++  LV KWW+IYND++LD K
Sbjct  269  SKPWRFTGKEANMDREDINALVNKWWDIYNDETLDLK  305



>gb|AGT50336.1| galactinol synthase 8 [Populus trichocarpa]
Length=337

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 214/275 (78%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLRKV +AYP++VAV PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  28   TFLAGDGDYVKGVVGLAKGLRKVKTAYPLIVAVLPDVPEEHRQILESQGCIVREIEPVYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DG FYAV D
Sbjct  88   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVYDNIDHLFDLPDGRFYAVMD  146

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP A +G  PS YFN GM +F+P+I+TY  LL  
Sbjct  147  CFCEKTWSHTPQYKIGYCQQCPDKVNWP-AEMGQPPSPYFNAGMCVFEPSIATYHDLLKT  205

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPPT FAEQDFLNM+F+D Y P+P VYN+++ MLWRHP+ VEL + KVVHYC   +K
Sbjct  206  LKVTPPTPFAEQDFLNMYFKDIYTPIPLVYNLVLAMLWRHPENVELDRVKVVHYCAADSK  265

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKWW+IY+D+SLD K
Sbjct  266  PWRYTGKEENMQREDIKMLVKKWWDIYSDESLDSK  300



>gb|KDO72072.1| hypothetical protein CISIN_1g037698mg [Citrus sinensis]
Length=314

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGLVKGLRK  SAYP+ VAV PDVPA+HR++LV+QGCIVRE++P+YP
Sbjct  9    TFLAGNGDYVKGVVGLVKGLRKAKSAYPLAVAVLPDVPADHRKILVSQGCIVREIQPVYP  68

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVFEN+DHLF+L +GY YA  D
Sbjct  69   P-ENQTQFAMAYYVINYSKLRIWEFVEYAKMIYLDGDIQVFENIDHLFELPNGYLYAAMD  127

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A +G+ P  YFN GMF+++PN+ TY+ LL  
Sbjct  128  CFCEKTWSNSPQYKIGYCQQCPEKVKWP-ASMGSPPPKYFNAGMFVYEPNLLTYSHLLET  186

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPP++FAEQDFLN FFR+ YKP+ + YN ++ MLWRHP+ VE  K KVVHYC  G+K
Sbjct  187  LKVTPPSSFAEQDFLNNFFRNIYKPISHTYNFVLAMLWRHPEHVETEKVKVVHYCASGSK  246

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKW +IY D+SLDYK
Sbjct  247  PWRYTGKEENMDREDIKMLVKKWKDIYEDKSLDYK  281



>ref|XP_010039526.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis]
 gb|KCW45874.1| hypothetical protein EUGRSUZ_L00240 [Eucalyptus grandis]
Length=337

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 228/319 (71%), Gaps = 22/319 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNG YVKGVVGL KGLRK  S YP+VVA+ PDVPA+HR++L  QGCIVRE+EP+YP
Sbjct  29    TFLAGNGHYVKGVVGLAKGLRKAKSKYPLVVAILPDVPADHRKILEDQGCIVREIEPVYP  88

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVF+N+DHLFDL +G+FYAV D
Sbjct  89    P-ENQTQFAMAYYVINYSKLRIWEFVEYEKMIYLDGDIQVFDNIDHLFDLPNGFFYAVMD  147

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + + WP  + G +PS+YFN GMF+++PN+ TY  LL  
Sbjct  148   CFCEKTWSHTPQYDIGYCQQCPDKVQWPDHV-GPKPSLYFNAGMFVYEPNLDTYHDLLET  206

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+TPPT+FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ VEL K KVVHYC  G+K
Sbjct  207   LKVTPPTSFAEQDFLNMYFKDIYKPIPNVYNLVLAMLWRHPENVELDKVKVVHYCAAGSK  266

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PW YTG+E  M R+++KMLVKKWW+IY+D+SLDYK    R +  +        +T   RF
Sbjct  267   PWLYTGEEQYMDRDDIKMLVKKWWDIYDDESLDYKNIVARDAAAK--------QTKWDRF  318

Query  999   -SNTGNLTEPRYIKGPPAA  1052
                   +   R+I  P AA
Sbjct  319   LVALAEVGAFRFITAPSAA  337



>ref|XP_002312306.1| galactinol synthase family protein [Populus trichocarpa]
 gb|EEE89673.1| galactinol synthase family protein [Populus trichocarpa]
Length=325

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 214/287 (75%), Gaps = 13/287 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCI+RE+EPLYP
Sbjct  20   TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHREILESQGCIIREIEPLYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  F+  YYV+NYSKL+ W+F +Y KMIYLD D+QVF+N+DHLF+   GYFYAV D
Sbjct  80   P-ENQTQFSMAYYVINYSKLRIWEFVDYGKMIYLDGDIQVFDNIDHLFEKPTGYFYAVMD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP  + G+ P +YFN GM +F+P + TY  LL  
Sbjct  139  CFCEKTWSTTPQYQIKYCQQCPEKVQWPLEM-GSPPPLYFNAGMCLFEPKLETYFDLLET  197

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT+FAEQDFLNMFFRD Y+P+P VYN++  MLWRHPDK +L K KVVHYC  GAK
Sbjct  198  LKVTTPTSFAEQDFLNMFFRDVYQPIPPVYNLVSAMLWRHPDKFDLDKVKVVHYCAAGAK  257

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELG  959
            PWRYTGKE NM RE++K+LVKKWWEIY D+SLD+K      +  +LG
Sbjct  258  PWRYTGKEENMDREDIKVLVKKWWEIYEDESLDFKNATVPVAQEKLG  304



>ref|XP_011019276.1| PREDICTED: galactinol synthase 2-like [Populus euphratica]
Length=325

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 212/287 (74%), Gaps = 13/287 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVA  PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  20   TFLAGNGDYVKGVVGLAKGLRKVKSVYPLVVATLPDVPEEHREILESQGCIVREIEPVYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  F+  YYV+NYSKL+ W+F +Y KMIYLD D+QVF+N+DHLF+   GYFYAV D
Sbjct  80   P-ENQTQFSMAYYVINYSKLRIWEFVDYGKMIYLDGDIQVFDNIDHLFEKPPGYFYAVMD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP  + G+ P +YFN GMF+++P + TY  LL  
Sbjct  139  CFCEKTWSSTPQYQIKYCQQCPEKVQWPLEM-GSPPPLYFNAGMFLYEPKLETYFDLLET  197

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K T PT+FAEQDFLNMFFRD Y+P+P VYN++  MLWRHPDK +L K KVVHYC  GAK
Sbjct  198  LKATTPTSFAEQDFLNMFFRDVYQPIPPVYNLVSAMLWRHPDKFDLDKVKVVHYCAAGAK  257

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELG  959
            PWRYTGKE NM RE++K+LVKKWWEIY D+SLD+K      +  +LG
Sbjct  258  PWRYTGKEENMDREDIKVLVKKWWEIYEDESLDFKNATVPVAQEKLG  304



>gb|AGT50333.1| galactinol synthase 5 [Populus trichocarpa]
Length=325

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/275 (62%), Positives = 210/275 (76%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL +GLRKV SAYP+VVA+ PDVP EHR +L +QGCI+RE+EPLYP
Sbjct  20   TFLAGNGDYVKGVVGLARGLRKVKSAYPLVVAILPDVPEEHREILESQGCIIREIEPLYP  79

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  F+  YYV+NYSKL+ W+F +Y KMIYLD D+QVF+N+DHLF+   GYFYAV D
Sbjct  80   P-ENQTQFSMAYYVINYSKLRIWEFVDYGKMIYLDGDIQVFDNIDHLFEKPTGYFYAVMD  138

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP  + G+ P +YFN GM +F+P + TY  LL  
Sbjct  139  CFCEKTWSTTPQYQIKYCQQCPEKVQWPLEM-GSPPPLYFNAGMCLFEPKLETYFDLLET  197

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+T PT+FAEQDFLNMFFRD Y+P+P VYN++  MLWRHPDK +L K KVVHYC  GAK
Sbjct  198  LKVTTPTSFAEQDFLNMFFRDVYQPIPPVYNLVSAMLWRHPDKFDLDKVKVVHYCAAGAK  257

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++K+LVKKWWEIY D+SLD+K
Sbjct  258  PWRYTGKEENMDREDIKVLVKKWWEIYEDESLDFK  292



>ref|XP_009113209.1| PREDICTED: galactinol synthase 4 [Brassica rapa]
 emb|CDY53053.1| BnaA09g14180D [Brassica napus]
Length=334

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 226/320 (71%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC++RE++P++P
Sbjct  27    TFLAGDGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVLREIDPVHP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSKM+YLD+D+QVF+N+D+LFDL DGYF+AV D
Sbjct  87    PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMMYLDADIQVFDNIDNLFDLPDGYFHAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSPQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFLFEPSPLTYESLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              + TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  206   LETTPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVDLEKVKVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND+SLD+K                +VE  V + 
Sbjct  266   PWRYTGEEANMDREDIKMLVDKWWDVYNDESLDFK-----------SKIPVDVEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             +   ++ EP   YI  P AA
Sbjct  315   TILASVLEPEMTYIPAPSAA  334



>ref|XP_006438367.1| hypothetical protein CICLE_v10032043mg [Citrus clementina]
 gb|ESR51607.1| hypothetical protein CICLE_v10032043mg [Citrus clementina]
Length=336

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 208/276 (75%), Gaps = 17/276 (6%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDYVKGVVGL KGLR   SAYP+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  28   TFLAGSGDYVKGVVGLAKGLRNSKSAYPLVVAILPDVPEEHREVLRSQGCIVREIEPIYP  87

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E ++ FA  YYV+NYSKL+ W F EYSKMIYLD+D+QVFEN+DHLFDL DG+FYAV D
Sbjct  88   P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVFENIDHLFDLPDGFFYAVMD  146

Query  492  CVCEE-------------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLL  632
            C CE+                P K  + WP A +G+ P +YFN GMF+F+P+  TY  LL
Sbjct  147  CFCEKTWSHSPQYSIGYCQQRPNK--VTWP-AEMGSPPPLYFNAGMFVFEPSRLTYENLL  203

Query  633  NHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEG  812
               K+T PT FAEQDFLNMFF+  YKP+P  YN++V MLWRHP+ VEL K K VHYC  G
Sbjct  204  QTLKITTPTPFAEQDFLNMFFQKTYKPIPLAYNLVVAMLWRHPENVELEKVKAVHYCAAG  263

Query  813  AKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            +KPWRYTGKE NM RE++KMLV KWW+IYND+SLD+
Sbjct  264  SKPWRYTGKEVNMDREDVKMLVTKWWDIYNDESLDF  299



>gb|AAM96868.1| fagopyritol synthase 2 [Fagopyrum esculentum]
Length=354

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/273 (61%), Positives = 213/273 (78%), Gaps = 13/273 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGV+GL KGLRK  S YP+VVAV PDVP EHRR+LVAQGCI++E++P+ P
Sbjct  32   TFLAGNGDYVKGVIGLAKGLRKTQSGYPLVVAVLPDVPQEHRRMLVAQGCIIKEIQPVNP  91

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QV++N+DHLFDL DGY Y   D
Sbjct  92   PDN-QTQFAMAYYVINYSKLRIWEFIEYSKMIYLDGDIQVYDNIDHLFDLPDGYLYGAMD  150

Query  492  CVCEE---HGEP--------CKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+   H  P        C + + WP  L G +P++YFN GMF+F+P++STY  LL+ 
Sbjct  151  CFCEKTWSHSLPYKIGYCQQCPDRVQWPERL-GPKPTLYFNAGMFIFEPSVSTYNDLLHT  209

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++TPPT FAEQDFLNM+F+D Y+P+P VYN+++ +LW HP  ++L + KVVHYC +G+K
Sbjct  210  LEITPPTPFAEQDFLNMYFKDVYRPIPNVYNLVLALLWYHPGLMKLDEVKVVHYCADGSK  269

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLD  917
            PWRYTGK +NM RE+++MLVKKWWEIY+DQSLD
Sbjct  270  PWRYTGKGDNMDREDVRMLVKKWWEIYDDQSLD  302



>ref|XP_006392163.1| hypothetical protein EUTSA_v10023585mg [Eutrema salsugineum]
 gb|ESQ29449.1| hypothetical protein EUTSA_v10023585mg [Eutrema salsugineum]
Length=333

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 227/320 (71%), Gaps = 26/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC++RE+EP+YP
Sbjct  27    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHRDILRSQGCVLREIEPVYP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSKMIYLD+D+QVFEN+D+LFD+ DGYFYAV D
Sbjct  87    PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFENIDNLFDMPDGYFYAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +  + P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSPQYSIGYCQQCPEKVTWPENM-ESPPPLYFNAGMFVFEPSPLTYESLLQT  204

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPP+ FAEQDFLNMFF   YKP+P V N+++ MLWRHP+ VEL + KVVHYC  G+K
Sbjct  205   LEITPPSPFAEQDFLNMFFEKVYKPIPLVNNLVLAMLWRHPENVELERVKVVHYCAAGSK  264

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND+SLD+K             +  +VE  V + 
Sbjct  265   PWRYTGEEANMDREDIKMLVDKWWDVYNDESLDFK-----------PKSPEDVEETVTKS  313

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             +   ++ EP   Y   P AA
Sbjct  314   TILASVPEPEFTYFPAPSAA  333



>ref|XP_007163306.1| hypothetical protein PHAVU_001G223700g [Phaseolus vulgaris]
 gb|ESW35300.1| hypothetical protein PHAVU_001G223700g [Phaseolus vulgaris]
Length=327

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/274 (61%), Positives = 211/274 (77%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRK  S YP+VVAV PDVP EHR +L +QGC VRE++P+YP
Sbjct  27   TFLAGNGDYVKGVVGLAKGLRKAKSMYPLVVAVLPDVPEEHRMILKSQGCTVREIQPVYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVF N+DHLFDL D YFYAV D
Sbjct  87   P-ENQTQFAMAYYVINYSKLRIWEFVEYTKMIYLDGDIQVFGNIDHLFDLPDSYFYAVMD  145

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C   + WP+ L G +P +YFN GMF+++PN+ TY  LL  
Sbjct  146  CFCEKTWGHSPQYKIGYCQQCPNKVQWPSHL-GPKPPLYFNAGMFVYEPNLVTYRDLLQT  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             ++T PT+FAEQDFLNM+F+D+YKP+P +YN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  205  VQITKPTSFAEQDFLNMYFKDKYKPIPNLYNLVLAMLWRHPENVELDKVQVVHYCAAGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWR+TGKE NM RE++K+LVKKWWEIY D++LDY
Sbjct  265  PWRFTGKEENMEREDIKILVKKWWEIYEDETLDY  298



>ref|XP_007201909.1| hypothetical protein PRUPE_ppa015580mg [Prunus persica]
 gb|EMJ03108.1| hypothetical protein PRUPE_ppa015580mg [Prunus persica]
Length=311

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 210/285 (74%), Gaps = 11/285 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGN DYVKGVVGL KGLRK  S YP+VVAV PDVP +HR +L +QGCIV+E+EP+YP
Sbjct  10   TFLAGNKDYVKGVVGLAKGLRKAKSQYPLVVAVLPDVPQDHRDILESQGCIVQEIEPVYP  69

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
            S+  +  FA  YYV+NYSKL+ ++F EYSKMIYLD D+QVFEN+DHLF+L DG+ YAV D
Sbjct  70   SENHQTQFAMAYYVINYSKLRIFKFVEYSKMIYLDGDIQVFENIDHLFELPDGFLYAVMD  129

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A LG+ P  YFN GMF+++P ISTY  LL  
Sbjct  130  CFCEKTWSHTPQNKIGYCQQCPEKVQWPAAELGSPPPPYFNAGMFVYEPKISTYNDLLAA  189

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             + TPPT FAEQD LNMFFRD YKP+P  YN ++ MLWRHP+  +L   KVVHYC  G+K
Sbjct  190  VQATPPTPFAEQDLLNMFFRDIYKPIPSEYNFVLAMLWRHPENAKLDALKVVHYCAAGSK  249

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYE  953
            PWRYTG+E NM RE++KMLVKKWW+IY D++LD K     A++ +
Sbjct  250  PWRYTGEEENMEREDIKMLVKKWWDIYEDKTLDLKAAPAVATLVD  294



>ref|XP_004302294.1| PREDICTED: galactinol synthase 2-like [Fragaria vesca subsp. 
vesca]
Length=337

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 227/320 (71%), Gaps = 21/320 (7%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S YP+VVA+ PDVP EHR++LV+QGCIVRE+EP++P
Sbjct  26    TFLAGNGDYVKGVVGLAKGLRKVKSKYPLVVAILPDVPEEHRQILVSQGCIVREIEPVHP  85

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  +A  YYV+NYSKL+ W+F EYSKMIYLD D+QVF+N+DHLFD  D YFYAV D
Sbjct  86    P-ENQTHYAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFQNIDHLFDYPDNYFYAVMD  144

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE            + + C + + W  +L G +P +YFN GMF+++PN+STY  LL+ 
Sbjct  145   CFCETNWRDSPQFKIGYCQQCPDRVQWDNSL-GPKPPLYFNAGMFVYEPNLSTYHDLLST  203

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K + PT FAEQDFLN+FFRD+Y P+P  YN+++ MLWRHP+ +EL K KVVHYC  G+K
Sbjct  204   LKTSTPTLFAEQDFLNVFFRDKYVPIPSNYNLVLAMLWRHPENIELEKVKVVHYCANGSK  263

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETA--VP  992
             PWRY G+  NM RE++KMLVKKWWEIY+D+SLDY+     A   E G    +V     V 
Sbjct  264   PWRYNGEGENMEREDIKMLVKKWWEIYDDESLDYQNCIGAA---ESGNGTEQVNLQPFVA  320

Query  993   RFSNTGNLTEPRYIKGPPAA  1052
               S  G++    +I  P AA
Sbjct  321   ALSKAGHVN---FIPAPSAA  337



>ref|XP_011039081.1| PREDICTED: uncharacterized protein LOC105135748 [Populus euphratica]
Length=681

 Score =   316 bits (810),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 242/347 (70%), Gaps = 28/347 (8%)
 Frame = +3

Query  60    KMAPD-----ASNgglvvaraaggrrayvTFLAGNGDYvkgvvglvkglrkvgSaypvvv  224
              +APD     A+N   +V +A+    AYVTFLAG+GDY KGVVGL KGLRK  S YP+VV
Sbjct  347   SIAPDITATLANNTNSLVKQASISSCAYVTFLAGDGDYWKGVVGLAKGLRKAKSNYPLVV  406

Query  225   avwpdvpaEHRRLLVAQGCIVREVEPLYPSDEFELPFARPYYVLNYSKLQFWQFTEYSKM  404
             A+ PDVP EHR++L +QGC+VRE+EP+ P  E +  FA  YYV+NYSKL+ W+F EYSKM
Sbjct  407   AILPDVPEEHRKILASQGCLVREIEPVNPP-ENQTQFAMAYYVINYSKLRIWEFVEYSKM  465

Query  405   IYLDSDMQVFENLDHLFDLADGYFYAVPDCVCEE-----------HGEPCKEILPWPTAL  551
             IYLD D+QVF+N+DHLFD+ DGYFYA  DC CE+           + + C + + WP A 
Sbjct  466   IYLDGDIQVFDNIDHLFDMPDGYFYAAMDCFCEKTWCNSPQYKVGYCQQCPDKVHWP-AE  524

Query  552   LGARPSMYFNGGMFMFQPNISTYTRLLNHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYN  731
             +G +P +YFN GMF+++PN+STY  LL   K+TPPT FAEQDFLNMFFRD YKP+P  YN
Sbjct  525   MGPKPPLYFNAGMFVYEPNLSTYHDLLETLKVTPPTLFAEQDFLNMFFRDVYKPIPSDYN  584

Query  732   MLVNMLWRHPDKVELSKAKVVHYCVEGAKPWRYTGKENNMGREEMKMLVKKWWEIYNDQS  911
             +++ +LWRHP+ + L K KVVHYC  G+KPWRYTGKE+NM RE++KMLV KWW+IY+D+S
Sbjct  585   LVLALLWRHPENINLDKVKVVHYCAAGSKPWRYTGKEDNMDREDIKMLVNKWWDIYHDES  644

Query  912   LDYKYYKQRASVYELGGAAHEVETAVPRFSNTGNLTEPRYIKGPPAA  1052
             LD K      +V    GA  EV+  +   S  G      YI  P AA
Sbjct  645   LDCK-----NTVVAAAGA--EVQPFLAALSEAGI---AHYITAPSAA  681



>ref|XP_004302295.1| PREDICTED: galactinol synthase 2-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 167/274 (61%), Positives = 211/274 (77%), Gaps = 13/274 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGL KGLRKV S YP+VVA+ PDVP EHR++LV+QGCIVRE+EP+YP
Sbjct  27   TFLAGNGDYVKGVVGLAKGLRKVESKYPLVVAILPDVPEEHRQILVSQGCIVREIEPVYP  86

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EYSKMIYLD D+QVFEN+DHLFD  D Y YAV D
Sbjct  87   P-ENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDYPDNYLYAVKD  145

Query  492  CVCEEH-----------GEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE +            + C + + W  +L G +P +YFN GMF+++P++STY  LL+ 
Sbjct  146  CFCEPNWRHSPQFKIGYCQQCPDKVQWDNSL-GPKPPLYFNAGMFVYEPSLSTYQELLSA  204

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K + PT+FAEQDFLN FF+D+YKP+P  YN+++ MLWRHP+ +EL K KVVHYC  G+K
Sbjct  205  LKTSTPTSFAEQDFLNDFFKDKYKPIPSEYNLVLAMLWRHPENIELDKVKVVHYCANGSK  264

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDY  920
            PWRY G+  NM R+++KMLVK+WW+IYND+SLDY
Sbjct  265  PWRYNGEGENMQRDDIKMLVKRWWDIYNDESLDY  298



>ref|XP_006488980.1| PREDICTED: galactinol synthase 2-like [Citrus sinensis]
Length=314

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 213/275 (77%), Gaps = 13/275 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAGNGDYVKGVVGLVKGLRK  SAYP+VVAV PDVPA+HR +LV+QGCIVRE++P+YP
Sbjct  9    TFLAGNGDYVKGVVGLVKGLRKAKSAYPLVVAVLPDVPADHREILVSQGCIVREIQPVYP  68

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY+KMIYLD D+QVFEN+DHLF+L +GY YA  D
Sbjct  69   P-ENQTQFAMAYYVINYSKLRIWEFVEYAKMIYLDGDIQVFENIDHLFELPNGYLYAAMD  127

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C E + WP A +G+ P  YFN GMF+++PN+ TY+ LL  
Sbjct  128  CFCEKTWSNSPQYKIGYCQQCPEKVKWP-ASMGSPPPKYFNAGMFVYEPNLLTYSHLLET  186

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K+TPP++FAEQDFLN FFR+ YKP+ + YN ++ MLWRHP+ VE  K KVVHYC  G+K
Sbjct  187  LKVTPPSSFAEQDFLNNFFRNIYKPISHTYNFVLAMLWRHPEHVETEKVKVVHYCASGSK  246

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLVKKW +IY D+SLDYK
Sbjct  247  PWRYTGKEENMDREDIKMLVKKWKDIYEDKSLDYK  281



>gb|ACA04028.1| galactinol synthase 1 [Populus trichocarpa x Populus deltoides]
Length=338

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 230/320 (72%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCIVRE+EP+YP
Sbjct  31    TFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAILPDVPEEHRDILRSQGCIVREIEPIYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E ++ FA  YYV+NYSKL+ W F EYSKMIYLD+D+QVFEN+DHLFD  DGYFYAV D
Sbjct  91    P-ENQIQFAMAYYVINYSKLRIWNFEEYSKMIYLDADIQVFENIDHLFDTQDGYFYAVMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP A +G+ P +YFN GMF+F+P+  TY  LL  
Sbjct  150   CFCEKTWSHSPQYSVGYCQQCPEKITWP-AEMGSPPPLYFNAGMFVFEPSRLTYESLLER  208

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              ++TPPT FAEQDFLNMFF+  YKP+P +YN+++ MLWRHP+ VE+ K KVVHYC  G+K
Sbjct  209   LQITPPTPFAEQDFLNMFFQKTYKPIPLLYNLVLAMLWRHPENVEVEKVKVVHYCAAGSK  268

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW+IYND+SLD+              +A E ET   R 
Sbjct  269   PWRYTGEEANMDREDIKMLVAKWWDIYNDESLDFNG----------ENSAPEEETIFSRS  318

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   Y+  P AA
Sbjct  319   SILSSMPEPAISYVPAPTAA  338



>ref|XP_008781185.1| PREDICTED: galactinol synthase 2-like [Phoenix dactylifera]
Length=347

 Score =   305 bits (782),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 211/275 (77%), Gaps = 12/275 (4%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG+GDY KGVVGL KGLRKV SAYP+VVA+ PDVP  HRR+L +QGC+VRE+EP+YP
Sbjct  31   TFLAGDGDYWKGVVGLAKGLRKVKSAYPLVVAMLPDVPEGHRRILRSQGCLVREIEPVYP  90

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              E +  FA  YYV+NYSKL+ W+F EY KMIYLD+D+QV++N+DHLFDL  G+FYAV D
Sbjct  91   P-ENQTQFAMAYYVINYSKLRIWEFVEYQKMIYLDADIQVYDNIDHLFDLPGGHFYAVMD  149

Query  492  CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
            C CE+           + + C + + WP   LGA P++YFN GMF+ +P+++T   LL  
Sbjct  150  CFCEKTWSHTPQYQIGYCQQCPDKVSWPEDKLGAPPALYFNAGMFVHEPSLATAESLLKT  209

Query  639  FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
             K   PT FAEQDFLNMFF+D YKP+  VYN+++ MLWRHP+ V+L K KVVHYC  G+K
Sbjct  210  LKSITPTPFAEQDFLNMFFKDIYKPIAGVYNLVLAMLWRHPENVQLDKVKVVHYCAAGSK  269

Query  819  PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            PWRYTGKE NM RE++KMLV+KWW+IYND+SLDYK
Sbjct  270  PWRYTGKEANMDREDIKMLVEKWWDIYNDESLDYK  304



>emb|CDY47222.1| BnaC09g14710D [Brassica napus]
Length=334

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 226/320 (71%), Gaps = 25/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG+GDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGC++RE++P++P
Sbjct  27    TFLAGDGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVLREIDPVHP  86

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
              D  ++ FA  YYVLNYSKL+ W F EYSK++YLD+D+QVF+N+D+LFDL DGYF+AV D
Sbjct  87    PDN-QVEFAMAYYVLNYSKLRIWNFEEYSKIMYLDADIQVFDNIDNLFDLPDGYFHAVMD  145

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C E + WP  +    P +YFN GMF+F+P+  TY  LL  
Sbjct  146   CFCEKTWSHSPQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSPLTYESLLQT  205

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              + TPP+ FAEQDFLNMFF   YKP+P VYN+++ MLWRHP+ VEL K +VVHYC  G+K
Sbjct  206   LETTPPSPFAEQDFLNMFFEKVYKPIPLVYNLVLAMLWRHPENVELEKVRVVHYCAAGSK  265

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTG+E NM RE++KMLV KWW++YND+SLD+K                +VE  V + 
Sbjct  266   PWRYTGEEANMDREDIKMLVDKWWDVYNDESLDFK-----------SKIPVDVEETVTKS  314

Query  999   SNTGNLTEPR--YIKGPPAA  1052
             +   ++ EP   YI  P AA
Sbjct  315   TILASVLEPEMTYIPAPSAA  334



>gb|AAU43781.1| galactinol synthase [Castanea sativa]
 gb|AGN88979.1| galactinol synthase [Castanea sativa]
Length=337

 Score =   304 bits (779),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 223/320 (70%), Gaps = 26/320 (8%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAG GDYVKGVVGL KGLRKV SAYP+VVA+ PDVP EHR +L +QGCI+RE+EP+YP
Sbjct  31    TFLAGKGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCILREIEPIYP  90

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E E+ FA  YYV+NYSKL+ W F EY KMIYLD+D+QVFEN+DHLFD  DGYFYA  D
Sbjct  91    P-ENEVQFAMAYYVINYSKLRIWNFEEYKKMIYLDADIQVFENIDHLFDTPDGYFYATMD  149

Query  492   CVCEE-----------HGEPCKEILPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+           + + C + +PWP  + G+ P +YFN GMF+F P+ ST+ +LL  
Sbjct  150   CFCEKTWSHSLQFKVGYCQQCPDRVPWPIDM-GSPPPLYFNAGMFVFNPSRSTFDKLLEV  208

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
                TP T FAEQDFLNMFF   YKPLP V+N+++ MLWRHP+ ++++K KV HYC  G+K
Sbjct  209   LYATPVTPFAEQDFLNMFFEKVYKPLPLVFNLVLAMLWRHPENIDVNKVKVAHYCAAGSK  268

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHEVETAVPRF  998
             PWRYTGKE NM RE++KMLVKKWW+I+ND+SLD+K           G      E    + 
Sbjct  269   PWRYTGKEANMDREDIKMLVKKWWDIFNDESLDFK-----------GENPVSEEETFSKS  317

Query  999   SNTGNLTEP--RYIKGPPAA  1052
             S   ++ EP   YI  P AA
Sbjct  318   SIMASMPEPTISYIPAPTAA  337



>ref|XP_006840727.1| hypothetical protein AMTR_s00096p00114120 [Amborella trichopoda]
 gb|ERN02402.1| hypothetical protein AMTR_s00096p00114120 [Amborella trichopoda]
Length=343

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/277 (60%), Positives = 210/277 (76%), Gaps = 14/277 (5%)
 Frame = +3

Query  132  TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
            TFLAG GDY KGVVGL KGLRK  SAYP+VVA+ PDVP EHR++L +QGCIVRE+EP+YP
Sbjct  34   TFLAGTGDYYKGVVGLAKGLRKAKSAYPLVVAILPDVPEEHRQILTSQGCIVREIEPIYP  93

Query  312  SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
             D  ++ FA  YYV+NYSKL+ + F EYSKM+YLD+D+QVF+N+DHLFD  DGYFYAV D
Sbjct  94   PDN-QIQFAMAYYVINYSKLRIFDFEEYSKMVYLDADIQVFDNIDHLFDTPDGYFYAVMD  152

Query  492  CVCEE-----------HGEPCKEILPWPT--ALLGARPSMYFNGGMFMFQPNISTYTRLL  632
            C CE+           + + C + + WP      G  P +YFN GMF+++P+  TY  LL
Sbjct  153  CFCEKTWSHTKQYSIGYCQQCPDKVKWPIDDQRFGNPPPLYFNAGMFVYEPSKLTYDSLL  212

Query  633  NHFKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEG  812
               ++TPPT FAEQDFLNMFF+  YKP+P +YN+++ MLWRHP+ VEL   KVVHYC  G
Sbjct  213  ETLQITPPTPFAEQDFLNMFFQHTYKPIPLIYNLVLAMLWRHPENVELENVKVVHYCAAG  272

Query  813  AKPWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYK  923
            +KPWRYTGKE NM RE++KMLV+KWW+IY+D+SLD+K
Sbjct  273  SKPWRYTGKEANMEREDIKMLVQKWWDIYDDESLDFK  309



>ref|XP_010544149.1| PREDICTED: galactinol synthase 2-like [Tarenaya hassleriana]
Length=330

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 229/319 (72%), Gaps = 17/319 (5%)
 Frame = +3

Query  132   TFLAGNGDYvkgvvglvkglrkvgSaypvvvavwpdvpaEHRRLLVAQGCIVREVEPLYP  311
             TFLAGNGDYVKGVVGL KGLRKV S YP++VAV PDVP +HRR L  QGCIV+E++P++P
Sbjct  17    TFLAGNGDYVKGVVGLAKGLRKVKSKYPLIVAVLPDVPEDHRRQLTEQGCIVKEIQPVHP  76

Query  312   SDEFELPFARPYYVLNYSKLQFWQFTEYSKMIYLDSDMQVFENLDHLFDLADGYFYAVPD  491
               E +  FA  YYV+NYSKL+ W+F EY KMIYLD D+QVF N+DHLFDL +G+FYAV D
Sbjct  77    P-ENQTRFAMAYYVINYSKLRIWKFVEYEKMIYLDGDIQVFGNIDHLFDLPNGHFYAVMD  135

Query  492   CVCEE---HGEP-----CKEI---LPWPTALLGARPSMYFNGGMFMFQPNISTYTRLLNH  638
             C CE+   H        C++    + WP+ L G +P +YFN GMF+F+P++STY  LL  
Sbjct  136   CFCEKTWSHAPQYKIGYCQQSPGKVTWPSEL-GPKPPLYFNAGMFVFEPSLSTYHILLET  194

Query  639   FKLTPPTAFAEQDFLNMFFRDEYKPLPYVYNMLVNMLWRHPDKVELSKAKVVHYCVEGAK  818
              K+ PPT FAEQDFLNM+F+D YKP+P VYN+++ MLWRHP+ +EL K KVVHYC  G+K
Sbjct  195   LKVVPPTPFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELDKVKVVHYCAAGSK  254

Query  819   PWRYTGKENNMGREEMKMLVKKWWEIYNDQSLDYKYYKQRASVYELGGAAHE-VETAVPR  995
             PWRYTG+E NM RE++KMLVKKW +IYND+SLDY   K    + +      + ++  +  
Sbjct  255   PWRYTGEEENMEREDIKMLVKKWRDIYNDESLDYDKNKNEMYIRQDDHKRQKALQPLLAA  314

Query  996   FSNTGNLTEPRYIKGPPAA  1052
              S TG L    +IK P AA
Sbjct  315   LSETGVL---HHIKAPSAA  330



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4006524533058