BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77779_g1_i1 len=1717 path=[1:0-1716]

Length=1717
                                                                      Score     E

ref|XP_009781170.1|  PREDICTED: uncharacterized acetyltransferase...    683   0.0      
gb|AAM73656.1|AF390211_1  AER                                           679   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004246337.2|  PREDICTED: uncharacterized acetyltransferase...    672   0.0      
ref|XP_009602090.1|  PREDICTED: uncharacterized acetyltransferase...    671   0.0      
ref|XP_006363050.1|  PREDICTED: BAHD acyltransferase DCR-like           659   0.0      
gb|EYU41860.1|  hypothetical protein MIMGU_mgv1a027064mg                643   0.0      
ref|XP_006480972.1|  PREDICTED: uncharacterized acetyltransferase...    634   0.0      
ref|XP_006429311.1|  hypothetical protein CICLE_v10011647mg             631   0.0      
ref|XP_008239572.1|  PREDICTED: BAHD acyltransferase DCR                629   0.0      
ref|XP_011019146.1|  PREDICTED: BAHD acyltransferase DCR                627   0.0      
emb|CDP06509.1|  unnamed protein product                                625   0.0      
ref|XP_011094979.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    625   0.0      
ref|XP_002308212.1|  transferase family protein                         623   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007205148.1|  hypothetical protein PRUPE_ppa005318mg             621   0.0      
gb|AGT37414.1|  anthocyanin 5-aromatic acyltransferase                  614   0.0      
gb|KDP24482.1|  hypothetical protein JCGZ_25046                         614   0.0      
ref|XP_010101800.1|  BAHD acyltransferase DCR                           613   0.0      
ref|XP_002322965.1|  transferase family protein                         610   0.0      Populus trichocarpa [western balsam poplar]
emb|CAN62119.1|  hypothetical protein VITISV_037024                     610   0.0      Vitis vinifera
ref|XP_002278801.2|  PREDICTED: BAHD acyltransferase DCR                610   0.0      Vitis vinifera
ref|XP_002531355.1|  Anthocyanin 5-aromatic acyltransferase, puta...    606   0.0      Ricinus communis
gb|AFF19200.1|  BAHD acyltransferase                                    605   0.0      
gb|KDO53236.1|  hypothetical protein CISIN_1g0453721mg                  603   0.0      
ref|XP_008388189.1|  PREDICTED: uncharacterized acetyltransferase...    604   0.0      
ref|XP_007026775.1|  HXXXD-type acyl-transferase family protein         603   0.0      
ref|XP_009358855.1|  PREDICTED: uncharacterized acetyltransferase...    603   0.0      
emb|CBI30421.3|  unnamed protein product                                601   0.0      
ref|XP_004137729.1|  PREDICTED: BAHD acyltransferase DCR-like           595   0.0      
ref|XP_009370265.1|  PREDICTED: BAHD acyltransferase DCR-like           593   0.0      
ref|XP_008442462.1|  PREDICTED: uncharacterized acetyltransferase...    592   0.0      
ref|XP_010423922.1|  PREDICTED: uncharacterized acetyltransferase...    587   0.0      
gb|AFF19201.1|  BAHD acyltransferase                                    587   0.0      
ref|XP_002873021.1|  transferase family protein                         585   0.0      
ref|XP_010452012.1|  PREDICTED: uncharacterized acetyltransferase...    582   0.0      
ref|NP_195741.1|  HXXXD-type acyl-transferase-like protein              580   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY48117.1|  BnaC02g03740D                                          579   0.0      
ref|XP_010490596.1|  PREDICTED: uncharacterized acetyltransferase...    577   0.0      
ref|XP_006287651.1|  hypothetical protein CARUB_v10000861mg             575   0.0      
gb|KFK44567.1|  hypothetical protein AALP_AA1G274300                    574   0.0      
ref|XP_010543226.1|  PREDICTED: uncharacterized acetyltransferase...    574   0.0      
ref|XP_003520927.1|  PREDICTED: BAHD acyltransferase DCR-like           571   0.0      
emb|CDY55902.1|  BnaAnng13950D                                          573   0.0      
ref|XP_006398644.1|  hypothetical protein EUTSA_v10013380mg             571   0.0      
ref|XP_004302658.1|  PREDICTED: BAHD acyltransferase DCR-like           569   0.0      
ref|XP_008449203.1|  PREDICTED: BAHD acyltransferase DCR-like           567   0.0      
ref|XP_007133941.1|  hypothetical protein PHAVU_010G005200g             565   0.0      
ref|XP_004147890.1|  PREDICTED: BAHD acyltransferase DCR-like           563   0.0      
emb|CDP14056.1|  unnamed protein product                                563   0.0      
ref|XP_003516942.1|  PREDICTED: BAHD acyltransferase DCR-like           562   0.0      
ref|XP_003604624.1|  BAHD acyltransferase DCR                           563   0.0      
emb|CDY40314.1|  BnaA10g27540D                                          561   0.0      
ref|XP_009125428.1|  PREDICTED: uncharacterized acetyltransferase...    563   0.0      
ref|XP_004162750.1|  PREDICTED: LOW QUALITY PROTEIN: BAHD acyltra...    560   0.0      
ref|XP_004506783.1|  PREDICTED: BAHD acyltransferase DCR-like           560   0.0      
ref|XP_011084938.1|  PREDICTED: uncharacterized acetyltransferase...    556   0.0      
ref|XP_008350541.1|  PREDICTED: LOW QUALITY PROTEIN: BAHD acyltra...    554   0.0      
ref|XP_006435679.1|  hypothetical protein CICLE_v10031464mg             546   0.0      
ref|XP_002316230.1|  transferase family protein                         544   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO69082.1|  hypothetical protein CISIN_1g012489mg                   545   0.0      
ref|XP_011076731.1|  PREDICTED: uncharacterized acetyltransferase...    541   0.0      
gb|AHB08888.1|  HXXXD-type acyl-transferase family protein              541   0.0      
gb|EYU19983.1|  hypothetical protein MIMGU_mgv1a005405mg                539   0.0      
ref|XP_011036002.1|  PREDICTED: uncharacterized acetyltransferase...    538   0.0      
ref|XP_010262784.1|  PREDICTED: uncharacterized acetyltransferase...    537   0.0      
ref|XP_009601485.1|  PREDICTED: uncharacterized acetyltransferase...    537   0.0      
emb|CBI31531.3|  unnamed protein product                                536   0.0      
ref|XP_010690020.1|  PREDICTED: uncharacterized acetyltransferase...    536   0.0      
gb|KDP44821.1|  hypothetical protein JCGZ_01321                         533   0.0      
ref|XP_009803702.1|  PREDICTED: uncharacterized acetyltransferase...    531   0.0      
ref|XP_006355659.1|  PREDICTED: BAHD acyltransferase DCR-like           530   0.0      
ref|XP_002276050.1|  PREDICTED: uncharacterized acetyltransferase...    531   1e-180   Vitis vinifera
ref|XP_006355660.1|  PREDICTED: uncharacterized acetyltransferase...    530   1e-180   
emb|CAN80937.1|  hypothetical protein VITISV_005841                     530   3e-180   Vitis vinifera
ref|XP_009799023.1|  PREDICTED: uncharacterized acetyltransferase...    525   2e-178   
ref|XP_004239937.1|  PREDICTED: BAHD acyltransferase DCR-like           524   3e-178   
ref|XP_006355661.1|  PREDICTED: uncharacterized acetyltransferase...    524   3e-178   
ref|XP_002311205.2|  transferase family protein                         525   4e-178   Populus trichocarpa [western balsam poplar]
ref|XP_007009085.1|  HXXXD-type acyl-transferase family protein         524   5e-178   
gb|EPS57660.1|  hypothetical protein M569_17156                         523   5e-178   
ref|XP_011041436.1|  PREDICTED: uncharacterized acetyltransferase...    524   6e-178   
ref|XP_008370133.1|  PREDICTED: BAHD acyltransferase DCR                518   4e-177   
ref|XP_004239935.1|  PREDICTED: BAHD acyltransferase DCR                518   4e-176   
ref|XP_010046515.1|  PREDICTED: BAHD acyltransferase DCR                518   5e-176   
ref|XP_010256629.1|  PREDICTED: BAHD acyltransferase DCR                519   6e-176   
gb|KFK36890.1|  hypothetical protein AALP_AA4G185300                    518   8e-176   
ref|XP_009791334.1|  PREDICTED: BAHD acyltransferase DCR-like           518   1e-175   
ref|XP_009143263.1|  PREDICTED: uncharacterized acetyltransferase...    518   2e-175   
ref|XP_007009084.1|  HXXXD-type acyl-transferase family protein         516   5e-175   
emb|CDY24938.1|  BnaC03g22340D                                          515   6e-175   
ref|XP_009626925.1|  PREDICTED: uncharacterized acetyltransferase...    515   9e-175   
ref|XP_010031257.1|  PREDICTED: uncharacterized acetyltransferase...    516   1e-174   
ref|XP_008392921.1|  PREDICTED: uncharacterized acetyltransferase...    516   2e-174   
ref|XP_006411242.1|  hypothetical protein EUTSA_v10016586mg             514   4e-174   
ref|XP_010095065.1|  BAHD acyltransferase DCR                           514   5e-174   
ref|XP_002526860.1|  Anthocyanin 5-aromatic acyltransferase, puta...    513   7e-174   Ricinus communis
ref|XP_004239936.1|  PREDICTED: BAHD acyltransferase DCR-like           511   3e-173   
ref|XP_003616578.1|  BAHD acyltransferase DCR                           511   1e-172   
ref|XP_006295818.1|  hypothetical protein CARUB_v10024944mg             510   2e-172   
emb|CDX74815.1|  BnaA05g05610D                                          508   3e-172   
ref|XP_009350907.1|  PREDICTED: uncharacterized acetyltransferase...    509   7e-172   
ref|NP_181527.1|  HXXXD-type acyl-transferase-like protein              508   1e-171   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28209.1|  unknown                                                 507   2e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881688.1|  transferase family protein                         507   3e-171   
ref|XP_009141856.1|  PREDICTED: uncharacterized acetyltransferase...    504   1e-170   
ref|XP_004138571.1|  PREDICTED: BAHD acyltransferase DCR-like           505   2e-170   
ref|XP_003519380.1|  PREDICTED: uncharacterized acetyltransferase...    503   6e-170   
ref|XP_010517384.1|  PREDICTED: uncharacterized acetyltransferase...    503   1e-169   
gb|KCW50517.1|  hypothetical protein EUGRSUZ_J00240                     500   6e-169   
ref|XP_004490956.1|  PREDICTED: uncharacterized acetyltransferase...    501   1e-168   
ref|XP_010512943.1|  PREDICTED: uncharacterized acetyltransferase...    499   2e-168   
ref|XP_007141793.1|  hypothetical protein PHAVU_008G226200g             499   2e-168   
ref|XP_008233722.1|  PREDICTED: uncharacterized acetyltransferase...    499   4e-168   
ref|XP_008441438.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    499   4e-168   
ref|XP_007217934.1|  hypothetical protein PRUPE_ppa004937mg             499   5e-168   
ref|XP_010505699.1|  PREDICTED: uncharacterized acetyltransferase...    498   8e-168   
ref|XP_003545239.1|  PREDICTED: uncharacterized acetyltransferase...    498   9e-168   
emb|CDX93218.1|  BnaC04g46780D                                          496   2e-167   
ref|XP_009141855.1|  PREDICTED: uncharacterized acetyltransferase...    497   4e-167   
ref|XP_010534567.1|  PREDICTED: BAHD acyltransferase DCR                492   2e-165   
emb|CDY07045.1|  BnaA04g22700D                                          489   5e-165   
ref|XP_004308921.1|  PREDICTED: uncharacterized protein LOC101293941    504   5e-165   
gb|KHN20867.1|  BAHD acyltransferase DCR                                473   6e-158   
ref|XP_009345656.1|  PREDICTED: BAHD acyltransferase DCR-like           459   1e-153   
ref|XP_008785410.1|  PREDICTED: uncharacterized acetyltransferase...    461   3e-153   
ref|XP_008800790.1|  PREDICTED: uncharacterized acetyltransferase...    457   1e-151   
ref|XP_010908559.1|  PREDICTED: uncharacterized acetyltransferase...    452   1e-149   
ref|XP_009419670.1|  PREDICTED: BAHD acyltransferase DCR-like           449   2e-148   
ref|XP_004503391.1|  PREDICTED: uncharacterized acetyltransferase...    449   8e-145   
ref|XP_007163518.1|  hypothetical protein PHAVU_001G240700g             437   3e-144   
ref|XP_004503232.1|  PREDICTED: uncharacterized acetyltransferase...    436   1e-143   
ref|XP_009380610.1|  PREDICTED: BAHD acyltransferase DCR-like           435   3e-143   
ref|XP_006601956.1|  PREDICTED: uncharacterized acetyltransferase...    433   2e-142   
ref|XP_009413798.1|  PREDICTED: uncharacterized acetyltransferase...    431   1e-141   
ref|XP_007163519.1|  hypothetical protein PHAVU_001G240800g             430   2e-141   
ref|XP_004961908.1|  PREDICTED: uncharacterized acetyltransferase...    425   4e-139   
emb|CDJ26508.1|  unnamed protein product                                425   4e-139   
gb|AES71111.2|  HXXXD-type acyl-transferase family protein              424   7e-139   
dbj|BAJ94368.1|  predicted protein                                      423   2e-138   
ref|XP_009386262.1|  PREDICTED: uncharacterized acetyltransferase...    424   4e-138   
dbj|BAD81949.1|  putative hydroxycinnamoyl transferase                  422   6e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006591380.1|  PREDICTED: uncharacterized acetyltransferase...    422   6e-138   
ref|XP_006645034.1|  PREDICTED: uncharacterized acetyltransferase...    420   2e-137   
ref|XP_006654487.1|  PREDICTED: uncharacterized acetyltransferase...    416   7e-136   
ref|XP_003566198.1|  PREDICTED: uncharacterized acetyltransferase...    416   2e-135   
dbj|BAJ93957.1|  predicted protein                                      414   5e-135   
ref|XP_004970614.1|  PREDICTED: uncharacterized acetyltransferase...    412   3e-134   
ref|XP_002456651.1|  hypothetical protein SORBIDRAFT_03g040180          412   3e-134   Sorghum bicolor [broomcorn]
ref|XP_004501103.1|  PREDICTED: uncharacterized acetyltransferase...    416   4e-134   
ref|XP_002441195.1|  hypothetical protein SORBIDRAFT_09g022030          412   7e-134   Sorghum bicolor [broomcorn]
ref|XP_003600860.1|  BAHD acyltransferase DCR                           422   1e-133   
ref|XP_003564637.1|  PREDICTED: uncharacterized acetyltransferase...    410   3e-133   
gb|KHN13079.1|  Putative acetyltransferase                              405   6e-133   
gb|KCW86101.1|  hypothetical protein EUGRSUZ_B028011                    400   1e-132   
ref|XP_010923110.1|  PREDICTED: uncharacterized acetyltransferase...    406   4e-132   
gb|EEC79316.1|  hypothetical protein OsI_20158                          405   9e-132   Oryza sativa Indica Group [Indian rice]
ref|NP_001055699.1|  Os05g0449200                                       405   1e-131   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA56793.1|  TPA: AER                                               405   2e-131   
gb|AGE46028.1|  putative hydroxycinnamoyl transferase                   400   4e-131   
ref|NP_001151798.1|  AER                                                403   9e-131   Zea mays [maize]
gb|AFW81723.1|  hypothetical protein ZEAMMB73_519077                    399   1e-128   
ref|XP_008657044.1|  PREDICTED: uncharacterized acetyltransferase...    383   1e-122   
ref|XP_011015986.1|  PREDICTED: BAHD acyltransferase DCR-like           360   3e-116   
gb|EEE55688.1|  hypothetical protein OsJ_04109                          333   3e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EPS69004.1|  hypothetical protein M569_05767                         332   7e-104   
ref|XP_010270496.1|  PREDICTED: uncharacterized acetyltransferase...    319   1e-98    
ref|XP_010915552.1|  PREDICTED: uncharacterized acetyltransferase...    314   1e-96    
ref|XP_008801989.1|  PREDICTED: uncharacterized acetyltransferase...    313   3e-96    
gb|ABR18470.1|  unknown                                                 308   9e-95    Picea sitchensis
ref|XP_007017180.1|  HXXXD-type acyl-transferase family protein         305   4e-93    
ref|XP_010915553.1|  PREDICTED: uncharacterized acetyltransferase...    302   6e-92    
ref|XP_002284916.2|  PREDICTED: uncharacterized acetyltransferase...    300   2e-91    Vitis vinifera
gb|KDO84111.1|  hypothetical protein CISIN_1g044173mg                   299   6e-91    
ref|XP_006473294.1|  PREDICTED: uncharacterized acetyltransferase...    298   2e-90    
ref|XP_004291089.1|  PREDICTED: uncharacterized acetyltransferase...    296   8e-90    
emb|CAN78155.1|  hypothetical protein VITISV_032623                     300   1e-89    Vitis vinifera
ref|XP_008347613.1|  PREDICTED: uncharacterized acetyltransferase...    295   3e-89    
ref|XP_004141386.1|  PREDICTED: uncharacterized acetyltransferase...    293   2e-88    
ref|XP_007136703.1|  hypothetical protein PHAVU_009G066800g             293   2e-88    
ref|XP_004163245.1|  PREDICTED: uncharacterized acetyltransferase...    293   2e-88    
gb|KGN55211.1|  hypothetical protein Csa_4G640970                       293   2e-88    
ref|XP_008378023.1|  PREDICTED: uncharacterized acetyltransferase...    292   4e-88    
ref|XP_009409404.1|  PREDICTED: uncharacterized acetyltransferase...    291   1e-87    
ref|XP_008452574.1|  PREDICTED: uncharacterized acetyltransferase...    290   2e-87    
ref|XP_010110811.1|  putative acetyltransferase                         290   2e-87    
ref|XP_011029557.1|  PREDICTED: uncharacterized acetyltransferase...    289   3e-87    
ref|XP_004291090.1|  PREDICTED: uncharacterized acetyltransferase...    289   4e-87    
ref|XP_007136696.1|  hypothetical protein PHAVU_009G066100g             289   6e-87    
ref|XP_010110810.1|  putative acetyltransferase                         288   6e-87    
ref|XP_008452572.1|  PREDICTED: uncharacterized acetyltransferase...    288   9e-87    
ref|XP_003603067.1|  N-hydroxycinnamoyl/benzoyltransferase              288   1e-86    
ref|XP_006374905.1|  transferase family protein                         288   2e-86    
ref|XP_010064180.1|  PREDICTED: uncharacterized acetyltransferase...    286   6e-86    
ref|XP_010677339.1|  PREDICTED: uncharacterized acetyltransferase...    285   1e-85    
ref|XP_010677650.1|  PREDICTED: uncharacterized acetyltransferase...    285   1e-85    
ref|XP_010059907.1|  PREDICTED: uncharacterized acetyltransferase...    285   1e-85    
ref|XP_010677336.1|  PREDICTED: uncharacterized acetyltransferase...    285   2e-85    
ref|XP_007136697.1|  hypothetical protein PHAVU_009G066200g             285   3e-85    
ref|XP_010059906.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    285   3e-85    
ref|XP_007224078.1|  hypothetical protein PRUPE_ppa015472mg             284   3e-85    
ref|XP_003603072.1|  N-hydroxycinnamoyl/benzoyltransferase              283   6e-85    
gb|ACU20865.1|  unknown                                                 282   2e-84    Glycine max [soybeans]
gb|ABC47860.1|  N-hydroxycinnamoyl/benzoyltransferase 1                 282   2e-84    Glycine max [soybeans]
ref|XP_003525889.1|  PREDICTED: uncharacterized acetyltransferase...    282   2e-84    
ref|XP_010059908.1|  PREDICTED: uncharacterized acetyltransferase...    282   2e-84    
ref|XP_007136702.1|  hypothetical protein PHAVU_009G066700g             282   2e-84    
emb|CDP11972.1|  unnamed protein product                                281   4e-84    
emb|CDP11973.1|  unnamed protein product                                281   4e-84    
gb|KHN04490.1|  Putative acetyltransferase                              281   5e-84    
gb|ABC47847.1|  N-hydroxycinnamoyl/benzoyltransferase 5                 281   7e-84    Glycine max [soybeans]
ref|XP_003523952.2|  PREDICTED: uncharacterized acetyltransferase...    281   7e-84    
ref|XP_008220248.1|  PREDICTED: uncharacterized acetyltransferase...    280   7e-84    
gb|KHN22332.1|  Putative acetyltransferase                              280   8e-84    
ref|XP_006354859.1|  PREDICTED: uncharacterized acetyltransferase...    279   2e-83    
gb|KDP41703.1|  hypothetical protein JCGZ_16110                         279   2e-83    
ref|XP_007226559.1|  hypothetical protein PRUPE_ppa024441mg             279   2e-83    
ref|XP_003523954.1|  PREDICTED: uncharacterized acetyltransferase...    279   2e-83    
gb|KCW66380.1|  hypothetical protein EUGRSUZ_F00196                     276   3e-83    
ref|XP_007136704.1|  hypothetical protein PHAVU_009G066900g             279   4e-83    
ref|XP_008220250.1|  PREDICTED: uncharacterized acetyltransferase...    277   8e-83    
ref|XP_002510186.1|  Anthranilate N-benzoyltransferase protein, p...    276   2e-82    Ricinus communis
ref|XP_004238137.1|  PREDICTED: uncharacterized acetyltransferase...    277   3e-82    
gb|KHN04489.1|  Putative acetyltransferase                              277   3e-82    
ref|XP_009775187.1|  PREDICTED: uncharacterized acetyltransferase...    276   3e-82    
ref|XP_008393786.1|  PREDICTED: uncharacterized acetyltransferase...    276   4e-82    
ref|XP_006374906.1|  anthranilate N-hydroxycinamoyl/bensoiltransf...    276   4e-82    
ref|XP_004141385.1|  PREDICTED: uncharacterized acetyltransferase...    276   5e-82    
ref|XP_010107873.1|  putative acetyltransferase                         275   5e-82    
ref|XP_009359877.1|  PREDICTED: uncharacterized acetyltransferase...    276   5e-82    
ref|XP_004291088.1|  PREDICTED: uncharacterized acetyltransferase...    275   6e-82    
ref|XP_003523950.1|  PREDICTED: uncharacterized acetyltransferase...    275   8e-82    
gb|KGN55210.1|  hypothetical protein Csa_4G640960                       275   9e-82    
gb|KHN04491.1|  Putative acetyltransferase                              275   1e-81    
gb|ABC47861.1|  N-hydroxycinnamoyl/benzoyltransferase 2                 274   1e-81    Glycine max [soybeans]
ref|XP_008220251.1|  PREDICTED: uncharacterized acetyltransferase...    275   1e-81    
ref|XP_004964259.1|  PREDICTED: uncharacterized acetyltransferase...    275   2e-81    
ref|XP_007221613.1|  hypothetical protein PRUPE_ppb015328mg             274   2e-81    
ref|XP_003528298.1|  PREDICTED: uncharacterized acetyltransferase...    274   2e-81    
ref|XP_006354860.1|  PREDICTED: uncharacterized acetyltransferase...    274   3e-81    
ref|XP_009365277.1|  PREDICTED: uncharacterized acetyltransferase...    273   4e-81    
ref|XP_009613516.1|  PREDICTED: uncharacterized acetyltransferase...    273   5e-81    
gb|EPS73996.1|  hypothetical protein M569_00760                         272   6e-81    
ref|XP_006354858.1|  PREDICTED: uncharacterized acetyltransferase...    273   6e-81    
ref|XP_003603061.1|  N-hydroxycinnamoyl/benzoyltransferase              273   6e-81    
gb|AES73312.2|  HXXXD-type acyl-transferase family protein              272   7e-81    
ref|XP_003523951.1|  PREDICTED: uncharacterized acetyltransferase...    273   8e-81    
gb|ACU18586.1|  unknown                                                 273   9e-81    Glycine max [soybeans]
ref|XP_003603068.1|  N-hydroxycinnamoyl/benzoyltransferase              272   1e-80    
ref|XP_008452575.1|  PREDICTED: uncharacterized acetyltransferase...    272   1e-80    
ref|XP_010933132.1|  PREDICTED: uncharacterized acetyltransferase...    272   1e-80    
ref|XP_010692375.1|  PREDICTED: uncharacterized acetyltransferase...    271   5e-80    
ref|XP_006434729.1|  hypothetical protein CICLE_v10003138mg             270   5e-80    
ref|XP_007149064.1|  hypothetical protein PHAVU_005G037900g             270   6e-80    
ref|XP_007136698.1|  hypothetical protein PHAVU_009G066300g             270   1e-79    
ref|XP_006850491.1|  hypothetical protein AMTR_s00035p00187610          269   1e-79    
ref|XP_007136701.1|  hypothetical protein PHAVU_009G066600g             270   1e-79    
gb|KHN29658.1|  Putative acetyltransferase                              268   1e-79    
ref|XP_010274412.1|  PREDICTED: uncharacterized acetyltransferase...    269   1e-79    
ref|XP_010924632.1|  PREDICTED: uncharacterized acetyltransferase...    269   2e-79    
ref|XP_010064179.1|  PREDICTED: uncharacterized acetyltransferase...    269   3e-79    
ref|XP_010107871.1|  putative acetyltransferase                         268   3e-79    
ref|XP_003523662.1|  PREDICTED: uncharacterized acetyltransferase...    268   5e-79    
gb|AES73322.2|  HXXXD-type acyl-transferase family protein              268   6e-79    
gb|KCW66379.1|  hypothetical protein EUGRSUZ_F00195                     266   1e-78    
ref|XP_008393787.1|  PREDICTED: uncharacterized acetyltransferase...    267   1e-78    
ref|XP_010252439.1|  PREDICTED: uncharacterized acetyltransferase...    267   2e-78    
gb|KDP42394.1|  hypothetical protein JCGZ_02451                         266   2e-78    
ref|XP_006367422.1|  PREDICTED: uncharacterized acetyltransferase...    265   4e-78    
ref|XP_010064177.1|  PREDICTED: uncharacterized acetyltransferase...    266   4e-78    
ref|XP_006280430.1|  hypothetical protein CARUB_v10026362mg             265   5e-78    
gb|KFK31810.1|  hypothetical protein AALP_AA6G161600                    265   5e-78    
ref|XP_010442114.1|  PREDICTED: uncharacterized acetyltransferase...    265   6e-78    
ref|NP_199097.1|  HXXXD-type acyl-transferase-like protein              263   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927209.1|  PREDICTED: uncharacterized acetyltransferase...    263   3e-77    
ref|XP_010481938.1|  PREDICTED: uncharacterized acetyltransferase...    262   5e-77    
ref|XP_003603062.1|  N-hydroxycinnamoyl/benzoyltransferase              270   6e-77    
gb|KDP42392.1|  hypothetical protein JCGZ_02449                         262   6e-77    
gb|ABK24638.1|  unknown                                                 262   7e-77    Picea sitchensis
emb|CDP06258.1|  unnamed protein product                                261   2e-76    
ref|XP_002436318.1|  hypothetical protein SORBIDRAFT_10g000340          261   3e-76    Sorghum bicolor [broomcorn]
ref|XP_003603064.1|  N-hydroxycinnamoyl/benzoyltransferase              260   4e-76    
gb|AES73315.2|  HXXXD-type acyl-transferase family protein              260   4e-76    
ref|XP_009123701.1|  PREDICTED: uncharacterized acetyltransferase...    259   8e-76    
emb|CDP06257.1|  unnamed protein product                                259   1e-75    
ref|XP_004501559.1|  PREDICTED: uncharacterized acetyltransferase...    259   1e-75    
ref|XP_003603071.1|  N-hydroxycinnamoyl/benzoyltransferase              268   2e-75    
ref|XP_006367771.1|  PREDICTED: uncharacterized acetyltransferase...    258   2e-75    
ref|XP_006480712.1|  PREDICTED: uncharacterized acetyltransferase...    258   2e-75    
ref|XP_004501558.1|  PREDICTED: uncharacterized acetyltransferase...    257   3e-75    
ref|XP_002533255.1|  Anthranilate N-benzoyltransferase protein, p...    257   4e-75    
ref|XP_010494242.1|  PREDICTED: uncharacterized acetyltransferase...    256   7e-75    
ref|XP_004288019.1|  PREDICTED: uncharacterized acetyltransferase...    256   7e-75    
emb|CDY21238.1|  BnaC02g28850D                                          256   1e-74    
ref|XP_008787703.1|  PREDICTED: uncharacterized acetyltransferase...    256   2e-74    
ref|XP_008378022.1|  PREDICTED: uncharacterized acetyltransferase...    254   7e-74    
ref|XP_006428978.1|  hypothetical protein CICLE_v10011715mg             253   1e-73    
ref|XP_009782781.1|  PREDICTED: uncharacterized acetyltransferase...    253   1e-73    
ref|XP_008452577.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    253   2e-73    
ref|XP_009399826.1|  PREDICTED: uncharacterized acetyltransferase...    252   2e-73    
ref|XP_006403341.1|  hypothetical protein EUTSA_v10003208mg             253   2e-73    
ref|XP_006480713.1|  PREDICTED: uncharacterized acetyltransferase...    251   6e-73    
emb|CDX71519.1|  BnaC04g17540D                                          251   7e-73    
ref|XP_010927437.1|  PREDICTED: uncharacterized acetyltransferase...    251   9e-73    
ref|XP_009125703.1|  PREDICTED: uncharacterized acetyltransferase...    251   1e-72    
ref|XP_008778923.1|  PREDICTED: uncharacterized acetyltransferase...    251   2e-72    
ref|XP_009625193.1|  PREDICTED: uncharacterized acetyltransferase...    250   3e-72    
ref|XP_006850498.1|  hypothetical protein AMTR_s00035p00220050          250   3e-72    
ref|XP_008648721.1|  PREDICTED: uncharacterized acetyltransferase...    249   7e-72    
ref|XP_008367983.1|  PREDICTED: uncharacterized acetyltransferase...    249   7e-72    
ref|XP_008452578.1|  PREDICTED: uncharacterized acetyltransferase...    249   1e-71    
ref|XP_008338333.1|  PREDICTED: uncharacterized acetyltransferase...    248   1e-71    
ref|XP_006848128.1|  hypothetical protein AMTR_s00029p00222850          251   1e-71    
ref|XP_002304178.2|  anthranilate N-hydroxycinnamoyl/benzoyltrans...    247   2e-71    
gb|ABK94986.1|  unknown                                                 247   2e-71    
gb|KFK25164.1|  hypothetical protein AALP_AA8G074700                    247   5e-71    
ref|XP_004141266.1|  PREDICTED: uncharacterized acetyltransferase...    246   5e-71    
ref|XP_002436317.1|  hypothetical protein SORBIDRAFT_10g000330          247   9e-71    
dbj|BAK02497.1|  predicted protein                                      246   1e-70    
ref|XP_004141265.1|  PREDICTED: uncharacterized acetyltransferase...    246   1e-70    
ref|XP_008452576.1|  PREDICTED: uncharacterized acetyltransferase...    246   1e-70    
ref|XP_004163246.1|  PREDICTED: uncharacterized acetyltransferase...    245   2e-70    
ref|XP_004171369.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    245   2e-70    
gb|KDP31965.1|  hypothetical protein JCGZ_12426                         245   2e-70    
ref|XP_004512834.1|  PREDICTED: BAHD acyltransferase DCR-like           244   3e-70    
ref|XP_007047323.1|  HXXXD-type acyl-transferase family protein, ...    244   3e-70    
ref|XP_007204343.1|  hypothetical protein PRUPE_ppa005635mg             244   3e-70    
ref|XP_007204351.1|  hypothetical protein PRUPE_ppa005715mg             244   4e-70    
ref|XP_008382283.1|  PREDICTED: uncharacterized acetyltransferase...    244   4e-70    
gb|AAV50009.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase      242   6e-70    
ref|XP_008361493.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    243   6e-70    
ref|XP_008241487.1|  PREDICTED: uncharacterized acetyltransferase...    243   6e-70    
ref|XP_007204008.1|  hypothetical protein PRUPE_ppa025918mg             243   7e-70    
ref|XP_009764197.1|  PREDICTED: uncharacterized acetyltransferase...    243   7e-70    
ref|XP_006387348.1|  hypothetical protein POPTR_1203s002001g            239   7e-70    
ref|XP_002282930.1|  PREDICTED: uncharacterized acetyltransferase...    242   1e-69    
ref|XP_004957081.1|  PREDICTED: uncharacterized acetyltransferase...    243   2e-69    
ref|XP_010452751.1|  PREDICTED: uncharacterized acetyltransferase...    243   2e-69    
ref|XP_004244447.2|  PREDICTED: uncharacterized acetyltransferase...    241   3e-69    
ref|XP_009343279.1|  PREDICTED: uncharacterized acetyltransferase...    242   3e-69    
ref|XP_008352605.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    242   3e-69    
ref|XP_008361421.1|  PREDICTED: uncharacterized acetyltransferase...    245   4e-69    
ref|XP_007203275.1|  hypothetical protein PRUPE_ppa025470mg             241   4e-69    
ref|XP_010549240.1|  PREDICTED: uncharacterized acetyltransferase...    241   7e-69    
ref|XP_007203667.1|  hypothetical protein PRUPE_ppa026934mg             241   7e-69    
gb|ABK94771.1|  unknown                                                 240   7e-69    
ref|XP_002304177.2|  hypothetical protein POPTR_0003s05590g             240   7e-69    
ref|XP_011076132.1|  PREDICTED: LOW QUALITY PROTEIN: BAHD acyltra...    240   9e-69    
ref|XP_004141387.1|  PREDICTED: uncharacterized acetyltransferase...    241   1e-68    
ref|XP_002467259.1|  hypothetical protein SORBIDRAFT_01g022200          241   1e-68    
ref|XP_009123702.1|  PREDICTED: uncharacterized acetyltransferase...    240   1e-68    
ref|XP_009123700.1|  PREDICTED: uncharacterized acetyltransferase...    240   1e-68    
ref|XP_004230696.1|  PREDICTED: uncharacterized acetyltransferase...    240   2e-68    
ref|XP_002871292.1|  transferase family protein                         239   3e-68    
ref|XP_011000815.1|  PREDICTED: uncharacterized acetyltransferase...    239   3e-68    
ref|XP_006659753.1|  PREDICTED: uncharacterized acetyltransferase...    239   4e-68    
ref|XP_002871293.1|  transferase family protein                         239   4e-68    
ref|XP_006346302.1|  PREDICTED: uncharacterized acetyltransferase...    239   4e-68    
gb|KDP31964.1|  hypothetical protein JCGZ_12425                         238   4e-68    
ref|XP_004972476.1|  PREDICTED: uncharacterized acetyltransferase...    239   5e-68    
dbj|BAF49303.1|  putative acyltransferase                               238   5e-68    
gb|EEC79821.1|  hypothetical protein OsI_21274                          238   7e-68    
ref|XP_004163247.1|  PREDICTED: uncharacterized acetyltransferase...    238   8e-68    
ref|XP_008241486.1|  PREDICTED: uncharacterized acetyltransferase...    238   8e-68    
gb|EYU25117.1|  hypothetical protein MIMGU_mgv1a006173mg                238   1e-67    
gb|EEE67923.1|  hypothetical protein OsJ_25794                          238   1e-67    
ref|XP_010275645.1|  PREDICTED: BAHD acyltransferase DCR                237   2e-67    
ref|NP_001056538.1|  Os06g0103200                                       237   2e-67    
emb|CDX81073.1|  BnaC03g03270D                                          237   2e-67    
ref|XP_004231858.1|  PREDICTED: uncharacterized acetyltransferase...    237   3e-67    
ref|NP_001060828.1|  Os08g0112200                                       237   3e-67    
ref|XP_007204342.1|  hypothetical protein PRUPE_ppa005630mg             236   3e-67    
ref|XP_006339875.1|  PREDICTED: uncharacterized acetyltransferase...    236   3e-67    
ref|XP_004972479.1|  PREDICTED: uncharacterized acetyltransferase...    236   6e-67    
ref|XP_004230695.1|  PREDICTED: uncharacterized acetyltransferase...    236   6e-67    
dbj|BAJ21224.1|  acyltransferase-like                                   235   6e-67    
ref|NP_196402.1|  HXXXD-type acyl-transferase-like protein              235   9e-67    
dbj|BAF01091.1|  N-hydroxycinnamoyl/benzoyltransferase - like pro...    235   1e-66    
ref|XP_007047327.1|  HXXXD-type acyl-transferase family protein, ...    235   1e-66    
ref|XP_009131022.1|  PREDICTED: uncharacterized acetyltransferase...    235   2e-66    
ref|XP_009367311.1|  PREDICTED: uncharacterized acetyltransferase...    234   2e-66    
ref|XP_006385479.1|  hypothetical protein POPTR_0003s05570g             230   2e-66    
ref|XP_010494241.1|  PREDICTED: uncharacterized acetyltransferase...    235   2e-66    
ref|XP_010491403.1|  PREDICTED: uncharacterized acetyltransferase...    234   3e-66    
gb|KFK25163.1|  hypothetical protein AALP_AA8G074600                    234   3e-66    
ref|XP_006659050.1|  PREDICTED: uncharacterized acetyltransferase...    234   4e-66    
ref|NP_196404.1|  HXXXD-type acyl-transferase family protein            233   5e-66    
ref|XP_008439271.1|  PREDICTED: BAHD acyltransferase DCR                233   5e-66    
ref|XP_002272435.1|  PREDICTED: BAHD acyltransferase DCR                233   7e-66    
ref|NP_196403.1|  HXXXD-type acyl-transferase family protein            233   7e-66    
ref|XP_010491408.1|  PREDICTED: uncharacterized acetyltransferase...    233   8e-66    
ref|XP_007220995.1|  hypothetical protein PRUPE_ppa005774mg             232   8e-66    
gb|EEC82800.1|  hypothetical protein OsI_27569                          233   9e-66    
emb|CDP09318.1|  unnamed protein product                                231   1e-65    
ref|XP_004972478.1|  PREDICTED: uncharacterized acetyltransferase...    233   1e-65    
ref|XP_009620391.1|  PREDICTED: BAHD acyltransferase DCR                232   1e-65    
ref|XP_009368753.1|  PREDICTED: BAHD acyltransferase DCR isoform X1     232   1e-65    
ref|XP_006399268.1|  hypothetical protein EUTSA_v10013445mg             233   1e-65    
emb|CBI22682.3|  unnamed protein product                                233   1e-65    
ref|XP_008361429.1|  PREDICTED: uncharacterized acetyltransferase...    232   2e-65    
emb|CDX78313.1|  BnaA03g02250D                                          232   2e-65    
ref|XP_010691628.1|  PREDICTED: uncharacterized acetyltransferase...    232   2e-65    
ref|NP_001274287.1|  BAHD acyltransferase DCR-like                      232   2e-65    
gb|ABI48361.1|  putative alcohol acyltransferase 2                      231   2e-65    
ref|XP_003580171.2|  PREDICTED: uncharacterized acetyltransferase...    232   2e-65    
ref|XP_009800795.1|  PREDICTED: BAHD acyltransferase DCR                231   2e-65    
ref|XP_006659051.1|  PREDICTED: uncharacterized acetyltransferase...    231   3e-65    
ref|XP_006353890.1|  PREDICTED: BAHD acyltransferase DCR-like           231   3e-65    
ref|XP_007220994.1|  hypothetical protein PRUPE_ppa005774mg             228   4e-65    
ref|XP_006346306.1|  PREDICTED: uncharacterized acetyltransferase...    231   4e-65    
ref|XP_010691627.1|  PREDICTED: uncharacterized acetyltransferase...    231   6e-65    
ref|XP_007203377.1|  hypothetical protein PRUPE_ppa025976mg             230   7e-65    
gb|KGN57399.1|  hypothetical protein Csa_3G183330                       230   8e-65    
ref|XP_010691626.1|  PREDICTED: uncharacterized acetyltransferase...    230   1e-64    
ref|XP_009589621.1|  PREDICTED: uncharacterized acetyltransferase...    229   1e-64    
ref|XP_006399267.1|  hypothetical protein EUTSA_v10015498mg             225   1e-64    
ref|XP_008352555.1|  PREDICTED: uncharacterized acetyltransferase...    229   1e-64    
ref|XP_002271409.1|  PREDICTED: BAHD acyltransferase DCR                233   2e-64    
ref|XP_006826188.1|  hypothetical protein AMTR_s04066p00001330          222   2e-64    
ref|XP_006421981.1|  hypothetical protein CICLE_v10004977mg             228   2e-64    
ref|XP_007152215.1|  hypothetical protein PHAVU_004G111300g             228   3e-64    
gb|KEH31455.1|  anthranilate N-benzoyltransferase                       228   3e-64    
ref|XP_009349545.1|  PREDICTED: uncharacterized acetyltransferase...    229   3e-64    
ref|XP_004233972.1|  PREDICTED: uncharacterized acetyltransferase...    229   3e-64    
ref|XP_004140767.1|  PREDICTED: BAHD acyltransferase DCR-like           230   3e-64    
ref|XP_010317216.1|  PREDICTED: uncharacterized acetyltransferase...    228   4e-64    
ref|XP_006287648.1|  hypothetical protein CARUB_v10000858mg             229   4e-64    
gb|KDO51966.1|  hypothetical protein CISIN_1g013527mg                   228   4e-64    
ref|XP_010935790.1|  PREDICTED: BAHD acyltransferase DCR                228   4e-64    
emb|CDY40771.1|  BnaAnng06340D                                          229   4e-64    
gb|KFK23749.1|  hypothetical protein AALP_AAs71196U000200               226   5e-64    
ref|XP_010064178.1|  PREDICTED: uncharacterized acetyltransferase...    225   7e-64    
ref|XP_010454680.1|  PREDICTED: BAHD acyltransferase DCR                228   8e-64    
ref|XP_003533987.1|  PREDICTED: BAHD acyltransferase DCR-like           227   9e-64    
ref|XP_008787429.1|  PREDICTED: BAHD acyltransferase DCR                227   1e-63    
dbj|BAA93453.1|  acyltransferase homolog                                226   2e-63    
ref|NP_001060826.1|  Os08g0111300                                       227   2e-63    
ref|XP_008234195.1|  PREDICTED: BAHD acyltransferase DCR                226   2e-63    
ref|XP_004288018.1|  PREDICTED: uncharacterized acetyltransferase...    226   2e-63    
ref|XP_003571295.1|  PREDICTED: uncharacterized acetyltransferase...    226   2e-63    
ref|XP_003557286.1|  PREDICTED: uncharacterized acetyltransferase...    227   2e-63    
ref|XP_010421201.1|  PREDICTED: BAHD acyltransferase DCR-like           226   3e-63    
emb|CDX81074.1|  BnaC03g03280D                                          226   3e-63    
ref|XP_007038770.1|  HXXXD-type acyl-transferase family protein         226   3e-63    
gb|EAZ05363.1|  hypothetical protein OsI_27566                          226   4e-63    
ref|XP_002513671.1|  Anthranilate N-benzoyltransferase protein, p...    225   4e-63    
gb|KCW66381.1|  hypothetical protein EUGRSUZ_F00197                     223   4e-63    
gb|EAZ38666.1|  hypothetical protein OsJ_23059                          226   4e-63    
ref|XP_006399269.1|  hypothetical protein EUTSA_v10013445mg             226   4e-63    
gb|AAL67994.1|  acyltransferase-like protein                            225   5e-63    
emb|CDY44265.1|  BnaC02g41520D                                          225   7e-63    
ref|XP_002523237.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    224   8e-63    
gb|KFK27683.1|  hypothetical protein AALP_AA8G415100                    225   1e-62    
ref|XP_006360905.1|  PREDICTED: uncharacterized acetyltransferase...    223   1e-62    
ref|XP_004308064.1|  PREDICTED: BAHD acyltransferase DCR-like           224   1e-62    
ref|XP_009130097.1|  PREDICTED: BAHD acyltransferase DCR                225   1e-62    
gb|AFF19205.1|  BAHD acyltransferase                                    224   1e-62    
ref|XP_008379960.1|  PREDICTED: BAHD acyltransferase DCR-like           224   1e-62    
ref|XP_004972480.1|  PREDICTED: uncharacterized acetyltransferase...    225   1e-62    
ref|XP_004253191.2|  PREDICTED: uncharacterized acetyltransferase...    224   1e-62    
ref|XP_008241494.1|  PREDICTED: uncharacterized acetyltransferase...    221   1e-62    
gb|KEH16419.1|  HXXXD-type acyl-transferase family protein              224   1e-62    
ref|XP_010495415.1|  PREDICTED: BAHD acyltransferase DCR-like           227   2e-62    
gb|KHN16923.1|  BAHD acyltransferase DCR                                219   2e-62    
gb|EMT19626.1|  Putative acetyltransferase                              224   2e-62    
ref|XP_003548168.1|  PREDICTED: BAHD acyltransferase DCR-like           223   2e-62    
gb|EPS62447.1|  hypothetical protein M569_12343                         223   3e-62    
ref|XP_011071701.1|  PREDICTED: uncharacterized acetyltransferase...    223   3e-62    
ref|XP_006342478.1|  PREDICTED: uncharacterized acetyltransferase...    223   3e-62    
ref|XP_008338376.1|  PREDICTED: uncharacterized acetyltransferase...    223   3e-62    
ref|XP_011030160.1|  PREDICTED: BAHD acyltransferase DCR-like           223   5e-62    
gb|AAX95845.1|  hypothetical protein                                    223   5e-62    
gb|KHG17482.1|  BAHD acyltransferase DCR -like protein                  223   5e-62    
emb|CDX80398.1|  BnaC07g30460D                                          223   5e-62    
ref|XP_003628043.1|  Acetyltransferase, putative                        222   6e-62    
ref|XP_002444572.1|  hypothetical protein SORBIDRAFT_07g023870          223   6e-62    
ref|XP_009338991.1|  PREDICTED: uncharacterized acetyltransferase...    222   7e-62    
ref|XP_008351423.1|  PREDICTED: uncharacterized acetyltransferase...    222   7e-62    
ref|XP_006394655.1|  hypothetical protein EUTSA_v10004127mg             223   8e-62    
ref|XP_010109793.1|  putative acetyltransferase                         222   9e-62    
ref|NP_001130851.1|  hypothetical protein                               223   1e-61    
ref|XP_008648377.1|  PREDICTED: uncharacterized acetyltransferase...    223   1e-61    
emb|CDP05164.1|  unnamed protein product                                222   1e-61    
ref|XP_003571308.1|  PREDICTED: uncharacterized acetyltransferase...    222   1e-61    
ref|XP_010452753.1|  PREDICTED: uncharacterized acetyltransferase...    221   1e-61    
ref|XP_010423163.1|  PREDICTED: uncharacterized acetyltransferase...    221   2e-61    
ref|XP_008342727.1|  PREDICTED: uncharacterized acetyltransferase...    221   2e-61    
ref|XP_009762458.1|  PREDICTED: uncharacterized acetyltransferase...    221   2e-61    
ref|XP_004509128.1|  PREDICTED: uncharacterized acetyltransferase...    220   3e-61    
ref|XP_002318207.2|  transferase family protein                         220   3e-61    
ref|NP_001143242.1|  uncharacterized protein LOC100275767               221   3e-61    
gb|KDP36440.1|  hypothetical protein JCGZ_09510                         223   4e-61    
ref|XP_004972474.1|  PREDICTED: uncharacterized acetyltransferase...    220   4e-61    
ref|NP_001062520.1|  Os08g0562500                                       220   5e-61    
ref|XP_010035162.1|  PREDICTED: BAHD acyltransferase DCR                219   5e-61    
gb|KEH31452.1|  anthranilate N-benzoyltransferase                       219   6e-61    
ref|NP_001183885.1|  uncharacterized protein LOC100502478               219   6e-61    
ref|XP_003524646.1|  PREDICTED: uncharacterized acetyltransferase...    219   7e-61    
ref|XP_007203290.1|  hypothetical protein PRUPE_ppa025724mg             217   7e-61    
gb|EMT06482.1|  Putative acetyltransferase                              219   8e-61    
gb|KEH26169.1|  alcohol acyltransferase                                 219   1e-60    
ref|XP_011048767.1|  PREDICTED: BAHD acyltransferase DCR                218   1e-60    



>ref|XP_009781170.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Nicotiana 
sylvestris]
Length=465

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/465 (77%), Positives = 412/465 (89%), Gaps = 7/465 (2%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+ V+S+ T+YPE+  S + SL+LSVSDLPMLSCQYIQKGVLL+QPP +  +   +
Sbjct  1     MPSSSVFVVSRSTIYPEHHESVNNSLRLSVSDLPMLSCQYIQKGVLLTQPPTELTSTHLI  60

Query  1391  l--klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shAD  1221
                K+SLSK L+HFP LAGRL T++ GHVYIL ND G++FVHAKAPHL+ A L+P +++D
Sbjct  61    SHLKISLSKTLSHFPPLAGRLITNSDGHVYILCNDAGVDFVHAKAPHLTIATLIPPNYSD  120

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P  FR FFQ+DSTLSYAGH KPLMAIQVTEL+D VF+GCTMNHAVVDGTSFWNFFNT+A
Sbjct  121   LPLYFRKFFQFDSTLSYAGHYKPLMAIQVTELNDGVFIGCTMNHAVVDGTSFWNFFNTFA  180

Query  1040  EICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             E  KG KKI+R P FGR+TVF+SPAVL+FP GGP+ATFSGDEPIREKIFHF+REAILK+K
Sbjct  181   EFSKGEKKITRQPFFGRNTVFDSPAVLQFPEGGPSATFSGDEPIREKIFHFSREAILKLK  240

Query  860   FRANNGKLCNGENGKLNGKITPVNHEPGLQNG----GAASEISSFQSLSAQLWRSVTRAR  693
             FRANN    NG+NGK NGKITPVN+EP LQNG    G ASEISSFQSLSAQLWRSVTRAR
Sbjct  241   FRANNKMAVNGQNGKTNGKITPVNNEPALQNGAAVKGTASEISSFQSLSAQLWRSVTRAR  300

Query  692   KLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRN  513
             KL+ SKTTTFRMA+NCRHRLE +++PLYFGNAIQSIPTVA   ELL++DL+W+A +LH+N
Sbjct  301   KLDGSKTTTFRMAVNCRHRLEQKMEPLYFGNAIQSIPTVASVNELLTNDLNWSANLLHQN  360

Query  512   VVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM  333
             VVAHDDATVRRG++DWE+NPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM
Sbjct  361   VVAHDDATVRRGVKDWESNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM  420

Query  332   ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             ANKFDGKISAFPGREGNG+VDLEVVLAPETMAGLE DME+MQYVS
Sbjct  421   ANKFDGKISAFPGREGNGTVDLEVVLAPETMAGLEEDMEFMQYVS  465



>gb|AAM73656.1|AF390211_1 AER [Nicotiana tabacum]
Length=465

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/465 (77%), Positives = 411/465 (88%), Gaps = 7/465 (2%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+ V+S+ T+YPE+  S + SL+LSVSDLPMLSCQYIQKGVLL+QPP +  +   +
Sbjct  1     MPSSSVFVVSRSTIYPEHHESVNNSLRLSVSDLPMLSCQYIQKGVLLTQPPTELTSTHLI  60

Query  1391  l--klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shAD  1221
                K+SLSK L+HFP LAGRL T++ GHVYIL ND G++FVHAKAPHL+ A L+P +++D
Sbjct  61    SHLKISLSKTLSHFPPLAGRLITNSDGHVYILCNDAGVDFVHAKAPHLTIATLIPPNYSD  120

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P  FR FFQ++STLSYAGH KPLM IQVTEL+D VF+GCTMNHAVVDGTSFWNFFNT+A
Sbjct  121   LPLYFRKFFQFESTLSYAGHYKPLMVIQVTELNDGVFIGCTMNHAVVDGTSFWNFFNTFA  180

Query  1040  EICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             E  KG KKI+R P FGR+TVF+SPAVL+FP GGP+ATFSGDEPIREKIFHF+REAILK+K
Sbjct  181   EFSKGEKKITRQPFFGRNTVFDSPAVLQFPEGGPSATFSGDEPIREKIFHFSREAILKLK  240

Query  860   FRANNGKLCNGENGKLNGKITPVNHEPGLQNG----GAASEISSFQSLSAQLWRSVTRAR  693
             FRANN    NG+NGK NGKITPVN+EP LQNG    G ASEISSFQSLSAQLWRSVTRAR
Sbjct  241   FRANNKMAVNGQNGKTNGKITPVNNEPALQNGAAVKGTASEISSFQSLSAQLWRSVTRAR  300

Query  692   KLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRN  513
             KL+ SKTTTFRMA+NCRHRLE +++PLYFGNAIQSIPTVA   ELL++DL+W+A +LH+N
Sbjct  301   KLDGSKTTTFRMAVNCRHRLEQKMEPLYFGNAIQSIPTVASVNELLTNDLNWSANLLHQN  360

Query  512   VVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM  333
             VVAHDDATVRRG++DWE+NPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM
Sbjct  361   VVAHDDATVRRGVKDWESNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM  420

Query  332   ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             ANKFDGKISAFPGREGNG+VDLEVVLAPETMAGLE DME+MQYVS
Sbjct  421   ANKFDGKISAFPGREGNGTVDLEVVLAPETMAGLEEDMEFMQYVS  465



>ref|XP_004246337.2| PREDICTED: uncharacterized acetyltransferase At3g50280 [Solanum 
lycopersicum]
Length=460

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/464 (76%), Positives = 399/464 (86%), Gaps = 10/464 (2%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP-ldaaalis  1395
             MP+SS+ V+SKCT+YP++ +S + +LKLSVSDLPMLSCQYIQKGVLL+Q P   + +LIS
Sbjct  1     MPTSSLFVVSKCTIYPDHHTSLNNTLKLSVSDLPMLSCQYIQKGVLLTQSPFESSNSLIS  60

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaall-pshADI  1218
              LK +LSK L+HFP LAGRL TD+ G+VYIL ND GI+FVH KAPHL  + L+  + +DI
Sbjct  61    HLKTALSKTLSHFPPLAGRLITDSDGYVYILCNDAGIDFVHTKAPHLMISTLVPQNQSDI  120

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P  FR FFQ+D TLSYAGH KPLMAIQVTEL+DAVF+GCTMNHAVVDGTSFWNFFNT+AE
Sbjct  121   PIYFRKFFQFDKTLSYAGHHKPLMAIQVTELNDAVFIGCTMNHAVVDGTSFWNFFNTFAE  180

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
               KG  KI+R P FGR TVF+SPAVLKFP GGP+ATFSGDEP+REKIFHF+REAILK+K 
Sbjct  181   FSKGEMKITRQPCFGRKTVFDSPAVLKFPEGGPSATFSGDEPLREKIFHFSREAILKLKL  240

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGA----ASEISSFQSLSAQLWRSVTRARK  690
             RAN      G NGK NGKITPVN E GL+NG A    ASEISSFQSLSAQLWRSVTRARK
Sbjct  241   RANK----TGVNGKTNGKITPVNDETGLKNGAAMKNSASEISSFQSLSAQLWRSVTRARK  296

Query  689   LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNV  510
             LE +KTTTFRMA+NCRHRLE RL+PLYFGNAIQSIPT+A   ELLS+DL W+A  LH+NV
Sbjct  297   LEGNKTTTFRMAVNCRHRLEQRLEPLYFGNAIQSIPTIASVKELLSNDLYWSANQLHQNV  356

Query  509   VAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMA  330
             VAH D TVR+G++DWE+NPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRP+AVRSGMA
Sbjct  357   VAHGDVTVRQGVKDWESNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPVAVRSGMA  416

Query  329   NKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NKFDGKISAFPGREGNG+VDLEVVLAPETM GLE DME+MQYVS
Sbjct  417   NKFDGKISAFPGREGNGTVDLEVVLAPETMVGLEEDMEFMQYVS  460



>ref|XP_009602090.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Nicotiana 
tomentosiformis]
Length=460

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/461 (77%), Positives = 408/461 (89%), Gaps = 4/461 (1%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+ V+S+ T+YPE+  S + SL+LSVSDLPMLSCQYIQKGVLL+QPP +  +   +
Sbjct  1     MPSSSVFVVSRSTIYPEHHDSVNNSLRLSVSDLPMLSCQYIQKGVLLTQPPTELTSTHLI  60

Query  1391  l--klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shAD  1221
                K+SLSK L+HFP LAGRL T++ GHVYI+ ND G++FVHAKAPHL+ A L P +++D
Sbjct  61    SYLKISLSKTLSHFPPLAGRLITNSDGHVYIICNDAGVDFVHAKAPHLTIATLSPPNYSD  120

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P  FR FFQ+DSTLSYAGH K LMAIQVTEL+D VF+GCTMNHAVVDGTSFWNFFNT+A
Sbjct  121   VPLYFRKFFQFDSTLSYAGHYKSLMAIQVTELNDGVFIGCTMNHAVVDGTSFWNFFNTFA  180

Query  1040  EICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             E  KG KKI+R P FGR+TVF+SPAVL+FP GGP+ATFSGDEPIREKIFHF+REAILK+K
Sbjct  181   EFSKGEKKITRQPFFGRNTVFDSPAVLQFPEGGPSATFSGDEPIREKIFHFSREAILKLK  240

Query  860   FRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEA  681
             FRANN    NG+NG+ NGKI PV +EP L+NG +ASEISSFQSLSAQLWRSVTRARKLE 
Sbjct  241   FRANNKMTVNGQNGRTNGKIRPVKNEPALKNG-SASEISSFQSLSAQLWRSVTRARKLEG  299

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
             SKTTTFRMA+NCRHR+E R++PLYFGNAIQSIPTVA   ELLS++L+W+A +LH+NVVAH
Sbjct  300   SKTTTFRMAVNCRHRMEKRMEPLYFGNAIQSIPTVASVNELLSNELNWSANLLHQNVVAH  359

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKF  321
             DDATVRRG++DWE+NPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRP+AVRSGMANKF
Sbjct  360   DDATVRRGVKDWESNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPVAVRSGMANKF  419

Query  320   DGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DGKISAFPGREGNG+VDLEVVLAPETMAGLE DME+MQYVS
Sbjct  420   DGKISAFPGREGNGTVDLEVVLAPETMAGLEEDMEFMQYVS  460



>ref|XP_006363050.1| PREDICTED: BAHD acyltransferase DCR-like [Solanum tuberosum]
Length=460

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/464 (74%), Positives = 396/464 (85%), Gaps = 10/464 (2%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP-ldaaalis  1395
             MP+SS+ V+SKC +YP++  S + +LKLSVSDLPMLSCQYIQKGVLL+Q P   + +LIS
Sbjct  1     MPTSSLFVVSKCIIYPDHHQSLNNTLKLSVSDLPMLSCQYIQKGVLLTQSPFESSNSLIS  60

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaall-pshADI  1218
              LK++LSK L+HFP LAGRL TD+ G+VYI+ ND G++FVH KAPHL  + L+  + +DI
Sbjct  61    HLKIALSKTLSHFPPLAGRLITDSDGYVYIICNDAGVDFVHTKAPHLMISTLVPQNQSDI  120

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P  FR FFQ+D TLSYAGH KPLMAIQVTEL+D VF+GCTMNHAVVDGTSFWNFFNT+AE
Sbjct  121   PIYFRKFFQFDKTLSYAGHDKPLMAIQVTELNDGVFIGCTMNHAVVDGTSFWNFFNTFAE  180

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
               KG KKI+R P F R TVF+SPAVLKFP GGP+ATFSGDEP+REKIFHF+REAILK+K 
Sbjct  181   FSKGEKKITRQPCFSRKTVFDSPAVLKFPEGGPSATFSGDEPLREKIFHFSREAILKLKL  240

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGG----AASEISSFQSLSAQLWRSVTRARK  690
             RAN      G NGK NGKITPVN E GL+NG     +A EISSFQSLSAQLW+SVTRARK
Sbjct  241   RANK----TGVNGKTNGKITPVNDELGLKNGAGVKNSALEISSFQSLSAQLWKSVTRARK  296

Query  689   LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNV  510
             LE +KTTTFRMA+NCRHRLE R+ PLYFGN IQSIPT+A   ELLS+DL W+A  LH+NV
Sbjct  297   LEGNKTTTFRMAVNCRHRLEQRMDPLYFGNGIQSIPTIASVKELLSNDLYWSANQLHQNV  356

Query  509   VAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMA  330
             VAH D TVR+G++DWE+NPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRP+AVRSGMA
Sbjct  357   VAHGDVTVRQGVKDWESNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPVAVRSGMA  416

Query  329   NKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NKFDGKISAFPGREGNG+VDLEVVLAPETMAGLE+DME+MQYVS
Sbjct  417   NKFDGKISAFPGREGNGTVDLEVVLAPETMAGLEDDMEFMQYVS  460



>gb|EYU41860.1| hypothetical protein MIMGU_mgv1a027064mg [Erythranthe guttata]
Length=474

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/475 (74%), Positives = 399/475 (84%), Gaps = 18/475 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+V++SKCT+YPE +SS  KSL+LSVSDLPMLSCQYIQKGVLL  PPL +A L+SL
Sbjct  1     MPSSSVVIVSKCTIYPE-RSSTIKSLRLSVSDLPMLSCQYIQKGVLLPSPPLSSADLLSL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
             +KLSLS+ L+ FP LAGRL TDA GHV+I+ ND G++F HAKAPH+S AALLP    DIP
Sbjct  60    IKLSLSRTLSEFPPLAGRLQTDAVGHVHIVCNDAGVDFFHAKAPHISVAALLPPHDRDIP  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +R FFQYDSTLSYAGH +PL+A+QVTEL+DAVFVGC  NHAV+DGTSFWNFFNT+AE+
Sbjct  120   SVYRRFFQYDSTLSYAGHDRPLVAVQVTELNDAVFVGCAANHAVMDGTSFWNFFNTFAEM  179

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
               GAKKISR PDF RDTVF+SPAVL FP GGP+ATFSGDEP+REKIFHF+REAI+K+KFR
Sbjct  180   ASGAKKISRSPDFSRDTVFDSPAVLAFPEGGPSATFSGDEPLREKIFHFSREAIMKLKFR  239

Query  854   ANN-------------GKLCNGE---NGKLNGKITPVNHEPGLQNGGAASEISSFQSLSA  723
             ANN             GK  N     N K NGKITPVN E  L      +EISSFQSLSA
Sbjct  240   ANNAAQKPEFGVPEILGKQSNDSWAVNCKTNGKITPVNDESTLVKKNPTAEISSFQSLSA  299

Query  722   QLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDL  543
              LWR VTRAR L+A+KTTTFRMA+NCRHRLEPRL+PLYFGN IQSIPTVA AGELLS+DL
Sbjct  300   HLWRCVTRARNLDANKTTTFRMAVNCRHRLEPRLEPLYFGNLIQSIPTVATAGELLSNDL  359

Query  542   SWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGW  363
             SW A+ LH+NVVAH D TVRRG+++WE+NPRLFPLGNFDGAM+TMGSSPRFPMYDNDFGW
Sbjct  360   SWGADRLHQNVVAHGDGTVRRGVKEWESNPRLFPLGNFDGAMMTMGSSPRFPMYDNDFGW  419

Query  362   GRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GRPLAVRSG ANKFDGKISAFPG EGNGSVDLEVVLAP+TMA LEND E+MQ+VS
Sbjct  420   GRPLAVRSGGANKFDGKISAFPGPEGNGSVDLEVVLAPDTMAVLENDFEFMQFVS  474



>ref|XP_006480972.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=472

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/474 (71%), Positives = 377/474 (80%), Gaps = 18/474 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  +ISKCTV P+ + S  K L+LSVSDLPMLSCQYIQKGVLL+ PP      +SL
Sbjct  1     MPSSSTTIISKCTVRPD-QKSRIKPLRLSVSDLPMLSCQYIQKGVLLTAPPFSITHFVSL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             L+ SLS AL+HFPALAGR  TD+ GH+ IL ND G++F+HAKA  LS  +LL    D+P 
Sbjct  60    LRQSLSVALSHFPALAGRFSTDSDGHISILCNDTGVDFIHAKATFLSVNSLLSPI-DVPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY GH +PL A+QVTEL+D VFVGCT+NHAV DGTSFW+FFNT+AEI 
Sbjct  119   SFKEFFAFDRTISYTGHVRPLAAVQVTELADGVFVGCTVNHAVTDGTSFWHFFNTFAEIT  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKIS+VPDF RDTVF+SPAVLKFPAGGPA TFSG  P+RE+IFHF+REAIL+MKFRA
Sbjct  179   KGAKKISKVPDFSRDTVFDSPAVLKFPAGGPAVTFSGAVPLRERIFHFSREAILRMKFRA  238

Query  851   NNG----------------KLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQ  720
             N G                K  N     +NG+IT +       N     EISSFQSL AQ
Sbjct  239   NKGILKSDYYKSVNNEIIGKQSNDSWKTVNGEITSLFETLLKTNANRTDEISSFQSLCAQ  298

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRARKLE+ KTTTFRMA+NCRHRLEPRL P YFGN IQSIPTVA  GELLSHDL 
Sbjct  299   LWRSVTRARKLESGKTTTFRMAVNCRHRLEPRLSPYYFGNLIQSIPTVASVGELLSHDLG  358

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W AE LH+NVVAHD+ TVRRG+ DWE+NPRLFPLGNFDGA ITMGSSPRFPMYDNDFGWG
Sbjct  359   WGAERLHKNVVAHDNETVRRGVADWESNPRLFPLGNFDGASITMGSSPRFPMYDNDFGWG  418

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             RPLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEND+E+M+YVS
Sbjct  419   RPLAVRSGRANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDLEFMEYVS  472



>ref|XP_006429311.1| hypothetical protein CICLE_v10011647mg [Citrus clementina]
 gb|ESR42551.1| hypothetical protein CICLE_v10011647mg [Citrus clementina]
Length=472

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/474 (70%), Positives = 376/474 (79%), Gaps = 18/474 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  +ISKCTV P+ + S  K L+LSVSDLPMLSCQYIQKGVLL+ PP      +SL
Sbjct  1     MPSSSTTIISKCTVRPD-QKSRIKPLRLSVSDLPMLSCQYIQKGVLLTAPPFSITHFVSL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             L+ SLS AL+HFPALAGR  TD+ GH+ IL ND G++F+HAKA  LS  +LL    D+P 
Sbjct  60    LRQSLSVALSHFPALAGRFSTDSDGHISILCNDTGVDFIHAKATFLSVNSLLSPI-DVPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY GH +PL A+QVTEL+D VFVGCT+NHAV DGTSFW+FFNT+AEI 
Sbjct  119   SFKEFFAFDRTISYTGHVRPLAAVQVTELADGVFVGCTVNHAVTDGTSFWHFFNTFAEIT  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKIS+VPDF RDTVF+SPAVLKFPAGGPA TFSG  P+RE+IFHF+REAIL+MKFRA
Sbjct  179   KGAKKISKVPDFSRDTVFDSPAVLKFPAGGPAVTFSGAVPLRERIFHFSREAILRMKFRA  238

Query  851   NNG----------------KLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQ  720
             N G                K  N     +NG+IT +       N     EISSFQSL AQ
Sbjct  239   NKGILKSNYYKSVNNEIIGKQSNDSWKTVNGEITSLFETLLKTNANRTDEISSFQSLCAQ  298

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRARKL + KTTTFRMA+NCRHRLEPRL P YFGN IQSIPTVA  GELLSHDL 
Sbjct  299   LWRSVTRARKLASGKTTTFRMAVNCRHRLEPRLSPYYFGNLIQSIPTVASVGELLSHDLG  358

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W AE LH+NVVAHD+ TVRRG+ DWE+NPRLFPLGNFDGA ITMGSSPRFPMYDNDFGWG
Sbjct  359   WGAERLHKNVVAHDNETVRRGVADWESNPRLFPLGNFDGASITMGSSPRFPMYDNDFGWG  418

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             RPLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEND+E+M+YVS
Sbjct  419   RPLAVRSGRANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDLEFMEYVS  472



>ref|XP_008239572.1| PREDICTED: BAHD acyltransferase DCR [Prunus mume]
Length=471

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/465 (72%), Positives = 379/465 (82%), Gaps = 12/465 (3%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             SS+ +ISKCTVYP    S  KSLKLSVSDLPMLSCQYIQKGVLL+ PP   A LI+ LK 
Sbjct  6     SSVTIISKCTVYPN-TKSTIKSLKLSVSDLPMLSCQYIQKGVLLNSPPFHIADLIASLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS AL+HFPALAGRL TDA+G+V+I+ ND G++F+ AKA HLS   LL +  D+P  FR
Sbjct  65    SLSLALSHFPALAGRLETDAEGYVHIICNDAGVDFIQAKAKHLSVDVLLLADEDVPHYFR  124

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF +D TLSY+GHS+PL AIQVTEL+D +F+GCT+NH+V DGTSFW+FFNT+AEICKGA
Sbjct  125   EFFAFDRTLSYSGHSRPLAAIQVTELADGIFIGCTVNHSVTDGTSFWHFFNTFAEICKGA  184

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             KKIS+ PDF RD +FNSPAVL+ P GGP  TFSG+EP+RE+IFHFTRE+ILK+K RANN 
Sbjct  185   KKISKSPDFSRDNIFNSPAVLQLPEGGPKLTFSGNEPLRERIFHFTRESILKLKNRANNS  244

Query  842   KLCNGENGKLNGKITPVNHEPGLQN----------GGAASEISSFQSLSAQLWRSVTRAR  693
              L NG NG  NG +          N          G   +EISSFQSLSAQLWRSVTR R
Sbjct  245   PLING-NGNCNGLLESAEIFGKQCNDTWKIVSRCKGAKTAEISSFQSLSAQLWRSVTRVR  303

Query  692   KLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRN  513
              L  SKTTTFRMA+NCRHRLEP+L P YFGNAIQSIPTVA AGELLS DLSW A +L +N
Sbjct  304   NLPDSKTTTFRMAVNCRHRLEPKLSPHYFGNAIQSIPTVASAGELLSRDLSWCAGLLRKN  363

Query  512   VVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM  333
             V AHD+ATVRRG++DWE+ PRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSG 
Sbjct  364   VAAHDNATVRRGVEDWESAPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGR  423

Query  332   ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             ANKFDGKISAFPGREGNGSVDLEVVLAPET+AGLE+DME+MQYVS
Sbjct  424   ANKFDGKISAFPGREGNGSVDLEVVLAPETLAGLESDMEFMQYVS  468



>ref|XP_011019146.1| PREDICTED: BAHD acyltransferase DCR [Populus euphratica]
Length=470

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/475 (69%), Positives = 379/475 (80%), Gaps = 21/475 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSS+  ++S+CT+YP+ KS+  ++L+LSVSDLPMLSCQYIQKGVLL  PP     LI+ 
Sbjct  1     MPSSNTTIVSRCTIYPDQKSTTIETLQLSVSDLPMLSCQYIQKGVLLPYPPYSIDDLITF  60

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL+HFPALAGRL TD  GHV+I+ ND G++F+ AKA HLS   +L    D+P 
Sbjct  61    LKHSLSVALSHFPALAGRLQTDPSGHVHIVCNDAGVDFIQAKARHLSIHTILSPT-DVPE  119

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D TLSY+GHSKPLMA+QVTEL D +F+GC++NHAV DGTSFW+FFNT+AEIC
Sbjct  120   CFKGFFAFDKTLSYSGHSKPLMAVQVTELQDGIFIGCSVNHAVTDGTSFWHFFNTFAEIC  179

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KG+KKIS  PDF R+T+FNSPAVLKFPAGGP  TFSGDEP+RE++FHF REAILK+KFRA
Sbjct  180   KGSKKISNSPDFSRNTLFNSPAVLKFPAGGPKVTFSGDEPLRERVFHFRREAILKLKFRA  239

Query  851   NNGKL-CN--------------GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQL  717
             NN  L CN                NG+ NGK+  +            +EISSFQSL AQL
Sbjct  240   NNSDLICNSAEIFGKQRNDSWKAANGESNGKVATL-----FLVKDKTAEISSFQSLCAQL  294

Query  716   WRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSW  537
             WRSVTRARKL  S  TTFRMA+NCRHRLEP+L+P YFGNAIQSIPT A AGELLS DLS+
Sbjct  295   WRSVTRARKLMPSNMTTFRMAVNCRHRLEPQLEPYYFGNAIQSIPTTASAGELLSKDLSF  354

Query  536   AAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
              AE+LHRNVVAHDD TVR+GI DWE  PRLFPLGNFDGA ITMGSSPRFPMYDNDFGWGR
Sbjct  355   GAELLHRNVVAHDDGTVRKGISDWEKEPRLFPLGNFDGASITMGSSPRFPMYDNDFGWGR  414

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*I  192
             PLAVRSG ANKFDGKISAFPGR+GNGSVDLEVVL+P+TM GLEND E+MQYVS I
Sbjct  415   PLAVRSGRANKFDGKISAFPGRDGNGSVDLEVVLSPDTMTGLENDDEFMQYVSEI  469



>emb|CDP06509.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/471 (73%), Positives = 393/471 (83%), Gaps = 21/471 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MP++++ V+SKCTVYPE KS+   SLKLSVSDLPMLSCQYIQKGVLLSQPPLDAA+L+SL
Sbjct  1     MPTTAVHVVSKCTVYPESKSALFPSLKLSVSDLPMLSCQYIQKGVLLSQPPLDAASLLSL  60

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaal----lpshA  1224
             LKLSLSKAL+HFP LAGRLHTD  GHV+IL ND G++FVHAKA HLS   L         
Sbjct  61    LKLSLSKALSHFPPLAGRLHTDPHGHVHILCNDAGVDFVHAKALHLSLPTLVPSDQLHLH  120

Query  1223  DIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTY  1044
             DIP  FR FFQ+D TLSYAGH KPL+A+QVTEL+  +F+GCTMNHAVVDGTSFWNFFNT+
Sbjct  121   DIPPCFRKFFQFDHTLSYAGHHKPLLAVQVTELNGGLFIGCTMNHAVVDGTSFWNFFNTF  180

Query  1043  AEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKM  864
             AE C+GAK+IS+ P+F R+TVF SPAVL+ PAGGP+ATFSGDEP REKIFHF+REA+L++
Sbjct  181   AEACRGAKRISKSPNFCRETVFTSPAVLQLPAGGPSATFSGDEPSREKIFHFSREAVLQL  240

Query  863   KFRANNGKLC--------NGENG-KLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWR  711
             K R N  K C        +GE G + NGK+T  + +P      A  EISSFQSL AQLWR
Sbjct  241   KLRTN--KTCKMGSWVAGDGEKGGRTNGKVTRKSLKP------ATDEISSFQSLCAQLWR  292

Query  710   SVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAA  531
             SVTRAR L+ ++ TTFRMA+NCRHRLEPR+ PLYFGN IQSIPTVA   ELL +DLSW A
Sbjct  293   SVTRARNLDGNRRTTFRMAVNCRHRLEPRVDPLYFGNLIQSIPTVACVEELLGNDLSWGA  352

Query  530   EMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPL  351
             + LHRNV+AHDD+TVRRG+++WE+NPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRP+
Sbjct  353   DRLHRNVLAHDDSTVRRGVEEWESNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPI  412

Query  350   AVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             AVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMA LE D+E+MQYVS
Sbjct  413   AVRSGRANKFDGKISAFPGREGNGSVDLEVVLAPETMAALEKDVEFMQYVS  463



>ref|XP_011094979.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280 [Sesamum indicum]
Length=472

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/478 (73%), Positives = 388/478 (81%), Gaps = 26/478 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+V++SKCT+YPE+KS+            PMLSCQYIQKGVLL  PPL +  LISL
Sbjct  1     MPSSSLVIVSKCTIYPEHKSAVKSLKLSVSDL-PMLSCQYIQKGVLLPLPPLSSPDLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
             LKLSLS+ L+HFP L+GRLHTD+ GHV+I+ ND G++F HAKAPHLS +ALLP S  DIP
Sbjct  60    LKLSLSRTLSHFPPLSGRLHTDSDGHVHIICNDLGVDFFHAKAPHLSTSALLPPSDRDIP  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +R FFQ+DSTLSYAGH KPL A+QVTEL+DAVFVGCT+NHAVVDGTSFWNFFNT+AE+
Sbjct  120   PVYRKFFQFDSTLSYAGHDKPLAAVQVTELNDAVFVGCTVNHAVVDGTSFWNFFNTFAEM  179

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
              +GAKKIS+ PDF R+TVFNS AVL  PAGGP+ TFSGDEP+REKIFHF+REAI+K+KFR
Sbjct  180   ARGAKKISKSPDFCRETVFNSSAVLALPAGGPSVTFSGDEPVREKIFHFSREAIMKLKFR  239

Query  854   ANN---------------GKLCNGE---NGKLNGKITPVNHEPGLQNGGAASEISSFQSL  729
             ANN               GK  N     N K NGKIT V     L     A+EISSFQSL
Sbjct  240   ANNPTGKVEPEFSDPEILGKQSNDTWAVNSKSNGKITTV-----LLKKNPAAEISSFQSL  294

Query  728   SAQLWRSVTRARKLEASKTTTFRMAINCRHRL-EPRLKPLYFGNAIQSIPTVAKAGELLS  552
              A LWRSVTRAR L A KTTTFRMA+NCRHRL EPRL+PLYFGNAIQSIPT A  GELLS
Sbjct  295   CAHLWRSVTRARNLNAKKTTTFRMAVNCRHRLAEPRLQPLYFGNAIQSIPTTAAVGELLS  354

Query  551   HDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDND  372
              DL WAA+ LHRNVVAHD+ATV R +++WE+NPRLFPLGNFDGAMITMGSSPRFPMYDND
Sbjct  355   KDLGWAADQLHRNVVAHDNATVLRCVKEWESNPRLFPLGNFDGAMITMGSSPRFPMYDND  414

Query  371   FGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FGWGRPLAVRSGMANKFDGKISAFPG EGNGSVDLEVVLAPETMAGLEND E+MQYVS
Sbjct  415   FGWGRPLAVRSGMANKFDGKISAFPGPEGNGSVDLEVVLAPETMAGLENDTEFMQYVS  472



>ref|XP_002308212.1| transferase family protein [Populus trichocarpa]
 gb|EEE91735.1| transferase family protein [Populus trichocarpa]
Length=476

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/475 (69%), Positives = 379/475 (80%), Gaps = 21/475 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSS+  ++S+CT++P+ KS+  ++LKLSVSDLPMLSCQYIQKGVLL  PP     LI+ 
Sbjct  1     MPSSNTTIVSRCTIHPDQKSTTIETLKLSVSDLPMLSCQYIQKGVLLPYPPYSIDDLITF  60

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL+HFPALAGRL TD  GH++I+ ND G++F+ AKA HLS   +L    D+P 
Sbjct  61    LKHSLSTALSHFPALAGRLQTDPTGHIHIVCNDAGVDFIQAKARHLSIHTILSPT-DVPE  119

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D TLSY+GHSKPLMA+QVTEL D +F+GC++NHAV DGTSFW+FFNT+AEIC
Sbjct  120   CFKGFFAFDKTLSYSGHSKPLMAVQVTELQDGIFIGCSVNHAVTDGTSFWHFFNTFAEIC  179

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KG+KKIS  PDF R+T+FNSPAVLKFPAGGP  TFSGDEP+RE++FHF REAILK+KFRA
Sbjct  180   KGSKKISNSPDFSRNTLFNSPAVLKFPAGGPKVTFSGDEPLRERVFHFRREAILKLKFRA  239

Query  851   NNGKL-CN--------------GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQL  717
             NN  L CN                NG+ NGK+ P+         G  +EISSFQSL AQL
Sbjct  240   NNSDLICNSAEIFGKQRNDSWKAANGESNGKVAPL-----FLMKGKTAEISSFQSLCAQL  294

Query  716   WRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSW  537
             WRSVTRARKL  SK TTFRMA+NCRHRLEPRL+P YFGNAIQSIPT A AGELLS DLS+
Sbjct  295   WRSVTRARKLMPSKMTTFRMAVNCRHRLEPRLEPYYFGNAIQSIPTAASAGELLSKDLSF  354

Query  536   AAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
              AE+LHRNVVAH D TVR+GI DWE  PRLFPLGNFDGA ITMGSSPRFPMYDNDFGWGR
Sbjct  355   GAELLHRNVVAHGDGTVRKGISDWEKEPRLFPLGNFDGASITMGSSPRFPMYDNDFGWGR  414

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*I  192
             PLAVRSG ANKFDGKISAFPG +G GSVDLEVVL+P+TM GLEND E+MQYVS I
Sbjct  415   PLAVRSGRANKFDGKISAFPGGDGKGSVDLEVVLSPDTMIGLENDGEFMQYVSEI  469



>ref|XP_007205148.1| hypothetical protein PRUPE_ppa005318mg [Prunus persica]
 gb|EMJ06347.1| hypothetical protein PRUPE_ppa005318mg [Prunus persica]
Length=467

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/460 (72%), Positives = 380/460 (83%), Gaps = 6/460 (1%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             SS+ +ISKC +YP    S  KSLKLSVSDLPMLSCQYIQKGVLLS  P   + LI+ LK 
Sbjct  6     SSVTIISKCVIYPN-TKSTIKSLKLSVSDLPMLSCQYIQKGVLLSSQPFHISDLIASLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS AL+HFPALAGR  TDA+G+V+I+ ND G++F+ AKA HLS   LLP++ D+P  FR
Sbjct  65    SLSLALSHFPALAGRFETDAQGYVHIVCNDAGVDFIQAKAKHLSVDVLLPANEDVPHYFR  124

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF +D TLSY+GHS+PL AIQVTEL+D +F+GCT+NH+V DGTSFW+FFNT+AEICKGA
Sbjct  125   EFFAFDRTLSYSGHSRPLAAIQVTELADGIFIGCTVNHSVTDGTSFWHFFNTFAEICKGA  184

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             KKIS+ PDF RD +FNSPAVL+ P GGP  TFSG+EP+RE+IFHFTRE+ILK+K RANN 
Sbjct  185   KKISKSPDFSRDNIFNSPAVLQLPEGGPKVTFSGNEPLRERIFHFTRESILKLKNRANNS  244

Query  842   KLCNG----ENGKLNGKITPVNHEPGLQNGGA-ASEISSFQSLSAQLWRSVTRARKLEAS  678
              L NG    E+ ++ GK      +   +  GA  +EISSFQSLSAQLWRSVTR R L  S
Sbjct  245   PLINGNGLLESAEIFGKQCNDTWKIVSRCKGAKTAEISSFQSLSAQLWRSVTRVRNLPDS  304

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
             KTTTFRMA+NCRHRLEP+L P YFGNAIQSIPTVA AGELLS DLSW A +L +NV AHD
Sbjct  305   KTTTFRMAVNCRHRLEPKLSPHYFGNAIQSIPTVASAGELLSRDLSWCAGLLRKNVAAHD  364

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFD  318
             +ATVRRG++DWE+ PRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSG ANKFD
Sbjct  365   NATVRRGVEDWESAPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGRANKFD  424

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GKISAFPGREGNGSVDLEVVLAPETMAGLE+D E+MQYVS
Sbjct  425   GKISAFPGREGNGSVDLEVVLAPETMAGLESDTEFMQYVS  464



>gb|AGT37414.1| anthocyanin 5-aromatic acyltransferase [Vaccinium dunalianum]
Length=451

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/464 (70%), Positives = 383/464 (83%), Gaps = 19/464 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+ +ISKCT+ P+ KS+  K+LKLSVSDLPMLSCQYIQKGVLLSQPPL   +L+S+
Sbjct  1     MPSSSVSIISKCTISPDQKSTIKKALKLSVSDLPMLSCQYIQKGVLLSQPPLPVDSLVSI  60

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK+SLSK L+HFPALAG L TD  GHV+IL ND G+EFVHA+A HL    +L    D+  
Sbjct  61    LKISLSKTLSHFPALAGCLITDPAGHVHILCNDSGVEFVHARAKHLFVDDILSPL-DVLI  119

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              FR FF +D+TLSY+GH  PL A+Q TE+ D +F+G T+NHAV DGTSFWNFFNT+AEI 
Sbjct  120   CFREFFAFDNTLSYSGHHTPLAAVQATEIGDGIFIGLTVNHAVTDGTSFWNFFNTFAEIT  179

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KG+KKIS+ PDF RDTVFNSPA+L+FP GGP+ATFSGDEP+RE+IFHFTRE+ILK+K +A
Sbjct  180   KGSKKISKSPDFRRDTVFNSPAILRFPKGGPSATFSGDEPLRERIFHFTRESILKLKLKA  239

Query  851   NNGKLCNG-ENGKLN-----GKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK  690
             N   + NG  +GK+      GKI P +            EISSFQSL AQLWRSVTRAR 
Sbjct  240   NQKLITNGVTDGKITELFKTGKINPTD------------EISSFQSLCAQLWRSVTRARN  287

Query  689   LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNV  510
             LE +K TTFRMA+NCRHRLEPRL+PLYFGNAIQSIPTVA  G++LS+DL W+A++LH+NV
Sbjct  288   LEKTKPTTFRMAVNCRHRLEPRLEPLYFGNAIQSIPTVALVGDVLSNDLHWSADLLHQNV  347

Query  509   VAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMA  330
             VAHDDATVRRG++DWE+NPRLFPLGN DGA ITMGSSPRFPMYDNDFGWGRP+AVRSG A
Sbjct  348   VAHDDATVRRGVKDWESNPRLFPLGNPDGASITMGSSPRFPMYDNDFGWGRPVAVRSGKA  407

Query  329   NKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NKFDGKISAFPGREG GSVDLEVVLAP TMAG+E D+E+MQYVS
Sbjct  408   NKFDGKISAFPGREGCGSVDLEVVLAPATMAGVETDVEFMQYVS  451



>gb|KDP24482.1| hypothetical protein JCGZ_25046 [Jatropha curcas]
Length=460

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/458 (69%), Positives = 360/458 (79%), Gaps = 1/458 (0%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  +ISKCT+YP++KSS            PMLSCQYIQKGVLLS PP      I+ 
Sbjct  1     MPSSSTTIISKCTIYPDHKSSIKTLKLSVSDL-PMLSCQYIQKGVLLSYPPYSVDDFITS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS ALA FPALAGRL TD  GHV+I+ ND G++F+ AKA HL    L+  H D+P 
Sbjct  60    LKRSLSTALAFFPALAGRLSTDPDGHVHIVCNDAGVDFIQAKARHLFIDDLISPHLDVPD  119

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF  D  LSY+GHSKPL AIQVTEL+D VFVGCT+NHAV DGTSFW+FFNT+AEIC
Sbjct  120   CVKGFFTLDRMLSYSGHSKPLAAIQVTELADGVFVGCTVNHAVTDGTSFWHFFNTFAEIC  179

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKI++ PDF RDTVFNSPAVLKFPAGGP  TFSGDEP+RE+IF F+REAILK+K RA
Sbjct  180   KGAKKITKSPDFCRDTVFNSPAVLKFPAGGPKVTFSGDEPLRERIFRFSREAILKLKSRA  239

Query  851   NNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKT  672
             NNG        + N     V+ +        A+EISSFQSL AQLWRSVTRAR L  +KT
Sbjct  240   NNGNFLEILGRQCNDSWKVVDGDTNSFLKNKAAEISSFQSLCAQLWRSVTRARNLSPTKT  299

Query  671   TTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDA  492
             TTFRMA+NCRHRL+P+L P YFGNAIQSIPT+A  GELLS DL W A++LH+NVVAHDD 
Sbjct  300   TTFRMAVNCRHRLDPKLHPYYFGNAIQSIPTLATIGELLSRDLHWGADLLHKNVVAHDDN  359

Query  491   TVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGK  312
             TVR+GI +WE+ PRLFPLGNFDGA ITMGSSPRFPMYDNDFGWGRPLA+RSG ANKFDGK
Sbjct  360   TVRKGIANWESEPRLFPLGNFDGASITMGSSPRFPMYDNDFGWGRPLAIRSGRANKFDGK  419

Query  311   ISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             ISAFPGREGNGSVDLEVVLAPETM GL +D E+MQYVS
Sbjct  420   ISAFPGREGNGSVDLEVVLAPETMDGLLSDGEFMQYVS  457



>ref|XP_010101800.1| BAHD acyltransferase DCR [Morus notabilis]
 gb|EXB89937.1| BAHD acyltransferase DCR [Morus notabilis]
Length=465

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/463 (68%), Positives = 374/463 (81%), Gaps = 2/463 (0%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSSI+++SKCT+ PE ++S  KSLKLSVSDLPMLSCQYIQKGVL + PP     LI+ 
Sbjct  1     MPSSSIILVSKCTIVPE-QNSTIKSLKLSVSDLPMLSCQYIQKGVLFNSPPYSINDLINS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             +K SL+ AL HFPALAGRL TD  GHV+I+ ND G++F+ AKA HLS   +LP   D+P 
Sbjct  60    IKQSLAVALVHFPALAGRLVTDDDGHVHIVCNDAGVDFIFAKAKHLSVDGILPPDDDVPD  119

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY GH KPLMA+QVTEL+D VF+GCT+NHAV DGTSFW+FFNT+AEIC
Sbjct  120   CFKEFFAFDRTVSYTGHFKPLMAVQVTELADGVFIGCTVNHAVTDGTSFWHFFNTFAEIC  179

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKIS+ PDF RDT+FNSPAVL+FPA GP  TFSGDE +RE+IFHF+REAI ++K RA
Sbjct  180   KGAKKISKTPDFSRDTIFNSPAVLRFPASGPKVTFSGDESLRERIFHFSREAIQRLKLRA  239

Query  851   NNGKLCNGENGKLNGKITPVNHEP-GLQNGGAASEISSFQSLSAQLWRSVTRARKLEASK  675
             NNG +        NG + P + E  G +     + IS+FQSL AQLWRSVTRAR LE +K
Sbjct  240   NNGSIVRTSKATRNGFVNPDSAEIYGKRLNDRTAAISAFQSLCAQLWRSVTRARNLEGTK  299

Query  674   TTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDD  495
             TTTFRMA+NCRHR+ P ++  YFGNAIQSIPT + A ELL++DL W A++LHRNVVAHDD
Sbjct  300   TTTFRMAVNCRHRVRPPMESHYFGNAIQSIPTFSAASELLANDLGWCADLLHRNVVAHDD  359

Query  494   ATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDG  315
             ATVRRG++DW   PRLFPLGNFDGA ITMGSSPRFPMY+NDFGWG+P+AVRSG ANKFDG
Sbjct  360   ATVRRGVEDWARQPRLFPLGNFDGASITMGSSPRFPMYNNDFGWGKPMAVRSGRANKFDG  419

Query  314   KISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQF  186
             KISAFPGREGNGSVDLEVVLAP TMAGLE D E+MQYVS + F
Sbjct  420   KISAFPGREGNGSVDLEVVLAPTTMAGLEADEEFMQYVSAVDF  462



>ref|XP_002322965.1| transferase family protein [Populus trichocarpa]
 gb|EEF04726.1| transferase family protein [Populus trichocarpa]
Length=478

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/483 (69%), Positives = 381/483 (79%), Gaps = 29/483 (6%)
 Frame = -3

Query  1571  MPSSS-IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MPSSS   ++S+CT+YP+ KSS  K+LKLSVSDLPMLSCQYIQKGVLL+ PP     LI+
Sbjct  1     MPSSSNTTIVSRCTIYPDQKSSTIKALKLSVSDLPMLSCQYIQKGVLLTYPPYSINDLIT  60

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP  1215
              LK SLS AL+HFPALAGRL TD  GHV+I+ ND G++F+ AKA HLS   +L     +P
Sbjct  61    FLKHSLSVALSHFPALAGRLQTDPTGHVHIVCNDAGVDFIQAKARHLSIHTILSPTH-VP  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               F+ FF  D TLSY+GHSKPL+A+QVTEL D +F+GCT+NHAV DGTSFWNFFNT+AEI
Sbjct  120   ECFKGFFAMDKTLSYSGHSKPLVAVQVTELKDGIFIGCTVNHAVTDGTSFWNFFNTFAEI  179

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             CKG+KKIS+ PDF R+T+ NSPAVLKFP GGP  TFSGDEP+RE+IFHF+R+AILK+K R
Sbjct  180   CKGSKKISKSPDFSRNTMLNSPAVLKFPPGGPKVTFSGDEPLRERIFHFSRDAILKLKLR  239

Query  854   ANNG------------------KLCNGE----NGKLNGKITPVNHEPGLQNGGAASEISS  741
             ANN                   K+ NGE    NG  NG++ P+     L+N   A EISS
Sbjct  240   ANNSNFRSNSAEIFGKQSNDSWKIVNGESNGNNGLSNGEVDPL----FLKNNETA-EISS  294

Query  740   FQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGE  561
             FQSL AQLWRSVTRARKL  SK TTFRMA+NCRHRLEPRL P YFGNAIQSIPTVA AG+
Sbjct  295   FQSLCAQLWRSVTRARKLSPSKMTTFRMAVNCRHRLEPRLDPYYFGNAIQSIPTVALAGK  354

Query  560   LLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMY  381
             LLS DLS+ A++LH+NVVAH D TVR+GI +WE  PRLFPLGN DGA ITMGSSPRFPMY
Sbjct  355   LLSKDLSFGADLLHKNVVAHVDGTVRKGIANWEKEPRLFPLGNLDGASITMGSSPRFPMY  414

Query  380   DNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
             DNDFGWGRPLAVRSG ANKFDGKISAFPGR+GNGSVDLEVVL+P+TM GLEND E+MQYV
Sbjct  415   DNDFGWGRPLAVRSGRANKFDGKISAFPGRDGNGSVDLEVVLSPDTMTGLENDDEFMQYV  474

Query  200   S*I  192
             S I
Sbjct  475   SEI  477



>emb|CAN62119.1| hypothetical protein VITISV_037024 [Vitis vinifera]
Length=494

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/495 (66%), Positives = 374/495 (76%), Gaps = 41/495 (8%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+ ++SKCTVYPE+KS+            PMLSCQYIQKGVL ++PPL   +LISL
Sbjct  1     MPSSSVTLVSKCTVYPEHKSTIKSLKLSVSDL-PMLSCQYIQKGVLHTRPPLPIDSLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL HFP LAGR  TDA GHV+I+ ND G+EF+HAKA H     LL    D+  
Sbjct  60    LKQSLSTALTHFPPLAGRFETDADGHVHIICNDAGVEFIHAKAKHFLIRDLLSPV-DVHN  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D  LSYAGH KPL A+Q+TEL+D +F+GCT+NH+V DGTSFW+FFNT+AE+ 
Sbjct  119   CFKQFFAFDGLLSYAGHFKPLAAVQITELADGLFIGCTVNHSVTDGTSFWHFFNTFAEMT  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKISR PDF RD VFNSP VL+ P GGP  TFSGDEP+RE+IF F REAILK+K+RA
Sbjct  179   KGAKKISRSPDFNRDNVFNSPVVLRVPEGGPRLTFSGDEPLRERIFRFHREAILKLKYRA  238

Query  851   NNG------------------------KLCNGENGKLNGKIT-------------PVNHE  783
             NN                         K  NGENG  NGK T             P++ E
Sbjct  239   NNQXQKSTNGQVLDMGEILGKRSNDSWKTINGENGMDNGKKTSVLGKLLKNNVSKPLDSE  298

Query  782   PGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFG  603
              G+ N  A  EISSFQSLSAQLWRSVTRARKL +S+TTTFRMA+NCRHRLEP+L+  YFG
Sbjct  299   TGIPNSTA--EISSFQSLSAQLWRSVTRARKLPSSRTTTFRMAVNCRHRLEPKLEAHYFG  356

Query  602   NAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDG  423
             NAIQSIPTVA  GELLS DL W A++LH+NVVAHDDATV+RG++DWE+NPR FPLGNFDG
Sbjct  357   NAIQSIPTVASVGELLSRDLRWCADLLHKNVVAHDDATVQRGVRDWESNPRCFPLGNFDG  416

Query  422   AMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPET  243
             AMITMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGR+G G+VDLEV LAPET
Sbjct  417   AMITMGSSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAFPGRDGAGTVDLEVCLAPET  476

Query  242   MAGLENDMEYMQYVS  198
             MAGLE+D E+MQYVS
Sbjct  477   MAGLESDPEFMQYVS  491



>ref|XP_002278801.2| PREDICTED: BAHD acyltransferase DCR [Vitis vinifera]
Length=494

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/495 (66%), Positives = 374/495 (76%), Gaps = 41/495 (8%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+ ++SKCTVYPE+KS+            PMLSCQYIQKGVL ++PPL   +LISL
Sbjct  1     MPSSSVTLVSKCTVYPEHKSTIKSLKLSVSDL-PMLSCQYIQKGVLHTRPPLPIDSLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL HFP LAGR  TDA GHV+I+ ND G+EF+HAKA H     LL    D+  
Sbjct  60    LKQSLSTALTHFPPLAGRFETDADGHVHIICNDAGVEFIHAKAKHFLIRDLLSPV-DVHN  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D  LSYAGH KPL A+Q+TEL+D +F+GCT+NH+V DGTSFW+FFNT+AE+ 
Sbjct  119   CFKQFFAFDGLLSYAGHFKPLAAVQITELADGLFIGCTVNHSVTDGTSFWHFFNTFAEMT  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKISR PDF RD VFNSP VL+ P GGP  TFSGDEP+RE+IF F REAILK+K+RA
Sbjct  179   KGAKKISRSPDFNRDNVFNSPVVLRVPEGGPRLTFSGDEPLRERIFRFHREAILKLKYRA  238

Query  851   NNG------------------------KLCNGENGKLNGKIT-------------PVNHE  783
             NN                         K  NGENG  NGK T             P++ E
Sbjct  239   NNQIQKSTNGQVLDMGEILGKRSNDSWKTINGENGMDNGKKTSVLGKLLKNNVSKPLDSE  298

Query  782   PGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFG  603
              G+ N  A  EISSFQSLSAQLWRSVTRARKL +S+TTTFRMA+NCRHRLEP+L+  YFG
Sbjct  299   TGIPNSTA--EISSFQSLSAQLWRSVTRARKLPSSRTTTFRMAVNCRHRLEPKLEAHYFG  356

Query  602   NAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDG  423
             NAIQSIPTVA  GELLS DL W A++LH+NVVAHDDATV+RG++DWE+NPR FPLGNFDG
Sbjct  357   NAIQSIPTVASVGELLSRDLRWCADLLHKNVVAHDDATVQRGVRDWESNPRCFPLGNFDG  416

Query  422   AMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPET  243
             AMITMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGR+G G+VDLEV LAPET
Sbjct  417   AMITMGSSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAFPGRDGAGTVDLEVCLAPET  476

Query  242   MAGLENDMEYMQYVS  198
             MAGLE+D E+MQYVS
Sbjct  477   MAGLESDPEFMQYVS  491



>ref|XP_002531355.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
 gb|EEF31039.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
Length=468

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/467 (69%), Positives = 367/467 (79%), Gaps = 9/467 (2%)
 Frame = -3

Query  1571  MPSSS-IVVISKCTVYPEYkssnsks-lklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPSSS   ++SKCT+YP++    S   L+LSVSDLPMLSCQYIQKGVLLS PP     LI
Sbjct  1     MPSSSATTIVSKCTIYPDHPQEPSVKPLRLSVSDLPMLSCQYIQKGVLLSYPPYSFDDLI  60

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             + LK SLS AL+ FPALAGRL TD  GHV I+ N  GI+F+HAKA H  +  +L    D+
Sbjct  61    TFLKRSLSTALSFFPALAGRLETDPHGHVNIVCNSAGIDFIHAKARHAFSNNILSPLHDV  120

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF +D TLSY+GHSKPL+A+QVTEL+D+VF+GCT+NHAV DGTSFW+FFNT+AE
Sbjct  121   PDYVKGFFAFDKTLSYSGHSKPLIAVQVTELADSVFIGCTVNHAVTDGTSFWHFFNTFAE  180

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             I KGAKKIS+ PDF R+ VFNSPAVLKFPAGGP  TFS D+P+RE+IFHFTREAILK+K+
Sbjct  181   INKGAKKISKSPDFSRNNVFNSPAVLKFPAGGPKVTFSDDQPLRERIFHFTREAILKLKY  240

Query  857   RANNGKLCNGENGKLNGKITPVN-------HEPGLQNGGAASEISSFQSLSAQLWRSVTR  699
             RAN+G L      ++N     VN       H          +EISSFQSL AQLW+SVTR
Sbjct  241   RANHGNLVELLGKQINDSWKVVNNGESILKHNNNNNINNKTAEISSFQSLCAQLWKSVTR  300

Query  698   ARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLH  519
             AR L   KTTTFRMA+NCRHRLEPRL P YFGNAIQSIPTV+  GELLS DL+W A++LH
Sbjct  301   ARNLSPLKTTTFRMAVNCRHRLEPRLDPYYFGNAIQSIPTVSPIGELLSRDLNWVADLLH  360

Query  518   RNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRS  339
             +NVVAHDD TVR+GI DWE  PRLFPLGNFDGA ITMGSSPRFPMYDNDFGWGRPLA+RS
Sbjct  361   QNVVAHDDTTVRKGIADWEREPRLFPLGNFDGASITMGSSPRFPMYDNDFGWGRPLAIRS  420

Query  338   GMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             G ANKFDGKISAFPGREGNGSVDLEVVLAPETM GL  D E+MQYVS
Sbjct  421   GRANKFDGKISAFPGREGNGSVDLEVVLAPETMEGLLKDEEFMQYVS  467



>gb|AFF19200.1| BAHD acyltransferase [Erythroxylum coca]
Length=480

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/477 (70%), Positives = 373/477 (78%), Gaps = 24/477 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPS+S  ++SKCT+ P  + S  KSLK SVSDLPMLSCQYIQKGVLLS+PP     LI+L
Sbjct  1     MPSASTTIVSKCTICPN-QKSTLKSLKFSVSDLPMLSCQYIQKGVLLSRPPYSIDNLITL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS  L HFP LAGRL TD  GHV+IL ND G+EFV AKA  L    +L    D+P 
Sbjct  60    LKHSLSITLTHFPPLAGRLITDPNGHVHILCNDAGVEFVQAKAGRLFIDNILSPL-DVPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D+TLSY+GH KPL A+QVTEL+D VF+GCT+NHAV DGTSFW+FFNT+AEIC
Sbjct  119   CFKEFFTFDNTLSYSGHFKPLAAVQVTELADGVFIGCTVNHAVTDGTSFWHFFNTFAEIC  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKIS  PDF R TVFNSPAVLKFP+GGP ATFSGDEP+RE+IFHF+REAI K+K RA
Sbjct  179   KGAKKISNSPDFSRTTVFNSPAVLKFPSGGPKATFSGDEPLRERIFHFSREAIQKLKSRA  238

Query  851   NN-------GKLCNGENGKLN------------GKITPVNHEPGLQNGGAASEISSFQSL  729
             N        GK  N     +N            GK+ PVN    L+   AA +ISSFQSL
Sbjct  239   NEHDPSEILGKQANDSWKVVNLDTNGNGNGNCNGKVNPVNTT--LKTNTAA-QISSFQSL  295

Query  728   SAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSH  549
             SAQLWRSVTRARKL  S+TTTFRMA+NCRHRLEP+L P YFGNAIQSIPTVA  GELLS 
Sbjct  296   SAQLWRSVTRARKLPNSRTTTFRMAVNCRHRLEPKLDPYYFGNAIQSIPTVASVGELLSR  355

Query  548   DLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDF  369
             +LS+ AE+LHRNVVAH D TVR+GI  WE+ PRLFPLGNFDGA ITMGSSPRFPMYDNDF
Sbjct  356   ELSYGAELLHRNVVAHGDGTVRKGIAAWEDEPRLFPLGNFDGASITMGSSPRFPMYDNDF  415

Query  368   GWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GWG PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETM GLE+D E+MQYVS
Sbjct  416   GWGLPLAVRSGRANKFDGKISAFPGREGNGSVDLEVVLAPETMDGLESDGEFMQYVS  472



>gb|KDO53236.1| hypothetical protein CISIN_1g0453721mg, partial [Citrus sinensis]
Length=434

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/435 (71%), Positives = 346/435 (80%), Gaps = 17/435 (4%)
 Frame = -3

Query  1454  YIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFV  1275
             YIQKGVLL+ PP      +SLL+ SLS AL+HFPALAGR  TD+ GH+ IL ND G++F+
Sbjct  1     YIQKGVLLTAPPFSITHFVSLLRQSLSVALSHFPALAGRFSTDSDGHISILCNDTGVDFI  60

Query  1274  hakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTM  1095
             HAKA  LS  +LL    D+P  F+ FF +D T+SY GH +PL A+QVTEL+D VFVGCT+
Sbjct  61    HAKATFLSVNSLLSPI-DVPDSFKEFFAFDRTISYTGHVRPLAAVQVTELADGVFVGCTV  119

Query  1094  NHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDE  915
             NHAV DGTSFW+FFNT+AEI KGAKKIS+VPDF RDTVF+SPAVLKFPAGGPA TFSG  
Sbjct  120   NHAVTDGTSFWHFFNTFAEITKGAKKISKVPDFSRDTVFDSPAVLKFPAGGPAVTFSGAV  179

Query  914   PIREKIFHFTREAILKMKFRANNG----------------KLCNGENGKLNGKITPVNHE  783
             P+RE+IFHF+REAIL+MKFRAN G                K  N     +NG+IT +   
Sbjct  180   PLRERIFHFSREAILRMKFRANKGILKSDYYKSVNNEIIGKQSNDSWKTVNGEITSLFET  239

Query  782   PGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFG  603
                 N     EISSFQSL AQLWRSVTRARKLE+ KTTTFRMA+NCRHRLEPRL P YFG
Sbjct  240   LLKTNANRTDEISSFQSLCAQLWRSVTRARKLESGKTTTFRMAVNCRHRLEPRLSPYYFG  299

Query  602   NAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDG  423
             N IQSIPTVA  GELLSHDL W AE LH+NVVAHD+ TVRRG+ DWE+NPRLFPLGNFDG
Sbjct  300   NLIQSIPTVASVGELLSHDLGWGAERLHKNVVAHDNETVRRGVADWESNPRLFPLGNFDG  359

Query  422   AMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPET  243
             A ITMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPET
Sbjct  360   ASITMGSSPRFPMYDNDFGWGRPLAVRSGRANKFDGKISAFPGREGNGSVDLEVVLAPET  419

Query  242   MAGLENDMEYMQYVS  198
             MAGLEND+E+M+YVS
Sbjct  420   MAGLENDLEFMEYVS  434



>ref|XP_008388189.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=481

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/474 (69%), Positives = 375/474 (79%), Gaps = 20/474 (4%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             SS+ VIS+CT+YP+ + S  KSLKLSVSDLPMLSC YIQKGVLL  PP     L+  LK 
Sbjct  6     SSVSVISQCTIYPD-QKSAVKSLKLSVSDLPMLSCHYIQKGVLLDSPPFSVVDLLPSLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS AL+HFPALAGR  TDA GHV+I+ ND G+ FVHAKA +LS  A+L  +AD+P  FR
Sbjct  65    SLSLALSHFPALAGRFETDADGHVHIVCNDTGVGFVHAKAKNLSLDAVLQPNADVPHCFR  124

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF Y  TLSY+GH +PL A+QVTEL+DAVF+GCT+NH+V DGTSFW+FFNT+AEI +GA
Sbjct  125   EFFAYQRTLSYSGHFRPLAAVQVTELADAVFIGCTVNHSVXDGTSFWHFFNTFAEINRGA  184

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             KKIS+ PDF RDTVFNSPAVL FP GGP  TFSG++P+RE+IFHFTRE+ILK+K RANN 
Sbjct  185   KKISKSPDFSRDTVFNSPAVLHFPEGGPKVTFSGNDPLRERIFHFTRESILKLKNRANNT  244

Query  842   KL------CNGE-NGKLNGK-ITPVNHEPGLQ-----------NGGAASEISSFQSLSAQ  720
              L      CN + NG  N   ++      G Q           NG   +EISSFQSLSAQ
Sbjct  245   HLFKTTHNCNSDDNGNCNDNGLSETAEILGKQLNDSWNAVHRYNGAKTAEISSFQSLSAQ  304

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRAR L  SKTTTFRMA+NCRHRL+P++   YFGNAIQSIPTVA  GELLS DL 
Sbjct  305   LWRSVTRARNLPDSKTTTFRMAVNCRHRLQPKMDSHYFGNAIQSIPTVATVGELLSRDLR  364

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W A +LH NVVAHDDATVRRG++DWE  PRLFPLGNFDGAMITMGSSPRFPMY+NDFGWG
Sbjct  365   WGANLLHNNVVAHDDATVRRGVEDWEXAPRLFPLGNFDGAMITMGSSPRFPMYNNDFGWG  424

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +PLAVRSG ANKFDGKISAFPGREG+GSVDLEVVLAPETMAGL +D E+MQYVS
Sbjct  425   KPLAVRSGAANKFDGKISAFPGREGSGSVDLEVVLAPETMAGLLSDXEFMQYVS  478



>ref|XP_007026775.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY07277.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=469

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/470 (69%), Positives = 374/470 (80%), Gaps = 12/470 (3%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  +ISKCT++P+ + SN K+LKLSVSD+PMLSCQYIQKGVLL+ PP+    L+  
Sbjct  1     MPSSSATLISKCTIFPD-QKSNVKTLKLSVSDIPMLSCQYIQKGVLLTAPPISFDDLVVF  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK S+S  L+HFP LAGRL TD  GHV+I  ND GIEF+  K+P +S   +L    D+P 
Sbjct  60    LKQSISTTLSHFPPLAGRLMTDPDGHVHITCNDAGIEFLVVKSPKVSIHDILCPG-DVPN  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF +D TLSY+GH KPL A+QVTEL D VF+G T+NHAV DGTSFW+FFNT+AE+ 
Sbjct  119   CVKEFFTFDKTLSYSGHFKPLAAVQVTELVDGVFIGSTVNHAVTDGTSFWHFFNTFAEMT  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGA KIS+ PDF R+TVFNS AVLKFP GGP  TF+G+EP+RE+IFHFTREAILK+K+RA
Sbjct  179   KGASKISKTPDFSRNTVFNSQAVLKFPPGGPTVTFAGNEPLRERIFHFTREAILKLKYRA  238

Query  851   NNGKLCNGEN-----GKL-NGKITPVNHEP-GLQNG---GAASEISSFQSLSAQLWRSVT  702
             N G+    +      GKL N     VN E  GL NG    +  EISSFQSL AQLWRSVT
Sbjct  239   NYGRFLTKQTNSEGLGKLRNDSWKSVNGETNGLSNGKVKNSNDEISSFQSLCAQLWRSVT  298

Query  701   RARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEML  522
             RARKLE +KTTTFRMA+NCRHRL+P+L+P YFGNAIQSIPT A AGELL+ DL W+A++L
Sbjct  299   RARKLEITKTTTFRMAVNCRHRLDPKLEPYYFGNAIQSIPTFAPAGELLAKDLGWSADLL  358

Query  521   HRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVR  342
             H+NVVAHDD TVR G+ DWE  PRLFPLGN DGA ITMGSSPRFPMYDNDFGWGRPLAVR
Sbjct  359   HKNVVAHDDGTVRGGVADWEKQPRLFPLGNSDGASITMGSSPRFPMYDNDFGWGRPLAVR  418

Query  341   SGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*I  192
             SG ANKFDGKISAFPGREGNGSVDLEVVLAP+TMAG+END E+MQYVS I
Sbjct  419   SGRANKFDGKISAFPGREGNGSVDLEVVLAPDTMAGIENDAEFMQYVSAI  468



>ref|XP_009358855.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=485

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/474 (69%), Positives = 377/474 (80%), Gaps = 20/474 (4%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             SS+ VIS+CT+YP+ + S  KSLKLSVSDLPMLSC YIQKGVLL  PP   A L+  LK 
Sbjct  6     SSVSVISQCTIYPD-QKSAVKSLKLSVSDLPMLSCHYIQKGVLLDSPPFSVADLLPSLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS AL+HFPALAGR  TDA GHV+I+ ND G+ FVHAKA +LS  A+L  +AD+P  FR
Sbjct  65    SLSLALSHFPALAGRFETDADGHVHIVCNDAGVRFVHAKAKNLSLDAVLQPNADVPHCFR  124

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF Y+ TLSY+GH +PL A+QVTEL+DA+F+GCT+NH+VVDGTSFW+FFNT+AEI +GA
Sbjct  125   EFFAYERTLSYSGHFRPLAAVQVTELTDAMFIGCTVNHSVVDGTSFWHFFNTFAEINRGA  184

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             +KIS+ PDF RDTVFNSPAVL FP GGP  TFSG++P+RE+IFHFTRE+ILK+K RANN 
Sbjct  185   RKISKSPDFSRDTVFNSPAVLHFPEGGPKVTFSGNDPLRERIFHFTRESILKLKNRANNT  244

Query  842   KLCN------------------GENGKLNGK-ITPVNHEPGLQNGGAASEISSFQSLSAQ  720
              L                     E  ++ GK +    +   L NG   +EISSFQSLSAQ
Sbjct  245   HLFKTTHNSNSNGNGNSNDNGLSETAEILGKQLNDSWNIVHLYNGAKTAEISSFQSLSAQ  304

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRAR L  SKTTTFRMA+NCRHRL+P++   YFGNAIQSIPTVA  GELLS DL 
Sbjct  305   LWRSVTRARNLPDSKTTTFRMAVNCRHRLQPKMDSHYFGNAIQSIPTVATVGELLSRDLR  364

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W A +LH NVVAHDDATVRRG++DWE+ PRLFPLGNFDGAMITMGSSPRFPMY+NDFGWG
Sbjct  365   WGANLLHNNVVAHDDATVRRGVEDWESAPRLFPLGNFDGAMITMGSSPRFPMYNNDFGWG  424

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +PLAVRSG ANKFDGKISAFPGREG+GSVDLEVVLAPETMAGL +D E+MQYVS
Sbjct  425   KPLAVRSGAANKFDGKISAFPGREGSGSVDLEVVLAPETMAGLLSDAEFMQYVS  478



>emb|CBI30421.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/459 (68%), Positives = 366/459 (80%), Gaps = 20/459 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS+ ++SKCTVYPE+KS+            PMLSCQYIQKGVL ++PPL   +LISL
Sbjct  1     MPSSSVTLVSKCTVYPEHKSTIKSLKLSVSDL-PMLSCQYIQKGVLHTRPPLPIDSLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL HFP LAGR  TDA GHV+I+ ND G+EF+HAKA H     LL    D+  
Sbjct  60    LKQSLSTALTHFPPLAGRFETDADGHVHIICNDAGVEFIHAKAKHFLIRDLLSPV-DVHN  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D  LSYAGH KPL A+Q+TEL+D +F+GCT+NH+V DGTSFW+FFNT+AE+ 
Sbjct  119   CFKQFFAFDGLLSYAGHFKPLAAVQITELADGLFIGCTVNHSVTDGTSFWHFFNTFAEMT  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KGAKKISR PDF RD VFNSP VL+ P GGP  TFSGDEP+RE+IF F REAILK+K+RA
Sbjct  179   KGAKKISRSPDFNRDNVFNSPVVLRVPEGGPRLTFSGDEPLRERIFRFHREAILKLKYRA  238

Query  851   NNGKLCNGENGK-LNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASK  675
             NN ++    NG+ +NG+                +EISSFQSLSAQLWRSVTRARKL +S+
Sbjct  239   NN-QIQKSTNGQTINGE----------------NEISSFQSLSAQLWRSVTRARKLPSSR  281

Query  674   TTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDD  495
             TTTFRMA+NCRHRLEP+L+  YFGNAIQSIPTVA  GELLS DL W A++LH+NVVAHDD
Sbjct  282   TTTFRMAVNCRHRLEPKLEAHYFGNAIQSIPTVASVGELLSRDLRWCADLLHKNVVAHDD  341

Query  494   ATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDG  315
             ATV+RG++DWE+NPR FPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDG
Sbjct  342   ATVQRGVRDWESNPRCFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGKANKFDG  401

Query  314   KISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             KISAFPGR+G G+VDLEV LAPETMAGLE+D E+MQYVS
Sbjct  402   KISAFPGRDGAGTVDLEVCLAPETMAGLESDPEFMQYVS  440



>ref|XP_004137729.1| PREDICTED: BAHD acyltransferase DCR-like [Cucumis sativus]
 ref|XP_004156596.1| PREDICTED: BAHD acyltransferase DCR-like [Cucumis sativus]
 gb|KGN58789.1| hypothetical protein Csa_3G732470 [Cucumis sativus]
Length=487

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/484 (66%), Positives = 370/484 (76%), Gaps = 28/484 (6%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSSI ++SKC+V+P+ + S   SL+LSVSDLPMLSC YIQKGVL   PP      +S 
Sbjct  1     MPSSSISIVSKCSVFPD-QPSPLHSLQLSVSDLPMLSCHYIQKGVLFPSPPYSFLDFVSF  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS  L+HF  LAGRL TD+ G+V+IL ND G+EF+ AKA HL+  ALL    D+P 
Sbjct  60    LKRSLSTTLSHFSPLAGRLSTDSNGYVHILCNDAGVEFIQAKAKHLTLNALLSPL-DVPN  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY+GHS PL+A+QVTEL+D VFVGCT+NHAV DGTSFW+FFNT+AE+C
Sbjct  119   YFKEFFDFDRTISYSGHSMPLVAVQVTELADGVFVGCTVNHAVTDGTSFWHFFNTFAEVC  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KG KKIS+ P F RDTVFNS AVLKFP GGP  TF+ DEP+RE+IFHFTRE+ILK+K RA
Sbjct  179   KGTKKISKSPAFTRDTVFNSSAVLKFPEGGPVVTFNSDEPLRERIFHFTRESILKLKLRA  238

Query  851   NN--------------------GKLCNGENGKLNGKITPVNHEPGLQN------GGAASE  750
             N                     GK  N     +NG     N    L+N          +E
Sbjct  239   NTNNQIAGRRPVNGFHDAVEILGKQGNDSWKTVNGTNNGGNMTAVLENLIKTNVPNRTAE  298

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAK  570
             ISSFQSL A LWRSVTRARKL+ SKTTTFRMA+NCRHRL PR++P YFGNAIQSIPTVA 
Sbjct  299   ISSFQSLCAHLWRSVTRARKLDESKTTTFRMAVNCRHRLNPRMEPYYFGNAIQSIPTVAT  358

Query  569   AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRF  390
               ++LS+DL W A++LH+NVVAHDDATVRRGI DWE+ PRLFPLGNFDGAMITMGSSPRF
Sbjct  359   VEDVLSNDLRWCADLLHKNVVAHDDATVRRGISDWESQPRLFPLGNFDGAMITMGSSPRF  418

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
             PMYDNDFGWGRP+AVRSG ANKFDGKISAFPGR+GNGSVDLEVVL+PETMAGLE D ++M
Sbjct  419   PMYDNDFGWGRPIAVRSGRANKFDGKISAFPGRDGNGSVDLEVVLSPETMAGLERDTDFM  478

Query  209   QYVS  198
             QYVS
Sbjct  479   QYVS  482



>ref|XP_009370265.1| PREDICTED: BAHD acyltransferase DCR-like, partial [Pyrus x bretschneideri]
Length=477

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/464 (69%), Positives = 367/464 (79%), Gaps = 17/464 (4%)
 Frame = -3

Query  1541  KCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslskalA  1362
             +CT+YP ++ S  KSLKLSVSDLPMLSC YIQKGVLL  P    A L+  LK SLS AL+
Sbjct  13    QCTIYP-HQKSTIKSLKLSVSDLPMLSCHYIQKGVLLESPSCSFADLLPSLKHSLSLALS  71

Query  1361  HFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDS  1182
             HFPALAGR  TDA G V+I+ ND G+ FVHAKA  LS  A+L  +AD+P  FR+FF Y+ 
Sbjct  72    HFPALAGRFETDADGRVHIVCNDAGVNFVHAKAKTLSVDAVLRPNADVPHCFRNFFAYER  131

Query  1181  TLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVP  1002
             TLSYAGH +PL A+QVTEL+DAVF+GCT+NH+VVDGTSFW+FFNT+AEI +GAKK+S+ P
Sbjct  132   TLSYAGHVRPLAAVQVTELADAVFIGCTVNHSVVDGTSFWHFFNTFAEINRGAKKMSKSP  191

Query  1001  DFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKL-----  837
             DF RDTVFNSPAVL FP GGP  TFSG++P+RE+IFHF+RE+ILK+K RANN        
Sbjct  192   DFSRDTVFNSPAVLHFPEGGPKVTFSGNDPLRERIFHFSRESILKLKNRANNTLFKTTHN  251

Query  836   CNGENGKLNGKITPVNHEPGLQ-----------NGGAASEISSFQSLSAQLWRSVTRARK  690
             CNG        ++      G Q           NG   SEISSFQSLSAQLWRSVTR R 
Sbjct  252   CNGNGKDYGNGLSESAEIFGKQCNDSWKAVPRYNGAKTSEISSFQSLSAQLWRSVTRVRN  311

Query  689   LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNV  510
             L   KTTTFRMA+NCRHRL+P++   YFGNAIQSIPTVA AGELLS DL W AE+LH+NV
Sbjct  312   LPHPKTTTFRMAVNCRHRLQPKMDSHYFGNAIQSIPTVATAGELLSRDLRWGAELLHKNV  371

Query  509   VAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMA  330
             VAHDDATVRRG++DWE+ PRLFPLGNFDGAMITMGSSPRFPMY+NDFGWG+PLAVRSG A
Sbjct  372   VAHDDATVRRGVEDWESAPRLFPLGNFDGAMITMGSSPRFPMYNNDFGWGKPLAVRSGAA  431

Query  329   NKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NKFDGKISAFPGREGNGSVDLEVVL PETMAGL +D E+MQYVS
Sbjct  432   NKFDGKISAFPGREGNGSVDLEVVLGPETMAGLLSDGEFMQYVS  475



>ref|XP_008442462.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Cucumis 
melo]
Length=485

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/484 (65%), Positives = 370/484 (76%), Gaps = 28/484 (6%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSSI ++SKC+++P+ + S   SL+LSVSDLPMLSC YIQKGVL   PP      +S 
Sbjct  1     MPSSSISIVSKCSIFPD-QPSPLHSLQLSVSDLPMLSCHYIQKGVLFPSPPYSFPDFVSF  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS  L+HF  LAGRL TD+ G+V+IL ND G+EF+ AKA HL+  +LL    D+P 
Sbjct  60    LKRSLSTTLSHFSPLAGRLSTDSNGYVHILCNDAGVEFIQAKAKHLTLNSLLSPL-DVPN  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY+GHS PL+A+QVTEL+D VFVGCT+NHAV DGTSFW+FFNT+AE+C
Sbjct  119   YFKEFFDFDRTISYSGHSMPLVAVQVTELADGVFVGCTVNHAVTDGTSFWHFFNTFAEVC  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             KG KKIS+ P F RDTVFNS AVLKFP GGP  TF+ DEP+RE+IFHFTRE+ILK+K RA
Sbjct  179   KGTKKISKSPAFSRDTVFNSSAVLKFPEGGPVVTFNSDEPLRERIFHFTRESILKLKLRA  238

Query  851   NN--------------------GKLCNGENGKLNGKITPVNHEPGLQN------GGAASE  750
             N                     GK  N     +NG     N    L+N          +E
Sbjct  239   NTNNQIAGRRPVNGFHDAVEILGKQGNDSWKTVNGTNNGGNITAVLENLIKTNVPNRTAE  298

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAK  570
             ISSFQSL A LWRSVTRARKL+ SKTTTFRMA+NCRHRL PR++P YFGNAIQSIPTVA 
Sbjct  299   ISSFQSLCAHLWRSVTRARKLDESKTTTFRMAVNCRHRLNPRMEPYYFGNAIQSIPTVAT  358

Query  569   AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRF  390
               ++LS+DL W A++LH+NVVAHDDATVRRGI DWE+ PRLFPLGNFDGAMITMGSSPRF
Sbjct  359   VRDVLSNDLRWCADLLHKNVVAHDDATVRRGISDWESQPRLFPLGNFDGAMITMGSSPRF  418

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
             PMYDNDFGWGRP+AVRSG ANKFDGKISAFPGR+GNGSVDLEVVL+PETMAGLE D ++M
Sbjct  419   PMYDNDFGWGRPIAVRSGRANKFDGKISAFPGRDGNGSVDLEVVLSPETMAGLERDSDFM  478

Query  209   QYVS  198
             QYV+
Sbjct  479   QYVT  482



>ref|XP_010423922.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=478

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/479 (65%), Positives = 367/479 (77%), Gaps = 18/479 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaa--ali  1398
             MP+SS+  ISKC V+PE K S    L+LSVSDLPMLSC YIQKGVLL++PP   +   L+
Sbjct  1     MPNSSVTEISKCIVHPE-KKSTVSDLRLSVSDLPMLSCHYIQKGVLLTRPPSSFSFDDLV  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+YI+ ND G++FV A A  +  + LL    D+
Sbjct  60    SSLRRSLSYTLSLFPALAGRFSTSPAGHIYIVCNDAGVDFVSASAKRVRVSDLLVPGKDV  119

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P  FR FF +   +SY GH KPL A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A+
Sbjct  120   PLLFREFFVFKRLVSYNGHHKPLAAVQVTELEDGVFIGCTVNHSVTDGTSFWHFFNTFAD  179

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             +  GA KI  +PDF R TVF+SPAVL+ P GGP  TF  D+P+RE+IFHF+R+AI K+K 
Sbjct  180   VTSGACKIKHLPDFSRHTVFDSPAVLRVPPGGPRVTFDADQPLRERIFHFSRDAISKLKQ  239

Query  857   RAN---------NGKLCNGENGKLNGKITPV-----NHEPGLQNGGAASEISSFQSLSAQ  720
             R+N         +GK CNG NG +NG IT V       +   +N    +EISSFQSLSAQ
Sbjct  240   RSNHRVNGIETNDGKKCNG-NGDINGNITTVLESILKSDANSKNHDRTAEISSFQSLSAQ  298

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRAR L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG+LLS DL 
Sbjct  299   LWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTLASAGDLLSKDLR  358

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W+AE LHRNVVAHDDATVRRGI  WE++PRLFPLGN DGA ITMGSSPRFPMYDNDFGWG
Sbjct  359   WSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITMGSSPRFPMYDNDFGWG  418

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFD  183
             +PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+E D E+MQYVS + ++
Sbjct  419   KPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIEKDAEFMQYVSEVTYE  477



>gb|AFF19201.1| BAHD acyltransferase [Erythroxylum coca]
Length=474

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/486 (65%), Positives = 366/486 (75%), Gaps = 43/486 (9%)
 Frame = -3

Query  1571  MP-SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MP +S+  ++SKCT+YP ++ S  K+L+LSVSDLPMLSCQYIQKGVLLS PP     LI+
Sbjct  1     MPCASTTTIVSKCTIYP-HQKSAIKTLQLSVSDLPMLSCQYIQKGVLLSYPPYSIKDLIT  59

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP  1215
              LK SLS  L HFP LAGRL TD  GHV+IL ND G+EFV AKA HL   ++L    D+P
Sbjct  60    SLKHSLSITLNHFPPLAGRLITDQNGHVHILCNDAGVEFVQAKALHLLVNSILSPL-DVP  118

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               F+ FF +D TLSY+GHSKPL+A+QVTEL+D +F+GCT+NHAVVDGTS W+FFNT+AE 
Sbjct  119   NCFQEFFTFDKTLSYSGHSKPLLAVQVTELADGIFIGCTVNHAVVDGTSLWHFFNTFAEF  178

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             CKG KKIS  PDF R TVFNSPAVL+FP GGP  TFSG+EP+RE+IFHF+RE+I K+K R
Sbjct  179   CKGVKKISNSPDFSRTTVFNSPAVLRFPPGGPQVTFSGNEPLRERIFHFSRESIQKLKLR  238

Query  854   ANN---------------------------GKLCNGENGKLNGKITPVNHEPGLQNGGAA  756
             AN+                            ++ N  NG  NGK     HE         
Sbjct  239   ANHNLISETFGNGYSNCNCNNGNTNGKHETAEVDNCNNGNANGK-----HE--------T  285

Query  755   SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTV  576
             +EISSFQSL AQLWRSVTR R L  SKTTTFRMA+NCRHRL  RL P YFGNAIQSIPTV
Sbjct  286   AEISSFQSLCAQLWRSVTRVRNLHFSKTTTFRMAVNCRHRLNSRLDPYYFGNAIQSIPTV  345

Query  575   AKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSP  396
             A AGELLS +LS+ AE+LHRNVVAHDD+TV++GI  WE  PRLFPLGN DGA ITMGSSP
Sbjct  346   ASAGELLSRNLSYGAELLHRNVVAHDDSTVKKGIASWEREPRLFPLGNSDGASITMGSSP  405

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RFPMYDNDFGWGRPLAVRSG  NKFDGKISAFPGR+G GSVDLEVVLAP+TMAGLE+D E
Sbjct  406   RFPMYDNDFGWGRPLAVRSGGTNKFDGKISAFPGRDGAGSVDLEVVLAPDTMAGLESDGE  465

Query  215   YMQYVS  198
             +MQYVS
Sbjct  466   FMQYVS  471



>ref|XP_002873021.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49280.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=477

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/479 (66%), Positives = 366/479 (76%), Gaps = 19/479 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaa--ali  1398
             MPS S+  ISKC VYPE K S    L+LSVSDLPMLSC YIQKGVLLS PP   +   L+
Sbjct  1     MPSCSVTEISKCIVYPE-KKSTVSDLRLSVSDLPMLSCHYIQKGVLLSSPPPSFSFDDLV  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+ I+ ND G++FV A A H+  + +L    D+
Sbjct  60    SSLRRSLSSTLSLFPALAGRFSTSPAGHISIVCNDAGVDFVAASAKHVKVSDVLLPGKDV  119

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P  FR FF ++  +SY GH KPL A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A+
Sbjct  120   PLLFREFFVFERLVSYNGHHKPLAAVQVTELDDGVFIGCTVNHSVTDGTSFWHFFNTFAD  179

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             +  GA KI  +PDF R TVF+SPAVL+ P GGP  TF  D+P+RE+IFHF+REAI K+K 
Sbjct  180   VTSGACKIKHLPDFSRHTVFDSPAVLRVPPGGPRVTFDADQPLRERIFHFSREAITKLKQ  239

Query  857   RANN-----------GKLCNGENGKLNGKITPVNHEPGLQNGGA---ASEISSFQSLSAQ  720
             R NN           G+ CNG NG+ NGKIT V  +  L N       +EISSFQSLSAQ
Sbjct  240   RTNNRVNGIETAVNDGRKCNG-NGENNGKITTV-LDSFLNNKKTHDRTAEISSFQSLSAQ  297

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRAR L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG+LLS DL 
Sbjct  298   LWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTLASAGDLLSKDLR  357

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W+AE LHRNVVAHDDATVRRGI  WE++PRLFPLGN DGA ITMGSSPRFPMYDNDFGWG
Sbjct  358   WSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITMGSSPRFPMYDNDFGWG  417

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFD  183
             +PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETM G+END E+MQYVS + +D
Sbjct  418   KPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGIENDAEFMQYVSQVTYD  476



>ref|XP_010452012.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=478

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/479 (63%), Positives = 360/479 (75%), Gaps = 18/479 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MP+SS+  ISKC V+PE K S    L+LSVSDLPMLSC YIQKGVLL+ PP   +    +
Sbjct  1     MPNSSVTEISKCIVHPE-KKSTVPDLRLSVSDLPMLSCHYIQKGVLLTSPPSSFSFEDLV  59

Query  1391  lklslskalAH--FPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
               L  S +     FPALAGR  T   GH+YI+ ND G++FV A A  +  + LL    D+
Sbjct  60    SSLRRSLSSTLSIFPALAGRFSTSPAGHIYIVCNDAGVDFVAASAKRVRVSDLLVPGKDV  119

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P  FR FF ++  +SY GH KPL A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A+
Sbjct  120   PLLFREFFVFERLVSYNGHHKPLAAVQVTELEDGVFIGCTVNHSVTDGTSFWHFFNTFAD  179

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             +  GA KI  +PDF R TVF+SPAVL+ P GGP  TF  D+P+RE+IFHF+R+AI K+K 
Sbjct  180   VTSGACKIKHLPDFSRHTVFDSPAVLRVPPGGPRVTFDADQPLRERIFHFSRDAISKLKQ  239

Query  857   RAN---------NGKLCNGENGKLNGKITPV-----NHEPGLQNGGAASEISSFQSLSAQ  720
             R+N         +GK CNG N  +NG IT V       +   +N    +EISSFQSLSAQ
Sbjct  240   RSNYRVNGIETNDGKKCNG-NKDINGNITTVLESILKSDANKKNHDRTAEISSFQSLSAQ  298

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRAR L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG+LLS DL 
Sbjct  299   LWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTLASAGDLLSKDLR  358

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W+AE LHRNVVAHDDATVRRGI  WE++PRLFPLGN DGA ITMGSSPRFPMYDNDFGWG
Sbjct  359   WSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITMGSSPRFPMYDNDFGWG  418

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFD  183
             +PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+E D E+MQYVS + ++
Sbjct  419   KPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIEKDAEFMQYVSEVTYE  477



>ref|NP_195741.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 emb|CAB69849.1| anthranilate N-benzoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL08268.1| AT5g01210/F7J8_190 [Arabidopsis thaliana]
 gb|AAL90982.1| AT5g01210/F7J8_190 [Arabidopsis thaliana]
 dbj|BAE99201.1| anthranilate N-benzoyltransferase - like protein [Arabidopsis 
thaliana]
 gb|AED90310.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=475

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/479 (65%), Positives = 364/479 (76%), Gaps = 21/479 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaa--ali  1398
             MPS S+  ISKC VYPE K S    L+LSVSDLPMLSC YIQKGVLL+ PP   +   L+
Sbjct  1     MPSCSVTEISKCIVYPE-KKSTVSDLRLSVSDLPMLSCHYIQKGVLLTSPPPSFSFDDLV  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+ I+ ND G++FV A A H+  + +L    D+
Sbjct  60    SSLRRSLSSTLSLFPALAGRFSTTPAGHISIVCNDAGVDFVAASAKHVKLSDVLLPGEDV  119

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P  FR FF ++  +SY GH KPL A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A+
Sbjct  120   PLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGVFIGCTVNHSVTDGTSFWHFFNTFAD  179

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             +  GA KI  +PDF R TVF+SP VL  P GGP  TF  D+P+RE+IFHF+REAI K+K 
Sbjct  180   VTSGACKIKHLPDFSRHTVFDSPVVLPVPPGGPRVTFDADQPLRERIFHFSREAITKLKQ  239

Query  857   RANN-----------GKLCNGENGKLNGKITPVNHEPGLQNGGA---ASEISSFQSLSAQ  720
             R NN           G+ CNGE   +NGKIT V  +  L N  +    +EISSFQSLSAQ
Sbjct  240   RTNNRVNGIETAVNDGRKCNGE---INGKITTV-LDSFLNNKKSYDRTAEISSFQSLSAQ  295

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRAR L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG+LLS DL 
Sbjct  296   LWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTLASAGDLLSKDLR  355

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W+AE LHRNVVAHDDATVRRGI  WE++PRLFPLGN DGA ITMGSSPRFPMYDNDFGWG
Sbjct  356   WSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITMGSSPRFPMYDNDFGWG  415

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFD  183
             +PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETM G+END E+MQYVS + +D
Sbjct  416   KPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGIENDAEFMQYVSEVTYD  474



>emb|CDY48117.1| BnaC02g03740D [Brassica napus]
Length=505

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/465 (66%), Positives = 358/465 (77%), Gaps = 9/465 (2%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaa--li  1398
             MPS S+  ISKC VYPE K S    L+LSVSDLPMLSC YIQKGVLLS+PP   +   L+
Sbjct  47    MPSCSVTEISKCIVYPE-KRSTVADLRLSVSDLPMLSCHYIQKGVLLSRPPPSFSLDDLV  105

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+YI  ND G+EFV A A H++ + +L    D+
Sbjct  106   SSLRRSLSSTLSLFPALAGRFSTSPSGHIYITCNDSGVEFVAASAKHITVSDVLSPGKDV  165

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++  +SY GH KPL A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A+
Sbjct  166   PLLVREFFVFERLVSYNGHHKPLSAVQVTELDDGVFIGCTVNHSVTDGTSFWHFFNTFAD  225

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
                GA KI  +PDF R+TVF+SPAVL  P GGP  TF  D+P+RE++FHF+REAILK+K 
Sbjct  226   ATSGACKIKHLPDFSRNTVFDSPAVLPVPPGGPRVTFDADQPLRERVFHFSREAILKLKQ  285

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEAS  678
             R N   L    NG  NGKIT        ++    +EISSFQSLSAQLWRSVTRAR L  S
Sbjct  286   RTNGKILGKVSNGNGNGKIT------KKKSYDRTAEISSFQSLSAQLWRSVTRARNLGPS  339

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
             KTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG++L+ DL W+A  LHRNVVAHD
Sbjct  340   KTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTMASAGDVLAKDLRWSAGQLHRNVVAHD  399

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFD  318
             DATVR GI DWE+NPRLFPLGN DGA ITMGSSPRFPMYDNDFGWG+PLAVRSG ANKFD
Sbjct  400   DATVRSGIADWESNPRLFPLGNADGASITMGSSPRFPMYDNDFGWGKPLAVRSGGANKFD  459

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFD  183
             GKISAFPGREGNGSVDLEVVLAPETMAG+END E+MQYVS + +D
Sbjct  460   GKISAFPGREGNGSVDLEVVLAPETMAGIENDPEFMQYVSEVSYD  504



>ref|XP_010490596.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=484

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 363/486 (75%), Gaps = 26/486 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MP+SS+  ISKC V+PE K S    L+LSVSDLPMLSC YIQKGVLL++PP  + +   L
Sbjct  1     MPNSSVTEISKCIVHPE-KKSTVSDLRLSVSDLPMLSCHYIQKGVLLTRPPSSSFSFSDL  59

Query  1391  lklslskalAH---FPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshAD  1221
             +        +    FPALAGR  T   GH+YI+ ND G++FV A A  +  + LL    D
Sbjct  60    VSSLRRSLSSTLSLFPALAGRFSTSPAGHIYIVCNDAGVDFVSASAKRVRVSDLLVPGKD  119

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P  FR FF ++  +SY GH K L A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A
Sbjct  120   VPLLFREFFVFERLVSYNGHHKSLAAVQVTELEDGVFIGCTVNHSVTDGTSFWHFFNTFA  179

Query  1040  EICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             ++  GA KI  +PDF R TVF+SPAVL+ P GGP  TF  D+P+RE+IFHF+R+AI K+K
Sbjct  180   DVTSGACKIKHLPDFSRHTVFDSPAVLRVPPGGPRVTFDADQPLRERIFHFSRDAISKLK  239

Query  860   FRANN----------GKLCNGENGKLNGKITPVNHEPGLQNGGA----------ASEISS  741
              R+N+          GK CNG NG +NG IT V  E  L++  +           +EISS
Sbjct  240   QRSNDYRVNGIETNDGKKCNG-NGDINGNITTV-LESILKSDASNNNKKNHHDRTAEISS  297

Query  740   FQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGE  561
             FQSLSAQLWRSVTRAR L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG+
Sbjct  298   FQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTLASAGD  357

Query  560   LLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMY  381
             LLS DL W+AE LHRNVVAHDDATVRRGI  WE++PRLFPLGN DGA ITMGSSPRFPMY
Sbjct  358   LLSKDLRWSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITMGSSPRFPMY  417

Query  380   DNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
             DNDFGWG+PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+E D E+MQYV
Sbjct  418   DNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIEKDAEFMQYV  477

Query  200   S*IQFD  183
             S + ++
Sbjct  478   SEVTYE  483



>ref|XP_006287651.1| hypothetical protein CARUB_v10000861mg [Capsella rubella]
 gb|EOA20549.1| hypothetical protein CARUB_v10000861mg [Capsella rubella]
Length=477

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/478 (63%), Positives = 364/478 (76%), Gaps = 17/478 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaa---l  1401
             MP+SS+  ISKC V+PE K S    L+LSVSDLPMLSC YIQKGVLL++PP  + +   L
Sbjct  1     MPNSSVTEISKCVVHPE-KKSTVSDLRLSVSDLPMLSCHYIQKGVLLTRPPSSSFSFDHL  59

Query  1400  isllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshAD  1221
             +S L+ SLS  L+ FP LAGR  T   GH+YI+ ND G++FV A A  +  + +L    D
Sbjct  60    VSSLRRSLSSTLSLFPPLAGRFSTCPAGHIYIVCNDAGVDFVAASAKRVKVSDVLLPGKD  119

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P  FR FF ++  +SY GH KPL A+QVTEL D +F+GCT+NH+V DGTSFW+FFNT+A
Sbjct  120   VPLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGIFIGCTVNHSVTDGTSFWHFFNTFA  179

Query  1040  EICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             ++  GA KI  +PDF R TVF+SPAVL+ P GGP  TF  D+P+RE+IFHFTR+AI K+K
Sbjct  180   DVTSGACKIKHLPDFSRHTVFDSPAVLRVPPGGPRVTFDADQPLRERIFHFTRDAISKLK  239

Query  860   FRAN------------NGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQL  717
              R+N            + K CNG NG +   +     +   +N    +EISSFQSLSAQL
Sbjct  240   QRSNYRVNGIETAAGNDAKKCNG-NGDITTAVLESYLKSDKKNHDRTAEISSFQSLSAQL  298

Query  716   WRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSW  537
             WRSVTRAR L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG+LLS DL W
Sbjct  299   WRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTMASAGDLLSKDLRW  358

Query  536   AAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
             +AE LHRNVVAHDDATVRRGI  WE++PR+FPLGN DGA ITMGSSPRFPMYDNDFGWG+
Sbjct  359   SAEQLHRNVVAHDDATVRRGIAAWESDPRMFPLGNPDGASITMGSSPRFPMYDNDFGWGK  418

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFD  183
             PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+END E+MQYVS + ++
Sbjct  419   PLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIENDAEFMQYVSQVSYE  476



>gb|KFK44567.1| hypothetical protein AALP_AA1G274300 [Arabis alpina]
Length=469

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/470 (65%), Positives = 358/470 (76%), Gaps = 6/470 (1%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaa--ali  1398
             MPS S+   SKC VYPE K S    L+LSVSDLPMLSC YIQKGVLL+ PP   +   LI
Sbjct  1     MPSCSVTEFSKCIVYPE-KKSTVSDLRLSVSDLPMLSCHYIQKGVLLTNPPPSFSFDDLI  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+YI  ND G+EFV A A H++ + +L    D+
Sbjct  60    SSLRRSLSSTLSLFPALAGRFTTTPSGHIYITCNDAGVEFVSASAKHVTVSNVLSPGKDV  119

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++  +SY GH+KPL A+QVTEL+D VF+GCT+NH+V DGTSFW FFNT+A+
Sbjct  120   PLLVRDFFVFERLVSYNGHNKPLAAVQVTELNDGVFIGCTVNHSVTDGTSFWQFFNTFAD  179

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             +  GA KI  +PDF R TVF+S AVLK P GGP  TF  D+P+RE+IFHF+REAI K+K 
Sbjct  180   VTSGACKIKHLPDFSRCTVFDSSAVLKVPPGGPRVTFDADQPLRERIFHFSREAITKLKQ  239

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGA---ASEISSFQSLSAQLWRSVTRARKL  687
             R NN       NG  NGKIT    +      G+    +EISSFQSLSAQLWRSVTRAR L
Sbjct  240   RTNNRIETVKCNGNGNGKITTGYLKSDSNKKGSYDRTAEISSFQSLSAQLWRSVTRARNL  299

Query  686   EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVV  507
             + SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT++  G+LL+ DL W+A+ LHRNV+
Sbjct  300   DPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTLSTVGDLLAKDLRWSADKLHRNVI  359

Query  506   AHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMAN  327
             AHDDATVR GI DWENNPR+FPLGN DGA ITMGSSPRFPMYDNDFGWG+PLAVRSG AN
Sbjct  360   AHDDATVRCGISDWENNPRMFPLGNPDGASITMGSSPRFPMYDNDFGWGKPLAVRSGGAN  419

Query  326   KFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFDHH  177
             KFDGKISAFPGREGNGSVDLEVVLAPETMAG+E D E+MQYVS + +D +
Sbjct  420   KFDGKISAFPGREGNGSVDLEVVLAPETMAGIEKDSEFMQYVSEVTYDDY  469



>ref|XP_010543226.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Tarenaya 
hassleriana]
Length=490

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/486 (64%), Positives = 363/486 (75%), Gaps = 30/486 (6%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPlda-aalis  1395
             MPSSS+  +SKC VYP+ K S    L+LSVSD+PMLSC YIQKGVLL++ P  +   L+S
Sbjct  1     MPSSSVTEVSKCMVYPD-KKSGLADLRLSVSDIPMLSCHYIQKGVLLTRHPFSSFTDLLS  59

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP  1215
              L+ SLS AL+ FP LAGRL T   GH++I  ND G+EFV A A H++ +A++    D+P
Sbjct  60    SLRRSLSAALSAFPPLAGRLSTAPSGHLFISCNDAGVEFVAASAAHVTISAVISPDDDVP  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
                R FF YD  +SY GHSKPL A+QVTEL+D VFVGCT+NHAV DGTSFW+FFNT+A++
Sbjct  120   IVVREFFVYDRLVSYNGHSKPLAAVQVTELADGVFVGCTVNHAVTDGTSFWHFFNTFADL  179

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
               G  KI  +P+F RDTVF+SPAVL FP GGP  TF+ DEP+RE+IFHF+R AI K+K R
Sbjct  180   TSGTCKIKHLPEFSRDTVFDSPAVLHFPPGGPRVTFAADEPLRERIFHFSRGAISKLKQR  239

Query  854   ANN---------------------------GKLCNGENGKLNGKITPVNHEPGLQNGGAA  756
             ANN                           G  CNG NG+ NGKI+         N    
Sbjct  240   ANNSSSNGLLTPLVAETAVKEEILGKQSNDGWKCNG-NGESNGKISQWKAGANKTNSDRT  298

Query  755   SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTV  576
              EISSFQSLSAQLWRSVTRARKL+ +KTTTFRMA+NCRHRLEPR+ P YFGNAIQSIPT 
Sbjct  299   DEISSFQSLSAQLWRSVTRARKLDPAKTTTFRMAVNCRHRLEPRMDPYYFGNAIQSIPTT  358

Query  575   AKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSP  396
             A AG+LL HDL W+A +LH+NVVAHDDATVRRGI  WE+NPR+FPLGN DGA ITMGSSP
Sbjct  359   ALAGDLLDHDLRWSASLLHKNVVAHDDATVRRGIAAWESNPRVFPLGNPDGASITMGSSP  418

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RFPMYDNDFGWGRPLAVRSG ANKFDGKISAFP REGNG VDLEVVL+PETMAG++ND E
Sbjct  419   RFPMYDNDFGWGRPLAVRSGGANKFDGKISAFPCREGNGGVDLEVVLSPETMAGIQNDPE  478

Query  215   YMQYVS  198
             +MQYVS
Sbjct  479   FMQYVS  484



>ref|XP_003520927.1| PREDICTED: BAHD acyltransferase DCR-like [Glycine max]
Length=467

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/467 (67%), Positives = 373/467 (80%), Gaps = 12/467 (3%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  ++SKC ++P+ + SN K L+LSVSDLPMLSC YIQKGVLL+ PP     LI  
Sbjct  1     MPSSSTTIVSKCVIHPD-QKSNMKPLRLSVSDLPMLSCHYIQKGVLLTAPPSSFDDLILS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
              K +LS AL+HFPALAGR  TD+ G+V I+ ND G++F+HAKA HL+  A++  S  D+ 
Sbjct  60    FKHTLSIALSHFPALAGRFETDSNGYVNIVCNDAGVDFIHAKAKHLTLNAVVSPSLVDVH  119

Query  1214  REFRS-FFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
               F+  FF YD T+SYAGH+ PL A+QVTEL+D VFVGCT+NH+V DGTSFW+FFNT+A 
Sbjct  120   PCFKEEFFAYDMTISYAGHNTPLAAVQVTELADGVFVGCTVNHSVTDGTSFWHFFNTFAA  179

Query  1037  ICKG--AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKM  864
             + KG  AKK+ R PDF RDTVFNS AVL  P+GGPA TF  ++P+RE++FHF+REAI K+
Sbjct  180   VTKGGAAKKVLRAPDFTRDTVFNSAAVLTVPSGGPAVTFDVNQPLRERVFHFSREAIQKL  239

Query  863   KFRANNGKLCNGENGKLNGKIT----PVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRA  696
             K RANN    N E  ++ GK       + +  G  NG   +EISSFQSLSAQLWR+VTRA
Sbjct  240   KQRANN--TVNNELTEVMGKQVNDGWKIVNGNGKINGNGRNEISSFQSLSAQLWRAVTRA  297

Query  695   RKL-EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLH  519
             RK  + +KT+TFRMA+NCRHRLEP++  LYFGNAIQSIPTVA  GE+LS DL + A++LH
Sbjct  298   RKFNDPAKTSTFRMAVNCRHRLEPKMDALYFGNAIQSIPTVATVGEILSRDLRFCADLLH  357

Query  518   RNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRS  339
             RNVVAHDDATVRRGI+DWE+ PRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRP+A+RS
Sbjct  358   RNVVAHDDATVRRGIEDWESAPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPVAIRS  417

Query  338   GMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             G ANKFDGKISAFPGREGNGSVDLEVVLAP TMAGLENDME+MQYV+
Sbjct  418   GKANKFDGKISAFPGREGNGSVDLEVVLAPATMAGLENDMEFMQYVT  464



>emb|CDY55902.1| BnaAnng13950D [Brassica napus]
Length=508

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/470 (65%), Positives = 360/470 (77%), Gaps = 18/470 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaa--ali  1398
             MPS S+  ISKC VYPE K S    L+LSVSDLPMLSC YIQKGVLLS+PP   +   L+
Sbjct  47    MPSCSVTEISKCIVYPE-KRSTVADLRLSVSDLPMLSCHYIQKGVLLSRPPPSFSFDDLV  105

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+YI  ND G+EFV A A H++ + +L    D+
Sbjct  106   SSLRRSLSSTLSLFPALAGRFSTSPSGHIYITCNDSGVEFVAASAKHITVSDVLSPGKDV  165

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++  +SY GH KPL A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A+
Sbjct  166   PLLVREFFVFERLVSYNGHHKPLSAVQVTELDDGVFIGCTVNHSVTDGTSFWHFFNTFAD  225

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
                GA KI  +PDF R+TVF+SPAVL  P GGP  TF  D+P+RE++FHF+REAILK+K 
Sbjct  226   ATSGACKIKHLPDFSRNTVFDSPAVLPVPPGGPRVTFDADQPLRERVFHFSREAILKLKQ  285

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGL------QNGGAASEISSFQSLSAQLWRSVTRA  696
             R N+         K+NG  T VN E  L      ++    +EISSFQSLSAQLWRSVTRA
Sbjct  286   RTNS---------KVNGIETVVNTEEILGKITKKKSYDRTAEISSFQSLSAQLWRSVTRA  336

Query  695   RKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHR  516
             R L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG++L+ DL W+A  LHR
Sbjct  337   RNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTMASAGDVLTKDLRWSAGQLHR  396

Query  515   NVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSG  336
             NVVAHDDATVR GI DWE+NPRLFPLGN DGA ITMGSSPRFPMYDNDFGWG+PLAVRSG
Sbjct  397   NVVAHDDATVRSGIADWESNPRLFPLGNADGASITMGSSPRFPMYDNDFGWGKPLAVRSG  456

Query  335   MANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQF  186
              ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+END E+MQYVS + +
Sbjct  457   GANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIENDPEFMQYVSEVSY  506



>ref|XP_006398644.1| hypothetical protein EUTSA_v10013380mg [Eutrema salsugineum]
 gb|ESQ40097.1| hypothetical protein EUTSA_v10013380mg [Eutrema salsugineum]
Length=488

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/488 (63%), Positives = 364/488 (75%), Gaps = 26/488 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaa--ali  1398
             MPS S+   SKC VYPE K S    L+LSVSDLPMLSC YIQKGVLL++PP   +   L+
Sbjct  1     MPSCSVRETSKCIVYPE-KKSTVSDLRLSVSDLPMLSCHYIQKGVLLTRPPPSFSFDDLV  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+YI  ND G+EFV A A H++ + +L    D+
Sbjct  60    SSLRRSLSSTLSLFPALAGRFTTTPSGHIYITCNDAGVEFVSASAKHVAVSDVLSPGKDV  119

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++  +SY GH KPL A+QVTEL D VFVGCT+NH+V DGTSFW+FFNT+A+
Sbjct  120   PLLVREFFVFERLVSYNGHHKPLAAVQVTELDDGVFVGCTVNHSVTDGTSFWHFFNTFAD  179

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             +  GA KI  +PDF R TVF+SPAVL  P GGP  TF  D+P+RE+IFHF+REAI ++K 
Sbjct  180   VTSGACKIKHLPDFSRHTVFDSPAVLPVPPGGPRVTFDADQPLRERIFHFSREAISRLKQ  239

Query  857   R---------------------ANNGKLCNGENGKLNGKITP--VNHEPGLQNGGAASEI  747
             R                     +N+G+  NG   + NGKIT   +  +   +N    +EI
Sbjct  240   RTNYRVNGIETAVKTEEILGKVSNDGRKFNGNGEEANGKITKGFLKSDTNKKNYDRTAEI  299

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSLSAQLWRSVTRAR L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A A
Sbjct  300   SSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTMASA  359

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFP  387
             G+LL+ DL W+A+ LHRNVVAHDDATVRRGI  WE++PR+FPLGN DGA ITMGSSPRFP
Sbjct  360   GDLLTKDLRWSADQLHRNVVAHDDATVRRGIAAWESDPRVFPLGNPDGASITMGSSPRFP  419

Query  386   MYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             MYDNDFGWG+PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+END E+MQ
Sbjct  420   MYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIENDPEFMQ  479

Query  206   YVS*IQFD  183
             YVS + +D
Sbjct  480   YVSQVSYD  487



>ref|XP_004302658.1| PREDICTED: BAHD acyltransferase DCR-like [Fragaria vesca subsp. 
vesca]
Length=456

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/454 (67%), Positives = 355/454 (78%), Gaps = 17/454 (4%)
 Frame = -3

Query  1541  KCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslskalA  1362
             KCTVYP  + S  KSLKLSVSDLPMLSC YIQKGVL + PP     L++ LK SLS AL 
Sbjct  12    KCTVYPN-QKSTIKSLKLSVSDLPMLSCHYIQKGVLFNSPPYSINDLVNSLKQSLSVALT  70

Query  1361  HFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDS  1182
             HFPALAGR  TD+ G+V+I+ ND G +F+ AKA HLS   +LP + D+P  F+ FF +D 
Sbjct  71    HFPALAGRFETDSDGYVHIVCNDAGADFIQAKAKHLSVDGVLPPNCDVPHCFKEFFTFDQ  130

Query  1181  TLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVP  1002
             T+SY+GH KPL A+QVTEL+D VF+GCT+NHAV DGTS W+FFNT+AEI KGA KI++ P
Sbjct  131   TISYSGHDKPLAAVQVTELADGVFIGCTVNHAVTDGTSLWHFFNTFAEINKGAMKITKSP  190

Query  1001  DFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCN---  831
             DF RDTVFNS AVLK P GGP  TFSG+EP+RE+IFHFTRE+ILK+K RANN    +   
Sbjct  191   DFSRDTVFNSSAVLKVPEGGPKITFSGNEPLRERIFHFTRESILKLKSRANNNSSFSQIA  250

Query  830   ---GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFR  660
                G++   N  +TP           +  EISSFQSLSAQLWRSVTR R L+ SK TT R
Sbjct  251   EIYGKSLNDNRNLTP----------RSRFEISSFQSLSAQLWRSVTRVRNLDPSKPTTLR  300

Query  659   MAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRR  480
             MA+NCRHRLEP+L   YFGNAIQSIPT+A  G+LLSHDL W A++LH NVVAHD  TVRR
Sbjct  301   MAVNCRHRLEPKLDSHYFGNAIQSIPTIATVGDLLSHDLRWGADLLHNNVVAHDSDTVRR  360

Query  479   GIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAF  300
             G++DWE+ PRLFPLGNFDGA +TMGSSPRFPMY+NDFGWG PLAVRSG ANKFDGKISAF
Sbjct  361   GVEDWESAPRLFPLGNFDGASMTMGSSPRFPMYNNDFGWGLPLAVRSGRANKFDGKISAF  420

Query  299   PGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             PGREGNGSVDLEVVLAPETMAGLE D E+MQYV+
Sbjct  421   PGREGNGSVDLEVVLAPETMAGLELDEEFMQYVT  454



>ref|XP_008449203.1| PREDICTED: BAHD acyltransferase DCR-like [Cucumis melo]
Length=471

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/470 (66%), Positives = 360/470 (77%), Gaps = 14/470 (3%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSS+  ++S  TV+P+ + S  K LKLSVSDLPMLSC YIQKGVLL  PP     LI  
Sbjct  1     MPSSTTAILSNSTVFPD-RKSTIKKLKLSVSDLPMLSCHYIQKGVLLPSPPSSFPDLILS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL+HFPALAGRL TD  G +Y+L ND G++F+ AKA HLS  +LL     +P 
Sbjct  60    LKRSLSAALSHFPALAGRLTTDHDGAIYLLCNDAGVDFIEAKAKHLSLDSLLSPLD-VPV  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              FR+FF +D TLSY GH+KPL A+QVTEL+D VF+GCT+NHAV DGTSFW+FFNT+AEI 
Sbjct  119   CFRAFFAFDRTLSYLGHNKPLAAVQVTELADGVFIGCTVNHAVADGTSFWHFFNTFAEIN  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
              G  KIS+ PDF RDT FNSPAVLKFP GGP  TF+G+  +RE+IFHF+REAIL++K+RA
Sbjct  179   FGEGKISKSPDFSRDTPFNSPAVLKFPPGGPTETFAGNSRLRERIFHFSREAILRLKYRA  238

Query  851   NNG-----KLCNGE-------NGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRS  708
             N G     ++ NG          +LN     V  +          EISSFQSL AQLWRS
Sbjct  239   NGGDFQRKRMSNGNCEAVEYFGKQLNDGWKTVKGKRNSDISDGKLEISSFQSLCAQLWRS  298

Query  707   VTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAE  528
             VTRARKL A+KTTTFRMA+NCRHRL+P +  LYFGNAIQSIP VA  GELLS DL W   
Sbjct  299   VTRARKLNATKTTTFRMAVNCRHRLQPPMPSLYFGNAIQSIPNVALVGELLSKDLGWCGT  358

Query  527   MLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLA  348
             ++HRNVVAH+DATVRRGI DWE  PRLFPLGN DGA +TMGSSPRFPMY+NDFGWGRP+A
Sbjct  359   LIHRNVVAHNDATVRRGISDWEKEPRLFPLGNSDGASVTMGSSPRFPMYNNDFGWGRPVA  418

Query  347   VRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             VRSG ANKFDGK+SAFPG+EGNGSVDLEVVL+PETMA LE+D+E+MQYVS
Sbjct  419   VRSGSANKFDGKMSAFPGKEGNGSVDLEVVLSPETMAALESDLEFMQYVS  468



>ref|XP_007133941.1| hypothetical protein PHAVU_010G005200g [Phaseolus vulgaris]
 gb|ESW05935.1| hypothetical protein PHAVU_010G005200g [Phaseolus vulgaris]
Length=471

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/469 (64%), Positives = 359/469 (77%), Gaps = 12/469 (3%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  ++S+C ++P++KS+            PMLSC YIQKGVLL+ PP     LI  
Sbjct  1     MPSSSTTIVSRCLIHPDHKSTLKPLKLSVSDL-PMLSCHYIQKGVLLTAPPSSFENLILS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
             LK SLS AL+HFP +AGR  TD++G+V+I+ ND G++F+HAKA HL+  A++     D+ 
Sbjct  60    LKHSLSAALSHFPPIAGRFSTDSQGYVHIVCNDAGVDFIHAKAKHLTLNAVVSPMSVDVH  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               F+ FF YD  +SYAGH  PL A+QVTEL+DAVFVGCT+NHAV DGTSFW+FFNT+A I
Sbjct  120   PCFKEFFAYDMMISYAGHHNPLAAVQVTELADAVFVGCTVNHAVTDGTSFWHFFNTFAAI  179

Query  1034  CKG--AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
              KG  AKK+ R PDF R+TV NSPAVL  PAGGPA TF  ++PIRE++FHF+RE+I K+K
Sbjct  180   TKGSAAKKVLRAPDFTRETVINSPAVLFVPAGGPALTFDANKPIRERVFHFSRESIQKLK  239

Query  860   FRAN--NGKLCNGENGKLNGKITPVNHEPGLQNGGAA-----SEISSFQSLSAQLWRSVT  702
              RAN    +L      ++N     VN        G       +EISSFQSLSAQLWR+VT
Sbjct  240   LRANANTNELTEVMGKQVNDGWKIVNGNGNANGNGKLNGNERNEISSFQSLSAQLWRAVT  299

Query  701   RARKL-EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEM  525
             RARK  + +KT+TFRMA+N RHRLEP++   YFGNAIQSIPTVA  G++LS DL + A+ 
Sbjct  300   RARKFNDPAKTSTFRMAVNFRHRLEPKMDAFYFGNAIQSIPTVATVGDILSRDLCFCADF  359

Query  524   LHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAV  345
             LHRNV+AHDDATVRRGI+DWEN PRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRP+A+
Sbjct  360   LHRNVIAHDDATVRRGIEDWENAPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPVAI  419

Query  344   RSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             RSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME+MQYV+
Sbjct  420   RSGKANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEFMQYVT  468



>ref|XP_004147890.1| PREDICTED: BAHD acyltransferase DCR-like [Cucumis sativus]
 gb|KGN54358.1| hypothetical protein Csa_4G308490 [Cucumis sativus]
Length=471

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 361/473 (76%), Gaps = 20/473 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSS+  ++S  TV+P+   S  K LKLSVSDLPMLSC YIQKGVLL  PP     LI  
Sbjct  1     MPSSTTAILSNSTVFPD-SKSTIKKLKLSVSDLPMLSCHYIQKGVLLPSPPSSFPDLILS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL+HFPALAGRL TD  G +++L ND G++F+ AKA HLS  +LL    DIP 
Sbjct  60    LKRSLSAALSHFPALAGRLTTDPDGAIFLLCNDAGVDFIEAKAKHLSLHSLLSPL-DIPV  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              FR+FF +D TLSY GH+KPL A+QVTEL+D +F+GCT+NHAV DGTSFW+FFNT+AEI 
Sbjct  119   CFRAFFAFDRTLSYLGHNKPLAAVQVTELADGLFIGCTVNHAVADGTSFWHFFNTFAEIN  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
              G  KIS  PDF RDT FNSPAVLKFP GGP  TF+G+  +RE+IFHF+REAIL++K+RA
Sbjct  179   FGKGKISNTPDFTRDTAFNSPAVLKFPPGGPTETFAGNTRLRERIFHFSREAILRLKYRA  238

Query  851   NN-----GKLCNGE-------NGKLNGKITPVNHEPGLQNGGAAS---EISSFQSLSAQL  717
             N       ++ NG          +LN     VN   G +NG  +    EISSFQSL AQL
Sbjct  239   NGVDVQRKRMSNGNCEAVEYFGKQLNDSWKTVN---GKRNGDVSDGKLEISSFQSLCAQL  295

Query  716   WRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSW  537
             WRSVTRARKL A+KTTTFRMA+NCRHRL+P +  LYFGNAIQSIP VA  GELLS DL W
Sbjct  296   WRSVTRARKLNATKTTTFRMAVNCRHRLQPPMPSLYFGNAIQSIPNVALVGELLSKDLGW  355

Query  536   AAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
                ++HRNV AH+DATVR GI DWE  PRLFPLGN DGA +TMGSSPRFPMY+NDFGWGR
Sbjct  356   CGTLIHRNVAAHNDATVRGGIGDWEKAPRLFPLGNADGASVTMGSSPRFPMYNNDFGWGR  415

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             P+AVRSG ANKFDGK+SAFPG+EGNGSVDLEVVL+PETMA LE+D+E+MQYVS
Sbjct  416   PVAVRSGSANKFDGKMSAFPGKEGNGSVDLEVVLSPETMAALESDLEFMQYVS  468



>emb|CDP14056.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/467 (63%), Positives = 357/467 (76%), Gaps = 17/467 (4%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             S    +SKC+++P  + S    LKLSVSDLPMLSC YIQKG L ++PP   + LISLLK 
Sbjct  7     SRTTTVSKCSIFPS-EDSTLGDLKLSVSDLPMLSCHYIQKGCLFTRPPFPISDLISLLKR  65

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS  L+HFP LAGRL TD+ GH+YI SND G++F HA A H+    +L S  D+P + +
Sbjct  66    SLSTTLSHFPPLAGRLFTDSDGHIYITSNDAGVDFTHANASHVRIRDILGSI-DVPHQVK  124

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF  D  +SY GH +P++A+QVTEL+D VF+GC++NHAV DGTSFWNFFNT+AE+ +G 
Sbjct  125   EFFSLDGMISYEGHFRPILAVQVTELADGVFIGCSLNHAVTDGTSFWNFFNTFAEVSRGI  184

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN-  846
             K+ISR PDF R++V  SPAVLK PA GP  TF  D P+RE+I  FTRE+ILK+K  ANN 
Sbjct  185   KRISRTPDFSRESVLISPAVLKLPADGPKITFDADAPVRERILSFTRESILKLKAIANNQ  244

Query  845   -----------GKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTR  699
                        GK  +    +L GK+TP+  +   QN    +EISSFQ+LSA LWR VTR
Sbjct  245   KCEVNHVVELMGKQRHDPLARLEGKMTPLAQQ---QNKTRTTEISSFQALSALLWRGVTR  301

Query  698   ARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLH  519
             ARKL ASKTTTFRMA+NCR+RL P+L+PLYFGNAIQSIPT A AG++L+HDL W AE L+
Sbjct  302   ARKLPASKTTTFRMAVNCRNRLGPKLEPLYFGNAIQSIPTYASAGDILAHDLRWCAEQLN  361

Query  518   RNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRS  339
             +NV A+DDATVR  +QDWE +PR FPLGNFDGAM+TMGSSPRFPMYDNDFGWGRP+AVRS
Sbjct  362   KNVTAYDDATVRSNVQDWERDPRCFPLGNFDGAMLTMGSSPRFPMYDNDFGWGRPMAVRS  421

Query  338   GMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             G ANKFDGKISAFPGREG G+VDLEV+LAPETM GLE+D E+MQYVS
Sbjct  422   GKANKFDGKISAFPGREGGGTVDLEVILAPETMDGLESDQEFMQYVS  468



>ref|XP_003516942.1| PREDICTED: BAHD acyltransferase DCR-like [Glycine max]
Length=474

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 373/473 (79%), Gaps = 17/473 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  ++SKC ++P+ + SN K L+LSVSDLPMLSC YIQKGVLL+ PP     +I  
Sbjct  1     MPSSSTTIVSKCVIHPD-QKSNMKPLRLSVSDLPMLSCHYIQKGVLLTAPPSSFEDMILS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
              K SLS AL+HFPALAGRL TD+ G+V I+ ND G++F+HAKA HL+  A++  S  D+ 
Sbjct  60    FKHSLSIALSHFPALAGRLETDSHGYVNIVCNDAGVDFIHAKAKHLTLNAVVSPSLVDVH  119

Query  1214  REFRS-FFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
               F+  FF YD T+SYAGH+ PL A+QVTEL+D VFVGCT+NH+V DGTSFW+FFNT+A 
Sbjct  120   PCFKEEFFAYDMTISYAGHNTPLAAVQVTELADGVFVGCTVNHSVTDGTSFWHFFNTFAA  179

Query  1037  ICKG--AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKM  864
             + KG  AKK+ R PDF R+TVFNS AVL  P+GGP  TF  +EP+RE++FHF+REAI K+
Sbjct  180   VTKGGSAKKLLRAPDFTRETVFNSAAVLPVPSGGPTVTFDANEPLRERVFHFSREAIQKL  239

Query  863   KFRANNGKLCNGENGKLNGK----------ITPVNHEPGLQNGGAASEISSFQSLSAQLW  714
             K RANN  + N E  ++ GK               +  G+ NG   +EISSFQSLSAQLW
Sbjct  240   KQRANN-TVNNKELTEVMGKHVNDGWKVVNGNGNGNCNGMINGNGRNEISSFQSLSAQLW  298

Query  713   RSVTRARKL-EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSW  537
             R+VTRARK  + +KT+TFRMA+NCRHRLEP++   YFGNAIQSIPTVA  G++LS DL +
Sbjct  299   RAVTRARKFNDPAKTSTFRMAVNCRHRLEPKMDAFYFGNAIQSIPTVATVGDILSRDLRF  358

Query  536   AAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
              A++LHRNVVAHDDATVRRGI+DWE+ PRLFPLGNFDGAMITMGSSPRFPMY+NDFGWGR
Sbjct  359   CADLLHRNVVAHDDATVRRGIEDWESAPRLFPLGNFDGAMITMGSSPRFPMYENDFGWGR  418

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             P+A+RSG ANKFDGKISAFPGREGNGSVDLEVVLAP TMAGLENDME+MQYV+
Sbjct  419   PVAIRSGKANKFDGKISAFPGREGNGSVDLEVVLAPATMAGLENDMEFMQYVT  471



>ref|XP_003604624.1| BAHD acyltransferase DCR [Medicago truncatula]
 gb|AES86821.1| anthocyanin 5-aromatic acyltransferase [Medicago truncatula]
Length=490

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/488 (64%), Positives = 368/488 (75%), Gaps = 31/488 (6%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  ++SKCT+YP ++ S+ K LKLSVSDLPMLSC YIQKG+LLS PP     LI  
Sbjct  1     MPSSSTTIVSKCTIYP-HQKSSLKPLKLSVSDLPMLSCHYIQKGILLSTPPYSFEELIHT  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
             LK SLS AL+HFP LAGRL TD+ G++YI SND G++F+H+KA HL+   +L  S  D+ 
Sbjct  60    LKNSLSIALSHFPPLAGRLTTDSDGYIYITSNDAGVDFIHSKAKHLTLNTILSPSLIDVH  119

Query  1214  REFRS-FFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
               F+  FF YD  +SY+GH  PL A+QVTEL+D VF+G T+NH+V DGTSFW+FFNT+A 
Sbjct  120   PCFKELFFAYDMPISYSGHQIPLAAVQVTELADGVFIGFTVNHSVTDGTSFWHFFNTFAA  179

Query  1037  ICK-----GAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAI  873
             I K      A KIS+ PDF RDT+FNS AVL  PAGGP  TF  DEP+RE+IFHF+RE+I
Sbjct  180   ITKSTGVGAAVKISKSPDFTRDTIFNSTAVLPIPAGGPTVTFDVDEPLRERIFHFSRESI  239

Query  872   LKMKFRAN---NG-KLCNGENGKLNGKITP-------------VNHEPGLQNGGAA----  756
             LK+K + N   NG    NG     NG   P             + +  G  NG       
Sbjct  240   LKLKHKTNGNSNGISNSNGNGISYNGLADPTEIISKESNDGWKIVNSNGHVNGNGTVKSN  299

Query  755   --SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIP  582
               +EISSFQSLSAQLWRSVTRARKLE +KT+TFRMA+NCRHRL P+++P YFGNAIQSIP
Sbjct  300   VRNEISSFQSLSAQLWRSVTRARKLELTKTSTFRMAVNCRHRLNPKMEPFYFGNAIQSIP  359

Query  581   TVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGS  402
             TVA   ++LS+DL + A +LH+NVVAHDD TVRRG++DWENNPRLFPLGNFDGAMITMGS
Sbjct  360   TVASVNDILSNDLKFLAGLLHQNVVAHDDVTVRRGVEDWENNPRLFPLGNFDGAMITMGS  419

Query  401   SPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEND  222
             SPRFPMYDNDFGWG PLA+RSG +NKFDGKISAFPGREGNGSVDLEVVL PETM GLEND
Sbjct  420   SPRFPMYDNDFGWGIPLAIRSGKSNKFDGKISAFPGREGNGSVDLEVVLKPETMFGLEND  479

Query  221   MEYMQYVS  198
             +E+MQYV+
Sbjct  480   VEFMQYVT  487



>emb|CDY40314.1| BnaA10g27540D [Brassica napus]
Length=456

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/465 (66%), Positives = 355/465 (76%), Gaps = 17/465 (4%)
 Frame = -3

Query  1571  MPSSSIV--VISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPlda---a  1407
             MP  S+   +ISKC VYPE K S    L+LSVSDLPMLSC YIQKGVLL+ PP  +    
Sbjct  1     MPCCSVTREIISKCIVYPE-KKSTVADLRLSVSDLPMLSCHYIQKGVLLATPPPPSFSFD  59

Query  1406  alisllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpsh  1227
              L+S L+ SLS AL+ FP LAGR +T   GH+YI  ND G +FV A A H++ + +L   
Sbjct  60    DLVSSLRRSLSSALSLFPPLAGRFYTSPSGHIYITCNDAGADFVAASAKHVTVSDVLSPG  119

Query  1226  ADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNT  1047
              D+P   R FF ++  +SY GH KPL A+QVTEL D VFVGCT+NH V DGTSFW+FFNT
Sbjct  120   KDVPLLVREFFVFERLVSYNGHHKPLAAVQVTELEDGVFVGCTVNHCVTDGTSFWHFFNT  179

Query  1046  YAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILK  867
              A++  G K I  +PDF R TVF+SP VL  P GGP  TF  D+PIRE+IFHF+REAI K
Sbjct  180   LADLTSG-KMIKHLPDFSRHTVFDSPQVLPIPPGGPRVTFDADQPIRERIFHFSREAISK  238

Query  866   MKFRANNGKLCNG--ENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRAR  693
             +K R N  K+ NG   NG   GKIT  N +P        +EISSFQSLSAQLWRSVTRAR
Sbjct  239   LKQRTNYNKV-NGMKSNGNGGGKITNKNDDP-------TAEISSFQSLSAQLWRSVTRAR  290

Query  692   KLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRN  513
              L+ SKTTTFRMA+NCRHRLEP++ P YFGNAIQSIPT+A AG+LL++DL W+A+ LHRN
Sbjct  291   NLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSIPTMASAGDLLANDLRWSADQLHRN  350

Query  512   VVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM  333
             VVAHDDATVRRGI DWE+NPRLFPLGN DGA ITMGSSPRFPMYDNDFGWG+PLAVRSG 
Sbjct  351   VVAHDDATVRRGIADWESNPRLFPLGNADGASITMGSSPRFPMYDNDFGWGKPLAVRSGG  410

Query  332   ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             ANKFDGKISAFPGREGNGSVDLEVVLAPETMA +END ++MQYVS
Sbjct  411   ANKFDGKISAFPGREGNGSVDLEVVLAPETMARIENDPDFMQYVS  455



>ref|XP_009125428.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brassica 
rapa]
Length=525

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/487 (63%), Positives = 359/487 (74%), Gaps = 35/487 (7%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaa--ali  1398
             MPS S+  ISKC VYPE K S    L+LSVSDLPMLSC YIQKGVLLS+PP   +   L+
Sbjct  47    MPSCSVTEISKCIVYPE-KRSTVADLRLSVSDLPMLSCHYIQKGVLLSRPPPSFSFDDLV  105

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+ FPALAGR  T   GH+YI  ND G+EFV A A H++ + +L    D+
Sbjct  106   SSLRRSLSSTLSLFPALAGRFSTSPSGHIYITCNDSGVEFVAASAKHITVSDVLSPGKDV  165

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++  +SY GH KPL A+QVTEL D VF+GCT+NH+V DGTSFW+FFNT+A+
Sbjct  166   PLLVREFFVFERLVSYNGHHKPLSAVQVTELDDGVFIGCTVNHSVTDGTSFWHFFNTFAD  225

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
                GA KI  +PDF R+TVF+SPAVL  P GGP  TF  D+P+RE++FHF+REAILK+K 
Sbjct  226   ATSGACKIKHLPDFSRNTVFDSPAVLPVPPGGPRVTFDADQPLRERVFHFSREAILKLKQ  285

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGL---QNGGA--------------------ASEI  747
             R N+         K+NG  T VN E  L    N G                      +EI
Sbjct  286   RTNS---------KVNGIETVVNTEEILGKVSNDGMITNGNGNGNGKITKKKSYDRTAEI  336

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSLSAQLWRSVTRAR L+ SKTTTFRMA+NCR RLEP++ P YFGNAIQSIPT+A A
Sbjct  337   SSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRPRLEPKMDPYYFGNAIQSIPTMASA  396

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFP  387
             G++L+ DL W+A  LHRNVVAHDDATVR GI DWE+NPRLFPLGN DGA ITMGSSPRFP
Sbjct  397   GDVLTKDLRWSAGQLHRNVVAHDDATVRSGIADWESNPRLFPLGNADGASITMGSSPRFP  456

Query  386   MYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             MYDNDFGWG+PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+END E+MQ
Sbjct  457   MYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIENDPEFMQ  516

Query  206   YVS*IQF  186
             YVS + +
Sbjct  517   YVSEVSY  523



>ref|XP_004162750.1| PREDICTED: LOW QUALITY PROTEIN: BAHD acyltransferase DCR-like 
[Cucumis sativus]
Length=471

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/473 (65%), Positives = 360/473 (76%), Gaps = 20/473 (4%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSS+  ++S  TV+P+   S  K LKLSVSDLPMLSC YIQKGVLL  PP     LI  
Sbjct  1     MPSSTTAILSNSTVFPD-SKSTIKKLKLSVSDLPMLSCHYIQKGVLLPSPPSSFPDLILS  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS AL+HFPALAGRL TD  G +++L ND G++F+ AKA HLS  +LL    DIP 
Sbjct  60    LKRSLSAALSHFPALAGRLTTDPDGAIFLLCNDAGVDFIEAKAKHLSLHSLLSPL-DIPV  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              FR+FF +D TLSY GH+KPL A+QVTEL+D +F+GCT+NHAV DGTSFW+F NT+AEI 
Sbjct  119   CFRAFFAFDRTLSYLGHNKPLAAVQVTELADGLFIGCTVNHAVADGTSFWHFXNTFAEIN  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
              G  KIS  PDF RDT FNSPAVLKFP GGP  TF+G+  +RE+IFHF+REAIL++K+RA
Sbjct  179   FGKGKISNTPDFTRDTAFNSPAVLKFPPGGPTETFAGNTRLRERIFHFSREAILRLKYRA  238

Query  851   NN-----GKLCNGE-------NGKLNGKITPVNHEPGLQNGGAAS---EISSFQSLSAQL  717
             N       ++ NG          +LN     VN   G +NG  +    EISSFQSL AQL
Sbjct  239   NGVDVQRKRMSNGNCEAVEYFGKQLNDSWKTVN---GKRNGDVSDGKLEISSFQSLCAQL  295

Query  716   WRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSW  537
             WRSVTRARKL A+KTTTFRMA+NCRHRL+P +  LYFGNAIQSIP VA  GELLS DL W
Sbjct  296   WRSVTRARKLNATKTTTFRMAVNCRHRLQPPMPSLYFGNAIQSIPNVALVGELLSKDLGW  355

Query  536   AAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
                ++HRNV AH+DATVR GI DWE  PRLFPLGN DGA +TMGSSPRFPMY+NDFGWGR
Sbjct  356   CGTLIHRNVAAHNDATVRGGIGDWEKAPRLFPLGNADGASVTMGSSPRFPMYNNDFGWGR  415

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             P+AVRSG ANKFDGK+SAFPG+EGNGSVDLEVVL+PETMA LE+D+E+MQYVS
Sbjct  416   PVAVRSGSANKFDGKMSAFPGKEGNGSVDLEVVLSPETMAALESDLEFMQYVS  468



>ref|XP_004506783.1| PREDICTED: BAHD acyltransferase DCR-like [Cicer arietinum]
Length=507

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/504 (60%), Positives = 369/504 (73%), Gaps = 47/504 (9%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  ++SKCT+YP+ + S+ K LKLSVSDLPMLSC YIQKG+LLS PP     LIS 
Sbjct  1     MPSSSTTIVSKCTIYPD-QKSSIKPLKLSVSDLPMLSCHYIQKGILLSTPPYSFENLIST  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
             LK SLS +L+HFP LAGRL TD+ G+VYI  ND G++F+H+KA HL+  A++  S  D+ 
Sbjct  60    LKHSLSISLSHFPPLAGRLTTDSDGYVYITCNDAGVDFIHSKAKHLTLNAIISPSLLDVH  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               F+ FF +D  +SY+GH+ PL A+Q+TEL+D VF+GCT+NH+V DGTSFW+FFNT+A +
Sbjct  120   PCFKEFFAHDMMISYSGHNNPLAAVQITELADGVFIGCTVNHSVTDGTSFWHFFNTFAAV  179

Query  1034  CK--GAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
              K  GA KIS +PDF RDT+FNS AVL  PAGGP  TF  +EP+RE++FHF+RE+I K+K
Sbjct  180   TKNAGAVKISNLPDFTRDTIFNSNAVLPIPAGGPTVTFDVNEPLRERVFHFSRESIQKLK  239

Query  860   FRANNGKLCNGE----------------------------NGKLNGKITPVNHEPGLQNG  765
              +AN     NG                             NGK NG I P        N 
Sbjct  240   QKANGYSNSNGNGLSDPTEEIKKQVNDSWKNVTSYGNGIVNGKGNGLIDPTEEMKKQVND  299

Query  764   G---------------AASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLE  630
             G                 +EISSFQSL AQLWRSVTRARKL+ SKT+TFRMA+NCRHRLE
Sbjct  300   GWKNVNSNGNSNRRTNVRNEISSFQSLCAQLWRSVTRARKLDFSKTSTFRMAVNCRHRLE  359

Query  629   PRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPR  450
             P++   YFGNAIQSIPTVA   E+++ DL + AE+LH+NVVAHD+ATVR G++DWEN PR
Sbjct  360   PKMDGFYFGNAIQSIPTVASVNEIITKDLRFCAELLHKNVVAHDNATVRHGVEDWENAPR  419

Query  449   LFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVD  270
             LFPLGNFDGAMITMGSSPRFPMYDNDFGWG+PL +RSG ANKFDGKISAFPGREGNGSVD
Sbjct  420   LFPLGNFDGAMITMGSSPRFPMYDNDFGWGKPLVIRSGKANKFDGKISAFPGREGNGSVD  479

Query  269   LEVVLAPETMAGLENDMEYMQYVS  198
             LEVVLAP+TM GLEND+++MQYV+
Sbjct  480   LEVVLAPQTMDGLENDIDFMQYVT  503



>ref|XP_011084938.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Sesamum 
indicum]
Length=481

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/482 (61%), Positives = 363/482 (75%), Gaps = 27/482 (6%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M S S+ ++S+CTV+P+ + S    LKLSVSDLPMLSC YIQKG L ++PP   + L+SL
Sbjct  1     MVSESLPLVSRCTVFPD-QKSTLGELKLSVSDLPMLSCHYIQKGCLFTRPPFPVSELVSL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS+AL HFP LAGRL TD+ G+VYI  ND G++F+HA   H+    LL S+ D+P+
Sbjct  60    LKRSLSQALTHFPPLAGRLTTDSDGYVYITCNDAGVDFIHANGSHIYVRDLLVSNDDLPK  119

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF  D T+SY GH +P++++Q+TEL+D VF+GC +NHAV DGTSFWNFFNT+AE+ 
Sbjct  120   AVKGFFALDQTVSYEGHFRPILSVQMTELADGVFIGCALNHAVTDGTSFWNFFNTFAELS  179

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+ISR+PDF RD++  SPAVLK P GGP  TFSGD PIRE+IF F+RE+ILK+K + 
Sbjct  180   RGVKRISRIPDFSRDSILISPAVLKLPVGGPTVTFSGDAPIRERIFRFSRESILKLKAKV  239

Query  851   NNGKLCNGENGKLN-----------------GKITP-------VNHEPGLQNGGAASEIS  744
             NN  +    NG ++                 GK+TP       V+ E    N  A  EIS
Sbjct  240   NNNTVKREVNGGIDFAELMGKHSNDTRKYPEGKLTPLTWLMNAVSRETSQVNPTA--EIS  297

Query  743   SFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAG  564
             SFQSLSA LWR +TRARKL ASK TTFRMA+NCRHRLEP+L PLYFGNAIQSIPT A AG
Sbjct  298   SFQSLSALLWRGITRARKLPASKMTTFRMAVNCRHRLEPKLDPLYFGNAIQSIPTYATAG  357

Query  563   ELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPM  384
             E+L  DL W AE L++NVVAH +ATVR+ ++DWE  PR FPLGNFDGAMITMGSSPRFPM
Sbjct  358   EVLGKDLRWCAEQLNKNVVAHGNATVRKYVEDWEQEPRCFPLGNFDGAMITMGSSPRFPM  417

Query  383   YDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQY  204
             Y+NDFGWGRP+AV+SG ANKFDGKISAFPG +G GSVDLEVVL+P+TMAGL +D E+MQY
Sbjct  418   YENDFGWGRPVAVQSGRANKFDGKISAFPGGDGRGSVDLEVVLSPDTMAGLLSDPEFMQY  477

Query  203   VS  198
             VS
Sbjct  478   VS  479



>ref|XP_008350541.1| PREDICTED: LOW QUALITY PROTEIN: BAHD acyltransferase DCR-like 
[Malus domestica]
Length=462

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/445 (68%), Positives = 348/445 (78%), Gaps = 20/445 (4%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             SS+ VIS+CT+YP+ + S  KSLKLSVSDLPMLSC YIQKGVLL  PP     L+  LK 
Sbjct  6     SSVSVISQCTIYPD-QKSAVKSLKLSVSDLPMLSCHYIQKGVLLDSPPFSVVDLLPSLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS AL+HFPALAGR  TDA GHV+I+ ND G+ FVHAKA +LS  A+L  +AD+P  FR
Sbjct  65    SLSLALSHFPALAGRFETDADGHVHIVCNDTGVGFVHAKAKNLSLDAVLQPNADVPHCFR  124

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF Y  TLSY+GH +PL A+QVTEL+DAVF+GCT+NH+V DGTSFW+FFNT+AEI +GA
Sbjct  125   EFFAYQRTLSYSGHFRPLAAVQVTELADAVFIGCTVNHSVXDGTSFWHFFNTFAEINRGA  184

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             KKIS+ PDF RDTVFNSPAVL FP GGP  TFSG++P+RE+IFHFTRE+ILK+K RANN 
Sbjct  185   KKISKSPDFSRDTVFNSPAVLHFPEGGPKVTFSGNDPLRERIFHFTRESILKLKNRANNT  244

Query  842   KL------CNGE-NGKLNGK-ITPVNHEPGLQ-----------NGGAASEISSFQSLSAQ  720
              L      CN + NG  N   ++      G Q           NG   +EISSFQSLSAQ
Sbjct  245   HLFKTTHNCNSDDNGNCNDNGLSETAEILGKQLNDSWNAVHRYNGAKTAEISSFQSLSAQ  304

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWRSVTRAR L  SKTTTFRMA+NCRHRL+P++   YFGNAIQSIPTVA  GELLS DL 
Sbjct  305   LWRSVTRARNLPDSKTTTFRMAVNCRHRLQPKMDSHYFGNAIQSIPTVATVGELLSRDLR  364

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W A +LH NVVAHDDATVRRG++DWE  PRLFPLGNFDGAMITMGSSPRFPMY+NDFGWG
Sbjct  365   WGANLLHNNVVAHDDATVRRGVEDWEGAPRLFPLGNFDGAMITMGSSPRFPMYNNDFGWG  424

Query  359   RPLAVRSGMANKFDGKISAFPGREG  285
             +PLAVRSG ANKFDGKISAFPGREG
Sbjct  425   KPLAVRSGAANKFDGKISAFPGREG  449



>ref|XP_006435679.1| hypothetical protein CICLE_v10031464mg [Citrus clementina]
 ref|XP_006486365.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
 gb|ESR48919.1| hypothetical protein CICLE_v10031464mg [Citrus clementina]
Length=462

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/451 (65%), Positives = 345/451 (76%), Gaps = 3/451 (1%)
 Frame = -3

Query  1547  ISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslska  1368
             +SKCTV PE ++SN   LKLSVSDLPMLSC YIQKG L ++PP     LISLLK SLS+ 
Sbjct  14    VSKCTVLPE-QNSNLGDLKLSVSDLPMLSCHYIQKGCLFTRPPFPIDHLISLLKKSLSQT  72

Query  1367  lAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQY  1188
             L+HFP LAGR  TD+ G++YI SND G++F+H  A   S   +L     +P   +SFF  
Sbjct  73    LSHFPPLAGRFTTDSDGYIYITSNDAGVDFIHKNATVWSVRDILSPVH-VPENVKSFFAL  131

Query  1187  DSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISR  1008
             D T+SY GH KP++ +QVTEL+D VF+GC MNHAV DGTSFWNFFNT+AE+ KG KKIS+
Sbjct  132   DRTVSYEGHYKPILTVQVTELADGVFIGCAMNHAVADGTSFWNFFNTFAELTKGIKKISK  191

Query  1007  VPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGK-LCN  831
              P+F RD+V  SPAVL  P GG   TF  +EP+ E+IF F+RE+ILK+K R NN K + N
Sbjct  192   QPEFSRDSVLVSPAVLMIPDGGLKVTFDENEPLSERIFSFSRESILKLKARVNNNKWIDN  251

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
             G    +       N    L+   +  EISSFQSLSA LWR+VTRARKL  +K TTFRMA+
Sbjct  252   GHVDAVELLGKQSNDTYWLKKTESNGEISSFQSLSALLWRAVTRARKLHVNKMTTFRMAV  311

Query  650   NCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQ  471
             NCRHRL P+L PLYFGNAIQSIPT A AG++LS DL W AE L++NV AHDD TVRR ++
Sbjct  312   NCRHRLNPKLDPLYFGNAIQSIPTYASAGDVLSKDLRWCAEQLNKNVNAHDDKTVRRFVE  371

Query  470   DWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGR  291
             DWE+NPR+FPLGNFDGA ITMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGR
Sbjct  372   DWESNPRVFPLGNFDGASITMGSSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAFPGR  431

Query  290   EGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             EG G+VDLEV+LAPETMAG+E+D E+MQYVS
Sbjct  432   EGGGTVDLEVILAPETMAGIESDHEFMQYVS  462



>ref|XP_002316230.1| transferase family protein [Populus trichocarpa]
 gb|EEF02401.1| transferase family protein [Populus trichocarpa]
Length=441

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/461 (62%), Positives = 350/461 (76%), Gaps = 24/461 (5%)
 Frame = -3

Query  1571  MPS-SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MPS +S+ ++SKCTV+P+ + S  + LKLSVSDLPMLSC YIQKG L + PP  +   + 
Sbjct  1     MPSATSLTIVSKCTVFPD-QKSTLQDLKLSVSDLPMLSCHYIQKGGLFTSPPTLSIDSLI  59

Query  1394  l-lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
               LK SLS+ L+HFP LAGR +TD+ GH+YI  ND G++F+HA A  +S   +L     +
Sbjct  60    SHLKQSLSQTLSHFPPLAGRFNTDSNGHIYITCNDAGVDFIHATATDISIQDILYPLH-V  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++ST+SY GH KP++A+QVTEL+D VF+GC+MNH+V DGTSFWNFFNT+AE
Sbjct  119   PDCIRGFFAFESTVSYQGHYKPILAVQVTELADGVFIGCSMNHSVTDGTSFWNFFNTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G KKISR PDF R+++  S AVLK P GGP  TF+ +EP+ E+IF F+REAILK+K 
Sbjct  179   VSRGIKKISRKPDFSRNSILISEAVLKVPQGGPRVTFNENEPLSERIFSFSREAILKLKS  238

Query  857   RANNGKLC-NGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEA  681
               NN K   N +N  ++                    ISSFQSLSA LWR+VTRARKL  
Sbjct  239   EVNNKKWSQNSDNANVD-------------------VISSFQSLSALLWRAVTRARKLNP  279

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
             SKTTTFRMA+NCRHRL P+L PLYFGNAIQSIPT A A ++LS DL W AE L++NV AH
Sbjct  280   SKTTTFRMAVNCRHRLNPKLDPLYFGNAIQSIPTYASAEDVLSRDLRWCAEQLNKNVAAH  339

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKF  321
             +D TVRR +QDWE+NPR FPLGN DGA +TMGSSPRFPMYDNDFGWGRPLAVRSG ANKF
Sbjct  340   NDGTVRRFVQDWESNPRCFPLGNLDGASMTMGSSPRFPMYDNDFGWGRPLAVRSGKANKF  399

Query  320   DGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DGKISAFPGREGNG+VDLEVVLAPETMAG+E+D E+MQ+VS
Sbjct  400   DGKISAFPGREGNGTVDLEVVLAPETMAGIESDHEFMQFVS  440



>gb|KDO69082.1| hypothetical protein CISIN_1g012489mg [Citrus sinensis]
Length=462

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/451 (64%), Positives = 344/451 (76%), Gaps = 3/451 (1%)
 Frame = -3

Query  1547  ISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslska  1368
             +SKCTV PE + SN   LKLSVSDLPMLSC YIQKG L ++PP     LISLLK SLS+ 
Sbjct  14    VSKCTVLPE-QKSNLGDLKLSVSDLPMLSCHYIQKGCLFTRPPFPIDYLISLLKKSLSQT  72

Query  1367  lAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQY  1188
             L+HFP LAGR  TD+ G++YI SND G++F+H  A   S   +L     +P   +SFF  
Sbjct  73    LSHFPPLAGRFTTDSDGYIYITSNDAGVDFIHKNATVWSVRDILSPVH-VPENVKSFFAL  131

Query  1187  DSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISR  1008
             D T+SY GH +P++ +QVTEL+D VF+GC MNHAV DGTSFWNFFNT+AE+ KG KKIS+
Sbjct  132   DRTVSYEGHYRPILIVQVTELADGVFIGCAMNHAVADGTSFWNFFNTFAELTKGIKKISK  191

Query  1007  VPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGK-LCN  831
              P+F RD+V  SPAVL  P GG   TF  +EP+ E+IF F+RE+ILK+K R NN K + N
Sbjct  192   QPEFSRDSVLVSPAVLMIPDGGLKVTFDENEPLSERIFSFSRESILKLKARVNNNKWIDN  251

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
             G    +       N    L+   +  EISSFQSLSA LWR+VTRARKL  +K TTFRMA+
Sbjct  252   GHVDAVELLGKQSNDTYWLKKTESNGEISSFQSLSALLWRAVTRARKLHVNKMTTFRMAV  311

Query  650   NCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQ  471
             NCRHRL P+L PLYFGNAIQSIPT A AG++LS DL W AE L++NV AHDD TVRR ++
Sbjct  312   NCRHRLNPKLDPLYFGNAIQSIPTYASAGDVLSKDLRWCAEQLNKNVNAHDDKTVRRFVE  371

Query  470   DWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGR  291
             DWE+NPR+FPLGNFDGA ITMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGR
Sbjct  372   DWESNPRVFPLGNFDGASITMGSSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAFPGR  431

Query  290   EGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             EG G+VDLEV+LAPETMAG+E+D E+MQYVS
Sbjct  432   EGGGTVDLEVILAPETMAGIESDHEFMQYVS  462



>ref|XP_011076731.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Sesamum 
indicum]
Length=480

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/479 (61%), Positives = 357/479 (75%), Gaps = 22/479 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M S S+ V+SKC V+P+ + S    LKLSVSDLPMLSC YIQKG+L + PP   + L SL
Sbjct  1     MVSQSLPVVSKCAVFPD-QESTLGELKLSVSDLPMLSCHYIQKGILFTNPPFPISQLFSL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp-shADIP  1215
             LK SLS+ LA+FP LAGRL +DA G++YI  ND G++F+HA   H+  A +L  +  D+P
Sbjct  60    LKRSLSQTLAYFPPLAGRLVSDADGYIYISCNDAGVDFIHADGSHIHVADMLGPADGDVP  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
                R  F +D T+SY GH +P++A+QVTEL+D VF+GC++NHAVVDGTSFWNFFNT+AE+
Sbjct  120   GAVRGCFAFDETVSYEGHFRPILAVQVTELADGVFIGCSVNHAVVDGTSFWNFFNTFAEL  179

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
              +G K ISR PDF RD+V  SPAVLK P GGP  TFSGD PIRE+IF F+RE+ILK+K +
Sbjct  180   SRGVKWISRTPDFSRDSVLISPAVLKLPDGGPQVTFSGDAPIRERIFKFSRESILKLKAK  239

Query  854   ANNGKLCNGE------------NGKLNGKITPVNHEPGLQNGGAAS--------EISSFQ  735
              N+  L + +            N  L    + +     L+N             EISSFQ
Sbjct  240   VNDSSLEDDDGIDVAELMGKHSNDTLKFPDSKLTALTWLRNAVCGETKHRNPTVEISSFQ  299

Query  734   SLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELL  555
             SL A LWR +TRARKL  SKTTTFRMA+NCRHRL P+L+PLYFGNAIQSIPT A AG++L
Sbjct  300   SLCALLWRGITRARKLPPSKTTTFRMAVNCRHRLGPKLEPLYFGNAIQSIPTYALAGDVL  359

Query  554   SHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDN  375
             S DL W A  L++NV+AHD+A VR+ ++DWE NP+ FPLGNFDGAM+TMGSSPRFPMYDN
Sbjct  360   SKDLRWCAAQLNKNVMAHDNAIVRKYVEDWERNPQCFPLGNFDGAMVTMGSSPRFPMYDN  419

Query  374   DFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DFGWGRP+AVRSG ANKFDGKISAFPGREG GSVDLEV+LAPETMAGLE+D E+MQYVS
Sbjct  420   DFGWGRPVAVRSGRANKFDGKISAFPGREGGGSVDLEVILAPETMAGLESDPEFMQYVS  478



>gb|AHB08888.1| HXXXD-type acyl-transferase family protein [Suaeda glauca]
Length=481

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/478 (61%), Positives = 352/478 (74%), Gaps = 22/478 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             + SSS+ ++SK T+ P  + S    LKLSVSDLPMLSC YIQKG L ++PP+ +++LI L
Sbjct  4     LQSSSVTIMSKATIVPS-QPSTIGDLKLSVSDLPMLSCHYIQKGCLFTRPPIHSSSLIPL  62

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK  LS AL+HFPALAGR  TD  G+V+I  ND G++FVHA A  +    +L    D+P 
Sbjct  63    LKDGLSTALSHFPALAGRFVTDRYGYVFITCNDAGVDFVHATAKTVFVRDILSPD-DVPN  121

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF YD T+SY GH +PLMA+ VTEL+D VF+ C++NH+V DGTSFWNFFNT+AE+C
Sbjct  122   VVKEFFTYDRTVSYKGHFQPLMAVMVTELADGVFISCSVNHSVTDGTSFWNFFNTFAEVC  181

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G KKI++ PDF RD+V  SPAVLK P GGP  TF+  EP+RE+IF F+REAIL++K + 
Sbjct  182   RGVKKITKSPDFTRDSVMISPAVLKIPEGGPVVTFNEKEPLRERIFSFSREAILELKSKV  241

Query  851   NNGKLC----------------NGENGKLNGKI---TPVNHEPGL-QNGGAASEISSFQS  732
             NN K                       KL   I     V+    L +    A EISSFQS
Sbjct  242   NNKKFSISALELLGKQSNDPWDEKRASKLENWIRNAVAVSKPQSLTETDSMAVEISSFQS  301

Query  731   LSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLS  552
             L A LWR VTRARKL ++K TTFRMA+NCRHRLEP+L PLYFGNAIQSIPTVA   ++LS
Sbjct  302   LCALLWRCVTRARKLNSAKATTFRMAVNCRHRLEPKLDPLYFGNAIQSIPTVASVEDVLS  361

Query  551   HDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDND  372
             +DL W AE L++NV  HD+ TVR+ +Q+WE NPR FPLGNFDGAMITMGSSPRFPMYDND
Sbjct  362   NDLRWVAEQLNKNVRDHDNGTVRKYVQEWETNPRTFPLGNFDGAMITMGSSPRFPMYDND  421

Query  371   FGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FGWGRP+AVRSG ANKFDGKISAFPGREG GSVDLEVVL+PETMAGLE+D E+MQ+VS
Sbjct  422   FGWGRPVAVRSGYANKFDGKISAFPGREGGGSVDLEVVLSPETMAGLESDSEFMQFVS  479



>gb|EYU19983.1| hypothetical protein MIMGU_mgv1a005405mg [Erythranthe guttata]
Length=485

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/486 (61%), Positives = 354/486 (73%), Gaps = 31/486 (6%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M S S+ ++SK TV+P+ + S    LKLSVSDLPMLSC YIQKG L ++PP     LISL
Sbjct  1     MVSQSLPLVSKSTVFPD-QKSCLPDLKLSVSDLPMLSCHYIQKGGLFTKPPFPILELISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshA-DIP  1215
             LK+SLS+ L HFP LAGRL TD  G+VYI  ND G+EF+HA   H+  + LL S   D+P
Sbjct  60    LKISLSQTLVHFPPLAGRLTTDDDGYVYITCNDAGVEFIHANGSHICVSDLLGSADGDVP  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
                +  F +D T+SY GH +P++A+QVTEL+D VF+GC +NHAV DGTSFWNFFNT+AE+
Sbjct  120   EAVKGCFAFDQTVSYQGHFRPILAVQVTELADGVFIGCAVNHAVTDGTSFWNFFNTFAEL  179

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
              +G K+ISR PDF RD++  SPAVL+ P GGP  TFSGD P+RE+IF F+RE+ILK+K R
Sbjct  180   TRGVKRISRTPDFSRDSILISPAVLRLPEGGPKVTFSGDAPVRERIFRFSRESILKLKAR  239

Query  854   ANN-------------------GKLCNGENGKLNGKITPV--------NHEPGLQNGGAA  756
              N                    GK  N      + K+TP+          E  + N    
Sbjct  240   VNYNNTPKWGDRDGGIDAAELMGKQSNDTLKFPDRKLTPLAWLRNAVSTREANVTN--PT  297

Query  755   SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTV  576
              EISSFQSLSA LWR +TRARKL  SKTTTFRMA+NCRHRLEP+L PLYFGNAIQSIPT 
Sbjct  298   VEISSFQSLSALLWRGITRARKLPTSKTTTFRMAVNCRHRLEPKLDPLYFGNAIQSIPTY  357

Query  575   AKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSP  396
             A AG++L  DL W AE L+ NV+AH  +TVR+ I+DWE +PR FPLGNFDGAMITMGSSP
Sbjct  358   ASAGDVLGKDLRWCAEQLNTNVMAHGSSTVRKYIEDWERDPRCFPLGNFDGAMITMGSSP  417

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RFPMYDNDFGWGRP++VRSG ANKFDGKISAFPGREG G VDLEV+LAPETMAGLE+D E
Sbjct  418   RFPMYDNDFGWGRPVSVRSGRANKFDGKISAFPGREGGGCVDLEVILAPETMAGLESDPE  477

Query  215   YMQYVS  198
             +MQYVS
Sbjct  478   FMQYVS  483



>ref|XP_011036002.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Populus 
euphratica]
Length=488

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/493 (59%), Positives = 357/493 (72%), Gaps = 41/493 (8%)
 Frame = -3

Query  1571  MPS-SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MPS +S  ++SKCTV+P+ + S  + LKLSVSDLPMLSC YIQKG L + PP  +   + 
Sbjct  1     MPSATSRTIVSKCTVFPD-QKSTLQDLKLSVSDLPMLSCHYIQKGGLFTSPPALSIDSLI  59

Query  1394  l-lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
               LK SLS+ L+HFP LAGR +TD  GH+YI  ND G++F+HA A  +S   +L     +
Sbjct  60    SHLKQSLSQTLSHFPPLAGRFNTDFNGHIYITCNDAGVDFIHATATDISIQDILYPLH-V  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++ST+SY GH KP++A+QVTEL+D VF+GC+MNH+V DGTSFWNFFNT+AE
Sbjct  119   PDCIRGFFAFESTVSYQGHYKPILAVQVTELADGVFIGCSMNHSVTDGTSFWNFFNTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G KKISR PDF R+++  S AVLK P GGP  TF+ +EP+ E+IF F+REAILK+K 
Sbjct  179   VSRGIKKISRKPDFSRNSILISEAVLKVPQGGPRVTFNENEPLSERIFSFSREAILKLKS  238

Query  857   RANNGKLC-NGENGKLN-------------------GKIT-------------PVNHEPG  777
             + NN K   N +N  ++                   GK+T             P      
Sbjct  239   KVNNKKWSQNSDNTNVDVVELMGKQSNDTLFQIHNSGKMTTILENWFKNAVFKPQETVSN  298

Query  776   LQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNA  597
             LQ G    EISSFQSL A LWR+VTRARKL  SKTTTFRMA+NCRHRL P+L PLYFGNA
Sbjct  299   LQTG----EISSFQSLCALLWRAVTRARKLNPSKTTTFRMAVNCRHRLNPQLDPLYFGNA  354

Query  596   IQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAM  417
             IQSIPT A A ++LS DL W AE L++NV AH+D TVRR +QDWE+NPR FPLGN DGA 
Sbjct  355   IQSIPTYASAEDVLSRDLRWCAEQLNKNVAAHNDGTVRRFVQDWESNPRCFPLGNLDGAS  414

Query  416   ITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMA  237
             +TMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPG+EGNG+VDLEVVLAPETMA
Sbjct  415   MTMGSSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAFPGKEGNGTVDLEVVLAPETMA  474

Query  236   GLENDMEYMQYVS  198
             G+E+D E+MQ+VS
Sbjct  475   GIESDHEFMQFVS  487



>ref|XP_010262784.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nelumbo 
nucifera]
Length=490

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 362/493 (73%), Gaps = 38/493 (8%)
 Frame = -3

Query  1571  MP-SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MP S+S+ +ISKCTV PE + S+  +LKLSVSDLPMLSC YIQKGV+ ++PPL   +LIS
Sbjct  1     MPFSASLTLISKCTVLPE-QKSSIGNLKLSVSDLPMLSCHYIQKGVVFTRPPLPIDSLIS  59

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP  1215
             LLK  LSK L HFPALAGRL TD+ G+V+I  ND G++F+HA A HL+   ++     +P
Sbjct  60    LLKRGLSKTLTHFPALAGRLVTDSDGYVFIACNDAGVDFLHANAAHLTLRDIVSPAH-VP  118

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
                + FF +D T+SY GH KP+ A+QVTEL+D VF+GC++NHAV DGTSFWNFFNT+AE+
Sbjct  119   DSVKEFFAFDRTISYDGHFKPVAAVQVTELADGVFIGCSVNHAVTDGTSFWNFFNTFAEV  178

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             C+G  KISR PDF R+    S AVL+FP GGP  TFS D P+ E+IFHF+REAILK+K R
Sbjct  179   CRGVSKISRPPDFRRNFFKGSLAVLRFPEGGPKVTFSVDAPLSERIFHFSREAILKLKSR  238

Query  854   ANN-------------GKLCN------GEN-GKLNGKITPVNHEPGLQNGGAAS------  753
             AN              GK  N      G+N    NGKI  V     L+N  + S      
Sbjct  239   ANGKVDNEFAIETEILGKQSNDGWKPHGDNHNHPNGKIASVLGS-WLRNAVSKSQYTETE  297

Query  752   --------EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNA  597
                     EISSFQSL AQLWRSVTRARK   SK TTFRMA+NCR R+EP++ P YFGNA
Sbjct  298   SKSPDQTVEISSFQSLCAQLWRSVTRARKFPPSKATTFRMAVNCRQRIEPKVDPYYFGNA  357

Query  596   IQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAM  417
             IQSIP+VA  GE+LS DL   A +L+RNVVA++DATVRR + DWE NPR FPLGNFDGAM
Sbjct  358   IQSIPSVASVGEVLSGDLRACAILLNRNVVAYNDATVRRVVDDWEKNPRCFPLGNFDGAM  417

Query  416   ITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMA  237
             ITMGSSPRFPMYDNDFGWG+P+AVRSG ANKFDGKISAFPGREG GSVDLEV LAPETMA
Sbjct  418   ITMGSSPRFPMYDNDFGWGQPMAVRSGRANKFDGKISAFPGREGGGSVDLEVCLAPETMA  477

Query  236   GLENDMEYMQYVS  198
             GLEND E+MQYVS
Sbjct  478   GLENDSEFMQYVS  490



>ref|XP_009601485.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/486 (60%), Positives = 357/486 (73%), Gaps = 31/486 (6%)
 Frame = -3

Query  1571  MPSSS---IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaal  1401
             MP S+   + ++SKCT++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     L
Sbjct  1     MPCSTMGVLTLLSKCTIFPS-QKSSLSDLKLSVSDLPMLSTHYIQKGGLFTRPPFSITDL  59

Query  1400  isllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshAD  1221
             +SLLK SLS+ L  FP LAGRL TD+ G+VYI  ND G +F+HA A H+    ++ S  D
Sbjct  60    LSLLKRSLSQTLTQFPPLAGRLVTDSDGYVYISCNDAGADFIHAAATHIFVRDVIGSI-D  118

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P   + FF +D T+SY GH  PL+A+QVTEL+D VF+GC++NHAV+DGTS WNFFNT+A
Sbjct  119   VPDHVKEFFTFDRTVSYQGHINPLLAVQVTELADGVFIGCSVNHAVIDGTSLWNFFNTFA  178

Query  1040  EICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             E+ +G K+I+R PDF RD+V  SPAVLK PAGGP  TFS D P+RE+IF F+RE+IL++K
Sbjct  179   ELTRGVKRITRQPDFSRDSVLISPAVLKIPAGGPKVTFSLDAPLRERIFSFSRESILRLK  238

Query  860   FRANN----------------GKLCNGENGKLNGKITPVN---------HEPGLQNGGAA  756
              + NN                GK  N      +GKITP+             G+     A
Sbjct  239   DKTNNNHKWNVDGEIDIAELMGKQSNDPLKISDGKITPLTWLRNAVRKTETEGITENQTA  298

Query  755   SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTV  576
              EISSFQSL A LWR+VTRARK  ASK TTFRMA+NCRHRL+P+L PLYFGNAIQSIPT 
Sbjct  299   -EISSFQSLCALLWRAVTRARKFHASKMTTFRMAVNCRHRLQPKLHPLYFGNAIQSIPTY  357

Query  575   AKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSP  396
             A AG++LSHDL W AE L++NV  HD+  VR+ ++DWE++PR FPLGNFDGAM+TMGSSP
Sbjct  358   ASAGDVLSHDLRWCAEQLNKNVKVHDNGMVRKYVEDWESDPRCFPLGNFDGAMLTMGSSP  417

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RFPMYDNDFGWGRP+AVRSG ANKFDGKISAFPGREG GSVDLEVVLAPETM GLE+D E
Sbjct  418   RFPMYDNDFGWGRPIAVRSGRANKFDGKISAFPGREGGGSVDLEVVLAPETMDGLESDPE  477

Query  215   YMQYVS  198
             +MQ+V+
Sbjct  478   FMQFVT  483



>emb|CBI31531.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/461 (63%), Positives = 347/461 (75%), Gaps = 5/461 (1%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M   S+ ++S CTV PE K S+   LKLS SDLPMLSC YIQKG L ++PP    AL++L
Sbjct  1     MRPDSVTIVSNCTVIPE-KKSSLGDLKLSASDLPMLSCHYIQKGGLFTRPPFPIDALLAL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK +LS  L HFP LAGRL TDA G+VYI  ND G++F+HA A H+    LL     +P 
Sbjct  60    LKRALSSTLVHFPPLAGRLITDAHGYVYITCNDAGVDFIHANAGHIFIRDLLSPIH-VPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY GH KP+MA+QVTEL+D VF+GC +NHAV DGTSFWNFFNT+A++ 
Sbjct  119   SFKEFFAFDRTVSYDGHFKPIMAVQVTELADGVFIGCAVNHAVTDGTSFWNFFNTFADLS  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+ISR P F R +V  S AVL  P GGP  TFSGD P+ E+IF F+REAILK+K + 
Sbjct  179   RGLKRISRAPCFERKSVLISQAVLMVPQGGPKVTFSGDAPLAERIFSFSREAILKLKSKV  238

Query  851   NNGKL-CNGENGKLN--GKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEA  681
             NN +  C GE   +   GK +    +P  +  G   EISSFQSLSA LWR+VTRARK   
Sbjct  239   NNHQSSCIGEIDAIEILGKQSNDPWKPDQKASGKTVEISSFQSLSALLWRAVTRARKFHP  298

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
             SKTTTFRMA+N RHRLEP+L PLYFGNAIQSIPT A AG++LS DL W AE L+ NV AH
Sbjct  299   SKTTTFRMAVNVRHRLEPKLDPLYFGNAIQSIPTYASAGDVLSRDLRWCAEQLNSNVKAH  358

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKF  321
             +D  VR+ I DWE++P+ FPLGNFDGAMITMGSSPRFPMYDNDFGWGRP+A+R G ANKF
Sbjct  359   NDDMVRKFIGDWESSPKCFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPMAIRGGRANKF  418

Query  320   DGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DGKISAFPGREG GSVDLEVVL+PETMAGLE+D E+MQYV+
Sbjct  419   DGKISAFPGREGGGSVDLEVVLSPETMAGLESDSEFMQYVT  459



>ref|XP_010690020.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Beta 
vulgaris subsp. vulgaris]
Length=492

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/481 (59%), Positives = 346/481 (72%), Gaps = 27/481 (6%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             S+S+ +ISK TV+P   S+            PMLSC YIQKG L ++P L+++ LISLLK
Sbjct  12    STSVKIISKSTVFPAIPSTMEDLKLSVSDL-PMLSCHYIQKGNLFTRPNLNSSTLISLLK  70

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
              SLS  L HFPALAGR  TD+ G++YI  ND G++FVHA A ++    +L    D+P   
Sbjct  71    DSLSTTLTHFPALAGRFITDSLGYIYITCNDSGVDFVHAVAKNVYIRDILSPT-DVPNVV  129

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             + FF YD  +SY GH +PLMA+QVTEL D VF+ C++NH+V DGTSFWNFFNT+AE+C+G
Sbjct  130   KEFFTYDRVVSYKGHFQPLMAVQVTELGDGVFISCSVNHSVTDGTSFWNFFNTFAEVCRG  189

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
              K+I++ PDF R++V  SPA+LK P GGP  TF    PIRE+IF F+REAIL++K + NN
Sbjct  190   VKRITKSPDFCRNSVIISPAILKVPEGGPVVTFDTKAPIRERIFSFSREAILELKSKVNN  249

Query  845   GKLC----------------NGENGKLNGKI-------TPVNHEPGL--QNGGAASEISS  741
              K                  + ++ K+  K+         V+    L      AA EISS
Sbjct  250   RKFSISAVELIGKQSNDPWNSNKDAKMASKLENWIRNAVAVSKPQSLIETESMAAVEISS  309

Query  740   FQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGE  561
             FQSLSA LWR VTRARKL   KTTTFRMA+NCRHRLEP+L PLYFGNAIQSIPT A A +
Sbjct  310   FQSLSALLWRCVTRARKLNPEKTTTFRMAVNCRHRLEPKLNPLYFGNAIQSIPTFASADD  369

Query  560   LLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMY  381
             +LS+DL WAAE L++NV  H + TVR+ + +WE+NPR FPLGNFDGAMITMGSSPRFPM+
Sbjct  370   VLSNDLRWAAEQLNKNVKDHGNDTVRKYVAEWESNPRTFPLGNFDGAMITMGSSPRFPMF  429

Query  380   DNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
             DNDFGWGRP+AVRSG ANKFDGKISAFPGREG GSVDLEVVLAPETMAGLE+D E+MQYV
Sbjct  430   DNDFGWGRPVAVRSGWANKFDGKISAFPGREGGGSVDLEVVLAPETMAGLESDPEFMQYV  489

Query  200   S  198
             S
Sbjct  490   S  490



>gb|KDP44821.1| hypothetical protein JCGZ_01321 [Jatropha curcas]
Length=487

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/488 (60%), Positives = 356/488 (73%), Gaps = 32/488 (7%)
 Frame = -3

Query  1571  MP-SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MP + S+ ++SKCTV+P+ + S    LKLSVSDLPMLSC YIQKG L ++PP+   +LIS
Sbjct  1     MPLAPSLTLVSKCTVFPD-QKSTMGDLKLSVSDLPMLSCHYIQKGGLFTRPPISIESLIS  59

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP  1215
              LK SLS+ L  FP LAGR  TD+ G+VYI  ND G++F+HA A H+S   +L  +  +P
Sbjct  60    SLKCSLSRTLTQFPPLAGRFRTDSNGYVYITCNDAGVDFLHATATHISVYDILSPNY-VP  118

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
                ++FF +D T+SY GH KP +A+QVTEL+D VF+GC +NH+V DGTSFWNFFNT+AE 
Sbjct  119   DCVKTFFAFDRTVSYDGHYKPFLAVQVTELADGVFIGCALNHSVTDGTSFWNFFNTFAEF  178

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
              +G KKISR PDF R++V  SPAVL+ P GGP  TF  + P+RE+IF F+REA+LK+K R
Sbjct  179   SRGIKKISRQPDFSRNSVLVSPAVLQVPEGGPKVTFDENAPLRERIFSFSREALLKLKAR  238

Query  854   ANNGKLCNGE--------------------NGKLNGKITPVNHEPGLQ-------NGGA-  759
             ANN K  +                      NGK+  KI    ++  +        NG A 
Sbjct  239   ANNKKWIDNSGIDAVELMGKQSNDPFHHQINGKMMTKILESFYKNAVSKPQETESNGSAV  298

Query  758   -ASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIP  582
              A EISSFQSL A LWR+VTRARKL  +KTTTFRMA+NCRHRL P+L PLYFGNAIQS P
Sbjct  299   AAVEISSFQSLCALLWRAVTRARKLNPNKTTTFRMAVNCRHRLNPKLDPLYFGNAIQSSP  358

Query  581   TVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGS  402
             T A AG++LS DL W AE L++NV AH+D TVRR I+ WE NPR FPLGNFDGA +TMGS
Sbjct  359   TYASAGDVLSRDLRWCAEQLNKNVQAHNDGTVRRFIETWEENPRCFPLGNFDGASLTMGS  418

Query  401   SPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEND  222
             S RFPMYDNDFGWGRPLA+RSG ANKFDGKISAFPGREG GSVDLEVVL+PETMAG+E+D
Sbjct  419   SARFPMYDNDFGWGRPLAIRSGRANKFDGKISAFPGREGGGSVDLEVVLSPETMAGIESD  478

Query  221   MEYMQYVS  198
              E++QYVS
Sbjct  479   FEFLQYVS  486



>ref|XP_009803702.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=485

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/479 (60%), Positives = 352/479 (73%), Gaps = 28/479 (6%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkls  1380
             ++ ++SKCT++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     L+SLLK S
Sbjct  8     AVTLLSKCTIFPS-QKSSLPDLKLSVSDLPMLSTHYIQKGGLFTRPPFSITDLLSLLKRS  66

Query  1379  lskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRS  1200
             LS+ L  FP LAGRL TD+ G+VYI  ND G +F+HA A H+    ++ S  D+P     
Sbjct  67    LSQTLTQFPPLAGRLVTDSDGYVYISCNDAGADFIHAAATHIFVRDVIGSI-DVPDHVNE  125

Query  1199  FFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK  1020
             FF +D T+SY GH  PL+A++VTEL+D VF+GC++NHAV+DGTS WNFFNT+AE+ +G K
Sbjct  126   FFAFDRTVSYQGHFNPLLAVKVTELADGVFIGCSVNHAVIDGTSLWNFFNTFAELTRGVK  185

Query  1019  KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN--  846
             +I+R PDF RD+V  SPAVLK PAGGP  TFS D P+RE+IF F+RE+I ++K + NN  
Sbjct  186   RITRQPDFSRDSVLISPAVLKLPAGGPKVTFSLDAPLRERIFSFSRESIRRLKVKTNNKH  245

Query  845   --------------GKLCNGENGKLNGKITPVN---------HEPGLQNGGAASEISSFQ  735
                           GK  N      +GKITP+             G+     A EISSFQ
Sbjct  246   KWNVDGEIDITELMGKQSNDPLKISDGKITPLTWLRNAVRKTETEGITENQTA-EISSFQ  304

Query  734   SLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELL  555
             SL A LWR VTRARK  ASK TTFRMA+NCRHRL+P+L PLYFGNAIQSIPT A AG++L
Sbjct  305   SLCALLWREVTRARKFHASKMTTFRMAVNCRHRLQPKLHPLYFGNAIQSIPTYASAGDVL  364

Query  554   SHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDN  375
             SHDL W AE L++NV  HD+  VR+ ++DWE++PR FPLGNFDGAM+TMGSSPRFPMYDN
Sbjct  365   SHDLRWCAEQLNKNVKVHDNDMVRKCVEDWESDPRCFPLGNFDGAMLTMGSSPRFPMYDN  424

Query  374   DFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DFGWGRP+AVRSG ANKFDGKISAFPGR+G GSVDLEVVLAPETMAGLE+D E+MQ+V+
Sbjct  425   DFGWGRPIAVRSGRANKFDGKISAFPGRKGGGSVDLEVVLAPETMAGLESDPEFMQFVT  483



>ref|XP_006355659.1| PREDICTED: BAHD acyltransferase DCR-like [Solanum tuberosum]
Length=463

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/462 (61%), Positives = 353/462 (76%), Gaps = 7/462 (2%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPS+++ ++SKC ++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     LISL
Sbjct  1     MPSATVNLVSKCIIFPS-EKSSLTDLKLSVSDLPMLSVHYIQKGCLFTRPPFPIPQLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS+ L HFP LAGR  TD+ G+VYI  ND+G++FVHA A H+S   ++ S  D+P 
Sbjct  60    LKHSLSQTLTHFPPLAGRFVTDSDGYVYITCNDDGVDFVHATATHISIRDVIGSI-DVPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF  D T+SY GH  PL+A+QVTEL+D VF+GC +NH+V DGTSFWNFFNT+AE+ 
Sbjct  119   HVKEFFPLDRTVSYRGHFIPLLAVQVTELADGVFIGCAVNHSVTDGTSFWNFFNTFAEVS  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+I R PDF RD+V  S +VLK PA GP  TF+GD P+RE+IF F+RE+I ++K + 
Sbjct  179   RGVKRIVRQPDFTRDSVLISNSVLKLPADGPKVTFAGDAPLRERIFSFSRESIQRLKAKT  238

Query  851   NNGKL-CNGENG--KLNGKIT--PVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKL  687
             NN KL  +GE    +L  K +  P+  +   +     +EISSFQSL A LWR+VTRARK 
Sbjct  239   NNQKLNFDGEINIVELMSKQSNDPLKIKTETEKINPTAEISSFQSLCALLWRAVTRARKF  298

Query  686   EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVV  507
              ASK TTFRMA+NCRHRL+P+L PLYFGNAIQSIPT   AG++LSHDL W AE L++NV 
Sbjct  299   PASKMTTFRMAVNCRHRLQPKLNPLYFGNAIQSIPTYVSAGDVLSHDLHWCAEQLNKNVK  358

Query  506   AHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMAN  327
             AHDD  VR+ ++DWE +PR FPLGNFDGAM+TMGSSPRFPMY+NDFGWGRP+AVRSG AN
Sbjct  359   AHDDVMVRKFVEDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYENDFGWGRPVAVRSGRAN  418

Query  326   KFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
             KFDGKISAFPGREG G+VDLEV+L+PETM  LE+D E+MQ+V
Sbjct  419   KFDGKISAFPGREGGGNVDLEVILSPETMDALESDPEFMQFV  460



>ref|XP_002276050.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Vitis 
vinifera]
Length=487

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 353/487 (72%), Gaps = 32/487 (7%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M   S+ ++S CTV PE K S+   LKLS SDLPMLSC YIQKG L ++PP    AL++L
Sbjct  1     MRPDSVTIVSNCTVIPE-KKSSLGDLKLSASDLPMLSCHYIQKGGLFTRPPFPIDALLAL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK +LS  L HFP LAGRL TDA G+VYI  ND G++F+HA A H+    LL     +P 
Sbjct  60    LKRALSSTLVHFPPLAGRLITDAHGYVYITCNDAGVDFIHANAGHIFIRDLLSPIH-VPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY GH KP+MA+QVTEL+D VF+GC +NHAV DGTSFWNFFNT+A++ 
Sbjct  119   SFKEFFAFDRTVSYDGHFKPIMAVQVTELADGVFIGCAVNHAVTDGTSFWNFFNTFADLS  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+ISR P F R +V  S AVL  P GGP  TFSGD P+ E+IF F+REAILK+K + 
Sbjct  179   RGLKRISRAPCFERKSVLISQAVLMVPQGGPKVTFSGDAPLAERIFSFSREAILKLKSKV  238

Query  851   NNGKL-CNGE-----------------NGKLNGKITPVNHEPGLQNGGAAS---------  753
             NN +  C GE                 + K +GK+T V  E  L+N  A S         
Sbjct  239   NNHQSSCIGEIDAIEILGKQSNDPWKPDQKASGKVTSV-LENWLKNAVAVSKPQTDCPNQ  297

Query  752   --EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPT  579
               EISSFQSLSA LWR+VTRARK   SKTTTFRMA+N RHRLEP+L PLYFGNAIQSIPT
Sbjct  298   TVEISSFQSLSALLWRAVTRARKFHPSKTTTFRMAVNVRHRLEPKLDPLYFGNAIQSIPT  357

Query  578   VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSS  399
              A AG++LS DL W AE L+ NV AH+D  VR+ I DWE++P+ FPLGNFDGAMITMGSS
Sbjct  358   YASAGDVLSRDLRWCAEQLNSNVKAHNDDMVRKFIGDWESSPKCFPLGNFDGAMITMGSS  417

Query  398   PRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDM  219
             PRFPMYDNDFGWGRP+A+R G ANKFDGKISAFPGREG GSVDLEVVL+PETMAGLE+D 
Sbjct  418   PRFPMYDNDFGWGRPMAIRGGRANKFDGKISAFPGREGGGSVDLEVVLSPETMAGLESDS  477

Query  218   EYMQYVS  198
             E+MQYV+
Sbjct  478   EFMQYVT  484



>ref|XP_006355660.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=457

 Score =   530 bits (1364),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 283/459 (62%), Positives = 349/459 (76%), Gaps = 5/459 (1%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M ++ + ++SKCT++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     LISL
Sbjct  1     MTTAPVALVSKCTIFPS-EKSSLPDLKLSVSDLPMLSVHYIQKGCLFTRPPFPIPQLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LKLSLS+ L HFP LAGR  TD+ G+VYI  NDEG++FVHA A H+    ++ S  D+P 
Sbjct  60    LKLSLSQTLTHFPPLAGRFVTDSDGYVYITCNDEGVDFVHATATHIFIRDVIGSI-DVPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF  D T+SY GH  PL+A+QVTEL+D VF+GC +NH+V DGTS WNFFNT+AE+ 
Sbjct  119   HVKEFFPLDRTVSYRGHFIPLLAVQVTELADGVFIGCAVNHSVTDGTSIWNFFNTFAEVS  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+I R PDF RD+V  S +VLK PA GP  TFSGD P+RE+IF F+RE+ILK+K + 
Sbjct  179   RGVKRIVRQPDFTRDSVLISNSVLKLPADGPEITFSGDAPLRERIFSFSRESILKLKAKT  238

Query  851   NNGKLCNGENGKLN-GKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASK  675
             NN KL    +G++N  ++        ++     +EISSFQSL A LWR+VTRARK   SK
Sbjct  239   NNQKL--SFDGEINIVELIAKQSNDHMKIKTETAEISSFQSLCALLWRAVTRARKFPPSK  296

Query  674   TTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDD  495
              TTFRMA+NCRHRL+P+L PLYFGNAIQSIP  A AGE+LS+DL W AE L +NV AHDD
Sbjct  297   MTTFRMAVNCRHRLQPKLNPLYFGNAIQSIPIYASAGEVLSNDLYWCAEQLTKNVNAHDD  356

Query  494   ATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDG  315
               VR+ ++DWE +PR FPLGNFDGAM+TMGSSPRFPMYDNDFGWGRP+AVRSG ANKFDG
Sbjct  357   VMVRKFVEDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYDNDFGWGRPVAVRSGRANKFDG  416

Query  314   KISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             KISAFPGREG GSVDLEV+L+PETM  LE+D E+MQYV+
Sbjct  417   KISAFPGREGGGSVDLEVILSPETMEALESDPEFMQYVT  455



>emb|CAN80937.1| hypothetical protein VITISV_005841 [Vitis vinifera]
Length=487

 Score =   530 bits (1365),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 297/487 (61%), Positives = 352/487 (72%), Gaps = 32/487 (7%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M   S+ ++S CTV PE K S+   LKLS SDLPMLSC YIQKG L ++PP    AL++L
Sbjct  1     MRPBSVTIVSXCTVIPE-KKSSLGDLKLSASDLPMLSCHYIQKGGLFTRPPFPIDALLAL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK +LS  L HFP LAGRL TDA G+VYI  ND G++F+HA A H+    LL     +P 
Sbjct  60    LKRALSSTLVHFPPLAGRLITDAHGYVYITCNDAGVDFIHANAGHIFIRDLLSPIH-VPD  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+SY GH KP+MA+QVTEL+D VF+GC +NHAV DGTSFWNFFNT+A++ 
Sbjct  119   SFKEFFAFDRTVSYDGHFKPIMAVQVTELADGVFIGCAVNHAVTDGTSFWNFFNTFADLS  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+ISR P F R +V  S AVL  P GGP  TFSGD P+ E+IF F+REAILK+K + 
Sbjct  179   RGLKRISRAPCFERKSVLISQAVLMVPQGGPKVTFSGDAPLAERIFSFSREAILKLKSKV  238

Query  851   NNGKL-CNGE-----------------NGKLNGKITPVNHEPGLQNGGAAS---------  753
             NN K  C GE                 + K +GK+  V  E  L+N  A S         
Sbjct  239   NNHKSSCIGEIDAIEILGKQSNDPWKPDQKASGKVXSV-LENWLKNAVAVSKPQTDCPNQ  297

Query  752   --EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPT  579
               EISSFQSLSA LWR+VTRARK   SKTTTFRMA+N RHRLEP+L PLYFGNAIQSIPT
Sbjct  298   TVEISSFQSLSALLWRAVTRARKFHPSKTTTFRMAVNVRHRLEPKLDPLYFGNAIQSIPT  357

Query  578   VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSS  399
              A AG++LS DL W AE L+ NV AH+D  VR+ I DWE++P+ FPLGNFDGAMITMGSS
Sbjct  358   YASAGDVLSRDLRWCAEQLNSNVKAHNDDMVRKFIGDWESSPKCFPLGNFDGAMITMGSS  417

Query  398   PRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDM  219
             PRFPMYDNDFGWGRP+A+R G ANKFDGKISAFPGREG GSVDLEVVL+PETMAGLE+D 
Sbjct  418   PRFPMYDNDFGWGRPMAIRGGRANKFDGKISAFPGREGGGSVDLEVVLSPETMAGLESDS  477

Query  218   EYMQYVS  198
             E+MQYV+
Sbjct  478   EFMQYVT  484



>ref|XP_009799023.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=485

 Score =   525 bits (1352),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 284/479 (59%), Positives = 350/479 (73%), Gaps = 28/479 (6%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkls  1380
             ++ ++SKCT++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     L+SLLK S
Sbjct  8     AVTLLSKCTIFPS-QKSSLSDLKLSVSDLPMLSTHYIQKGGLFTRPPFSITDLLSLLKRS  66

Query  1379  lskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRS  1200
             LS+ L  FP LAGRL TD+ G+VYI  N  G  F+HA A H+    ++ S  D+P   + 
Sbjct  67    LSQTLTQFPPLAGRLVTDSDGYVYISCNGAGAGFIHAAANHIFVRDVIGSI-DVPDLVKE  125

Query  1199  FFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK  1020
             FF +D T+SY GH  PL+A+QVTEL+D +F+GC++NHAV+DGTS WNFFNT+AE+ +G K
Sbjct  126   FFTFDRTVSYQGHFNPLLAVQVTELADGIFIGCSVNHAVIDGTSLWNFFNTFAELTRGVK  185

Query  1019  KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN--  846
             +I+R PDF RD+V  SPAVLK P GGP  TFS D P+RE+IF F+RE+IL++K + NN  
Sbjct  186   RITRQPDFSRDSVLISPAVLKLPDGGPKVTFSLDAPLRERIFSFSRESILRLKDKTNNNH  245

Query  845   --------------GKLCNGENGKLNGKITPVN---------HEPGLQNGGAASEISSFQ  735
                           GK  N    K +GK+T +             G+     A EISSFQ
Sbjct  246   KWNVDGEIDIAELMGKQSNDPIKKSDGKVTTLTWLRNAVRKTETEGITENQTA-EISSFQ  304

Query  734   SLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELL  555
             SL A LWR+VTRARK  ASK TTFRMA+NCRHRL+P+L PLYFGNAIQSIPT A AGE+L
Sbjct  305   SLCALLWRAVTRARKFHASKMTTFRMAVNCRHRLQPKLHPLYFGNAIQSIPTYASAGEVL  364

Query  554   SHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDN  375
             SHDL W AE L++NV  HD+  VR+ ++DWE++PR FPLGNFDGAM+TMGSSPRFPMYDN
Sbjct  365   SHDLRWCAEQLNKNVKVHDNDMVRKYVEDWESDPRCFPLGNFDGAMLTMGSSPRFPMYDN  424

Query  374   DFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DFGWGRP+AV SG ANKFDGKISAFPGREG GSVDLEVVLAPETM GLE+D E+MQ+V+
Sbjct  425   DFGWGRPIAVLSGRANKFDGKISAFPGREGGGSVDLEVVLAPETMDGLESDPEFMQFVT  483



>ref|XP_004239937.1| PREDICTED: BAHD acyltransferase DCR-like [Solanum lycopersicum]
Length=457

 Score =   524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 277/459 (60%), Positives = 351/459 (76%), Gaps = 5/459 (1%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPS+++ ++SKCT++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     LISL
Sbjct  1     MPSATVNLVSKCTIFPS-EKSSPNYLKLSVSDLPMLSVHYIQKGCLFTRPPFPIPQLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK++LS  L  FP LAGR  TD+ G+VYI  ND+G++FVHA A H+    ++ S  D+P 
Sbjct  60    LKINLSHTLTDFPPLAGRFVTDSDGYVYINCNDDGVDFVHATATHICIRDVIGSI-DVPH  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF  D T+SY GH  PL+A+QVTEL+D VF+GC +NH+V DGTSFWNFFNT+AE+ 
Sbjct  119   CVKEFFPLDRTVSYRGHFIPLLAVQVTELADGVFIGCAVNHSVTDGTSFWNFFNTFAEVS  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+I R PDF RD+V  + +VLK PA GP  TF+GD P+RE+IF F+RE+I ++K + 
Sbjct  179   RGVKRIVRQPDFTRDSVLITNSVLKLPADGPKVTFAGDAPLRERIFSFSRESIQRLKAKT  238

Query  851   NNGKLCNGENGKLN-GKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASK  675
             NN KL    +G++N  ++        L+    ++EISSFQSL A LWR+VTRARK  +SK
Sbjct  239   NNQKL--NFDGEINIVELIAKQSNDHLKIKTESAEISSFQSLCALLWRAVTRARKFPSSK  296

Query  674   TTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDD  495
              TTFRMA+NCRHRL+P+L PLYFGNAIQSIPT   AG++LSHDL W AE L++NV AHDD
Sbjct  297   MTTFRMAVNCRHRLQPKLNPLYFGNAIQSIPTYVSAGDVLSHDLRWCAEQLNKNVKAHDD  356

Query  494   ATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDG  315
               VR+ + DWE +PR FPLGNFDGAM+TMGSSPRFPMY+NDFGWGRP+AVRSG ANKFDG
Sbjct  357   FMVRKFVGDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYENDFGWGRPVAVRSGRANKFDG  416

Query  314   KISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             KISAFPGREG GSVDLEV+L+PETM  LE+D E+MQ+V+
Sbjct  417   KISAFPGREGGGSVDLEVILSPETMDALESDPEFMQFVN  455



>ref|XP_006355661.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=460

 Score =   524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 280/462 (61%), Positives = 353/462 (76%), Gaps = 8/462 (2%)
 Frame = -3

Query  1571  MPSSS---IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaal  1401
             MPS++   + ++SKCT++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     L
Sbjct  1     MPSAAAAHVTLLSKCTIFPS-EKSSLPHLKLSVSDLPMLSVHYIQKGCLFTRPPFPIPQL  59

Query  1400  isllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshAD  1221
             ISLLKLSLS+ L  FP LAGR  TD   +VYI  ND+G++FVHA A H+    ++ S  D
Sbjct  60    ISLLKLSLSQTLTRFPPLAGRFVTDLNDYVYITCNDDGVDFVHATATHIFIRDIIGSI-D  118

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P   + FF  D T+SY GH  PL+A+QVTEL+D VF+GC +NH+V DGTSFWNFFNT+A
Sbjct  119   VPDHVKEFFPLDRTVSYRGHFIPLLAVQVTELADGVFIGCAVNHSVTDGTSFWNFFNTFA  178

Query  1040  EICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             E+ +G K+I R PDF R++V  S +VLK PA GP  TF+GD P+RE+IF F+RE+I ++K
Sbjct  179   EVSRGVKRIVRQPDFTRNSVLISNSVLKLPADGPKVTFAGDAPLRERIFSFSRESIQRLK  238

Query  860   FRANNGKLCNGENGKLN-GKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLE  684
              + NN KL    +G++N  K+    +   L+    ++EISSFQSL A LWR+VTRARK  
Sbjct  239   AKTNNQKL--KFDGEINIVKLMEKQNNDHLKIKTESAEISSFQSLCALLWRAVTRARKFP  296

Query  683   ASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVA  504
             ASK TTFRMA+NCRHRL+P+L PLYFGNAIQSIPT   AG++LSHDL W AE L++NV A
Sbjct  297   ASKMTTFRMAVNCRHRLQPKLNPLYFGNAIQSIPTYVSAGDVLSHDLHWCAEQLNKNVKA  356

Query  503   HDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANK  324
             HDD  VR+ ++DWE +PR FPLGNFDGAM+TMGSSPRFPMY+NDFGWGRP+AVRSG ANK
Sbjct  357   HDDVMVRKFVEDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYENDFGWGRPIAVRSGRANK  416

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGKISAFPGR+G GSVDLEV+L+PETM GLE+D E+M+YV+
Sbjct  417   FDGKISAFPGRKGGGSVDLEVILSPETMEGLESDTEFMEYVT  458



>ref|XP_002311205.2| transferase family protein [Populus trichocarpa]
 gb|EEE88572.2| transferase family protein [Populus trichocarpa]
Length=488

 Score =   525 bits (1351),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 278/489 (57%), Positives = 354/489 (72%), Gaps = 33/489 (7%)
 Frame = -3

Query  1571  MPS-SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MPS +S+ ++S+C V+P+ + S  + LKLSVSDLPMLSC YIQKG L ++PP  +   + 
Sbjct  1     MPSATSVTIVSQCNVFPD-QKSTLEDLKLSVSDLPMLSCHYIQKGGLFTRPPTLSIDSLI  59

Query  1394  l-lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
               LK SLS+ L+HFP LAGR +TD+ G++YI  ND G++F+HA A  +S   +L     +
Sbjct  60    SHLKQSLSQTLSHFPPLAGRFNTDSNGYIYITCNDAGVDFIHATATSISIQDILSPLH-V  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R  F ++ST+SY GH KP++A+QVTEL+D VF+GC+MNH+V DGTSFW FFNT++E
Sbjct  119   PDCVRGLFAFESTVSYQGHYKPIVAVQVTELADGVFIGCSMNHSVTDGTSFWTFFNTFSE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G KKISR PDF R+++  S AVLK P GGP  TF+ +EP+ E+IF F+REAILK+K 
Sbjct  179   VSRGIKKISRQPDFSRNSILISEAVLKVPQGGPQVTFNENEPLCERIFSFSREAILKLKS  238

Query  857   RANNGKLCNGEN------------------------GKLNGKI-----TPVNHEPGLQNG  765
             + NN K     +                        GK+ G +       V+    +++ 
Sbjct  239   KVNNKKWTQKSDNTNVDAVELMGKQSNDTLLQIHNKGKMTGILESWFKNAVSKPQEMESN  298

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
              +  EISSFQSL A LWR+VTRARKL  SK TTFRMA+NCRHRL P+L PLYFGNAIQS+
Sbjct  299   LSMVEISSFQSLCALLWRAVTRARKLNPSKRTTFRMAVNCRHRLNPKLDPLYFGNAIQSV  358

Query  584   PTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMG  405
             PT A AG++LS DL W AE L+++V AH+D  VRR ++DWE+NPR FPLGN DGA +TMG
Sbjct  359   PTYASAGDVLSRDLRWCAEQLNKSVAAHNDEMVRRFVEDWESNPRCFPLGNLDGASMTMG  418

Query  404   SSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEN  225
             SSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGREGNG+VDLEVVLAPE MAG+E+
Sbjct  419   SSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAFPGREGNGTVDLEVVLAPEAMAGIES  478

Query  224   DMEYMQYVS  198
             D E+MQ+VS
Sbjct  479   DHEFMQFVS  487



>ref|XP_007009085.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY17895.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=486

 Score =   524 bits (1350),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 291/487 (60%), Positives = 347/487 (71%), Gaps = 31/487 (6%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSS +V++SK TV+P+ + SN   LKLSVSDLPMLSC YIQKG L + PP+   +L+SL
Sbjct  1     MPSSPLVLVSKSTVFPD-RKSNLGELKLSVSDLPMLSCHYIQKGCLFTLPPVPIDSLVSL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLSK L+ F  LAGRLHTD  G++Y+  ND G+EF H           +     +P 
Sbjct  60    LKQSLSKTLSFFSPLAGRLHTDQNGYIYVSCNDAGVEF-HHSKCATRFVRDVIGPIHVPE  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               + FF +D T+SY GH KP+MA+QVTEL+D  F+GC++NHAVVDGTSFWNFFNT+AEIC
Sbjct  119   LVKEFFCFDKTVSYQGHYKPIMAVQVTELADGFFIGCSVNHAVVDGTSFWNFFNTFAEIC  178

Query  1031  K---------GAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTRE  879
             +           +KI+R PDF RD+   S A+L+ P GGP  TF+ +EP+RE+IF F+RE
Sbjct  179   RKISTANDDRSVEKIARQPDFSRDSALISSAILRVPEGGPRVTFNENEPLRERIFSFSRE  238

Query  878   AILKMKFRANN-----------------GKLCNGENGKLNGKITPVNHEPGLQNGGAAS-  753
             AIL++K + NN                 GK  N +    NGK      E  L    A S 
Sbjct  239   AILELKAKVNNTKEDLLVNGNFNAVEILGKQSNDKYHNDNGKNLTGIFEKWLFKTTAISD  298

Query  752   --EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPT  579
               EISSFQSL A LWR+VTRARKL  SKTTTFRMA+NCRHRL P+L PLYFGNAIQSIPT
Sbjct  299   SVEISSFQSLCALLWRAVTRARKLPYSKTTTFRMAVNCRHRLNPKLDPLYFGNAIQSIPT  358

Query  578   VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSS  399
              A AGE+ S  L W AE L+ +V AHDD TVRR I +WE +PR FPLGNFDGA +TMGSS
Sbjct  359   YATAGEVTSRGLRWCAEQLNESVKAHDDETVRRFIGNWEKDPRCFPLGNFDGASMTMGSS  418

Query  398   PRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDM  219
             PRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+E+D 
Sbjct  419   PRFPMYDNDFGWGRPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIESDH  478

Query  218   EYMQYVS  198
             E+MQ+V+
Sbjct  479   EFMQFVT  485



>gb|EPS57660.1| hypothetical protein M569_17156, partial [Genlisea aurea]
Length=442

 Score =   523 bits (1346),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 283/459 (62%), Positives = 335/459 (73%), Gaps = 20/459 (4%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             SSS+ ++SKC +YP   S+ +           MLS  YIQKGVLL   PL +A L+SLLK
Sbjct  1     SSSVTIVSKCHIYPSRSSAVTALKLSVSDLT-MLSVHYIQKGVLLPPSPLPSADLVSLLK  59

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpsh-ADIPRE  1209
              SLS+ L+HFP LAGRL T+  GHV I+   EGIEF HA+A  +SAAALL S   D+P E
Sbjct  60    NSLSETLSHFPPLAGRLRTEDSGHVKIVCTGEGIEFYHARATLVSAAALLQSRHRDVPPE  119

Query  1208  FRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICK  1029
             FR FFQ+D T+SYAGH +PL+A+QVTEL+  VF+GCT NHAVVDGTSFWNFFNT+AEI  
Sbjct  120   FRRFFQFDHTVSYAGHGRPLLAVQVTELNGGVFIGCTANHAVVDGTSFWNFFNTFAEIAA  179

Query  1028  --GAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
               G++KI++ P F RDT F+SP  L+ P GGP+  FS  EP+REKIFHFTREAILK+K R
Sbjct  180   RGGSQKITKSPAFCRDTPFDSPIALQVPEGGPSPNFSIGEPLREKIFHFTREAILKLKLR  239

Query  854   ANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASK  675
             ANN                P   +         +EISSFQSL A +WR+VTRAR L  S+
Sbjct  240   ANN----------------PTRFQEITDPENPTAEISSFQSLCANVWRAVTRARNLNPSR  283

Query  674   TTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDD  495
             TTTFRMA NCRHRL P L PLYFGNAIQSIP  A  GELLS+DL W+A+ L R V  HDD
Sbjct  284   TTTFRMAANCRHRLRPPLPPLYFGNAIQSIPIAANVGELLSNDLRWSADKLRRRVADHDD  343

Query  494   ATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDG  315
             A+VRRG+++W+ NP +F LGNFDG+ + MGSSPRFPMYDNDFGWGRPLAVRSG ANK DG
Sbjct  344   ASVRRGVEEWQRNPIMFSLGNFDGSEVIMGSSPRFPMYDNDFGWGRPLAVRSGGANKLDG  403

Query  314   KISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             K+SAFPGREGNG+VD+EVVL P  MA LEND E+MQYVS
Sbjct  404   KMSAFPGREGNGAVDVEVVLTPAAMAALENDSEFMQYVS  442



>ref|XP_011041436.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Populus 
euphratica]
Length=488

 Score =   524 bits (1350),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 351/489 (72%), Gaps = 33/489 (7%)
 Frame = -3

Query  1571  MPS-SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MPS +S  ++S+C V+P+ + S  + LKLSVSDLPMLSC YIQKG L ++PP  +   + 
Sbjct  1     MPSATSARIVSQCNVFPD-QKSTLEDLKLSVSDLPMLSCHYIQKGGLFTRPPTLSVDSLI  59

Query  1394  l-lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
               LK SLS+ L+HFP LAGR +TD+ G++YI  ND G++F+HA A  +S   +L     +
Sbjct  60    SHLKQSLSQTLSHFPPLAGRFNTDSNGYIYITCNDAGVDFIHATATSISIQDILCPL-HV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   R FF ++ST+SY GH KP++A+QVTEL+D VF+GC+MNH+V DGTSFW FFNT+AE
Sbjct  119   PDCVRGFFAFESTVSYQGHYKPILAVQVTELADGVFIGCSMNHSVTDGTSFWTFFNTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G KKISR PDF R+++  S AVLK P GGP  TF+ +EP+ E+IF F+REAILK+K 
Sbjct  179   VSRGIKKISRQPDFSRNSILISEAVLKVPQGGPQVTFNENEPLCERIFSFSREAILKLKS  238

Query  857   RANNGKLCNGEN------------------------GKLNGKI-----TPVNHEPGLQNG  765
             + NN K     +                        GK+ G +       V     +++ 
Sbjct  239   KVNNKKWTQKSDNTNVDAVELMGKQSNDTLIQIRNKGKMTGILESWFKNAVLKPQEMESN  298

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
              +  EISSFQSL A LWR+VTRARKL  SKTTTFRMA+NCRHRL P+L PLYFGNAIQS+
Sbjct  299   LSVVEISSFQSLCALLWRAVTRARKLNPSKTTTFRMAVNCRHRLSPKLDPLYFGNAIQSV  358

Query  584   PTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMG  405
             P  A AGE+LS DL W AE L++ V AH+D  VRR ++DWE NPR FPLGN DGA +TMG
Sbjct  359   PAYASAGEVLSRDLRWCAEQLNKIVAAHNDEMVRRFVEDWERNPRCFPLGNLDGASMTMG  418

Query  404   SSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEN  225
             SSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGREGNG+VDLEVVLAPE MAG+E+
Sbjct  419   SSPRFPMYDNDFGWGRPLAVRSGKANKFDGKISAFPGREGNGTVDLEVVLAPEAMAGIES  478

Query  224   DMEYMQYVS  198
             D E+MQ+V+
Sbjct  479   DQEFMQFVA  487



>ref|XP_008370133.1| PREDICTED: BAHD acyltransferase DCR, partial [Malus domestica]
Length=372

 Score =   518 bits (1333),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 254/382 (66%), Positives = 291/382 (76%), Gaps = 48/382 (13%)
 Frame = -3

Query  1223  DIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTY  1044
             D+P  FR FF Y+ TLSY GH +PL A+QVTEL+DAVF+GCT+NH+VVDGTSFW+FFNT+
Sbjct  2     DVPHCFRKFFAYERTLSYTGHFRPLAAVQVTELADAVFIGCTVNHSVVDGTSFWHFFNTF  61

Query  1043  AEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKM  864
             AEI +GAKK+S+ PDF RDTVFNSPAVL FP GGP  TFSG++P+RE+IFHF+RE+ILK+
Sbjct  62    AEINRGAKKMSKSPDFSRDTVFNSPAVLHFPEGGPKVTFSGNDPLRERIFHFSRESILKL  121

Query  863   KFRANN-------------------------------------GKLCNGENGKLNGKITP  795
             K RANN                                     GK CN      + K  P
Sbjct  122   KNRANNTLFKTTHNCNGNGNDHGNCNGNGNDHGNGLSESAEIFGKQCND-----SWKAVP  176

Query  794   VNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKP  615
                     NG   SE SSFQSLSAQLWRSVTR R L  SKTTTFRMA+NCRHRL+P++  
Sbjct  177   P------YNGAKTSEFSSFQSLSAQLWRSVTRVRNLPHSKTTTFRMAVNCRHRLQPKMDS  230

Query  614   LYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG  435
              YFGNAIQSIPTVA AG+LLS DL W AE+LH+NVVAHDDATVRRG++DWE+ PRLFPLG
Sbjct  231   HYFGNAIQSIPTVATAGDLLSRDLRWGAELLHKNVVAHDDATVRRGVEDWESAPRLFPLG  290

Query  434   NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVL  255
             NFDGAMITMGSSPRFPMY+NDFGWG+PLAVRSG ANKFDGKISAFPGREGNGSVDLEVVL
Sbjct  291   NFDGAMITMGSSPRFPMYNNDFGWGKPLAVRSGAANKFDGKISAFPGREGNGSVDLEVVL  350

Query  254   APETMAGLENDMEYMQYVS*IQ  189
             APETMAGL +D E+MQYVS ++
Sbjct  351   APETMAGLLSDGEFMQYVSAVE  372



>ref|XP_004239935.1| PREDICTED: BAHD acyltransferase DCR [Solanum lycopersicum]
Length=457

 Score =   518 bits (1334),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 277/458 (60%), Positives = 341/458 (74%), Gaps = 3/458 (1%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M +  + ++SKCTV+P  + S+   LKLSVSDLPMLS  YIQKG L ++PP     LISL
Sbjct  1     MTTPPVALVSKCTVFPS-EKSSLPDLKLSVSDLPMLSVHYIQKGCLFTRPPFPIPQLISL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK++LS  L  FP LAGR  TD+ G+VYI  ND+G++FVHA A H+    ++ S  D+P 
Sbjct  60    LKINLSHTLTRFPPLAGRFVTDSDGYVYITCNDDGVDFVHASATHICIRDVIGSI-DVPH  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
                 FF  D T+SY GH  PL+A+QVTEL+D VF+GC +NH+V DGTS WNFFNT+AE+ 
Sbjct  119   CVNEFFPLDRTVSYRGHFIPLLAVQVTELADGVFIGCAVNHSVTDGTSIWNFFNTFAEVS  178

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             +G K+I R PDF RD+V  S +VLK PA GP  TF+GD P+RE+IF F+RE+I ++K + 
Sbjct  179   RGVKRIVRQPDFTRDSVLISNSVLKLPADGPKVTFAGDAPLRERIFSFSRESIQRLKAKT  238

Query  851   NNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKT  672
             NN KL N + G    ++        L+     +EISSFQSL A LWR+VTRARK   SK 
Sbjct  239   NNQKL-NFDGGINIVELIAKQSNDHLKIKTETAEISSFQSLCALLWRAVTRARKFPPSKM  297

Query  671   TTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDA  492
             TTFRMA+NCRHRL+P+L PLYFGNAIQSIP  A AGE+L++DL W AE L +NV AHDD 
Sbjct  298   TTFRMAVNCRHRLQPKLNPLYFGNAIQSIPIYASAGEVLANDLYWCAEQLTKNVNAHDDV  357

Query  491   TVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGK  312
              VR+ ++DWE +PR FPLGNFDGAM+TMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGK
Sbjct  358   MVRKFVEDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYDNDFGWGRPLAVRSGRANKFDGK  417

Query  311   ISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             ISAFPGR G GSVDLEV+L+PETM  LE+D E+MQYV+
Sbjct  418   ISAFPGRGGGGSVDLEVILSPETMDALESDPEFMQYVT  455



>ref|XP_010046515.1| PREDICTED: BAHD acyltransferase DCR [Eucalyptus grandis]
Length=453

 Score =   518 bits (1334),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 298/480 (62%), Positives = 344/480 (72%), Gaps = 46/480 (10%)
 Frame = -3

Query  1571  MPSSS--IVVISKCTVYPE----YkssnskslklsvsdLPMLSCQYIQKGVLLSQPPlda  1410
             MPSSS  + + SK TVYP       ++ + SLKLSVSDLPMLSC YIQKGVLLS PPL  
Sbjct  1     MPSSSPSLTITSKSTVYPSTPAAPAAAAAPSLKLSVSDLPMLSCHYIQKGVLLSDPPLLV  60

Query  1409  -aalisllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallp  1233
              + LI LLK +LS AL+HFPALAGRL TD  GHV+IL ND G++F+ A+A HL+   +L 
Sbjct  61    FSDLILLLKRALSLALSHFPALAGRLSTDPLGHVHILCNDAGVDFIEARAKHLTVRGVLS  120

Query  1232  shADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFF  1053
                D+P   + FF +D T+SY GH  PL+A+Q                   DGTSFW+FF
Sbjct  121   PDRDVPDCVKQFFAFDRTVSYNGHFLPLLAVQSV--------------TSTDGTSFWHFF  166

Query  1052  NTYAEICKGAKKISRVPDFGRDTVFNSP-AVLKFPAGGPAATFSGDEPIREKIFHFTREA  876
             N++AE  +G+K+ S  PDF RD  F SP AVL+ PAGGPA TFS  EP+RE+IFHF+R A
Sbjct  167   NSFAEAARGSKRPSNSPDFCRDNAFVSPSAVLRLPAGGPAVTFSQHEPLRERIFHFSRAA  226

Query  875   ILKMKFRANN-----------GKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSL  729
             ILKMK  AN            GK  N      NGK+ P             +EISSFQSL
Sbjct  227   ILKMKSVANGAGVSPAVAEIMGKRSNDGFLAGNGKVAP-------------TEISSFQSL  273

Query  728   SAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSH  549
               QLWRSVTRARKL  SKT+TFRMA+NCRHR+EPR++P YFGNAIQSIPT A AGELLS 
Sbjct  274   CGQLWRSVTRARKLAPSKTSTFRMAVNCRHRIEPRIEPYYFGNAIQSIPTAAPAGELLSR  333

Query  548   DLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDF  369
             DL+W+A +LHRNVVAH DATVRRG++ WE  PRLFPLGNFDGA ITMGSSPRFPMY NDF
Sbjct  334   DLAWSAGLLHRNVVAHGDATVRRGVEAWEREPRLFPLGNFDGASITMGSSPRFPMYANDF  393

Query  368   GWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQ  189
             GWGRPLAVRSG ANKFDGKISAFPGREG GSVDLEVVLAP TMAGLEND E+MQYVS ++
Sbjct  394   GWGRPLAVRSGRANKFDGKISAFPGREGGGSVDLEVVLAPATMAGLENDAEFMQYVSSVE  453



>ref|XP_010256629.1| PREDICTED: BAHD acyltransferase DCR [Nelumbo nucifera]
Length=486

 Score =   519 bits (1336),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 290/477 (61%), Positives = 344/477 (72%), Gaps = 31/477 (6%)
 Frame = -3

Query  1541  KCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslskalA  1362
             KCTV+PE + S+   LKLSVSDLPMLSC YIQKG+  ++PPL   +L+SLLK  LSK L 
Sbjct  12    KCTVFPE-QKSSLGLLKLSVSDLPMLSCHYIQKGLFYTRPPLPIDSLLSLLKRGLSKTLI  70

Query  1361  HFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDS  1182
             +FPALAGRL TD  G VYI  ND G++F+HA A HL+   +L     +P   + FF +D 
Sbjct  71    YFPALAGRLTTDDDGFVYIACNDAGVDFLHANAAHLTIRDILSPVH-VPDSVKEFFAFDR  129

Query  1181  TLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVP  1002
             T+SY GH  P+ A+QVTEL+D +F+GCT+NHAV DGTSFWNFFN +AE+C+G  K++R P
Sbjct  130   TISYDGHFMPIAAVQVTELADGIFIGCTVNHAVADGTSFWNFFNAFAEVCRGVNKLTRPP  189

Query  1001  DFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN--------  846
             DF R+ V  S AVL+FP GGP  TFS D P+ E+IFHF+REAILK+K RAN         
Sbjct  190   DFRRNFVNGSLAVLRFPEGGPQITFSSDVPLSERIFHFSREAILKLKSRANKWVDNRLTV  249

Query  845   -----GKLCNG-------ENGKLNGKIT---------PVNHEPGLQNGGAASEISSFQSL  729
                  GK  N         N   NGKIT          V++    +      E+SSFQSL
Sbjct  250   EVEILGKQSNDGWKPQSDNNQNPNGKITSVIGSWLRNAVSNSQVTETADQTVEVSSFQSL  309

Query  728   SAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSH  549
              AQLWRSVTRARKL  SK TTFRMA+NCR R+EP++ P YFGNAIQSIPT+A AGE+LS 
Sbjct  310   CAQLWRSVTRARKLPPSKPTTFRMAVNCRLRIEPKVDPYYFGNAIQSIPTIASAGEILSG  369

Query  548   DLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDF  369
             +L   A +LH NV+A++DA VRR ++DWE NPR FPLGN DGAM+TMGSSPRFPMYDNDF
Sbjct  370   NLRACALLLHGNVIAYNDAAVRRVVEDWEKNPRCFPLGNSDGAMLTMGSSPRFPMYDNDF  429

Query  368   GWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GWGRPLAVRSG ANKFDGKISAFPGREG GSVDLEV LAPETM GLE D E+MQYVS
Sbjct  430   GWGRPLAVRSGRANKFDGKISAFPGREGGGSVDLEVCLAPETMEGLEKDSEFMQYVS  486



>gb|KFK36890.1| hypothetical protein AALP_AA4G185300 [Arabis alpina]
Length=473

 Score =   518 bits (1334),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 278/473 (59%), Positives = 347/473 (73%), Gaps = 17/473 (4%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  + + +IS+  VYP  K S    LKLSVSDLPMLSC YIQKG L ++P L   AL+
Sbjct  1     MPSLENKVTIISRNRVYPN-KKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRPNLSPHALL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             + LK SLS  L+HFP LAGRL T   GHV++ SND G +F+ A A  L  + ++ +  D+
Sbjct  60    THLKNSLSITLSHFPPLAGRLSTSDDGHVFLTSNDSGADFIFADAKTLHVSDVIIAGIDV  119

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  +SY GH++P++A+QVTEL D VF+GC++NHAV DGTS WNF NT+AE
Sbjct  120   PEVVKEFFSYDRVVSYDGHNRPILAVQVTELIDGVFIGCSVNHAVTDGTSLWNFINTFAE  179

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G ++++R PDF R++V  S AVLK P GGP  TF+ +EP+RE+IF FTREAIL++K 
Sbjct  180   VSRGVEELTRHPDFTRESVLISQAVLKVPHGGPKVTFNENEPLRERIFSFTREAILELKD  239

Query  857   RANNGKLCNG-----------ENGKLNGKITPVNHEPGLQNGGAAS--EISSFQSLSAQL  717
               N  K CNG            NGK NGK+T +      +N   +   EISSFQSL A L
Sbjct  240   IVNKKK-CNGVELLGKQNNDKMNGKENGKLTEMLESLLGRNDVVSKTMEISSFQSLCALL  298

Query  716   WRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSW  537
             WR++TRARKL +SKTTTFRMA+NCRHRL P+L   YFGNAIQS+PT A AGE+LS DL W
Sbjct  299   WRAITRARKLPSSKTTTFRMAVNCRHRLNPKLDQEYFGNAIQSVPTFATAGEVLSRDLRW  358

Query  536   AAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
             +A+ L+++V AH D  +R  + DWE NPR FPLGN DG  +TMGSSPRFPMYDNDFGWGR
Sbjct  359   SADKLNQSVAAHQDGRIRSVVADWEANPRCFPLGNSDGGSVTMGSSPRFPMYDNDFGWGR  418

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             P+AVRSG ANKFDGKISAFPGREGNG+VDLEVVLAPETMAG+E+D E+M+YV+
Sbjct  419   PVAVRSGKANKFDGKISAFPGREGNGTVDLEVVLAPETMAGIESDGEFMRYVT  471



>ref|XP_009791334.1| PREDICTED: BAHD acyltransferase DCR-like [Nicotiana sylvestris]
Length=476

 Score =   518 bits (1333),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 273/466 (59%), Positives = 341/466 (73%), Gaps = 12/466 (3%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             S ++ +I KCT++P  + S+   LKLSVSDLPMLS  YIQKG L ++PP   A LISLLK
Sbjct  11    SGAVTLIKKCTIFPS-QKSSIPDLKLSVSDLPMLSVHYIQKGCLFTRPPFSIAHLISLLK  69

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
             LSLS+ L HFP LAGRL TD  G+VYI  ND G++F             +    D+    
Sbjct  70    LSLSQTLTHFPPLAGRLLTDQDGYVYISCNDAGVDF-EHATATDIFIRDVIGSIDVLDHV  128

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             + FF +D T+SY GH +PL+A+QVTEL+D VF+GC +NH+V+DGTSFWNFFNT+AE  +G
Sbjct  129   KEFFPFDRTVSYQGHFRPLLAVQVTELADGVFIGCAVNHSVIDGTSFWNFFNTFAEDSRG  188

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
              K+I++ P+F R+++  S AVLK PA GP  TF  D P+RE+IF F+RE+I ++K + NN
Sbjct  189   VKRITKQPNFNRNSILISNAVLKLPANGPTVTFDADAPLRERIFSFSRESIQRLKSKTNN  248

Query  845   GKLCNGENGKLNGKITPVNHEPGLQNGG-------AASEISSFQSLSAQLWRSVTRARKL  687
              K    E   +   +   +++P +Q          + +EISSFQSL A LWR+VTRARK 
Sbjct  249   QKSNFDEEINIVELMAKQSNDPLIQCSRTEKAAVISTAEISSFQSLCALLWRAVTRARKF  308

Query  686   EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIP---TVAKAGELLSHDLSWAAEMLHR  516
              ASK TTFRMA+NCRHRL+P+L PLYFGNAIQSIP   T   AG++LSHDL W AE L++
Sbjct  309   PASKMTTFRMAVNCRHRLQPKLDPLYFGNAIQSIPXIPTYTSAGDVLSHDLRWCAEQLNK  368

Query  515   NVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSG  336
             NV AHD+  VR+ ++DWE +PR FPLGNFDGAM+TMGSSPRFPMYDNDFGWGRP+A+RSG
Sbjct  369   NVKAHDNVMVRKYVEDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYDNDFGWGRPVAIRSG  428

Query  335   MANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              ANKFDGKISAFPGREG GSVDLEVVL+PETM GLE D E+MQYVS
Sbjct  429   RANKFDGKISAFPGREGGGSVDLEVVLSPETMKGLELDTEFMQYVS  474



>ref|XP_009143263.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Brassica 
rapa]
Length=479

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 281/479 (59%), Positives = 350/479 (73%), Gaps = 23/479 (5%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ VIS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P L   AL+
Sbjct  1     MPSLENSVTVISRSRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRPHLPPHALL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S LK SLS  L+HFP LAGRL T   GHV++  ND G +FV A A  +    ++    D+
Sbjct  60    SHLKHSLSLTLSHFPPLAGRLSTSEDGHVFLSCNDAGADFVSAAAKSVRVGDVIGGI-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD T+SY GH++P++A+QVTEL+D VF+GC++NH+V DGTS WNF NT+AE
Sbjct  119   PDVVKEFFTYDRTVSYDGHNRPILAVQVTELNDGVFIGCSVNHSVTDGTSLWNFINTFAE  178

Query  1037  ICKGAK-KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             + +GA   ++R PDF R++V  SPAVLK P GGP  TF+ +EP+RE+IF F+RE IL++K
Sbjct  179   VSRGAGGNVTRHPDFTRESVLISPAVLKVPQGGPKVTFNENEPLRERIFSFSREQILELK  238

Query  860   FRANNGK---LCNGE---------------NGKLNGKITPVNHEPGLQNGGAASEISSFQ  735
                N  +   + NGE               NGK NGK+T +     L+N   A EISSFQ
Sbjct  239   AMVNKKRSWTVGNGEINGVEVFGKQSNDKLNGKENGKLTEMLESLLLRNDVVAVEISSFQ  298

Query  734   SLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELL  555
             SLSA LWR++TRARKL +SKTTTFRMA+N RHRL P+L P YFGNAIQS+PT A AGE+L
Sbjct  299   SLSALLWRAITRARKLPSSKTTTFRMAVNVRHRLSPKLDPEYFGNAIQSVPTFATAGEVL  358

Query  554   SHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDN  375
             S D+ W+A+ L+R+V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMYDN
Sbjct  359   SRDIRWSADQLNRSVAAHQDGKIRDTVADWEANPRCFPLGNPDGASVTMGSSPRFPMYDN  418

Query  374   DFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DFGWG+P+AVRSG ANKFDGKISAFPGR+GNGSVDLEVVLAPETMAG+E D E+M+YVS
Sbjct  419   DFGWGKPVAVRSGRANKFDGKISAFPGRDGNGSVDLEVVLAPETMAGIETDGEFMRYVS  477



>ref|XP_007009084.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY17894.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=479

 Score =   516 bits (1330),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 286/480 (60%), Positives = 349/480 (73%), Gaps = 24/480 (5%)
 Frame = -3

Query  1571  MPSSS--IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPSS+  I ++SK  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++ P+   +L+
Sbjct  1     MPSSAPCIALVSKSNVFPD-QKSKLGELKLSVSDLPMLSCHYIQKGCLFTRSPIPIDSLV  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             SLLK SLSK L+ FP LAGRLHTD  G++Y+  ND G+EF HA    LS   ++    D+
Sbjct  60    SLLKQSLSKTLSFFPPLAGRLHTDPNGYIYVTCNDGGVEFYHATCKGLSIRDVIGPL-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF +D T+SY GH KP+MA+QVTEL D VF+GC++NHAV DGTSFWNFFNT+AE
Sbjct  119   PEFVKKFFCFDKTVSYQGHFKPIMAVQVTELGDGVFIGCSVNHAVTDGTSFWNFFNTFAE  178

Query  1037  ICKGA-------KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTRE  879
             +CK         +KI+R PDF R++V  SPAVLK P GGP  TF+  E +RE+IF F+RE
Sbjct  179   LCKKISSNNQNFEKIARQPDFSRNSVLVSPAVLKVPEGGPKVTFNEKERLRERIFSFSRE  238

Query  878   AILKMKFRANNGKLCNGENGKLNG-KITPVNHEPGLQNGGAAS------------EISSF  738
             AIL++K R NN +     NG  N  +I          N  + S            EISSF
Sbjct  239   AILELKARVNNNEEELLVNGNFNAVEILGKQSNDKYHNEKSKSRLFRTAPVSNTAEISSF  298

Query  737   QSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGEL  558
             QSL A LWR+VTRARKL + + TTFRMA+NCRHRL P+L PLYFGNAIQSIPT A AG++
Sbjct  299   QSLCALLWRAVTRARKLPSFQKTTFRMAVNCRHRLNPKLDPLYFGNAIQSIPTYASAGDV  358

Query  557   LSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD  378
              S +L W AE L+++V +HDD TVRR +++WE +PR FPLGNFDGA +TMGSSPRFPMYD
Sbjct  359   TSRELRWCAEQLNQSVRSHDDETVRRFVKEWEKDPRCFPLGNFDGASMTMGSSPRFPMYD  418

Query  377   NDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NDFGWGRPL VRSG ANKFDGKISAFPGREGNGSVDLEVVLAPETMAG+E+D E+MQYV+
Sbjct  419   NDFGWGRPLVVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMAGIESDHEFMQYVT  478



>emb|CDY24938.1| BnaC03g22340D [Brassica napus]
Length=459

 Score =   515 bits (1327),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 272/460 (59%), Positives = 343/460 (75%), Gaps = 5/460 (1%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ +IS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P L   AL+
Sbjct  1     MPSLENSVTLISRSRVFPD-QKSTLADLKLSVSDLPMLSCHYIQKGCLFTRPHLPPHALL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S LK SLS  L+HFP LAGRL T   GHV++  ND G +FV A A  +    ++    D+
Sbjct  60    SHLKHSLSLTLSHFPPLAGRLSTSQDGHVFLSCNDAGADFVFAVAESVRVRDVIGGT-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   +SFF YD  +SY GH++P++ +QVTEL+D VF+GC++NHAV DGTS WNF NT+AE
Sbjct  119   PDVVKSFFSYDGAVSYEGHNRPILGVQVTELNDGVFIGCSVNHAVTDGTSLWNFINTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G + ++R PDF R+ V  SPAVLK P GGP  TF+ +EP+RE+IF F+RE IL++K 
Sbjct  179   VSRGVENVTRQPDFTRENVLISPAVLKMPHGGPKVTFNENEPLRERIFSFSREQILELKE  238

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEAS  678
               N  K  +  NGK NGK+T +      +N   + EISSFQSL A LWR++TRARKL +S
Sbjct  239   MVNK-KRSSTLNGKENGKLTEMLESLLGRNDAVSVEISSFQSLCALLWRAITRARKLPSS  297

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
             +TTTFRMA+N RHRL P+L P YFGNAIQS+PT A AGE+LS DL W A+ L+++V AH 
Sbjct  298   QTTTFRMAVNVRHRLRPKLDPEYFGNAIQSVPTFATAGEVLSRDLRWTADQLNQSVAAHQ  357

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFD  318
             D  +R  + DWE NPR FPLGNFDGAM+TMGSSPRFPMYDN+FGWG+P+AVRSG ANKFD
Sbjct  358   DGKIRSVVADWEANPRCFPLGNFDGAMVTMGSSPRFPMYDNNFGWGKPVAVRSGRANKFD  417

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GKISAFPGR+  GSVDLEVVLAPETMAG+E+D E+M+YVS
Sbjct  418   GKISAFPGRDEKGSVDLEVVLAPETMAGIESDGEFMRYVS  457



>ref|XP_009626925.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
tomentosiformis]
Length=470

 Score =   515 bits (1327),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 271/461 (59%), Positives = 342/461 (74%), Gaps = 7/461 (2%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             S ++ +++KCT++P  + S+   LKLSVSDLPMLS  YIQKG L + P      LISLLK
Sbjct  10    SGAVTLVNKCTIFPS-QKSSIPDLKLSVSDLPMLSVHYIQKGCLFTCPSFSITHLISLLK  68

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
             LSLS+ L HFP LAGRL TD  G+VYI  ND G++FV+A A  +    ++ S  D+    
Sbjct  69    LSLSQTLTHFPPLAGRLLTDQDGYVYISCNDTGVDFVYATATDIFIRDVIGSI-DVHDHV  127

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             + FF +D T+SY GH  PL+A+QVTEL D VF+GC +NH+V DGTSFWNFFNT+AE+ +G
Sbjct  128   KEFFPFDRTVSYQGHFSPLLAVQVTELVDGVFIGCAVNHSVTDGTSFWNFFNTFAEVSRG  187

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
              K+I++ P+F R+++  S AVLK P  GP  TF  D P+RE+IF F+RE+I ++K + NN
Sbjct  188   VKRITKQPNFTRNSILISNAVLKLPVNGPKVTFDADAPLRERIFSFSRESIQRLKAKTNN  247

Query  845   GKLCNGENGKLNGKITPVNHEPGLQNG-----GAASEISSFQSLSAQLWRSVTRARKLEA  681
              K    E   +   +   +++P +         + +EISSFQSL A LWR+VTRARK+ A
Sbjct  248   QKWNFNEEINIVELMAKQSNDPLIMRTEKVAVNSTAEISSFQSLCALLWRAVTRARKVPA  307

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
             SK TTFRMA+NCRHRL P+L PLYFGNAIQSIPT   AG++LSHDL W AE L++NV AH
Sbjct  308   SKMTTFRMAVNCRHRLHPKLDPLYFGNAIQSIPTYTSAGDVLSHDLRWCAEQLNKNVKAH  367

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKF  321
             D+  VR+ ++DWE +PR FPLGNFDGAM+TMGSSPRFPMYDNDFGWGRP+A+RSG ANKF
Sbjct  368   DNVMVRKFVEDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYDNDFGWGRPVAIRSGRANKF  427

Query  320   DGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DGKISAFPGREG GSVDLEVVL+PETM G+E D E+MQYVS
Sbjct  428   DGKISAFPGREGGGSVDLEVVLSPETMEGIELDTEFMQYVS  468



>ref|XP_010031257.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Eucalyptus 
grandis]
Length=500

 Score =   516 bits (1329),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 292/481 (61%), Positives = 345/481 (72%), Gaps = 28/481 (6%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             ++  ++SKC VYP  ++S    LKLSVSDLPMLSC YIQKGVLL +PP    +L+SLLKL
Sbjct  19    AATTLVSKCRVYPS-QASAMDDLKLSVSDLPMLSCHYIQKGVLLLRPPFPIQSLLSLLKL  77

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS  L+ FP LAGR  T   GH+ I  NDEG++F+HA A  L  A LL     +P  F+
Sbjct  78    SLSCTLSLFPPLAGRFSTAPSGHILISCNDEGVDFIHASAGDLLVADLLAPSR-VPDRFK  136

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICK-G  1026
             SFF  D T+SY GH  P++A+QVTEL D VF+GC  NHAV+DGTSFWNFFNT+AE+ + G
Sbjct  137   SFFPMDGTVSYRGHWDPILAVQVTELRDGVFIGCAANHAVMDGTSFWNFFNTFAEVSRIG  196

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
              ++ SR PDF R++V  S AVL+ P GGP  TF+ DEP+ E+IF F+REAIL++K +AN 
Sbjct  197   ERRFSRAPDFRRESVLISDAVLRIPEGGPRVTFNEDEPLSERIFSFSREAILRVKAKANE  256

Query  845   GKLCNGENGKLNG------------------KITPVNHEPGLQN--GGA-----ASEISS  741
              K    E+G +N                   K TP  HE       GGA      +EISS
Sbjct  257   RKWSESEDGDVNAVEIMGKQLHDPHVTSGNVKPTPSFHEGWFARPRGGAETRVETAEISS  316

Query  740   FQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGE  561
             FQ+LSA LWRSVTRARKL ASKTTTFRMA+NCRHRLEPRL   YFGNAIQS+PT A AGE
Sbjct  317   FQALSALLWRSVTRARKLHASKTTTFRMAVNCRHRLEPRLDAHYFGNAIQSVPTRAAAGE  376

Query  560   LLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMY  381
             +LS DL W AE L+R V AH D  VR  ++DWE  PRLFPLGN DGA ITMGSSPRFPMY
Sbjct  377   VLSRDLRWCAERLNRAVAAHGDGAVRGAVKDWEGEPRLFPLGNADGASITMGSSPRFPMY  436

Query  380   DNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
             DNDFGWGRP+AVRSG ANKFDGKISAFPGR+G GSVDLEV+LAP TM G+E D+E+MQYV
Sbjct  437   DNDFGWGRPVAVRSGRANKFDGKISAFPGRDGGGSVDLEVLLAPGTMDGIEGDVEFMQYV  496

Query  200   S  198
             S
Sbjct  497   S  497



>ref|XP_008392921.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Malus 
domestica]
Length=496

 Score =   516 bits (1328),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 284/497 (57%), Positives = 339/497 (68%), Gaps = 41/497 (8%)
 Frame = -3

Query  1571  MPSSSI---VVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP--ldaa  1407
             MPSS     ++ISKCTV+P+  SS +          PMLSC YIQKG+L   PP  +  +
Sbjct  1     MPSSDSPMSLIISKCTVFPDLPSSLNDLPLSVSDL-PMLSCHYIQKGLLFPLPPYPIIPS  59

Query  1406  alisllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpsh  1227
               I LLK SLS+ L+ FP LAGRL T   GHVYI  ND G +F+HA AP LS   +L   
Sbjct  60    THIPLLKSSLSQTLSRFPPLAGRLTTYPTGHVYITCNDAGADFIHASAPSLSIRDVLGPA  119

Query  1226  ADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNT  1047
              D+P   +  F +D T+SY GH   ++A+QVTEL+DAVF+GC++NHAV DGTSFWNFFNT
Sbjct  120   -DVPDCVKELFAFDRTISYTGHHNAILAVQVTELNDAVFIGCSVNHAVTDGTSFWNFFNT  178

Query  1046  YAEICKGAK------------KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIRE  903
             +AE+C+ +              I+R PDF R++V  SPAVL+FP GGP  TF+ DEP+RE
Sbjct  179   FAELCRASSLSPNENYNYKKLTITRQPDFSRNSVLISPAVLRFPDGGPKVTFNVDEPLRE  238

Query  902   KIFHFTREAILKMKFRANNGKLC----------------------NGENGKLNGKITPVN  789
             +IF F+REAI K+K R NN K                        N +NG     I    
Sbjct  239   RIFCFSREAIQKLKARTNNKKWSENEDVLLSAVEILGKQSSDPYQNNDNGARVTSIIENW  298

Query  788   HEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLY  609
              +    N    +EISSFQSL A LWRSVTRAR L +S+TTTFRMA+NCRHRLEP+L   Y
Sbjct  299   FKTSNANSKTTAEISSFQSLCALLWRSVTRARNLPSSQTTTFRMAVNCRHRLEPKLDAFY  358

Query  608   FGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF  429
             FGNAIQSIPT A AGE+LSHD  W AE L++ V AHD+  VR  I+DWE NPR+FPLGNF
Sbjct  359   FGNAIQSIPTYATAGEVLSHDTKWCAEQLNKGVKAHDNDGVRGVIEDWERNPRVFPLGNF  418

Query  428   DGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAP  249
             DGAM+TMGSSPRFPMYDNDFGWGRP+A+RSG ANKFDGKISAFPGREG GSVDLEVVLAP
Sbjct  419   DGAMMTMGSSPRFPMYDNDFGWGRPMAIRSGRANKFDGKISAFPGREGGGSVDLEVVLAP  478

Query  248   ETMAGLENDMEYMQYVS  198
             + MAGLE D E+MQYVS
Sbjct  479   DAMAGLETDSEFMQYVS  495



>ref|XP_006411242.1| hypothetical protein EUTSA_v10016586mg [Eutrema salsugineum]
 gb|ESQ52695.1| hypothetical protein EUTSA_v10016586mg [Eutrema salsugineum]
Length=483

 Score =   514 bits (1324),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 279/485 (58%), Positives = 347/485 (72%), Gaps = 27/485 (6%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ +IS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P L   AL+
Sbjct  1     MPSLDNSVTIISRSRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRPHLPTHALL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S LK SLS  L+HFP LAGRL T   GHV++  ND G +FV A A  +    ++    D+
Sbjct  60    SHLKHSLSLTLSHFPPLAGRLSTSEDGHVFLSCNDAGADFVFADANSVHVRDVIGGI-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  +SY GH +P++A+QVTEL D VF+GC++NHAV DGTS WNF NT+AE
Sbjct  119   PDVVKEFFSYDRAVSYEGHHRPILAVQVTELIDGVFIGCSVNHAVTDGTSLWNFINTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G + ++R PDF R++V  S AVLK P GGP  TF+ +EP+RE+IF FTRE IL++K 
Sbjct  179   VSRGVENVTRKPDFTRESVLISQAVLKVPQGGPKVTFNENEPLRERIFSFTREQILELKS  238

Query  857   RANN-------------GKLCNGE-NGKLNGKITPVNHEPGLQNGGAAS---------EI  747
               N              GK  N + NGK NGK+T +      +N   +          EI
Sbjct  239   MVNKKRNWTVINGVEVLGKQSNDKLNGKENGKLTEMLESLFGRNDAVSKTVSKTVDTVEI  298

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSL A LWR++TRARKL +SKTTTFRMA+NCRHRL P+L+P YFGNAIQS+PT A A
Sbjct  299   SSFQSLCALLWRAITRARKLPSSKTTTFRMAVNCRHRLSPKLEPEYFGNAIQSVPTFATA  358

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFP  387
             G++LS DL W A+ L++NV AH D  +R  + DWE NPR FPLGNFDGA +TMGSSPRFP
Sbjct  359   GDVLSRDLRWIADQLNQNVAAHQDGKIRSVVADWEANPRCFPLGNFDGASVTMGSSPRFP  418

Query  386   MYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             MYDNDFGWGRP+AVRSG +NKFDGKISAFPGR+GNGSVDLEVVLAPETMAG+E+D E+M+
Sbjct  419   MYDNDFGWGRPVAVRSGRSNKFDGKISAFPGRDGNGSVDLEVVLAPETMAGIESDGEFMR  478

Query  206   YVS*I  192
             YVS I
Sbjct  479   YVSKI  483



>ref|XP_010095065.1| BAHD acyltransferase DCR [Morus notabilis]
 gb|EXB58171.1| BAHD acyltransferase DCR [Morus notabilis]
Length=480

 Score =   514 bits (1323),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 289/479 (60%), Positives = 346/479 (72%), Gaps = 23/479 (5%)
 Frame = -3

Query  1571  MPSSSIV-VISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQP-Pldaaali  1398
             MP S ++ V+SK TV+P+ + S    LKLSVSDLPMLSCQYIQKG L ++P  +   +LI
Sbjct  1     MPCSPVISVVSKSTVFPD-RKSTLGDLKLSVSDLPMLSCQYIQKGSLFTRPLQIPNDSLI  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             SLLK  LS+ L+ FP LAGRL TD  GHV++  ND G +F+HA A  +    +L     +
Sbjct  60    SLLKQGLSRTLSLFPPLAGRLTTDGYGHVFLTCNDAGADFIHANAADVFIRDILGPTH-V  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P     FF  D T+SYAGH +P++A+QVTEL+D VF+GC +NHAV DGTSFWNFFNT+AE
Sbjct  119   PEHVWDFFACDGTVSYAGHFRPILAVQVTELADGVFIGCAVNHAVTDGTSFWNFFNTFAE  178

Query  1037  ICKGAKKISR-VPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
              C+G K+ISR  PDF RD++  S AVLK P GGP  TFS D  +RE+IF F+REAIL +K
Sbjct  179   ACRGVKRISRPSPDFSRDSILISKAVLKLPEGGPKVTFSNDASLRERIFSFSREAILILK  238

Query  860   FRANN------------GKLCNGENGKLNGKITPVNHEPGLQNG------GAASEISSFQ  735
              R NN            GK  N    + +        E  L+NG       A +EISSFQ
Sbjct  239   DRTNNRTALIENDIEILGKQKNDTYSQSDNNKVASIIENWLKNGVISKQNAAVAEISSFQ  298

Query  734   SLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELL  555
             SL A LWR+VTRARKL +SKTTTFRMA+NCRHRLEP+L P YFGNAIQS+PT A AGE+L
Sbjct  299   SLCALLWRAVTRARKLPSSKTTTFRMAVNCRHRLEPKLDPHYFGNAIQSVPTCASAGEVL  358

Query  554   SHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDN  375
             S DL W AE L+ +V AHD+A V   ++DWE+NPR FPLGN +GA ITMGSSPRFPMYDN
Sbjct  359   SRDLRWCAEQLNESVRAHDNANVHLFVKDWESNPRCFPLGNPNGASITMGSSPRFPMYDN  418

Query  374   DFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DFGWGRPLAVRSG ANKFDGKISAFPGR+GNG+VDLEVVL+PETMA LEND E+M YVS
Sbjct  419   DFGWGRPLAVRSGRANKFDGKISAFPGRDGNGTVDLEVVLSPETMAALENDSEFMHYVS  477



>ref|XP_002526860.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
 gb|EEF35491.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis]
Length=477

 Score =   513 bits (1322),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 279/474 (59%), Positives = 350/474 (74%), Gaps = 24/474 (5%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkls  1380
             S V++SKCTV+P+ + S  + LKLSVSDLPMLSC YIQKG L ++P +   +L+SLL+ S
Sbjct  7     SPVLLSKCTVFPD-QKSTMEDLKLSVSDLPMLSCHYIQKGGLFTRPSIPIESLVSLLRRS  65

Query  1379  lskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRS  1200
             LS+ L+HFP LAGRL TD+ G+VYI  ND G++F+HA A H+    +L     +P   + 
Sbjct  66    LSQTLSHFPPLAGRLKTDSDGYVYITCNDAGVDFIHASATHIFIRDVLSPV-HVPECVKG  124

Query  1199  FFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK  1020
             FF +D  +SY GH  P++A+QVTEL D VF+GC +NH+V DGTSFWNFFNT+AE+ +G K
Sbjct  125   FFAFDRMVSYNGHHSPILAVQVTELGDGVFIGCAVNHSVTDGTSFWNFFNTFAELSRGIK  184

Query  1019  KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAI-----------  873
             KI++VPDF RD++  SPAVLK P GGP  TF+ +EP+ E+IF F+REAI           
Sbjct  185   KITKVPDFTRDSMLISPAVLKLPEGGPKVTFNENEPLSERIFSFSREAILKLKAKANNKK  244

Query  872   -----LKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS----EISSFQSLSAQ  720
                  +++  +  N    N  NGK+   I     E  L+N   +     EISSFQSL A 
Sbjct  245   WIDNSVELMGKQINDPYINNNNGKMT--IMSSILETLLKNAVVSKQQEPEISSFQSLCAL  302

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             LWR+VTRARKL  +KTTTFRMA+NCR RL P+L PLYFGNAIQSIPT A +G++LS DL 
Sbjct  303   LWRAVTRARKLSPTKTTTFRMAVNCRPRLNPKLDPLYFGNAIQSIPTYASSGDVLSRDLR  362

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             W AE+L++NV+AH+D+TVRR +++W  NPR FPLGNFDGA +TMGSSPRFPMYDNDFGWG
Sbjct  363   WCAELLNKNVMAHNDSTVRRFVEEWGENPRCFPLGNFDGASMTMGSSPRFPMYDNDFGWG  422

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             RPLAVRSG ANKFDGKISAFPGREG GSVDLEVVL PETMA +E+D E++QYVS
Sbjct  423   RPLAVRSGRANKFDGKISAFPGREGGGSVDLEVVLKPETMALIESDYEFIQYVS  476



>ref|XP_004239936.1| PREDICTED: BAHD acyltransferase DCR-like [Solanum lycopersicum]
Length=461

 Score =   511 bits (1316),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 275/463 (59%), Positives = 345/463 (75%), Gaps = 9/463 (2%)
 Frame = -3

Query  1571  MPSSS----IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaa  1404
             MPS++    + ++SK T+ P  + S+   LKLSVSDLPMLS  YIQKG L + PP   + 
Sbjct  1     MPSAAAATHVTLLSKSTISPS-EKSSLPDLKLSVSDLPMLSVHYIQKGCLFTHPPFPISQ  59

Query  1403  lisllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshA  1224
             LISLLK++LS  L  FP LAGR  TD+ G+VYI  ND+G++FVHA A H+    ++ S  
Sbjct  60    LISLLKINLSHTLTRFPPLAGRFVTDSDGYVYINCNDDGVDFVHATATHICIRDVIGSI-  118

Query  1223  DIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTY  1044
             D+P     FF  D T+SY GH  PL+A+QVTEL+D VF+GC +NH+V DGTSFWNFFNT+
Sbjct  119   DVPHCVNEFFPLDRTVSYRGHFIPLLAVQVTELADGVFIGCAVNHSVTDGTSFWNFFNTF  178

Query  1043  AEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKM  864
             AE+ +G K+I R PDF RD+V  S ++LK PA GP  TF GD P+RE+IF F+ E+I ++
Sbjct  179   AEVSRGVKRIVRQPDFTRDSVLISSSILKLPADGPKVTFDGDAPLRERIFSFSWESIQRL  238

Query  863   KFRANNGKLCNGENGKLN-GKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKL  687
             K + NN KL    + ++N  K         L+    ++EISSFQSL A LWR+VTRARK 
Sbjct  239   KAKTNNQKL--NFDAEINIVKSMEKQSNDHLKIKTESAEISSFQSLCALLWRAVTRARKF  296

Query  686   EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVV  507
              +SK TTFRMA+NCRHRL+P+L PLYFGNAIQSIPT   AG++LSHDL W AE L++NV 
Sbjct  297   PSSKMTTFRMAVNCRHRLQPKLNPLYFGNAIQSIPTYVSAGDVLSHDLRWCAEQLNKNVK  356

Query  506   AHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMAN  327
             AHDD  VR+ + DWE +PR FPLGNFDGAM+TMGSSPRFPMY+NDFGWGRP+AVRSG AN
Sbjct  357   AHDDVMVRKFVGDWEKDPRCFPLGNFDGAMLTMGSSPRFPMYENDFGWGRPVAVRSGRAN  416

Query  326   KFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             KFDGKISAFPGR+G GSVDLE++L+PETM GLE+D E+MQYV+
Sbjct  417   KFDGKISAFPGRKGGGSVDLEMILSPETMEGLESDTEFMQYVT  459



>ref|XP_003616578.1| BAHD acyltransferase DCR [Medicago truncatula]
 gb|AES99536.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=489

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 273/489 (56%), Positives = 339/489 (69%), Gaps = 34/489 (7%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSSS  ++SKCT+ P+ + SN  +LKLSVSDLPMLSC YIQKG L ++P      ++  
Sbjct  1     MPSSSPTLVSKCTITPD-QKSNIANLKLSVSDLPMLSCHYIQKGCLFTKPSNIPFHILIP  59

Query  1391  lklslskalAH-FPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP  1215
             L  +        FP LAGRL TD++G+VY+  ND G++F+ A +  L    LL +  D+ 
Sbjct  60    LLKNSLSRTLSLFPPLAGRLTTDSEGYVYLTCNDAGVDFITATSTSLYITDLLSTT-DVH  118

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               F+ FF +D  +SY GH  P+MA+QVTEL+D +F+G  +NHAV DGTSFWNFFNT+A+I
Sbjct  119   ESFKEFFTFDRKVSYTGHFSPIMAVQVTELADGIFIGIAVNHAVTDGTSFWNFFNTFAQI  178

Query  1034  CKGAKK-ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+GA K I   P F R++V  S AVL+ PA GPA TF+ + PIRE+IF F+REAI K+K 
Sbjct  179   CRGANKCIRNSPSFRRNSVLISDAVLRLPAEGPAVTFNANAPIRERIFSFSREAIQKLKA  238

Query  857   RANNGKLCNGE-----------------NGKLNGKIT------------PVNHEPGLQNG  765
             RANN K C  +                 N K NGK+T            PVN     +  
Sbjct  239   RANN-KPCPAKYNTIELMQKHMNDHYNNNNKENGKVTTLIENWFKNNAKPVNGTEVAETD  297

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                 EISSFQSLSA LWR++TRARK   SKTTTFRMA+NCRHR+EP+L+  YFGNAIQS+
Sbjct  298   TETVEISSFQSLSALLWRAITRARKFHPSKTTTFRMAVNCRHRIEPKLEAFYFGNAIQSV  357

Query  584   PTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMG  405
             PT A AG+++S D+ W A  L++NV AHD+  VRR ++DWENNPR FPLGN DG  ITMG
Sbjct  358   PTYASAGDVMSRDIRWCAMQLNKNVKAHDNGMVRRFVEDWENNPRCFPLGNSDGGSITMG  417

Query  404   SSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEN  225
             SSPRFPMYDNDFGWG+PL VRSG ANKFDGKISAFPGR+G+G+VDLEVVLAPETMA LE 
Sbjct  418   SSPRFPMYDNDFGWGKPLVVRSGKANKFDGKISAFPGRDGSGTVDLEVVLAPETMAALEL  477

Query  224   DMEYMQYVS  198
             D E+M Y +
Sbjct  478   DTEFMTYAT  486



>ref|XP_006295818.1| hypothetical protein CARUB_v10024944mg [Capsella rubella]
 gb|EOA28716.1| hypothetical protein CARUB_v10024944mg [Capsella rubella]
Length=483

 Score =   510 bits (1313),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 273/478 (57%), Positives = 343/478 (72%), Gaps = 25/478 (5%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             +S+ VIS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P L   AL++ LK 
Sbjct  6     NSVTVISRSRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRPHLPPHALLAHLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS  L+HFP LAGRL T + GHV++  ND G +FV A+A  +  + +L    D+P   +
Sbjct  65    SLSLTLSHFPPLAGRLSTSSSGHVFLTCNDAGADFVFAEAKSVCVSDVLAGI-DVPDVVK  123

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF YD  +SY GH++P++A+QVTEL D VF+GC++NHAV DGTS WNF NT+AE+ +GA
Sbjct  124   EFFAYDRAVSYDGHNRPILAVQVTELIDGVFIGCSVNHAVTDGTSLWNFINTFAEVSRGA  183

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             + ++R PDF R++V  SPAVLK P GGP  TF    P+RE+IF F++E+I ++K   N  
Sbjct  184   ENVTRQPDFTRESVLISPAVLKVPQGGPKVTFDETAPLRERIFSFSKESIQELKAVVNKK  243

Query  842   K---LCNGE---------------NGKLNGKITPV-----NHEPGLQNGGAASEISSFQS  732
             K   L NGE               NGK NGK+T +          +    AA EISSFQS
Sbjct  244   KWLTLDNGEVDGVELLGKQSNDKLNGKENGKLTEMLESLFGRNDAVSKTVAAVEISSFQS  303

Query  731   LSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLS  552
             L A LWR++TRARKL  SKTTTFRMA+NCRHRL P+L P YFGNAIQS+PT A AGE+LS
Sbjct  304   LCALLWRAITRARKLPGSKTTTFRMAVNCRHRLSPKLNPEYFGNAIQSVPTFATAGEVLS  363

Query  551   HDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDND  372
              DL W A+ L+++V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMYDND
Sbjct  364   RDLKWCADQLNQSVAAHQDGRIRSVVADWEANPRCFPLGNPDGASVTMGSSPRFPMYDND  423

Query  371   FGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FGWGRP+AVRSG +NKFDGKISAFPGREGNG+VDLEVVL+PETM G+E+D E+M+YV+
Sbjct  424   FGWGRPVAVRSGRSNKFDGKISAFPGREGNGTVDLEVVLSPETMTGIESDAEFMRYVT  481



>emb|CDX74815.1| BnaA05g05610D [Brassica napus]
Length=434

 Score =   508 bits (1307),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 272/461 (59%), Positives = 338/461 (73%), Gaps = 32/461 (7%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ VIS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P L   AL+
Sbjct  1     MPSLENSVTVISRSRVFPD-QKSTLVHLKLSVSDLPMLSCHYIQKGCLFTRPHLPPHALL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S LK +LS  L+HFP LAGRL T   GHV++  ND G +FV A A               
Sbjct  60    SHLKHALSLTLSHFPPLAGRLSTSEDGHVFLSCNDAGADFVSAAA---------------  104

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
                 +SFF YD T+SY GH++P++A+QVTEL+D VF+GC++NH+V DGTS WNF NT+AE
Sbjct  105   ----KSFFTYDRTVSYDGHNRPILAVQVTELNDGVFIGCSVNHSVTDGTSLWNFINTFAE  160

Query  1037  ICKGAK-KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
             + +GA+  ++R PDF R++V  SPAVLK P GGP  TF+ +EP+RE+IF F+RE IL++K
Sbjct  161   VSRGAEGNVTRHPDFTRESVLISPAVLKVPQGGPKVTFNENEPLRERIFSFSREQILELK  220

Query  860   FRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEA  681
                N  +     NG++NG            N   A EISSFQSLSA LWR++TRARKL +
Sbjct  221   AMVNKKRSWTVGNGEINGVEV---------NDVVAVEISSFQSLSALLWRAITRARKLPS  271

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
             SKTTTFRMA+N RHRL P+L P YFGNAIQS+PT A AGE+LS D+ W+A+ L+R+V AH
Sbjct  272   SKTTTFRMAVNVRHRLSPKLDPEYFGNAIQSVPTFATAGEVLSRDIRWSADQLNRSVAAH  331

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKF  321
              D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMYDNDFGWG+P+AVRSG ANKF
Sbjct  332   QDGKIRDTVADWEANPRCFPLGNPDGASVTMGSSPRFPMYDNDFGWGKPVAVRSGRANKF  391

Query  320   DGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DGKISAFPGR+GNGSVDLEVVLAPETMAG+E+D E+M+YVS
Sbjct  392   DGKISAFPGRDGNGSVDLEVVLAPETMAGIESDGEFMRYVS  432



>ref|XP_009350907.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Pyrus 
x bretschneideri]
Length=496

 Score =   509 bits (1310),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 281/497 (57%), Positives = 337/497 (68%), Gaps = 41/497 (8%)
 Frame = -3

Query  1571  MPSSSI---VVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP--ldaa  1407
             MPSS     ++ISKCTV+P+  SS            PMLSC YIQKG+L   PP  +  +
Sbjct  1     MPSSDSPMSLIISKCTVFPDLPSSLDDLPLSVSDL-PMLSCHYIQKGLLFPLPPYPIIPS  59

Query  1406  alisllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpsh  1227
              LI LLK SLS+ L+ FP LAGRL T   G VYI  ND G +F+HA AP LS   +L   
Sbjct  60    TLIPLLKSSLSQTLSRFPPLAGRLTTYPTGQVYISCNDAGADFIHASAPSLSIRDVLGPA  119

Query  1226  ADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNT  1047
              D+P   +  F +D T+SY GH   ++A+QVTEL+DAVF+GC++NHAV DGTSFWNFFNT
Sbjct  120   -DVPDCVKELFAFDRTVSYTGHHNAILAVQVTELNDAVFIGCSVNHAVTDGTSFWNFFNT  178

Query  1046  YAEICKGAK------------KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIRE  903
             +AE+C+ +              I+R PDF R++V  SPAVL+FP GGP  TF+ +EP+RE
Sbjct  179   FAELCRASSLSPNENYNYKKLTITRQPDFSRNSVLISPAVLRFPDGGPKVTFNVEEPLRE  238

Query  902   KIFHFTREAILKMKFRANNGKLC----------------------NGENGKLNGKITPVN  789
             +IF F+REAI K+K R NN K                        N +NG     I    
Sbjct  239   RIFSFSREAIQKLKARTNNKKWSESEDVLLSAVEILGKQSNDPYQNNDNGARVTSIIENW  298

Query  788   HEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLY  609
              +    N     EISSFQSL A LWRSVTRAR L +S+TTTFRMA+NCRHRLEP+L   Y
Sbjct  299   FKTSNANSKTTEEISSFQSLCALLWRSVTRARNLPSSQTTTFRMAVNCRHRLEPKLDAFY  358

Query  608   FGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF  429
             FGNAIQSIPT A A E+LSHD  W AE L+++V AHD+ +VR  I+DWE NPR+FPLGNF
Sbjct  359   FGNAIQSIPTYATAEEVLSHDTKWCAEQLNKSVKAHDNNSVRGVIEDWERNPRVFPLGNF  418

Query  428   DGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAP  249
             DGAM+TMGSSPRFPMYDNDFGWGRP+A+RSG ANKFDGKISAFPGREG GSVDLEVVLAP
Sbjct  419   DGAMMTMGSSPRFPMYDNDFGWGRPMAIRSGRANKFDGKISAFPGREGGGSVDLEVVLAP  478

Query  248   ETMAGLENDMEYMQYVS  198
             + M GLE D E+MQYVS
Sbjct  479   DAMVGLETDSEFMQYVS  495



>ref|NP_181527.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAK50105.1|AF372968_1 At2g39980/T28M21.14 [Arabidopsis thaliana]
 gb|AAB95283.1| putative anthocyanin 5-aromatic acyltransferase [Arabidopsis 
thaliana]
 gb|AAM70565.1| At2g39980/T28M21.14 [Arabidopsis thaliana]
 gb|ABE65472.1| transferase family protein [Arabidopsis thaliana]
 gb|AEC09758.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=482

 Score =   508 bits (1307),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 276/482 (57%), Positives = 345/482 (72%), Gaps = 26/482 (5%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS   S+ +IS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L + P L   ALI
Sbjct  1     MPSLEKSVTIISRNRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTCPNLPLPALI  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S LK SLS  L HFP LAGRL T + GHV++  ND G +FV A+A  +  + ++    D+
Sbjct  60    SHLKHSLSITLTHFPPLAGRLSTSSSGHVFLTCNDAGADFVFAQAKSIHVSDVIAGI-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  +SY GH++P++A+QVTEL+D VF+GC++NHAV DGTS WNF NT+AE
Sbjct  119   PDVVKEFFTYDRAVSYEGHNRPILAVQVTELNDGVFIGCSVNHAVTDGTSLWNFINTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +GAK ++R PDF R++V  SPAVLK P GGP  TF  + P+RE+IF F+RE+I ++K 
Sbjct  179   VSRGAKNVTRQPDFTRESVLISPAVLKVPQGGPKVTFDENAPLRERIFSFSRESIQELKA  238

Query  857   RANNGK---LCNGE---------------NGKLNGKITPVNHEPGLQNGGA----ASEIS  744
               N  K   + NGE               NGK NG +T +      +N       A EIS
Sbjct  239   VVNKKKWLTVDNGEIDGVELLGKQSNDKLNGKENGILTEMLESLFGRNDAVSKPVAVEIS  298

Query  743   SFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAG  564
             SFQSL A LWR++TRARKL +SKTTTFRMA+NCRHRL P+L P YFGNAIQS+PT A A 
Sbjct  299   SFQSLCALLWRAITRARKLPSSKTTTFRMAVNCRHRLSPKLNPEYFGNAIQSVPTFATAA  358

Query  563   ELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPM  384
             E+LS DL W A+ L+++V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPM
Sbjct  359   EVLSRDLKWCADQLNQSVAAHQDGRIRSVVADWEANPRCFPLGNADGASVTMGSSPRFPM  418

Query  383   YDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQY  204
             YDNDFGWGRP+AVRSG +NKFDGKISAFPGREGNG+VDLEVVL+PETMAG+E+D E+M+Y
Sbjct  419   YDNDFGWGRPVAVRSGRSNKFDGKISAFPGREGNGTVDLEVVLSPETMAGIESDGEFMRY  478

Query  203   VS  198
             V+
Sbjct  479   VT  480



>gb|ABK28209.1| unknown [Arabidopsis thaliana]
Length=483

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 276/482 (57%), Positives = 345/482 (72%), Gaps = 26/482 (5%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS   S+ +IS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L + P L   ALI
Sbjct  1     MPSLEKSVTIISRNRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTCPNLPLPALI  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S LK SLS  L HFP LAGRL T + GHV++  ND G +FV A+A  +  + ++    D+
Sbjct  60    SHLKHSLSITLTHFPPLAGRLSTSSSGHVFLTCNDAGADFVFAQAKSIHVSDVIAGI-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  +SY GH++P++A+QVTEL+D VF+GC++NHAV DGTS WNF NT+AE
Sbjct  119   PDVVKEFFTYDRAVSYEGHNRPILAVQVTELNDGVFIGCSVNHAVTDGTSLWNFINTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +GAK ++R PDF R++V  SPAVLK P GGP  TF  + P+RE+IF F+RE+I ++K 
Sbjct  179   VSRGAKNVTRQPDFTRESVLISPAVLKVPQGGPKVTFDENAPLRERIFSFSRESIQELKA  238

Query  857   RANNGK---LCNGE---------------NGKLNGKITPVNHEPGLQNGGA----ASEIS  744
               N  K   + NGE               NGK NG +T +      +N       A EIS
Sbjct  239   VVNKKKWLTVDNGEIDGVELLGKQSNDKLNGKENGILTEMLESLFGRNDAVSKPVAVEIS  298

Query  743   SFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAG  564
             SFQSL A LWR++TRARKL +SKTTTFRMA+NCRHRL P+L P YFGNAIQS+PT A A 
Sbjct  299   SFQSLCALLWRAITRARKLPSSKTTTFRMAVNCRHRLSPKLNPEYFGNAIQSVPTFATAA  358

Query  563   ELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPM  384
             E+LS DL W A+ L+++V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPM
Sbjct  359   EVLSRDLKWCADQLNQSVAAHQDGRIRSVVADWEANPRCFPLGNADGASVTMGSSPRFPM  418

Query  383   YDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQY  204
             YDNDFGWGRP+AVRSG +NKFDGKISAFPGREGNG+VDLEVVL+PETMAG+E+D E+M+Y
Sbjct  419   YDNDFGWGRPVAVRSGRSNKFDGKISAFPGREGNGTVDLEVVLSPETMAGIESDGEFMRY  478

Query  203   VS  198
             V+
Sbjct  479   VT  480



>ref|XP_002881688.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57947.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=482

 Score =   507 bits (1305),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 273/482 (57%), Positives = 346/482 (72%), Gaps = 26/482 (5%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ + S+  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P L   AL+
Sbjct  1     MPSLENSVTINSRSRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRPHLPLHALL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S LK SLS  L+HFP LAGRL T + GHV++  ND G +FV A+A  +  + ++    D+
Sbjct  60    SHLKHSLSITLSHFPPLAGRLSTSSSGHVFLTCNDAGADFVFAEAKSVHVSDVIAGI-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  +SY GH++P++A+QVTEL D VF+GC++NHAV DGTS WNF NT+AE
Sbjct  119   PNVVKEFFTYDRAVSYEGHNRPILAVQVTELIDGVFIGCSVNHAVTDGTSLWNFINTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +G K ++R PDF R++V  SPAVLK P GGP  TF    P+RE+IF F++E+I ++K 
Sbjct  179   VSRGVKNVTRQPDFTRESVLISPAVLKVPQGGPKVTFDEKAPLRERIFSFSKESIQELKA  238

Query  857   RANNGK---LCNGE---------------NGKLNGKITPVNHEPGLQNGGAAS----EIS  744
              AN  K   + NGE               NGK NG +T +      +N   +     EIS
Sbjct  239   AANKKKWLTVDNGEVDGVELLGKQSNDKLNGKENGILTEMLESLFGRNDAVSKPVVVEIS  298

Query  743   SFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAG  564
             SFQSL A LWR++TRARKL +SKTTTFRMA+NCRHRL P+L P YFGNAIQS+PT A AG
Sbjct  299   SFQSLCALLWRAITRARKLPSSKTTTFRMAVNCRHRLSPKLNPEYFGNAIQSVPTFATAG  358

Query  563   ELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPM  384
             E+LS DL W A+ L+++V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPM
Sbjct  359   EVLSRDLKWCADQLNQSVAAHQDGRIRSVVADWEANPRCFPLGNSDGASVTMGSSPRFPM  418

Query  383   YDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQY  204
             YDNDFGWGRP+AVRSG +NKFDGKISAFPGREGNG+VDLEVVL+PETMAG+E+D E+M+Y
Sbjct  419   YDNDFGWGRPVAVRSGRSNKFDGKISAFPGREGNGTVDLEVVLSPETMAGIESDSEFMRY  478

Query  203   VS  198
             V+
Sbjct  479   VT  480



>ref|XP_009141856.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Brassica rapa]
Length=470

 Score =   504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 274/471 (58%), Positives = 343/471 (73%), Gaps = 16/471 (3%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ VIS   V+P+ K S    LKLSVSDLPMLSC YIQKG L ++P L    L+
Sbjct  1     MPSLENSVTVISTNKVFPD-KKSTLADLKLSVSDLPMLSCHYIQKGCLFTRPHLTPHELL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+HFP LAGRL T   GHV++  ND G + V A+A  +S + ++    D+
Sbjct  60    SHLEHSLSLTLSHFPPLAGRLSTSEDGHVFLSCNDAGADIVFAEAKSVSVSDVITGG-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  + Y GH++P++A+QVTEL+D VF+GC++NHAVVDGTS WNF NT+AE
Sbjct  119   PGVVKEFFSYDRAVRYEGHNRPILAVQVTELNDGVFIGCSVNHAVVDGTSLWNFVNTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +GA+ ++R PDF R++V  SPAVLK P GGP  TF  + P+RE+IF FTRE IL++K 
Sbjct  179   VSRGAENVTRQPDFTRESVLISPAVLKVPRGGPKVTFDENAPLRERIFSFTREQILELKA  238

Query  857   RANNGK-----LCNGENGKLNGKITPVNHEPGLQNGGAAS------EISSFQSLSAQLWR  711
               N  +     L    N KLNGK+T +  E  L +  A S      EISSFQSL A LWR
Sbjct  239   MVNGERNGVEVLGKQSNDKLNGKLTEM-LESLLGSNDAVSKTESKREISSFQSLCALLWR  297

Query  710   SVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAA  531
             ++TRAR L ++KTTTFRMA+N RHRL P+L P YFGNAIQS+PT A AGE+LS D+ W A
Sbjct  298   AITRARNLPSAKTTTFRMAVNVRHRLSPKLNPEYFGNAIQSVPTFATAGEVLSRDIRWTA  357

Query  530   EMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPL  351
             + L+R+V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMY+NDFGWG+P+
Sbjct  358   DQLNRSVAAHGDERIREVVADWEANPRCFPLGNADGASVTMGSSPRFPMYENDFGWGKPV  417

Query  350   AVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             AVRSG ANKFDGKISAFPGR+GNGSVDLEVV+APETMAG+E D E+M+YVS
Sbjct  418   AVRSGRANKFDGKISAFPGRDGNGSVDLEVVIAPETMAGIECDGEFMRYVS  468



>ref|XP_004138571.1| PREDICTED: BAHD acyltransferase DCR-like [Cucumis sativus]
 ref|XP_004165972.1| PREDICTED: BAHD acyltransferase DCR-like [Cucumis sativus]
 gb|KGN45772.1| Anthocyanin 5-aromatic acyltransferase [Cucumis sativus]
Length=498

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 282/492 (57%), Positives = 340/492 (69%), Gaps = 39/492 (8%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             PSSS +++SKC V+P+ + S+   L+LSVSDLPMLSC YIQKG L +      A  I   
Sbjct  6     PSSSPLLLSKCIVFPD-QPSSLPDLQLSVSDLPMLSCHYIQKGCLFTTSNNLDATSIIQR  64

Query  1388  kl-slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
                SLS+AL+ FP LAGRL TD  G+VYI  ND G++F+H  A       LL    D+P 
Sbjct  65    LKCSLSRALSRFPPLAGRLVTDDDGYVYIKCNDAGVDFIHTNAGEFFVRDLLAPG-DVPD  123

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+S+AGH  P+MA+QVT L+D +F+GC++NHAV DGTSFWNFFNT+AE C
Sbjct  124   CFKEFFAFDRTVSFAGHFNPIMAVQVTFLADGIFIGCSVNHAVTDGTSFWNFFNTFAEEC  183

Query  1031  KGAKKISRV-----PDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILK  867
             K      ++     PDF RD V  SP VL+ P+ GP  TFSGD P+RE+IF F+REAILK
Sbjct  184   KSTTTTKKLAITPSPDFLRDCVLVSPTVLRLPSSGPKVTFSGDVPLRERIFSFSREAILK  243

Query  866   MKFRANNGKLCNGENGKL-------------------NGKITPV----NHEPGLQNGGAA  756
             +K + N  KL   +NG+L                   NGK+  +    N    +    A 
Sbjct  244   LKAKTNEKKLI--DNGELTVTAVEIMGKQSNDKYCQNNGKVGTIKDSWNRNDTVSKENAN  301

Query  755   SE------ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAI  594
              E      ISSFQSL A LWRSVTRARKL  +K TTFRMA+NCRHRLEP+L P YFGNAI
Sbjct  302   CEEIPNTTISSFQSLCALLWRSVTRARKLPPNKMTTFRMAVNCRHRLEPKLDPYYFGNAI  361

Query  593   QSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMI  414
             QS+PT A A ++LS DL W AE L+ NV+AHD+  VRR ++DWE NPR+FPLGN DGA I
Sbjct  362   QSVPTYASAADVLSRDLRWCAEKLNENVMAHDNGMVRRFVEDWEGNPRVFPLGNADGASI  421

Query  413   TMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAG  234
             TMGSSPRFPMY+NDFGWGRPLAVRSG ANKFDGKISAFP RE  GSVDLEVVLAPETMAG
Sbjct  422   TMGSSPRFPMYENDFGWGRPLAVRSGRANKFDGKISAFPSRESGGSVDLEVVLAPETMAG  481

Query  233   LENDMEYMQYVS  198
             +E+D E+MQYVS
Sbjct  482   IESDWEFMQYVS  493



>ref|XP_003519380.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
Length=478

 Score =   503 bits (1296),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 338/479 (71%), Gaps = 25/479 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPS    ++SKCTV+P+ + S   +LKLSVSDLPMLSC YIQKG L + P L   +LI L
Sbjct  1     MPSPVPTLLSKCTVFPD-QKSTLGNLKLSVSDLPMLSCHYIQKGCLFTHPNLPLHSLIPL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK SLS+ L+ FP LAGRL TD+  +VYI  ND G++F+HA A  L    LL    D+P 
Sbjct  60    LKSSLSRTLSLFPPLAGRLITDSDSYVYIACNDAGVDFIHANATALRICDLLSQL-DVPE  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D  +SY GH  P++A+QVTEL+D VF+GC +NHAV DGTSFWNFFNT+A++ 
Sbjct  119   SFKEFFAFDRKVSYTGHFSPILAVQVTELADGVFIGCAVNHAVTDGTSFWNFFNTFAQLS  178

Query  1031  KGAKK-ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             +GA   I  +PDF R++V  S AVL+ P GGP  TF  + P+RE+IF F+REAI K+K  
Sbjct  179   RGASNCIRNIPDFHRESVLISDAVLRLPEGGPQVTFDANAPLRERIFSFSREAIQKLKAI  238

Query  854   ANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS--------------------EISSFQ  735
             ANN +    EN    G++        L     A+                    EISSFQ
Sbjct  239   ANNRRW--PENNNFAGELLRKKSNDNLLKENKATTILENWFKVNSNSISKPQTVEISSFQ  296

Query  734   SLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELL  555
             S+ A LWR VTRARK  +SKTTTFRMA+NCRHRLEP+L+  YFGNAIQS+PT A AGE+L
Sbjct  297   SVCALLWRGVTRARKFPSSKTTTFRMAVNCRHRLEPKLEAYYFGNAIQSVPTYASAGEVL  356

Query  554   SHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDN  375
             S DL W AE L++NV AHDD  VRR ++DWE NPR FPLGN DGA ITMGSSPRFPMYDN
Sbjct  357   SRDLRWCAEQLNKNVKAHDDTMVRRFVEDWERNPRCFPLGNPDGASITMGSSPRFPMYDN  416

Query  374   DFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +FGWGRPLAVRSG ANKFDGKISAFPGR+G G+VDLEVVLAPETM  LE+D E+M+Y +
Sbjct  417   NFGWGRPLAVRSGRANKFDGKISAFPGRDGTGTVDLEVVLAPETMEALESDPEFMKYAT  475



>ref|XP_010517384.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=481

 Score =   503 bits (1295),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 267/475 (56%), Positives = 343/475 (72%), Gaps = 22/475 (5%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             +S+ +IS+  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P +   AL++ LK 
Sbjct  6     NSVTIISRSRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRPHVPPHALLAHLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS  L+HFP LAGRL T + GHV++  ND G +FV A+A  +  + +L    D+P   +
Sbjct  65    SLSLTLSHFPPLAGRLSTSSSGHVFLTCNDAGADFVSAEAKSVYVSDVLAGI-DVPDVVK  123

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF YD  +SY GH++P++A+QVTEL D VF+GC++NHAV DGTS WNF NT+AE+ +G 
Sbjct  124   EFFTYDRAVSYEGHNRPILAVQVTELIDGVFIGCSVNHAVTDGTSLWNFINTFAEMSRGV  183

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             + ++R PDF R++V  SPAVLK P GGP  TF  + P+RE+IF F++E+I ++K   N  
Sbjct  184   ENVTRQPDFTRESVLISPAVLKVPHGGPKVTFDENAPLRERIFSFSKESIQELKAAVNKK  243

Query  842   K---LCNGE---------------NGKLNGKITPVNHEPGLQNGGAAS--EISSFQSLSA  723
             K   + NGE               NGK NGK+T +      +N   +   EISSFQSL A
Sbjct  244   KWLTVDNGEIDGVELLGKQSNDKLNGKENGKLTEMLESLFGRNDAVSKTVEISSFQSLCA  303

Query  722   QLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDL  543
              LWR++TRARK  +SKTTTFRMA+NCRHRL P++ P YFGNAIQS+PT A AGE+LS DL
Sbjct  304   LLWRAITRARKHPSSKTTTFRMAVNCRHRLNPKMNPEYFGNAIQSVPTFATAGEVLSRDL  363

Query  542   SWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGW  363
              W A+ L ++V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMYDNDFGW
Sbjct  364   RWCADQLKQSVAAHQDGRIRSVVADWEANPRCFPLGNADGASVTMGSSPRFPMYDNDFGW  423

Query  362   GRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GRP+AVRSG +NKFDGKISAFPGREGNG+VDLEVVL+PETMAG+E+D E+M+YV+
Sbjct  424   GRPVAVRSGRSNKFDGKISAFPGREGNGTVDLEVVLSPETMAGIESDGEFMRYVT  478



>gb|KCW50517.1| hypothetical protein EUGRSUZ_J00240, partial [Eucalyptus grandis]
Length=465

 Score =   500 bits (1288),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 320/447 (72%), Gaps = 27/447 (6%)
 Frame = -3

Query  1472  PMLSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSND  1293
             PMLSC YIQKGVLL +PP    +L+SLLKLSLS  L+ FP LAGR  T   GH+ I  ND
Sbjct  20    PMLSCHYIQKGVLLLRPPFPIQSLLSLLKLSLSCTLSLFPPLAGRFSTAPSGHILISCND  79

Query  1292  EGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAV  1113
             EG++F+HA A  L  A LL     +P  F+SFF  D T+SY GH  P++A+QVTEL D V
Sbjct  80    EGVDFIHASAGDLLVADLLAPSR-VPDRFKSFFPMDGTVSYRGHWDPILAVQVTELRDGV  138

Query  1112  FVGCTMNHAVVDGTSFWNFFNTYAEICK-GAKKISRVPDFGRDTVFNSPAVLKFPAGGPA  936
             F+GC  NHAV+DGTSFWNFFNT+AE+ + G ++ SR PDF R++V  S AVL+ P GGP 
Sbjct  139   FIGCAANHAVMDGTSFWNFFNTFAEVSRIGERRFSRAPDFRRESVLISDAVLRIPEGGPR  198

Query  935   ATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNG-----------------  807
              TF+ DEP+ E+IF F+REAIL++K +AN  K    E+G +N                  
Sbjct  199   VTFNEDEPLSERIFSFSREAILRVKAKANERKWSESEDGDVNAVEIMGKQLHDPHVTSGN  258

Query  806   -KITPVNHEPGLQN--GGA-----ASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
              K TP  HE       GGA      +EISSFQ+LSA LWRSVTRARKL ASKTTTFRMA+
Sbjct  259   VKPTPSFHEGWFARPRGGAETRVETAEISSFQALSALLWRSVTRARKLHASKTTTFRMAV  318

Query  650   NCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQ  471
             NCRHRLEPRL   YFGNAIQS+PT A AGE+LS DL W AE L+R V AH D  VR  ++
Sbjct  319   NCRHRLEPRLDAHYFGNAIQSVPTRAAAGEVLSRDLRWCAERLNRAVAAHGDGAVRGAVK  378

Query  470   DWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGR  291
             DWE  PRLFPLGN DGA ITMGSSPRFPMYDNDFGWGRP+AVRSG ANKFDGKISAFPGR
Sbjct  379   DWEGEPRLFPLGNADGASITMGSSPRFPMYDNDFGWGRPVAVRSGRANKFDGKISAFPGR  438

Query  290   EGNGSVDLEVVLAPETMAGLENDMEYM  210
             +G GSVDLEV+LAP TM G+E D+E+M
Sbjct  439   DGGGSVDLEVLLAPGTMDGIEGDVEFM  465



>ref|XP_004490956.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=490

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 274/489 (56%), Positives = 338/489 (69%), Gaps = 33/489 (7%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPSS+  ++SKCT++P    S   +LKLSVSDLPMLSC YIQKG L +QP +    LI  
Sbjct  1     MPSSAPTLLSKCTIFPN-TKSTIGNLKLSVSDLPMLSCHYIQKGCLFTQPSIPFHNLIRN  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK +L++ L+ FP LAGRL TD+ G+VY+  ND G++F+HA A       LL +  D+  
Sbjct  60    LKSALARTLSLFPPLAGRLTTDSDGYVYLTCNDAGVDFIHATATGFYIRDLLSTT-DVHE  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D  +SY GH  P++A+QVTEL+D VF+GC +NHAV DGTSFWNFFNT+A+ C
Sbjct  119   SFKEFFAFDRKVSYTGHFSPILAVQVTELADGVFIGCAVNHAVTDGTSFWNFFNTFAQEC  178

Query  1031  KGAKKISR-VPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             +GA K  R VP+F RD+V  S AVL+   GGP  TF+ D P RE+IF F+REAI K+K +
Sbjct  179   RGANKCLRNVPNFRRDSVLISDAVLRLEKGGPVVTFNADAPFRERIFSFSREAIQKLKAK  238

Query  854   ANNGKLCNGENG-------------------KLNGKITPV-------NHEPGLQNGGAA-  756
              NN +     +                    K NGK+  +       N     Q      
Sbjct  239   VNNRRWTENNSTVELMQKHINDRYNNNNNNQKENGKVATLIDNWFKSNVHSKQQTISVTE  298

Query  755   ---SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                +EISSFQSL A LWR+VTRARK  ASKTTTFRMA+NCRHR+EP+++  YFGNAIQS+
Sbjct  299   TETNEISSFQSLCALLWRAVTRARKFPASKTTTFRMAVNCRHRIEPKMETYYFGNAIQSV  358

Query  584   PTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMG  405
             PT A AG+++S DL W AE L++NV AHD+  VR  ++DWE NPR FPLGN DG  ITMG
Sbjct  359   PTYASAGDVMSRDLRWCAEQLNKNVKAHDNGMVRLFVEDWEKNPRCFPLGNPDGGSITMG  418

Query  404   SSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEN  225
             SSPRFPMYDNDFGWG+PLAVRSG ANKFDGKISAFPGR+G G+VDLEVVLAPETMAGLE 
Sbjct  419   SSPRFPMYDNDFGWGKPLAVRSGKANKFDGKISAFPGRDGTGTVDLEVVLAPETMAGLEA  478

Query  224   DMEYMQYVS  198
             D E+M Y S
Sbjct  479   DPEFMLYAS  487



>ref|XP_010512943.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=470

 Score =   499 bits (1285),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 254/446 (57%), Positives = 323/446 (72%), Gaps = 22/446 (5%)
 Frame = -3

Query  1472  PMLSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSND  1293
             PMLSC YIQKG L ++P L   AL++ LK SLS  L+HFP LAGRL T + GHV+++ ND
Sbjct  23    PMLSCHYIQKGCLFTRPHLPPHALLAHLKHSLSLTLSHFPPLAGRLSTSSSGHVFLICND  82

Query  1292  EGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAV  1113
              G +FV A+A  +  + +L    D+P   + FF YD  +SY GH++P++A+QVTEL D V
Sbjct  83    AGADFVSAEAKSVKVSDVLAGI-DVPDVVKEFFTYDRAVSYEGHNRPILAVQVTELIDGV  141

Query  1112  FVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAA  933
             F+GC++NHAV DGTS WNF NT+AE+ +G + ++R PDF R++V  SPAVLK P GGP  
Sbjct  142   FIGCSVNHAVTDGTSLWNFINTFAEVSRGVENVTRQPDFTRESVLISPAVLKVPHGGPKV  201

Query  932   TFSGDEPIREKIFHFTREAILKMKFRANNGKLC--NGE---------------NGKLNGK  804
             TF  + P+RE+IF F++E+I ++K   N   L   NGE               NGK NGK
Sbjct  202   TFDENAPLRERIFSFSKESIQELKAVVNKKWLTVDNGEIDGVELLGKQSNDKLNGKENGK  261

Query  803   ITPVNHEPGLQNGGAAS----EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHR  636
             +T +      +N   +     EISSFQSL A LWR++TRARK  +SKTTTFRMA+NCRHR
Sbjct  262   LTEMLESLFGRNDAVSKTVEVEISSFQSLCALLWRAITRARKHPSSKTTTFRMAVNCRHR  321

Query  635   LEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENN  456
             L P+L P YFGNAIQS+PT A AGE+LS DL W A+ L+++V AH D  +R  + DWE N
Sbjct  322   LSPKLNPEYFGNAIQSVPTFATAGEVLSRDLRWCADQLNQSVAAHQDGRIRSVVADWEAN  381

Query  455   PRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGS  276
             PR FPLGN DGA +TMGSSPRFPMYDNDFGWGRP+AVRSG +NKFDGKISAFPGREGNG+
Sbjct  382   PRCFPLGNADGASVTMGSSPRFPMYDNDFGWGRPVAVRSGRSNKFDGKISAFPGREGNGT  441

Query  275   VDLEVVLAPETMAGLENDMEYMQYVS  198
             VDLEVVL+PETMAG+E+D E+M++V+
Sbjct  442   VDLEVVLSPETMAGIESDGEFMRFVT  467



>ref|XP_007141793.1| hypothetical protein PHAVU_008G226200g [Phaseolus vulgaris]
 gb|ESW13787.1| hypothetical protein PHAVU_008G226200g [Phaseolus vulgaris]
Length=484

 Score =   499 bits (1286),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 271/478 (57%), Positives = 337/478 (71%), Gaps = 25/478 (5%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             S+  ++SKCTV+P+ ++S   +LKLSVSDLPMLSC YIQKG L +QP +   +LI LLK 
Sbjct  6     SAPTLLSKCTVFPD-QNSTIGNLKLSVSDLPMLSCHYIQKGCLFTQPNIPLYSLIPLLKS  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             +LS+ L+ FP LAGRL TD++G+VYI  ND G++F+H  A  +    LL    D+P  F+
Sbjct  65    ALSRTLSLFPPLAGRLTTDSQGYVYIACNDAGVDFIHTNATTIRICDLLSPL-DVPEYFK  123

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF +D  +SY GH  P++A+QVTEL+D +F+GC +NHAV DGTSFWNFFNT+A++C+ A
Sbjct  124   DFFAFDRKVSYTGHYSPILAVQVTELADGLFIGCAVNHAVTDGTSFWNFFNTFAQLCRNA  183

Query  1022  KK-ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
              K I  VP F RD++  S AVL+ P GGP  TF    P+RE+IF F+RE I K+K + NN
Sbjct  184   NKSIRNVPYFHRDSILISDAVLRLPEGGPQVTFDSHAPLRERIFSFSRETIQKLKAKTNN  243

Query  845   ----------------------GKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQS  732
                                    K  NG+ G +      VN     Q      EISSFQS
Sbjct  244   RRCQENNSTSVELMRKQSNDHHAKENNGKAGTILESWFKVNSNSKPQTITETMEISSFQS  303

Query  731   LSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLS  552
             + A LWR++TRARKL ASKTTTFRMA+NCRHR+EP+L+  YFGNAIQS+PT A AG++LS
Sbjct  304   VCALLWRAITRARKLPASKTTTFRMAVNCRHRIEPKLEQYYFGNAIQSVPTYACAGDVLS  363

Query  551   HDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDND  372
              DL W AE L+ NV AHD+A VRR + DWE  PR FPLGN DGA ITMGSSPRFPMYDN+
Sbjct  364   RDLRWCAEQLNSNVKAHDEAMVRRFVDDWEQKPRCFPLGNPDGASITMGSSPRFPMYDNN  423

Query  371   FGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FGWGRPLAVRSG ANKFDGKISAFPGR+G G+VDLEVVLAPETM  LE+D E+ +Y +
Sbjct  424   FGWGRPLAVRSGRANKFDGKISAFPGRDGTGTVDLEVVLAPETMEALESDPEFTRYAT  481



>ref|XP_008233722.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Prunus 
mume]
Length=497

 Score =   499 bits (1286),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 283/484 (58%), Positives = 342/484 (71%), Gaps = 35/484 (7%)
 Frame = -3

Query  1550  VISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP-ldaaalisllklsls  1374
             V++K TV+P  + S    LKLSVSDLPMLSC YIQKG+L   PP     +L+ LLK SLS
Sbjct  15    VVAKSTVFPN-QPSTLGDLKLSVSDLPMLSCHYIQKGLLFPLPPFPIQHSLVPLLKASLS  73

Query  1373  kalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFF  1194
             ++L+ FP LAGRL T + GHV+I  ND G++F+HA AP LS   +L    D+P   +  F
Sbjct  74    QSLSRFPPLAGRLTTYSDGHVHITCNDAGVDFIHASAPSLSTRDILGPT-DVPNCVKDLF  132

Query  1193  QYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICK-----  1029
              +D T+SY GH   ++A+QVTELSDAVF+GC +NHA+ DGTSFWNFFNT+AE+C+     
Sbjct  133   PFDRTVSYTGHHNSILAVQVTELSDAVFIGCAVNHAITDGTSFWNFFNTFAELCRLSSSS  192

Query  1028  --GAKK--ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK  861
                 KK  I++ PDF R +V  SPAVL+FP GGP  TFS  EP+RE+IF F+REAI  +K
Sbjct  193   SNENKKLTIAKQPDFSRSSVIISPAVLRFPEGGPKVTFSLTEPLRERIFSFSREAIQDLK  252

Query  860   FRANNGKLCNGEN-----------GKLNGKITPVNHEPGLQ------------NGGAASE  750
              R N+ K    +N           GK +     +N+  G +            N     E
Sbjct  253   SRTNSKKWAEFQNDDALISAVEILGKQSNDPYEINNSNGARVTSIIENWFKNSNAKTTPE  312

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAK  570
             ISSFQSL A LWRSVTRARKL +SKTTTFRMA+NCRHRLEP+L   YFGNAIQSIPT A 
Sbjct  313   ISSFQSLCALLWRSVTRARKLPSSKTTTFRMAVNCRHRLEPKLDAYYFGNAIQSIPTYAT  372

Query  569   AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRF  390
             AGE+LS+D  W AE L++NV AHD+  VR  ++DWE +PR+FPLGN DGA +TMGSSPRF
Sbjct  373   AGEVLSNDTRWCAEQLNKNVKAHDNDKVRGVVKDWERDPRVFPLGNLDGATMTMGSSPRF  432

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
             PMYDNDFGWGRPLA+RSG ANKFDGKISAFPGREG GSVDLEVVLAP+TMA LE D E+M
Sbjct  433   PMYDNDFGWGRPLAIRSGRANKFDGKISAFPGREGAGSVDLEVVLAPDTMALLETDSEFM  492

Query  209   QYVS  198
             QYVS
Sbjct  493   QYVS  496



>ref|XP_008441438.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280 [Cucumis melo]
Length=497

 Score =   499 bits (1285),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 281/492 (57%), Positives = 337/492 (68%), Gaps = 39/492 (8%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             PSSS +++SKC V+P+ + S    L+LSVSDLPMLSC YIQKG L S      A  I   
Sbjct  6     PSSSPILLSKCIVFPD-QPSALPDLQLSVSDLPMLSCHYIQKGCLFSTSTNLDAISIVQR  64

Query  1388  kl-slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
                SLS  L+ FP LAGRL TD  G+VYI  ND G++F+H  A       LL    D+P 
Sbjct  65    LKCSLSXTLSRFPPLAGRLVTDHDGYVYIKCNDAGVDFIHTNAGEFFVRDLLAPG-DVPD  123

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D T+S+AGH  P+MA+Q+T L+D +FVGC++NHAV DGTSFWNFFNT+AE C
Sbjct  124   CFKEFFAFDRTVSFAGHFNPIMAVQITFLADGIFVGCSVNHAVTDGTSFWNFFNTFAEEC  183

Query  1031  KGAKKISRVP-----DFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILK  867
             K      ++      DF RD+V  S AVL+ P+ GP  TFSGD P+RE+IF F+REAILK
Sbjct  184   KSTTTTKKITITPTPDFRRDSVLVSSAVLRLPSSGPKVTFSGDVPLRERIFSFSREAILK  243

Query  866   MKFRANNGKLCNGENGKL-------------------NGKITPV----NHEPGLQNGGAA  756
             +K + N  KL   +NG+L                   NGK+  +    N    + N    
Sbjct  244   LKAKTNEKKLI--DNGELTVTAVEIMGKRSNDKYCQNNGKVGTIKDSWNRNDTVSNEHEN  301

Query  755   SE------ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAI  594
              E      ISSFQSL A LWRSVTRARKL  +K TTFRMA+NCRHRLEP+L P YFGNAI
Sbjct  302   CEQIPKTTISSFQSLCALLWRSVTRARKLPPNKMTTFRMAVNCRHRLEPKLDPYYFGNAI  361

Query  593   QSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMI  414
             QS+PT A A ++LS DL W AE L+ NV+AHD+  VRR ++DWE NPR+FPLGN DGA I
Sbjct  362   QSVPTYASAADVLSQDLRWCAEKLNENVMAHDNGMVRRFVEDWEANPRVFPLGNADGASI  421

Query  413   TMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAG  234
             TMGSSPRFPMY+NDFGWGRPLAVRSG ANKFDGKISAFP REG GSVDLEVVL PETMAG
Sbjct  422   TMGSSPRFPMYENDFGWGRPLAVRSGRANKFDGKISAFPSREGGGSVDLEVVLEPETMAG  481

Query  233   LENDMEYMQYVS  198
             +E+D E+MQYVS
Sbjct  482   IESDWEFMQYVS  493



>ref|XP_007217934.1| hypothetical protein PRUPE_ppa004937mg [Prunus persica]
 gb|EMJ19133.1| hypothetical protein PRUPE_ppa004937mg [Prunus persica]
Length=484

 Score =   499 bits (1284),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 280/485 (58%), Positives = 340/485 (70%), Gaps = 36/485 (7%)
 Frame = -3

Query  1550  VISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis-llklsls  1374
             +++K TV+P+ + S    LKLSVSDLPMLSC YIQKG+L   PP      +  LLK SLS
Sbjct  1     MVAKSTVFPD-QPSTLGDLKLSVSDLPMLSCHYIQKGLLFPLPPFPIQHSLIPLLKASLS  59

Query  1373  kalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFF  1194
             ++L+ FP LAGRL T + GHV+I  ND G++F+HA AP LS   +L    D+P   +  F
Sbjct  60    QSLSRFPPLAGRLTTYSDGHVHITCNDAGVDFIHASAPSLSTRDILGPT-DVPNCVKDLF  118

Query  1193  QYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-  1017
              +D T+SY GH   ++A+QVTELSDAVF+GC +NHAV DGTSFWNFFNT+AE+C+ +   
Sbjct  119   PFDRTVSYTGHHNSILAVQVTELSDAVFIGCALNHAVTDGTSFWNFFNTFAELCRLSSSS  178

Query  1016  ---------ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKM  864
                      I++ PDF R +V  SPAVL+FP GGP  TFS  EP+RE+IF F+ EAI  +
Sbjct  179   SPNENKKLTIAKQPDFSRSSVIISPAVLRFPEGGPKVTFSLTEPLRERIFSFSTEAIQNL  238

Query  863   KFRANNGKLCNGEN-----------GKLNGKITPVNHEPGLQ------------NGGAAS  753
             K R N+ K    +N           GK +     +N+  G +            N   A 
Sbjct  239   KSRTNSKKWAEFQNDDALISAVEILGKQSNDPYEINNSNGARVTSIIENWFKNSNAKTAP  298

Query  752   EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA  573
             EISSFQSL A LWRSVTRARKL +SKTTTFRMA+NCRHRLEP+L   YFGNAIQSIPT A
Sbjct  299   EISSFQSLCALLWRSVTRARKLPSSKTTTFRMAVNCRHRLEPKLDAYYFGNAIQSIPTYA  358

Query  572   KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPR  393
              AGE+LS+D  W AE L++NV  HD+  VR  ++DWE +PR+FPLGNFDGA +TMGSSPR
Sbjct  359   TAGEVLSNDTRWCAEQLNKNVKEHDNDKVRGVVEDWEMDPRVFPLGNFDGATMTMGSSPR  418

Query  392   FPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEY  213
             FPMYDNDFGWGRPLA+RSG ANKFDGKISAFPGREG GSVDLEVVLAP+TMA LE D E+
Sbjct  419   FPMYDNDFGWGRPLAIRSGRANKFDGKISAFPGREGAGSVDLEVVLAPDTMALLETDSEF  478

Query  212   MQYVS  198
             MQYVS
Sbjct  479   MQYVS  483



>ref|XP_010505699.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Camelina 
sativa]
Length=481

 Score =   498 bits (1282),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 269/475 (57%), Positives = 344/475 (72%), Gaps = 22/475 (5%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             +S+ +ISK  V+P+ + S    LKLSVSDLPMLSC YIQKG L ++P L   AL++ LK 
Sbjct  6     NSVTIISKSRVFPD-QKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRPHLPPHALLAHLKH  64

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS +L+HFP LAGRL T + GHV++  ND G +FV A+A  +  + +L    D+P   +
Sbjct  65    SLSLSLSHFPPLAGRLSTSSSGHVFLTCNDAGADFVSAEAKSVKVSDVLAGI-DVPDVVK  123

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              FF YD  +SY GH++P++A+QVTEL D VF+GC++NHAV DGTS WNF NT+AE+ +G 
Sbjct  124   EFFTYDRAVSYEGHNRPILAVQVTELIDGVFIGCSVNHAVTDGTSLWNFINTFAEMSRGV  183

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
             + ++R PDF R++V  SPAVLK P GGP  TF  + P+RE+IF F++E+I ++K   N  
Sbjct  184   ENVTRQPDFTRESVLISPAVLKVPHGGPKVTFDENAPLRERIFSFSKESIQELKAVVNKK  243

Query  842   K---LCNGE---------------NGKLNGKITPVNHEPGLQNGGAAS--EISSFQSLSA  723
             K   + NGE               NGK NGK+T +      +N   +   EISSFQSL A
Sbjct  244   KWLTIDNGEIDGVELLGKQSNDKLNGKENGKLTEMLESLFGRNDAVSKTVEISSFQSLCA  303

Query  722   QLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDL  543
              LWR++TRARK  +SKTTTFRMA+NCRHRL P+L P YFGNAIQS+PT A AGE+LS DL
Sbjct  304   LLWRAITRARKHPSSKTTTFRMAVNCRHRLSPKLNPEYFGNAIQSVPTFATAGEVLSRDL  363

Query  542   SWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGW  363
              W A+ L+++V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMYDNDFGW
Sbjct  364   RWCADQLNQSVAAHQDGRIRSVVADWEANPRCFPLGNADGASVTMGSSPRFPMYDNDFGW  423

Query  362   GRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GRP+AVRSG +NKFDGKISAFPGR GNG+VDLEVVL+PETMAG+E+D E+M+YV+
Sbjct  424   GRPVAVRSGRSNKFDGKISAFPGRGGNGTVDLEVVLSPETMAGIESDGEFMRYVT  478



>ref|XP_003545239.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=479

 Score =   498 bits (1281),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 277/480 (58%), Positives = 341/480 (71%), Gaps = 26/480 (5%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPS +  ++SKCTV+P+ + S   +LKLSVSDLPMLSC YIQKG L + P L   +LI L
Sbjct  1     MPSPAPTMLSKCTVFPD-QKSTLGNLKLSVSDLPMLSCHYIQKGCLFTHPNLPLHSLIPL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK +LS+ L+ FP LAGRL TD+ G++YI  ND G++F+HA A  L    LL    D+P+
Sbjct  60    LKSALSRTLSLFPPLAGRLITDSHGYLYISCNDAGVDFIHANATGLRICDLLSPL-DVPQ  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D  +SY GH  P++A+QVTEL+D +F+GC +NHAV DGTSFWNFFNT+A+  
Sbjct  119   SFKDFFSFDRKVSYTGHFSPILAVQVTELADGIFIGCAVNHAVTDGTSFWNFFNTFAQFS  178

Query  1031  KGAKK-ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             +GA   I   PDF RD+   S AVL+ P  GP  TF  + P+RE+IF F+REAI K+K +
Sbjct  179   RGASNCIRNTPDFRRDSFLISDAVLRLPEDGPQVTFDANVPLRERIFSFSREAIQKLKAK  238

Query  854   ANNGKLCNGEN---GKLNGKIT------------------PVNHEPGLQNGGAASEISSF  738
             ANN +     N   G+L  K +                   VN +P  Q      EISSF
Sbjct  239   ANNRRWPENNNNVAGELMRKQSNDNLLKENKATTILETWFKVNSKP--QTVTETVEISSF  296

Query  737   QSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGEL  558
             QS+ A LWR VTRARKL +SKTTTFRMA+NCRHR+EP+L+  YFGNAIQS+PT A AGE+
Sbjct  297   QSVCALLWRGVTRARKLPSSKTTTFRMAVNCRHRIEPKLEAYYFGNAIQSVPTYASAGEV  356

Query  557   LSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD  378
             LS DL W AE L++NV AHDDA VRR + DWE NPR FPLGN DGA ITMGSSPRFPMYD
Sbjct  357   LSRDLRWCAEQLNKNVKAHDDAMVRRFVDDWERNPRCFPLGNPDGASITMGSSPRFPMYD  416

Query  377   NDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             N+FGWGRPLAVRSG ANKFDGKISAFPGR+G G+V LEVVLAP+TM  LE+D E+M+Y +
Sbjct  417   NNFGWGRPLAVRSGRANKFDGKISAFPGRDGTGTVGLEVVLAPQTMEALESDPEFMKYAT  476



>emb|CDX93218.1| BnaC04g46780D [Brassica napus]
Length=451

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 332/460 (72%), Gaps = 13/460 (3%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ VIS   V+P+ K S    LKLSVSDLPMLSC YIQKG L ++P L    L+
Sbjct  1     MPSLENSVTVISTNKVFPD-KKSTLADLKLSVSDLPMLSCHYIQKGCLFTRPHLTPQELL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+HFP LAGRL T   GHV++  ND G + V A+A  +  + ++    D+
Sbjct  60    SHLEHSLSLTLSHFPPLAGRLSTSEDGHVFLSCNDAGADIVFAEAKSVRVSDVITGV-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  +SY GH++P++A+Q+TEL+D VF+GC++NHAVVDGTS WNF NT+AE
Sbjct  119   PGVVKEFFSYDRAVSYEGHNRPILAVQMTELNDGVFIGCSVNHAVVDGTSLWNFVNTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +GA+  +R PDF R+ V  SPAVLK P GGP  TF  + P+RE+IF FTRE IL++K 
Sbjct  179   VSRGAENATRQPDFTRENVLISPAVLKVPRGGPKVTFDENAPLRERIFSFTREQILELKA  238

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEAS  678
               N         G+ NG    +     +   G+  EISSFQSL A LWR++TRAR L ++
Sbjct  239   MVN---------GERNGVEVLLGSNDAVSKTGSKLEISSFQSLCALLWRAITRARNLPSA  289

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
             KTTTFRMA+N RHRL P+L P YFGNAIQS+PT A AGE+LS D+ W A  L+++V AH 
Sbjct  290   KTTTFRMAVNVRHRLSPKLNPDYFGNAIQSVPTFAAAGEVLSRDIRWTAGQLNQSVAAHG  349

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFD  318
             D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMY+NDFGWG+P+AVRSG ANKFD
Sbjct  350   DERIREVVADWEENPRCFPLGNADGASVTMGSSPRFPMYENDFGWGKPVAVRSGRANKFD  409

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GKISAFPGR+GNGSVDLEV+LAPETMAG+E D E+M+YVS
Sbjct  410   GKISAFPGRDGNGSVDLEVILAPETMAGIECDGEFMRYVS  449



>ref|XP_009141855.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Brassica rapa]
Length=510

 Score =   497 bits (1280),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 271/468 (58%), Positives = 340/468 (73%), Gaps = 16/468 (3%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ VIS   V+P+ K S    LKLSVSDLPMLSC YIQKG L ++P L    L+
Sbjct  1     MPSLENSVTVISTNKVFPD-KKSTLADLKLSVSDLPMLSCHYIQKGCLFTRPHLTPHELL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+HFP LAGRL T   GHV++  ND G + V A+A  +S + ++    D+
Sbjct  60    SHLEHSLSLTLSHFPPLAGRLSTSEDGHVFLSCNDAGADIVFAEAKSVSVSDVITGG-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  + Y GH++P++A+QVTEL+D VF+GC++NHAVVDGTS WNF NT+AE
Sbjct  119   PGVVKEFFSYDRAVRYEGHNRPILAVQVTELNDGVFIGCSVNHAVVDGTSLWNFVNTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +GA+ ++R PDF R++V  SPAVLK P GGP  TF  + P+RE+IF FTRE IL++K 
Sbjct  179   VSRGAENVTRQPDFTRESVLISPAVLKVPRGGPKVTFDENAPLRERIFSFTREQILELKA  238

Query  857   RANNGK-----LCNGENGKLNGKITPVNHEPGLQNGGAAS------EISSFQSLSAQLWR  711
               N  +     L    N KLNGK+T +  E  L +  A S      EISSFQSL A LWR
Sbjct  239   MVNGERNGVEVLGKQSNDKLNGKLTEM-LESLLGSNDAVSKTESKREISSFQSLCALLWR  297

Query  710   SVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAA  531
             ++TRAR L ++KTTTFRMA+N RHRL P+L P YFGNAIQS+PT A AGE+LS D+ W A
Sbjct  298   AITRARNLPSAKTTTFRMAVNVRHRLSPKLNPEYFGNAIQSVPTFATAGEVLSRDIRWTA  357

Query  530   EMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPL  351
             + L+R+V AH D  +R  + DWE NPR FPLGN DGA +TMGSSPRFPMY+NDFGWG+P+
Sbjct  358   DQLNRSVAAHGDERIREVVADWEANPRCFPLGNADGASVTMGSSPRFPMYENDFGWGKPV  417

Query  350   AVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             AVRSG ANKFDGKISAFPGR+GNGSVDLEVV+APETMAG+E D E+M+
Sbjct  418   AVRSGRANKFDGKISAFPGRDGNGSVDLEVVIAPETMAGIECDGEFMR  465



>ref|XP_010534567.1| PREDICTED: BAHD acyltransferase DCR [Tarenaya hassleriana]
Length=486

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 272/487 (56%), Positives = 342/487 (70%), Gaps = 32/487 (7%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS    + VIS+CTV P ++ S    LKLSVSDLPMLSC YIQKG L ++        +
Sbjct  1     MPSLHHPVTVISRCTVVP-HQKSTLVDLKLSVSDLPMLSCHYIQKGCLFTRHHTVPLHAL  59

Query  1397  s-llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshAD  1221
                LK SLS AL+ FP LAGRL TD+ GHV+ +S+D G +F  A+A  +    ++    D
Sbjct  60    LPHLKRSLSVALSRFPPLAGRLSTDSHGHVFSVSDDSGADFFFAEARSVHVRDVIGGI-D  118

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P   + FF +D  +SY GH +P++A+QVTEL+D VF+GC++NH++ DGTSFWNFFNT+A
Sbjct  119   VPEVVKGFFSFDGAVSYEGHYRPILAVQVTELADGVFIGCSVNHSITDGTSFWNFFNTFA  178

Query  1040  EICK-GAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKM  864
             E+ + G K ++R PDF R++V  S AVLK P GGP  TF+ +EP+RE+IF F+REAI ++
Sbjct  179   EVSRAGMKIVTRQPDFTRESVLISQAVLKVPPGGPKVTFNVNEPLRERIFSFSREAITEL  238

Query  863   KFRAN----------NGKLCNGE----------NGKLNGKITPVNHEPGLQNGGAASEI-  747
             K   N          NG +   E          NGK N K+T +  E         S + 
Sbjct  239   KATVNSYNKKKLTRGNGDIDGAELMGKQSNDKLNGKDNAKLTEM-LESLFARDDVVSVVE  297

Query  746   ----SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPT  579
                 SSFQSL A LWR++TRARKL +SKTTTFRMA+NCR RL P+L P YFGNAIQSIPT
Sbjct  298   KKIFSSFQSLCALLWRAITRARKLPSSKTTTFRMAVNCRQRLSPKLNPYYFGNAIQSIPT  357

Query  578   VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSS  399
              A AGE+LS DL W AE L+R+V AHDD  +R  +++WE NPR FPLGNFDGA IT+GSS
Sbjct  358   YAAAGEVLSRDLRWCAEELNRSVTAHDDGKIRSVVKEWEENPRCFPLGNFDGASITIGSS  417

Query  398   PRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDM  219
             PRFPMYDNDFGWGRP+AVRSG ANKFDGKISAFPGREG+GSVDLEV+L+PETMA +E+D 
Sbjct  418   PRFPMYDNDFGWGRPVAVRSGRANKFDGKISAFPGREGSGSVDLEVILSPETMAAVESDR  477

Query  218   EYMQYVS  198
             E+M+YVS
Sbjct  478   EFMRYVS  484



>emb|CDY07045.1| BnaA04g22700D [Brassica napus]
Length=450

 Score =   489 bits (1260),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 333/460 (72%), Gaps = 14/460 (3%)
 Frame = -3

Query  1571  MPS--SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaali  1398
             MPS  +S+ VIS   V+P+ K S    LKLSVSDLPMLSC YIQKG L ++P L    L+
Sbjct  1     MPSLENSVTVISTNKVFPD-KKSTLADLKLSVSDLPMLSCHYIQKGCLFTRPHLTPHELL  59

Query  1397  sllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADI  1218
             S L+ SLS  L+HFP LAGRL T   GHV++  ND G + V A+A ++    ++    D+
Sbjct  60    SHLEHSLSLTLSHFPPLAGRLSTSEDGHVFLSCNDAGADIVFAEAKYVRVGDVMAGV-DV  118

Query  1217  PREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             P   + FF YD  +SY GH++P++A+QVTEL+D VF+GC++NHAVVDGTS WNF NT+AE
Sbjct  119   PGVVKEFFSYDRAVSYEGHNRPILAVQVTELNDGVFIGCSVNHAVVDGTSLWNFVNTFAE  178

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
             + +GA+  +R PDF R++V  SPAVLK P GGP  TF  + P+RE+IF FTRE IL++K 
Sbjct  179   VSRGAENATRQPDFTRESVLISPAVLKVPRGGPKVTFDENAPLRERIFSFTREQILELKA  238

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEAS  678
               N         G+ NG +  +  +   +   +   ISSFQSL A LWR++TRAR L ++
Sbjct  239   MVN---------GERNG-VEVLGKQSNDKLNESKLVISSFQSLCALLWRAITRARNLPSA  288

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
             KTTTFRMA+N RHRL P+L P YFGNAIQS+PT A AGE+LS D+ W A+ L+R+V AH 
Sbjct  289   KTTTFRMAVNVRHRLSPKLNPEYFGNAIQSVPTFATAGEVLSRDIRWTADQLNRSVAAHG  348

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFD  318
             D   R  + DWE NPR FPLGN DGA +TMGSSPRFPMY+NDFGWG+P+AVRSG ANKFD
Sbjct  349   DERTREVVADWEANPRCFPLGNADGASVTMGSSPRFPMYENDFGWGKPVAVRSGRANKFD  408

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GKISAFPGR+GNGSVDLEVV+APETMAG+E D E+M+YVS
Sbjct  409   GKISAFPGRDGNGSVDLEVVIAPETMAGIECDGEFMRYVS  448



>ref|XP_004308921.1| PREDICTED: uncharacterized protein LOC101293941 [Fragaria vesca 
subsp. vesca]
Length=857

 Score =   504 bits (1297),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 260/449 (58%), Positives = 320/449 (71%), Gaps = 25/449 (6%)
 Frame = -3

Query  1472  PMLSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSND  1293
             PMLSC YIQKG L ++P     +LISLLK  LS+ L  FP LAGRL TD  G+++I  ND
Sbjct  409   PMLSCHYIQKGGLFTKPSFPIQSLISLLKTGLSQTLTRFPPLAGRLITDKDGYIHITCND  468

Query  1292  EGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAV  1113
              G+ F+HA A  +S   +L     +P   + FF  D T+SY GH  P++A+QVTEL D V
Sbjct  469   AGVNFIHATATEVSVRDILSPTH-VPESVKEFFALDRTVSYTGHHNPILAVQVTELKDGV  527

Query  1112  FVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAA  933
             F+GC +NHAV+DGTS WNFFNT+AE+C+G K  SR PDF R+++  S AVL+ P GGP  
Sbjct  528   FIGCAVNHAVIDGTSLWNFFNTFAEVCRGGKSFSRKPDFTRESILISQAVLQLPEGGPKV  587

Query  932   TFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGEN--------GKLN----------G  807
             TF+ +EP+ E+IF F+REAILK+K R NN K    ++        GK +           
Sbjct  588   TFNVNEPLAERIFSFSREAILKLKARTNNKKWTQNDDVAALVEILGKQSNNPYNTNNNGA  647

Query  806   KITPV------NHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINC  645
             ++T +      N +P +      +EISSFQSL A LW++VTRARKL  +KTTTFRMA+NC
Sbjct  648   RVTAIFENWFNNCKPQITEDKTTAEISSFQSLCALLWKAVTRARKLPEAKTTTFRMAVNC  707

Query  644   RHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDW  465
             RHRLEP+L   YFGNAIQSIPT A AG++ S DL W AE L+ NV AH    VR  ++DW
Sbjct  708   RHRLEPKLDAYYFGNAIQSIPTYASAGDVASRDLRWCAEQLNENVKAHGSDRVRECVEDW  767

Query  464   ENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREG  285
             E NPR+FPLGNFDGA +TMGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGKISAFPGR+G
Sbjct  768   EKNPRVFPLGNFDGASMTMGSSPRFPMYDNDFGWGRPLAVRSGRANKFDGKISAFPGRDG  827

Query  284   NGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              G+VDLEVVL+PETMAGLE+D+E+MQYVS
Sbjct  828   AGTVDLEVVLSPETMAGLESDLEFMQYVS  856



>gb|KHN20867.1| BAHD acyltransferase DCR [Glycine soja]
Length=476

 Score =   473 bits (1216),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 273/482 (57%), Positives = 336/482 (70%), Gaps = 33/482 (7%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             MPS +  ++SKCTV+P+ + S   +LKLSVSDLPMLSC YIQKG L + P L   +LI L
Sbjct  1     MPSPAPTMLSKCTVFPD-QKSTLGNLKLSVSDLPMLSCHYIQKGCLFTHPNLPLHSLIPL  59

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPR  1212
             LK +LS+ L+ FP LAGRL TD+ G++YI  ND G++F+HA A  L    LL    D+P+
Sbjct  60    LKSALSRTLSLFPPLAGRLITDSHGYLYISCNDAGVDFIHANATGLRICDLLSPL-DVPQ  118

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              F+ FF +D  +SY GH  P++A+QVTEL+D +F+GC +NHAV DGTSFWNFFNT+A+  
Sbjct  119   SFKDFFSFDRKVSYTGHFSPILAVQVTELADGIFIGCAVNHAVTDGTSFWNFFNTFAQFS  178

Query  1031  KGAKK-ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             +GA   I   PDF RD+   S AVL+ P  GP  TF  + P+RE+IF F+REAI K+K +
Sbjct  179   RGASNCIRNTPDFRRDSFLISDAVLRLPEDGPQVTFDANVPLRERIFSFSREAIQKLKAK  238

Query  854   ANN-------------GKLCNGENG----KLNGKIT------PVNHEPGLQNGGAASEIS  744
             ANN             G+L   ++     K N   T       VN +P  Q      EIS
Sbjct  239   ANNRRWPENNNNNNIAGELMRKQSNDNLLKENKATTILETWFKVNSKP--QTVTETVEIS  296

Query  743   SFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAG  564
             SFQS+ A LWR VTRARKL +SKTTTF      RHR+EP+L+  YFGNAIQS+PT A AG
Sbjct  297   SFQSVCALLWRGVTRARKLPSSKTTTFS-----RHRIEPKLEAYYFGNAIQSVPTYASAG  351

Query  563   ELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPM  384
             E+LS DL W AE L++NV AHDDA VRR + DWE NPR FPLGN DGA ITMGSSPRFPM
Sbjct  352   EVLSRDLRWCAEQLNKNVKAHDDAMVRRFVDDWERNPRCFPLGNPDGASITMGSSPRFPM  411

Query  383   YDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQY  204
             YDN+FGWGRPLAVRSG ANKFDGKISAFPGR+G G+V LEVVLAP+TM  LE+D E+M+Y
Sbjct  412   YDNNFGWGRPLAVRSGRANKFDGKISAFPGRDGTGTVGLEVVLAPQTMEALESDPEFMKY  471

Query  203   VS  198
              +
Sbjct  472   AT  473



>ref|XP_009345656.1| PREDICTED: BAHD acyltransferase DCR-like, partial [Pyrus x bretschneideri]
Length=402

 Score =   459 bits (1180),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 223/378 (59%), Positives = 269/378 (71%), Gaps = 36/378 (10%)
 Frame = -3

Query  1223  DIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTY  1044
             D+P   + FF +D T+SY+GH   ++A+QVTELSDAVF+GC+ NHAV+DGTSFWNFFNT+
Sbjct  24    DVPDCVKEFFAFDRTVSYSGHHNAILAVQVTELSDAVFIGCSANHAVIDGTSFWNFFNTF  83

Query  1043  AEICKGAKK--------------ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIR  906
             AE+C+ +                I+R PDF R++V  SPAVL+ PAGGP  TF+ DEP+R
Sbjct  84    AELCRASPSSLSPNENYNYTKMTITRQPDFSRNSVLISPAVLRVPAGGPKVTFNVDEPVR  143

Query  905   EKIFHFTREAILKMKFRANNGKLC----------------------NGENGKLNGKITPV  792
             E+IF F+REA+ K+K R NN K                        N +NG     I   
Sbjct  144   ERIFSFSREAMQKLKARTNNKKWSENGDVLLSAVEILGKQSNDPYQNKDNGAKVTSIIEN  203

Query  791   NHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPL  612
               +    N    +EISSFQSL A LWRSVTRAR L +SKTTTFR A+NCRHRLEP+L   
Sbjct  204   WSKNSNANSKTTAEISSFQSLCALLWRSVTRARNLPSSKTTTFRRAVNCRHRLEPKLDAF  263

Query  611   YFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN  432
             YFGNAIQSIPT A AGELLSHD  W AE L++NV A+D+  VR  ++DWE +PR+FPLGN
Sbjct  264   YFGNAIQSIPTYATAGELLSHDTRWCAEQLNKNVKAYDNDRVRGVVEDWERDPRVFPLGN  323

Query  431   FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLA  252
             FDGAM+T+GSSPRFPMYDNDFGWGRP+A+RSG ANKFDGKISAFPGREG GSVDLEVVLA
Sbjct  324   FDGAMMTVGSSPRFPMYDNDFGWGRPMAIRSGRANKFDGKISAFPGREGGGSVDLEVVLA  383

Query  251   PETMAGLENDMEYMQYVS  198
             P+ MAG+E D E+M YVS
Sbjct  384   PDAMAGVETDSEFMHYVS  401



>ref|XP_008785410.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Phoenix 
dactylifera]
Length=475

 Score =   461 bits (1185),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 272/464 (59%), Positives = 327/464 (70%), Gaps = 16/464 (3%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             ++++ V SKCTVYP+   S    LKLSVSDLPMLSC YIQKG+  SQPP+  A L++LLK
Sbjct  14    AAAVTVASKCTVYPD-SKSTLGDLKLSVSDLPMLSCHYIQKGLFFSQPPIPFAPLLALLK  72

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
              SLS+AL+  PALAGRL T   G + I  ND G EF HA AP L+   LLP  +D+P   
Sbjct  73    SSLSRALSLLPALAGRLSTLPDGRIVISCNDAGAEFSHAVAPSLTLPLLLPPSSDVPLPV  132

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICK  1029
             +S F +D  +SY GH +PL A QVTEL D A+F+GC +NHA+VDGTSFWNFFN +AE+C+
Sbjct  133   KSLFPFDGAVSYQGHLRPLAAFQVTELGDGAIFIGCVVNHAIVDGTSFWNFFNVWAELCR  192

Query  1028  GAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             G    S  PDF R+   +S +VL+F  G GP  TF  + P+RE++FHF+REA+  +K RA
Sbjct  193   GGSPKS--PDFRRNFFGDSTSVLRFADGDGPEVTFPVNAPLRERVFHFSREAVRDLKSRA  250

Query  851   NNG----KLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-L  687
             N          G   ++ GK      + G++      EISSFQSL AQLWRSVTRARK L
Sbjct  251   NRQAQRVSTGGGPIAEIYGKQIHDRKKAGMEE-----EISSFQSLCAQLWRSVTRARKHL  305

Query  686   EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVV  507
                 TTTFRMA+NCRHR+ PR+ PLYFGNAIQSIPT A  GE+ + +L W A +LHRNV 
Sbjct  306   PPEATTTFRMAVNCRHRVRPRVDPLYFGNAIQSIPTTAAVGEVTASELGWTARLLHRNVA  365

Query  506   AHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMA  330
             A+ D  VRR + DWE  PR FPLGN DGA ITMGSS RFPMY+ NDFGWG PLAVRSG A
Sbjct  366   AYGDEAVRRVVADWEAAPRCFPLGNPDGAGITMGSSNRFPMYEGNDFGWGLPLAVRSGRA  425

Query  329   NKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NKF+GKISAFPGREG GSVDLEV LAP+TMA L  D E+MQYVS
Sbjct  426   NKFNGKISAFPGREGGGSVDLEVCLAPDTMAALLQDDEFMQYVS  469



>ref|XP_008800790.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Phoenix 
dactylifera]
Length=510

 Score =   457 bits (1177),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 272/460 (59%), Positives = 330/460 (72%), Gaps = 9/460 (2%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             ++ + V+S+CTVYP+   S    L LSVSDLPMLSC YIQKG+   +PP+  A L+SLLK
Sbjct  50    AAPVTVVSRCTVYPD-TKSTLGDLNLSVSDLPMLSCHYIQKGLFFPRPPIPFAPLLSLLK  108

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
              SLS+AL+ FPALAGRL T A G + I  ND G +F HA AP L+   LLP+ +D+P   
Sbjct  109   SSLSRALSLFPALAGRLSTLADGRIVISCNDAGADFSHAVAPSLALPLLLPTSSDVPLPV  168

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICK  1029
             +SFF +D  +SY GH +PL A QVTEL D AVF+G  ++HA+VDGTSFWNFFNT+AE+C+
Sbjct  169   KSFFPFDGAVSYQGHFRPLAAFQVTELGDGAVFIGSVVDHAIVDGTSFWNFFNTWAELCR  228

Query  1028  GAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             G     + PDF R+   +S AV++F  G GP  TF  + P+RE+IFHF+REAI  +K RA
Sbjct  229   GGAP--QPPDFRRNFFGDSTAVIRFADGAGPEVTFPVNAPLRERIFHFSREAIRDLKSRA  286

Query  851   NNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEASK  675
             N+    +    ++ GK      +       AA EISSFQSL AQLWRSVTRARK L    
Sbjct  287   NS--RAHDSIAEICGKQIHDRKKATTAAAAAAGEISSFQSLCAQLWRSVTRARKHLRPEA  344

Query  674   TTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDD  495
             TTTFRMA+NCRHRL P++ PLYFGNAIQSIPT A  GE+ + +L WAA +LHR+VVAH D
Sbjct  345   TTTFRMAVNCRHRLVPQVDPLYFGNAIQSIPTAAAVGEVAASELQWAAGLLHRSVVAHGD  404

Query  494   ATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKFD  318
               VRR + +WE  PR FPLGN DGA ITMGSS RFP+Y+ NDFGWG PLAVRSG ANKFD
Sbjct  405   EAVRRVVAEWEAAPRCFPLGNPDGAGITMGSSHRFPVYEGNDFGWGLPLAVRSGRANKFD  464

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GKISAFPGREG GSVDLEV LAP+TMA L  D E+M YVS
Sbjct  465   GKISAFPGREGGGSVDLEVCLAPDTMAALLKDDEFMHYVS  504



>ref|XP_010908559.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=508

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 272/462 (59%), Positives = 331/462 (72%), Gaps = 15/462 (3%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             +++ V+S+CTV P+   S    LKLSVSDLPMLSC YIQKG+   +PP+  A L+SLLK 
Sbjct  49    AAVTVVSRCTVCPD-TESTLGGLKLSVSDLPMLSCHYIQKGLFFPRPPIPFAPLLSLLKS  107

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFR  1203
             SLS+AL+ FPALAGRL T   G + I  ND G +F HA A  L+   LLP+ +D+P   +
Sbjct  108   SLSRALSLFPALAGRLSTLPDGRIVISCNDAGADFSHAVASSLTLPLLLPTSSDVPLPVK  167

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             SFF +D  +SY GH +PL A QVTEL D AVF+GC +NHA++DGTSFWNFFNT+AE+C+G
Sbjct  168   SFFPFDGAVSYQGHFRPLAAFQVTELGDGAVFIGCVVNHAILDGTSFWNFFNTWAELCRG  227

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRAN  849
             A    + PDF R+   +S AVL+F  G GP  TF  + P+RE+IFHF+REAI  +K RAN
Sbjct  228   AAP--QPPDFRRNFFGDSTAVLRFADGAGPKVTFPVNAPLRERIFHFSREAIRDLKSRAN  285

Query  848   NGKLCNGENGKLNGKITPVNHEPGLQNGGAAS---EISSFQSLSAQLWRSVTRARK-LEA  681
                  +    ++ GK     H+P      AA+   +ISSFQSL AQLWR+VTRARK L  
Sbjct  286   GRT--HDSIAEIYGKQI---HDPKKATTAAAAAEEQISSFQSLCAQLWRAVTRARKHLRP  340

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHR+ PR+ P YFGNAIQSIPT A  GE+ + +L W A +LH+NVVAH
Sbjct  341   EATTTFRMAVNCRHRVVPRVDPSYFGNAIQSIPTTAAVGEVSARELRWTAGLLHQNVVAH  400

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
              D TVRR + +WE  PR FPLGN DGA ITMGSS RFP+Y+ NDFGWG PLAVRSG ANK
Sbjct  401   RDETVRRMVAEWEATPRCFPLGNPDGAGITMGSSHRFPVYEGNDFGWGLPLAVRSGRANK  460

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGKISAFPGREG GSVDLEV LAP+TMA L  D E+M YVS
Sbjct  461   FDGKISAFPGREGGGSVDLEVCLAPDTMAALLQDDEFMHYVS  502



>ref|XP_009419670.1| PREDICTED: BAHD acyltransferase DCR-like [Musa acuminata subsp. 
malaccensis]
Length=489

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 271/502 (54%), Positives = 336/502 (67%), Gaps = 25/502 (5%)
 Frame = -3

Query  1679  ILSSQHFPPIPFFSLYSSSCKSTRIKDTAkkrrkkKMPSSSIVVISKCTVYPEYkssnsk  1500
             ILS+ H+P +   SL S    S               P++++ V+S+CTVYP+ + S+  
Sbjct  4     ILSTFHYPSLAAASLISGGLSSI-----------FSSPAAAVSVVSRCTVYPD-RRSDLG  51

Query  1499  slklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAK  1320
              L LSVSDLPMLSC YIQKG+  S PP+  A+L+SLL  SLS+AL+ FPALAGRL T   
Sbjct  52    DLPLSVSDLPMLSCHYIQKGLFFSSPPIPVASLLSLLTSSLSRALSIFPALAGRLCTLPD  111

Query  1319  GHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAI  1140
             G + +  ND G EF HA A  LS   LLP  AD+P   +S F  D ++S+ GH++PL A 
Sbjct  112   GRILVSCNDAGAEFSHATAASLSLPDLLPPSADVPPAVKSLFPLDGSISFHGHTRPLAAF  171

Query  1139  QVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAV  963
             Q+TEL+D AVF+G  +NHAVVDGTSFWNF N +AE+C+G       PDF R+    S AV
Sbjct  172   QLTELADGAVFLGAAVNHAVVDGTSFWNFLNAWAELCRGGDPAK--PDFHRNYFGGSKAV  229

Query  962   LKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRAN----NGKLCNGENGKLNGKIT  798
             L FP G GP  TF  + P+RE+IFHF+REA+L++K RAN    N    + ++ ++ GK T
Sbjct  230   LCFPDGRGPEVTFPVNAPLRERIFHFSREAVLELKSRANRRTKNVVAGDSKDAEVYGKQT  289

Query  797   PVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRAR-KLEASKTTTFRMAINCRHRLEPRL  621
                H+P         EISSFQSL A +WRSVTRAR +L A   TTFR+A+NCRHR+ P +
Sbjct  290   ---HDPKTVEVNDEEEISSFQSLCAHVWRSVTRARTRLPAEAITTFRIAVNCRHRVVPPV  346

Query  620   KPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFP  441
                YFGNAIQSIPT A  GE+   DL W A +LHR+V  H D  +RRG+ +WE  PR FP
Sbjct  347   AANYFGNAIQSIPTKAAVGEVAGRDLRWVAALLHRSVAGHGDEAIRRGVAEWEAAPRCFP  406

Query  440   LGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLE  264
             LGN DGA +TMGSSPRFPMY+ NDFGWGRP AVRSG ANKFDGK+SAFPG EG GSV+LE
Sbjct  407   LGNPDGAGLTMGSSPRFPMYEGNDFGWGRPAAVRSGRANKFDGKMSAFPGHEGGGSVELE  466

Query  263   VVLAPETMAGLENDMEYMQYVS  198
             V L PETM  L  D E+M YVS
Sbjct  467   VCLTPETMTALLRDEEFMSYVS  488



>ref|XP_004503391.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=797

 Score =   449 bits (1156),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 234/460 (51%), Positives = 318/460 (69%), Gaps = 6/460 (1%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             SS++ ++SKCTV+P+ KS+             ML C YIQKGVL + P L +  LI  L 
Sbjct  337   SSAVTILSKCTVFPDQKSTLEDLKLSISDLN-MLCCHYIQKGVLFTTPSLPSQTLIPHLI  395

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
              SLSK L+ FP  +GR  TD+ G++Y+  ND G++F+HA A H S   LL    D+ + F
Sbjct  396   TSLSKTLSIFPPFSGRFVTDSNGYIYVTCNDAGVDFIHATATHFSITDLLSPL-DVHQAF  454

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             + FF +   ++Y  H  P++A+QVT L+D +F+G  ++HAV DGT+ WNFFNT+A+I KG
Sbjct  455   KKFFPFHHKINYTAHFSPILAVQVTYLADGIFIGVAVSHAVTDGTTLWNFFNTFADISKG  514

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
               +++R+PDF R+++  S   L+   G    TF+ D+P+RE+IF F+REAI K+K R N 
Sbjct  515   VTRVTRIPDFRRESILISKVALRLLEGDIKVTFNPDDPLRERIFSFSREAIQKLKARVNQ  574

Query  845   GKLCNGENGKLNGKITPVNHEPGLQ----NGGAASEISSFQSLSAQLWRSVTRARKLEAS  678
                 + EN  +   I+ +N++  L+    +G   SEISSFQSL A +WR VTRARKL+ S
Sbjct  575   NHHISPENADVAELISKMNNDVQLKTVTRDGSETSEISSFQSLCALMWRCVTRARKLDDS  634

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
             KTTTFRMA+N R+RL+P+L   YFGNAIQSI T AK  ++ ++D++W  E L++NV A+D
Sbjct  635   KTTTFRMAVNIRNRLQPKLSEYYFGNAIQSIATCAKVYDVSNNDITWCGEQLNKNVRAYD  694

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFD  318
                VRR I++WE  P+ F LGN DG ++ MGSS RFPMYDNDFGWGRP+AVRSG ANKFD
Sbjct  695   SGVVRRVIENWEREPKCFELGNNDGGILQMGSSHRFPMYDNDFGWGRPIAVRSGGANKFD  754

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GK+SAFPGR+G GS+D+EVVLAPETMA LE D E+M Y +
Sbjct  755   GKMSAFPGRKGGGSIDVEVVLAPETMALLETDSEFMLYAT  794



>ref|XP_007163518.1| hypothetical protein PHAVU_001G240700g [Phaseolus vulgaris]
 gb|ESW35512.1| hypothetical protein PHAVU_001G240700g [Phaseolus vulgaris]
Length=481

 Score =   437 bits (1125),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 306/458 (67%), Gaps = 7/458 (2%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkls  1380
             +I V+SKCTV P   S+             +LS  YIQKG L + P L +  LI  L  +
Sbjct  26    AITVLSKCTVVPHQTSTLGDLKLSISDLNMLLS-HYIQKGCLFTTPSLPSHTLIPHLINA  84

Query  1379  lskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRS  1200
             LS+ L+ FP  AGRL +   G+VYI  NDEG++F+HA A H+S A LL      P  F  
Sbjct  85    LSRTLSFFPPFAGRLKSHHHGYVYIACNDEGVDFIHATALHISVADLLSPSHPHP-TFNH  143

Query  1199  FFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK  1020
              F +   +SY  HS P+MA QVTELSD VF+GC + HAV DG SFWNFFNT+A + +GA 
Sbjct  144   LFPFHHKISYTAHSSPIMAFQVTELSDGVFIGCAVCHAVTDGASFWNFFNTFAAVSQGAT  203

Query  1019  KI-SRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
                SR+PDF RD++  S  +L+ P      TF  D P RE+IF F+RE+I K+K  ANNG
Sbjct  204   VCPSRLPDFRRDSILTSKILLRLPKE-IKVTFDVDAPFRERIFSFSRESIQKLKAVANNG  262

Query  842   -KLCNGENGKLNGKITPVNHEPGLQNG--GAASEISSFQSLSAQLWRSVTRARKLEASKT  672
              K+C  EN +L GK++       +  G     +EISSFQSL A +WRSVT+AR LE  + 
Sbjct  263   GKVCLSENVELMGKLSHDTQVKPVTRGITNETTEISSFQSLCALMWRSVTKARNLEGPQV  322

Query  671   TTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDA  492
             TTFRMA+N R R+EP+L   YFGNAIQSI   A AG+++S DL W AE+L+++V A D  
Sbjct  323   TTFRMAVNVRQRMEPKLGDYYFGNAIQSIAACAAAGDVVSSDLRWCAELLNKSVKAFDSD  382

Query  491   TVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGK  312
             TVRR +++WE  P+ F LGN DGA + MGSSPRFPMY+NDFGWGRPLAVRSG ANKFDGK
Sbjct  383   TVRRNVENWEREPKCFELGNHDGATLQMGSSPRFPMYENDFGWGRPLAVRSGGANKFDGK  442

Query  311   ISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +SAFPGR G GSVDLEVVLAP+TM  L +D E+M YVS
Sbjct  443   MSAFPGRNGGGSVDLEVVLAPDTMDQLHSDPEFMFYVS  480



>ref|XP_004503232.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=478

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 236/460 (51%), Positives = 313/460 (68%), Gaps = 7/460 (2%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             SS++ V+SKCTV+P+ KS+             ML   YIQKGVL   P L +  LI  L 
Sbjct  9     SSAVTVLSKCTVFPDRKSTLGDLKLTISDLT-MLCWHYIQKGVLFITPSLPSQTLIPHLI  67

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
              SLSK L+ FP L+GRL TD+ G++YI  ND G +F+HA A H +   LL S  DI + F
Sbjct  68    TSLSKTLSIFPPLSGRLVTDSNGYIYITCNDAGADFIHATATHFTLTDLLSSP-DIHQAF  126

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
               FF +   L+Y  H  P++A+QVT L D VF+G  + HAV DG++ WNFFNT+A+I +G
Sbjct  127   EQFFPFHRKLNYDAHFSPILAVQVTYLPDGVFIGVAVCHAVTDGSTLWNFFNTFADISRG  186

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
                +SR+PDF R+++ NS   ++ P GG    F+ DEP+RE+IF F+REAI K+K R N+
Sbjct  187   VTPLSRIPDFRRESILNSKVAVQLPEGGIELAFNPDEPLRERIFSFSREAIQKLKSRVNH  246

Query  845   GKLCNGENGKLNGKITPVNHEPGLQ----NGGAASEISSFQSLSAQLWRSVTRARKLEAS  678
              +  + EN  +   I+ ++ +  L+    NG    ++SSFQSL A +W+ VTRARKL+ S
Sbjct  247   HR-TSPENADVAELISKLSDDTQLKTVTRNGSEMEDVSSFQSLCAMMWQCVTRARKLDGS  305

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
             +TTTFRMA N R+RLEP+L   YFGNAIQSI T  K  E+L++DL+W AE L+++V  +D
Sbjct  306   ETTTFRMAANIRNRLEPKLGEYYFGNAIQSIATCCKVYEVLNNDLTWCAEQLNKSVREYD  365

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFD  318
                VRR +++WE  P+ F LG+ DGA++ MGSS RFPMYDNDFGWGRPLAVRSG ANKFD
Sbjct  366   SVVVRRVVENWEREPKCFKLGSQDGALLLMGSSHRFPMYDNDFGWGRPLAVRSGGANKFD  425

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GKIS +PGR+G GS+DLEV LAPETMA L  D E+M Y +
Sbjct  426   GKISVYPGRKGGGSIDLEVALAPETMALLVTDSEFMLYAT  465



>ref|XP_009380610.1| PREDICTED: BAHD acyltransferase DCR-like [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   435 bits (1118),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 254/458 (55%), Positives = 314/458 (69%), Gaps = 8/458 (2%)
 Frame = -3

Query  1556  IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklsl  1377
             + ++SKCTV P+   S+   L LSVSDLPMLSC YIQKG+    P +  A+L+SLL  SL
Sbjct  19    VTIVSKCTVCPD-SDSSLGGLPLSVSDLPMLSCHYIQKGLFFPSPQMPIASLVSLLTSSL  77

Query  1376  skalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSF  1197
             S AL+ FP LAGRL T   G + +  ND G+EF +A A  L+   LLP  +D+P   +S 
Sbjct  78    SGALSLFPPLAGRLSTLPDGRILVSCNDAGVEFAYATAYSLTLPDLLPPSSDVPAAVKSL  137

Query  1196  FQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK  1020
             F  D  +S+ GH +PL + Q+TEL+D AVF+G  +NHAVVDGTSFWNFFN +AE+C+  +
Sbjct  138   FPLDGAISFHGHFRPLASFQLTELADGAVFLGAAVNHAVVDGTSFWNFFNAWAELCR--R  195

Query  1019  KISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRANNG  843
                  PDF R+   +S AVL+FP G GP  TF  D P+RE+IF  +REAI ++K RAN+G
Sbjct  196   GSPSPPDFRRNYFGDSKAVLRFPGGRGPEVTFPVDAPLRERIFRLSREAIFELKSRANDG  255

Query  842   KLCNGENGKLNGKITPVN-HEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEASKTT  669
                    G  N +I     H+P         +ISSFQSL A +WRSVTRARK L     T
Sbjct  256   FANVAAVGDPNAEIYGKQVHDPKAVMAYKEEQISSFQSLCAHVWRSVTRARKQLPPEAMT  315

Query  668   TFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDAT  489
             TFRMA+NCRHR+EP++ P YFGNAIQSIPT A   E++  DL WAA +LHRNV +H + T
Sbjct  316   TFRMAVNCRHRVEPQVAPDYFGNAIQSIPTTAAVREVVGRDLRWAAGLLHRNVASHGNET  375

Query  488   VRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKFDGK  312
             +RRG+  WE  PR FPLGN DGA +TMGSS RFPMY+ NDFGWG P AVRSG ANKFDGK
Sbjct  376   IRRGVAVWEAAPRCFPLGNPDGAGLTMGSSHRFPMYEGNDFGWGLPAAVRSGRANKFDGK  435

Query  311   ISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +SAFPGREG GSV+LEV LAPETM  L  D E+M YV+
Sbjct  436   MSAFPGREGGGSVELEVCLAPETMEALLRDEEFMSYVT  473



>ref|XP_006601956.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=473

 Score =   433 bits (1113),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 241/463 (52%), Positives = 310/463 (67%), Gaps = 18/463 (4%)
 Frame = -3

Query  1550  VISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslsk  1371
             V+SKCTV P   S+             +LS  YIQKG L + P L ++ALI  LK +LS+
Sbjct  16    VVSKCTVVPHRNSTMGDLKLSISDLNMLLS-HYIQKGCLFTTPSLPSSALIPHLKNALSQ  74

Query  1370  alAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaa-----allpshADIPREF  1206
              L+ FP LAGRL TDA G+VYI  ND G++F+H  A  +S A     +   S +D+P  F
Sbjct  75    TLSLFPPLAGRLKTDADGYVYITCNDTGVDFIHVTAADISVADLLSPSSSSSSSDVPPIF  134

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             +  F +   +SY  HS P+MA QVT+L+D +F+GC + HAV DG SFWNFFNT+A I +G
Sbjct  135   KQLFPFHHKISYTAHSSPIMAFQVTDLADGIFLGCAVCHAVTDGASFWNFFNTFAGISRG  194

Query  1025  AKKI-SRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRAN  849
             A    S +PDF R+++ NS  VL+ P      TF+ +EP RE+IF F+RE+I ++K   N
Sbjct  195   ATTSPSTLPDFRRESILNSNVVLRLPEE-IKVTFNVEEPFRERIFSFSRESIQELKATVN  253

Query  848   NGKLC------NGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKL  687
             N  L       NG+  +L  K++       +      +EISSFQSL A +WR VT+AR +
Sbjct  254   NNGLTSFPPPENGDAVELMAKMSNDTQPKTV----TTTEISSFQSLCALVWRCVTKARNI  309

Query  686   EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVV  507
             E SKTTTFRMA+N R RLEP+L   YFGNAIQSI T A+A ++ S +L W AE L+++V 
Sbjct  310   EGSKTTTFRMAVNVRQRLEPKLGDCYFGNAIQSIATCAEAADVASKELRWCAEQLNKSVK  369

Query  506   AHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMAN  327
             A D ATV R +++WE  P+ F LGN DGA + MGSSPRFPMYDNDFGWGRPLAVRSG AN
Sbjct  370   AFDSATVHRNVENWERQPKCFELGNHDGATVQMGSSPRFPMYDNDFGWGRPLAVRSGGAN  429

Query  326   KFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             KFDGK+SAFPGR G G+VDLE+VLAP+TMA LE+D E+M YVS
Sbjct  430   KFDGKMSAFPGRNGGGAVDLEMVLAPDTMARLESDSEFMFYVS  472



>ref|XP_009413798.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 257/453 (57%), Positives = 309/453 (68%), Gaps = 7/453 (2%)
 Frame = -3

Query  1544  SKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklslskal  1365
             SKCTVYP+ + S+   L LSVSDLPMLSC YIQKG+    PP+  A+L+SLL  SLS+AL
Sbjct  43    SKCTVYPD-RESDLSDLPLSVSDLPMLSCHYIQKGLFFLPPPVPIASLVSLLTSSLSRAL  101

Query  1364  AHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYD  1185
             + FPALAGRL T   G ++I  ND G EF +A A   S   LLP  +D+P   +S F +D
Sbjct  102   SLFPALAGRLCTHPDGRIFISCNDAGAEFSYATAASFSLPDLLPPSSDVPSAVKSLFPFD  161

Query  1184  STLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISR  1008
               +S+ GH +PL A Q+TEL+D A+F+G  +NHA+VDGTSFWNFFN +AE+C+G      
Sbjct  162   GAVSFHGHFRPLAAFQLTELADGALFLGAAVNHAIVDGTSFWNFFNAWAELCRGGSPAP-  220

Query  1007  VPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCN  831
              PDF R+    S AVL+FP G GP  TF  D P+RE+IFHF+REAI+ +K RAN      
Sbjct  221   -PDFRRNYFGGSKAVLQFPGGRGPEVTFPVDAPLRERIFHFSREAIVDLKSRANCRAKSI  279

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRAR-KLEASKTTTFRMA  654
                   N +I   N            EISSFQSL A +WRSVTRAR +L A  TTTFRMA
Sbjct  280   AAGDLPNTEIYGENSHDRKTVASNEEEISSFQSLCAHVWRSVTRARTRLPAEATTTFRMA  339

Query  653   INCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
             +NCR R+ PR+   YFGNAIQS PT A   E+   DL WAAE+LHR+V  + +  VRR +
Sbjct  340   VNCRGRVAPRVAANYFGNAIQSTPTKALVAEVAGRDLRWAAELLHRSVADYGNEAVRRVV  399

Query  473   QDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKFDGKISAFP  297
              +WE  PR FPLGN DGA ITMGSS RFPMY+ NDFGWG+  AVRSG ANKFDGK+SAFP
Sbjct  400   AEWEAAPRCFPLGNPDGAGITMGSSHRFPMYEGNDFGWGQAAAVRSGRANKFDGKMSAFP  459

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GREG GSVDLEV LAPETMA L  D E+M YVS
Sbjct  460   GREGGGSVDLEVCLAPETMAALLRDDEFMSYVS  492



>ref|XP_007163519.1| hypothetical protein PHAVU_001G240800g [Phaseolus vulgaris]
 gb|ESW35513.1| hypothetical protein PHAVU_001G240800g [Phaseolus vulgaris]
Length=467

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 247/463 (53%), Positives = 311/463 (67%), Gaps = 13/463 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P  S+ VISKC V P  K+S    LKLS+SDL ML C YIQKG L + P   +  LI  L
Sbjct  7     PCDSVTVISKCKVVP-LKNSTVGDLKLSISDLNMLLCHYIQKGCLFTTPSPPSQPLIPHL  65

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPRE  1209
               +LS  L+ FP  AGRL TD  G+VYI  ND G++ +HA A H+S A LL S  D+   
Sbjct  66    TKALSHTLSLFPPFAGRLKTDVDGYVYIACNDAGVDLIHATATHISVADLLSSS-DVHPT  124

Query  1208  FRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICK  1029
              +  F +   +SYA HS P+MA QVTEL+D VFVGC + HAV DG +FWNFFNT+A I +
Sbjct  125   VKHLFPFHHKISYAAHSSPIMAFQVTELADGVFVGCAVCHAVTDGATFWNFFNTFAAISR  184

Query  1028  GAKKI-SRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMK---  861
             G     SR+PDF RD++ +S  VL+ P      TF+ D P REKIF F+RE+I K+K   
Sbjct  185   GETACPSRLPDFRRDSILSSNVVLRLPKE-IKVTFNVDAPFREKIFSFSRESIQKLKASV  243

Query  860   ----FRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRAR  693
                 F A N  + +    KLNG         G++  G  +EISSFQSL A +W+ VTRAR
Sbjct  244   NSSMFTAENVDVADELTAKLNGDTELKTASEGVR--GERTEISSFQSLCALMWKVVTRAR  301

Query  692   KLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRN  513
              +E SK T+FR A+N R R++P L+  YFGNA+QSI T AK G+++S DL W AE L+R+
Sbjct  302   NMEKSKMTSFRTAVNIRKRMKPELEDCYFGNALQSITTCAKVGDVVSKDLPWCAEQLNRS  361

Query  512   VVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGM  333
             V A D ATV+R +++WE++P+ + LGN DGA + MGSSPRFPMYDNDFGWGRP+ VRSG 
Sbjct  362   VKAFDSATVQRNVENWESDPKCYELGNHDGATVQMGSSPRFPMYDNDFGWGRPVTVRSGG  421

Query  332   ANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQY  204
             ANKFDGK+SAFPG  G GSVD+EVVLA ETMA LE+D E+M Y
Sbjct  422   ANKFDGKLSAFPGSSGGGSVDVEVVLAAETMAQLESDPEFMVY  464



>ref|XP_004961908.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=490

 Score =   425 bits (1092),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 258/459 (56%), Positives = 313/459 (68%), Gaps = 15/459 (3%)
 Frame = -3

Query  1556  IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklsl  1377
             I V+SK TV P   +S    L+LSVSD+PMLSC YIQKG+    P +  A+L+  L  +L
Sbjct  40    ISVVSKQTVRPA-GTSAVGDLRLSVSDMPMLSCHYIQKGLFFRPPGVVMASLVPSLVAAL  98

Query  1376  skalAHFPALAGRLHT-DAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-REFR  1203
             S+AL  FPALAGRL T D    V     D  +EF HA AP LS    L   AD+P R   
Sbjct  99    SRALGVFPALAGRLVTLDDDSIVIRCGGDAAVEFYHAVAPALSLGDFLVPGADVPIRLTN  158

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
               F  D T+SY GH +PL + Q+T L D AVFVG   NHAVVDGTSFW+FFNT+A +C+G
Sbjct  159   GLFPMDRTVSYGGHGRPLTSFQLTVLGDGAVFVGFVANHAVVDGTSFWHFFNTWAGLCRG  218

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRAN  849
             A    R PDF R+   +S AVL+FP G GPA TF  + P+RE+I HF+  AI ++K  AN
Sbjct  219   AP--VREPDFRRNFFGDSTAVLRFPGGVGPAVTFDAEAPLRERILHFSAAAIRELKATAN  276

Query  848   NGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKL-EASKT  672
               K   G++ ++NGK+T   H+  +Q G    EISSFQSL A +WR+VTRAR+L  A KT
Sbjct  277   RWKR-TGQDSEVNGKVT---HDSKVQCG--CREISSFQSLCAHVWRAVTRARRLLAADKT  330

Query  671   TTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDA  492
             TTFRMA+NCRHRL P + PLYFGNAIQS+ T A   EL S+DL WAA  LH  V AH+D 
Sbjct  331   TTFRMAVNCRHRLRPAISPLYFGNAIQSVATKATVAELASNDLGWAAAKLHATVAAHEDG  390

Query  491   TVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKFDG  315
              +R    +WE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGR LAVRSG ANKFDG
Sbjct  391   AIRLAAAEWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRALAVRSGRANKFDG  450

Query  314   KISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             K+SAFPG+ G+GSVD+EV LAP+TMA L  D  ++QYV+
Sbjct  451   KMSAFPGQAGDGSVDVEVCLAPDTMACLLRDEAFLQYVT  489



>emb|CDJ26508.1| unnamed protein product [Triticum aestivum]
Length=492

 Score =   425 bits (1092),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 257/460 (56%), Positives = 316/460 (69%), Gaps = 13/460 (3%)
 Frame = -3

Query  1562  SSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkl  1383
             S I V+S+  V P+   S    L LSVSDLPMLSC YIQKG+    P +  A+L+SLL  
Sbjct  35    SGIAVLSRQAVRPDGPPSAIGDLTLSVSDLPMLSCHYIQKGLFFPAPDVPMASLVSLLVS  94

Query  1382  slskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-REF  1206
             SLS+ALA FPALAGR  T     + I  ND G+EF HA AP LS    L  +AD+P R  
Sbjct  95    SLSRALAVFPALAGRFVTLPDDRIVIRCNDAGVEFHHAVAPALSLNDFLVPNADVPTRLT  154

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICK  1029
             +  F  D T+SY GH +PL + Q+T L D AVF+G   NHAVVDGTSFW+F+NT+A +C+
Sbjct  155   KDLFPMDRTVSYEGHRRPLTSFQLTVLGDGAVFIGIVANHAVVDGTSFWHFYNTWATLCR  214

Query  1028  GAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRA  852
             GA    ++PDF R+    S AVL+F  G GPA TF  D P+RE+IFHF+R+AI ++K  A
Sbjct  215   GASP--KLPDFRRNFFGESTAVLRFAGGVGPAVTFDADAPLRERIFHFSRDAIRELKAIA  272

Query  851   NNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEASK  675
             N  +   G+  ++ GK+    H+P  +N  A SEISSFQSL AQ+W S TRARK L+A  
Sbjct  273   NR-RSSAGQEAEVYGKMA---HDP--KNQEARSEISSFQSLCAQIWISTTRARKQLDAGA  326

Query  674   TTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDD  495
             T T R+A+NCRHRL P + P YFGNAIQS PT A   EL S+DL WAA  LH ++ A+ D
Sbjct  327   TATLRLAVNCRHRLRPAISPAYFGNAIQSAPTTATVAELASNDLRWAASRLHASLAAYGD  386

Query  494   ATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKFD  318
               +R     W+  PR FPLGN DGA++TMGSS RFPMY+ NDFGWGRPLAVRSG ANKFD
Sbjct  387   EAIRGVAAAWQAAPRCFPLGNPDGAVVTMGSSNRFPMYEGNDFGWGRPLAVRSGRANKFD  446

Query  317   GKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             GK+SAFPGR G+GSVD+EV LAP+TMA L  D E+MQYVS
Sbjct  447   GKMSAFPGRSGDGSVDIEVCLAPDTMAALLRDDEFMQYVS  486



>gb|AES71111.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=473

 Score =   424 bits (1089),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 312/464 (67%), Gaps = 10/464 (2%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             SS++ ++SKCTV+P+ KS+ +           M+ C YIQKG L + P L +  L+  LK
Sbjct  9     SSAVTILSKCTVFPDQKSTLADLKLSISDLN-MICCHYIQKGNLFTSPSLPSQTLVPHLK  67

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
              SLSK L+ FP LAGR  TD+ GH++I  ND G++F+HA A  L+   LL    D+   F
Sbjct  68    TSLSKTLSIFPPLAGRFVTDSAGHIFITCNDSGVDFIHASATDLTITHLLSPP-DVHPAF  126

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             + FF +   ++Y  H  P++A+QVT L+D +F+G  ++HAV DG++FWNFFNT+A+I +G
Sbjct  127   KQFFPFHRKINYTAHFSPILAVQVTSLADGIFIGIAVSHAVTDGSTFWNFFNTFADISRG  186

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
                 +R+P F R+++  S   ++ P G    +F+ D P+RE+IF FTRE+I K+K   N 
Sbjct  187   LTVANRIPYFRRESILMSKVPVQLPEGEIKVSFNADAPLRERIFTFTRESIQKLKATVNK  246

Query  845   G--KLCNGENGKLNGKITPVNHEPGLQNGGA------ASEISSFQSLSAQLWRSVTRARK  690
                   + EN  +   I+ + ++       A       +EISSFQSL+A +WR VTRARK
Sbjct  247   NINHRTSPENADVAEIISKMKNDDAQMKAVAERVTVETTEISSFQSLNALMWRCVTRARK  306

Query  689   LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNV  510
             L++SKTTT+R A+N R RLEP+L   YFGNAIQSI T A A E++ +DL+W+A  L ++V
Sbjct  307   LDSSKTTTYRNAVNVRSRLEPKLPEYYFGNAIQSIATYASAREVVENDLTWSAMQLSKSV  366

Query  509   VAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMA  330
               +D ATVRR    W+  P+ FP+GN DGA + MGSS RFPMY+NDFGWGRPLAVRSG A
Sbjct  367   KEYDSATVRRVAGKWDVEPKCFPMGNHDGATLQMGSSHRFPMYENDFGWGRPLAVRSGGA  426

Query  329   NKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NKFDGK+SAFPGR+G G+VD+EV+LAPETMA LE+D E+M Y S
Sbjct  427   NKFDGKMSAFPGRKGGGAVDVEVLLAPETMARLESDEEFMAYAS  470



>dbj|BAJ94368.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90612.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05277.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=486

 Score =   423 bits (1087),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 315/462 (68%), Gaps = 14/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P+ +I V+SK  V PE  +     LKLSVSD+PMLSC YIQKG+  +   +  A L+  L
Sbjct  31    PTPTIAVVSKHLVLPE-GAQPVGDLKLSVSDMPMLSCHYIQKGLFFTPAGMPTARLVKSL  89

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-R  1212
              LSLS+AL  FPALAGRL T     + I  +D  +EF HA AP LS A  L   AD+P R
Sbjct  90    LLSLSRALGVFPALAGRLVTLPDDRIVIRCDDAAVEFYHAVAPALSLADFLVPDADVPTR  149

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D  +SY GH +PL + QVT L D AVFVG   NHAVVDGTSFW+FFNT+A +
Sbjct  150   LTKDLFPMDRVVSYEGHRRPLTSFQVTVLGDGAVFVGLVANHAVVDGTSFWHFFNTWAGL  209

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPA-GGPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+G  +  + PDF R+    S AVL+F    GPA TF    P+RE++ HF+  AI  +K 
Sbjct  210   CRG--EPVQPPDFSRNFFGGSTAVLRFSGRDGPAVTFDAAAPLRERVIHFSAAAIRDLKA  267

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRAR-KLEA  681
              AN  +  N E+ ++NGK+    H+  +Q GG   +ISSFQS+ A +WR+VTRAR +L A
Sbjct  268   AANRCRKTN-EDDEVNGKL---EHDLKVQGGG--GQISSFQSMCAHMWRAVTRARLQLTA  321

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHRL P++ P+YFGNAIQS+ T A   EL SHDL WAA  LH  VVAH
Sbjct  322   DATTTFRMAVNCRHRLRPKISPVYFGNAIQSVATTATVAELASHDLGWAAARLHATVVAH  381

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
             +D  +R+   DWE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGR +AVRSG ANK
Sbjct  382   EDGAIRQAAADWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRAVAVRSGRANK  441

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFPG+ G+GSVD+EV LAP+TM  L +D E++Q+VS
Sbjct  442   FDGKMSAFPGQAGDGSVDVEVCLAPDTMGRLLSDDEFLQFVS  483



>ref|XP_009386262.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Musa 
acuminata subsp. malaccensis]
Length=536

 Score =   424 bits (1089),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 309/462 (67%), Gaps = 11/462 (2%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllkls  1380
             ++ ++SKC V+P+ KS+            PMLSC YIQKG+   +PP+  A+L+ LL   
Sbjct  72    AVTILSKCRVFPDCKSTIGDLPLSVSDL-PMLSCHYIQKGLFFPRPPVPVASLLPLLTSC  130

Query  1379  lskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRS  1200
             L++ L+ FPALAGRL T   G ++I  +D G EF HA AP L+   LLP  AD+P   + 
Sbjct  131   LARVLSLFPALAGRLSTRPDGRIFISCDDSGAEFYHAAAPSLTLPLLLPDSADVPAAVKL  190

Query  1199  FFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              F  D  LSY GH  P+   Q+TEL+D A+F+G  +NHAVVDGTS WNFFN +AEIC+G 
Sbjct  191   LFPLDGALSYHGHFLPISNFQLTELADGALFLGAVVNHAVVDGTSLWNFFNAWAEICRGG  250

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRAN-  849
               I   PD  R+   +S AVL+FP+G GP  TF  D P+RE+IF F+REAI  +K RAN 
Sbjct  251   --IPASPDLRRNYFGDSKAVLRFPSGAGPEVTFQMDAPLRERIFRFSREAIFDLKSRANR  308

Query  848   -NGKLCNGENG--KLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEA  681
              + KL +  N    ++ +  P      L       EISSFQSL A +WRSVT ARK L  
Sbjct  309   QSPKLVDDGNALAGIHEEQIPDGESEALAAVVKEDEISSFQSLCALVWRSVTGARKRLAM  368

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHR+ P +   YFGNAIQSIPT A  G+++  DLSW   +LH +VVAH
Sbjct  369   EATTTFRMAVNCRHRVVPPVAANYFGNAIQSIPTKALVGDIVGRDLSWTTGLLHGSVVAH  428

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
              + TVRRG+ +WE  PR FPLGN DGA ITMGSS RFP+Y+ N+FGWG P+AVRSG ANK
Sbjct  429   GNETVRRGVTEWEAAPRCFPLGNPDGAGITMGSSHRFPVYEGNNFGWGNPVAVRSGRANK  488

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFPGR+G GSVDLE+ LAPETMA L  D ++M YVS
Sbjct  489   FDGKMSAFPGRDGEGSVDLEMCLAPETMAALLLDEDFMSYVS  530



>dbj|BAD81949.1| putative hydroxycinnamoyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD82451.1| putative hydroxycinnamoyl transferase [Oryza sativa Japonica 
Group]
 gb|EAY76530.1| hypothetical protein OsI_04473 [Oryza sativa Indica Group]
 dbj|BAG91952.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score =   422 bits (1084),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 254/462 (55%), Positives = 317/462 (69%), Gaps = 14/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P+S I V+S+  V P+  +S    L LSVSDLPMLSC YIQKG+    P +  A+L+SLL
Sbjct  31    PASGITVVSRQDVRPD-GASAVGDLTLSVSDLPMLSCHYIQKGLFFPAPDVPMASLVSLL  89

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPRE  1209
               SLS+ALA FP LAGRL T     V I  ND G+EF HA AP+LS    +   AD+P +
Sbjct  90    MSSLSRALAIFPTLAGRLVTLPDDRVVIRCNDAGVEFRHAVAPNLSLDDFIVPDADVPTK  149

Query  1208  F-RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + QVT L D AVF+G   NHAVVDGTSFW+FFNT+A +
Sbjct  150   LTKDLFPMDRTVSYDGHRRPLTSFQVTVLGDGAVFIGIVANHAVVDGTSFWHFFNTWAAL  209

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+GA    ++PDF R     S AVL+FP G GPA TF  D P+RE++FHF+ +AI ++K 
Sbjct  210   CRGASP--KLPDFRRSFFGESTAVLRFPGGVGPAVTFDADAPLRERVFHFSADAIRELK-  266

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRAR-KLEA  681
                N +   G++ ++ GK+    H+   +N    S ISSFQSL AQ+W SVTRAR +L  
Sbjct  267   AITNRRPSGGQDAEVYGKMA---HD--RKNPEGLSAISSFQSLCAQIWLSVTRARQRLAP  321

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               T+TFRMA+NCRHRL P + P+YFGNAIQS  T A   EL S+DL WAA  L+ ++ A+
Sbjct  322   DATSTFRMAVNCRHRLRPAISPVYFGNAIQSAATTATVAELASNDLRWAAAKLNASLAAY  381

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
             DD  +RR    W+  PR FPLGN DGA+ITMGSS RFPMY+ NDFGWGRPLAVRSG ANK
Sbjct  382   DDGAIRRAAAAWQGAPRCFPLGNPDGAVITMGSSNRFPMYEGNDFGWGRPLAVRSGRANK  441

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFP R G+GSVD+EV LAP+TMA L  D E+MQ+VS
Sbjct  442   FDGKMSAFPARAGDGSVDIEVCLAPDTMAALLRDSEFMQFVS  483



>ref|XP_006591380.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=493

 Score =   422 bits (1084),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 240/458 (52%), Positives = 305/458 (67%), Gaps = 12/458 (3%)
 Frame = -3

Query  1550  VISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQP--Pldaaalisllklsl  1377
             V+SKCTV+P   S+              LS  YIQKG L + P  P  +  LI  LK +L
Sbjct  39    VLSKCTVFPHRNSTLGDLKLSISDLNMFLS-HYIQKGCLFTTPSLPSHSHTLIPHLKNAL  97

Query  1376  skalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakap--hlsaaallpshADIPREFR  1203
             S+ L+ FP LAGRL TD  G VYI  ND G++F+HA A    ++      S +D+P   +
Sbjct  98    SQTLSLFPPLAGRLKTDTDGFVYITCNDAGVDFIHATAADISVADLLSPSSSSDVPPISK  157

Query  1202  SFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
               F +   +SY  HS P+MA QVT+L+DAVF+GC + H+V DG SFWNFFNT+A I +GA
Sbjct  158   QLFPFHHKISYTAHSSPIMAFQVTDLADAVFLGCAVCHSVTDGASFWNFFNTFAGISRGA  217

Query  1022  K-KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
                 S +PDF R+++ +S  VL+ P      TF+ +EP RE+IF F+RE+I K+K   N 
Sbjct  218   TISPSSLPDFRRESILSSNVVLRLPED-IKVTFNVEEPFRERIFSFSRESIQKLKATVNK  276

Query  845   GKLC--NGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKT  672
                     ENG     +  ++ +  L+     +EISSFQSL A +WR VT+AR LE SKT
Sbjct  277   SLTLFPPPENGDAVELMAKMSSDTQLRT---VTEISSFQSLCALVWRCVTKARNLEGSKT  333

Query  671   TTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDA  492
             TTFRMA+N R RLEP+L   YFGNAIQSI T A+AG++ S +L W AE L+++V A D A
Sbjct  334   TTFRMAVNVRQRLEPKLGDSYFGNAIQSIATCAEAGDVASKELRWCAEQLNKSVKAFDGA  393

Query  491   TVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGK  312
             TVRR +++WE  P+ F LGN DGA + MGSSPRFPMYDNDFGWGRPLAVRSG ANKFDGK
Sbjct  394   TVRRNLENWEREPKCFELGNHDGATVQMGSSPRFPMYDNDFGWGRPLAVRSGGANKFDGK  453

Query  311   ISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +SAFPGR G G++DLEVVLAPETMA LE+D E+M YVS
Sbjct  454   MSAFPGRNGGGAIDLEVVLAPETMARLESDSEFMFYVS  491



>ref|XP_006645034.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Oryza 
brachyantha]
Length=485

 Score =   420 bits (1080),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 248/464 (53%), Positives = 310/464 (67%), Gaps = 16/464 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P+S I V+S+  V P+  S+            PMLSC YIQKG+    P    A+L+SLL
Sbjct  31    PASGITVVSRQEVRPDVASAAGDLTLSISDL-PMLSCHYIQKGLFFPAPGAPMASLVSLL  89

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPRE  1209
               SLS+ALA FPALAGRL T     V I  ND G+EF HA AP LS    +   AD+P +
Sbjct  90    VSSLSRALAIFPALAGRLVTLPDDRVVIRCNDAGVEFRHAVAPTLSLDDFIVPDADVPTK  149

Query  1208  F-RSFFQYDSTLSYAGHSKPLMAIQVTELSDA-VFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + Q+T L D  VF+G   NHAVVDGTSFW+FFNT+A +
Sbjct  150   LTKDLFPMDRTVSYDGHRRPLTSFQLTVLGDGTVFIGIVANHAVVDGTSFWHFFNTWANL  209

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+GA    ++PDF R+    S AVL+FP G GPA TF  D P+RE+IFHF+ +A+ ++K 
Sbjct  210   CRGASP--KLPDFRRNFFGESTAVLRFPGGVGPAVTFDADAPLRERIFHFSADAVRELKA  267

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRAR-KLEA  681
              AN  +   GE+ ++ GK+    H+P  +N    S ISSFQSL AQ+W SVTRAR +L A
Sbjct  268   TANR-RPSGGEDAEVYGKMA---HDP--KNPEGLSVISSFQSLCAQIWLSVTRARHRLAA  321

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               T TFRMA+NCRHR+ P + P+YFGNAIQS  T A   EL S+DL WAA  L+ ++ A+
Sbjct  322   DATATFRMAVNCRHRVRPTVSPVYFGNAIQSAVTTATVAELASNDLRWAAARLNASLAAY  381

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
             DD  +RR    W+  PR FPLGN DGA+ITMGSS RFPMY+ NDFGWGRPLAVRSG ANK
Sbjct  382   DDGAIRRAASAWQAAPRCFPLGNPDGAVITMGSSNRFPMYEGNDFGWGRPLAVRSGRANK  441

Query  323   FDGKISAFPGREGNGSVDLEV--VLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFP R G+GSVD+EV   LAP+ MA L  D E+MQ+VS
Sbjct  442   FDGKMSAFPARAGDGSVDIEVCLALAPDPMAALLRDSEFMQFVS  485



>ref|XP_006654487.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Oryza 
brachyantha]
Length=483

 Score =   416 bits (1070),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 248/461 (54%), Positives = 313/461 (68%), Gaps = 14/461 (3%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             +S++ V+SK +V P+   S +  +KLSVSD+PMLSC YIQKG+    P +  A+L S L 
Sbjct  29    TSAVTVVSKQSVRPD-GVSAAGDVKLSVSDMPMLSCHYIQKGLFFPPPGVPIASLASSLV  87

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-RE  1209
              +LS+AL  FPALAGRL T   G + I  +   +EF HA AP LS    L  +AD+P R 
Sbjct  88    CALSRALTVFPALAGRLVTLDDGRIVIRCDAAAVEFYHAVAPALSLDDFLVPNADVPTRL  147

Query  1208  FRSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
              +  F  D T+SY GH +PL + Q+T L D AVFVG   NHAVVDGTSFW+FFNT+A +C
Sbjct  148   TKDLFPMDRTVSYDGHRRPLTSFQLTVLGDGAVFVGFVANHAVVDGTSFWHFFNTWAGLC  207

Query  1031  KGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFR  855
             +G     + PD  R+   +S AV++FP G GPA TF  D P+RE++ HF+  AI ++K +
Sbjct  208   RGTP--VQPPDLRRNFFGDSTAVIRFPGGTGPAVTFDADAPLRERVLHFSAAAIRELKAK  265

Query  854   ANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKL-EAS  678
             AN  +  +    + +GK     H    +  G   EISSFQSL A +WR+VTR+R+L  A 
Sbjct  266   ANQRRRSD-NFAEADGK-----HVDEAKVQGGYREISSFQSLCAHIWRAVTRSRRLLAAD  319

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
              TTTFRMA+ CRHRL P + PLYFGNAIQS+ T AK  EL S+DL WAA  L+  VVAH+
Sbjct  320   ATTTFRMAVTCRHRLRPAISPLYFGNAIQSVATTAKVAELASNDLRWAAARLNATVVAHE  379

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKF  321
             D  +R    +WE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGRPLAVRSG ANKF
Sbjct  380   DGAIRLAAAEWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRPLAVRSGRANKF  439

Query  320   DGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DGK+SAFPGR G+GSVD+E  LAP+TMA L  D E++Q+VS
Sbjct  440   DGKMSAFPGRSGDGSVDVEFCLAPDTMARLLGDHEFLQHVS  480



>ref|XP_003566198.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brachypodium 
distachyon]
Length=494

 Score =   416 bits (1068),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 253/469 (54%), Positives = 308/469 (66%), Gaps = 24/469 (5%)
 Frame = -3

Query  1571  MPSSSIV-VISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             +P++ IV V+SK TV PE   + +  LKLSVSD+PMLSC YIQKG+   +PP+      S
Sbjct  35    VPAAPIVTVVSKQTVVPEGVWAATGDLKLSVSDMPMLSCHYIQKGLFFPKPPVGMPITAS  94

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEG--IEFVhakaphlsaaallpshAD  1221
             L           FPALAGRL T     + ++  DEG  +E  HA AP LS A  L   AD
Sbjct  95    LATALARALAV-FPALAGRLVTLPDDRI-VIRCDEGASVELYHAVAPALSLADFLVPDAD  152

Query  1220  IP-REFRSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNT  1047
             +P R  +  F  D T+SY GH + L + QVT L D AVFVG   NHAVVDGTSFW+FFNT
Sbjct  153   VPTRLTKDLFPMDRTVSYEGHRRRLTSFQVTVLGDGAVFVGFVANHAVVDGTSFWHFFNT  212

Query  1046  YAEICKGAKKIS-RVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAI  873
             +A +C+GA+    + PDF R+   +S AVL+FP   GPA TF    P+RE++ HF+  AI
Sbjct  213   WAGLCRGAEAPEVQPPDFRRNFFGDSTAVLRFPGSEGPAVTFDAAAPLRERVIHFSAAAI  272

Query  872   LKMKFRANNGKLCN--GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTR  699
               MK  AN  K      +N ++NGK+    H+        + EISSFQSL A +WR+VTR
Sbjct  273   RDMKAAANRRKTSGRAKDNAEVNGKLA---HD--------SREISSFQSLCAHMWRAVTR  321

Query  698   AR-KLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEML  522
             AR +L A   TTFRMA+NCRHRL P + PLYFGNAIQS+ T A   EL S D  WAA  L
Sbjct  322   ARLRLSADAVTTFRMAVNCRHRLRPSISPLYFGNAIQSVATHATVSELASEDFPWAAAKL  381

Query  521   HRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAV  345
             H  VVAH+D  +R+   DWE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGR LAV
Sbjct  382   HATVVAHEDGAIRQAAADWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRALAV  441

Query  344   RSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             RSG ANKFDGK+SAFPG+ G+GSVD+EV LAP+TMA L  D E++QYVS
Sbjct  442   RSGRANKFDGKMSAFPGQAGDGSVDVEVCLAPDTMARLLGDEEFLQYVS  490



>dbj|BAJ93957.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   414 bits (1065),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 254/463 (55%), Positives = 318/463 (69%), Gaps = 13/463 (3%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             M  S I V+S+  V P+   S    L LSVSDLPMLSC YIQKG+    P +  A+L+SL
Sbjct  32    MSGSGITVVSRQAVLPDGPPSAIGDLTLSVSDLPMLSCHYIQKGLFFPAPDVPMASLVSL  91

Query  1391  lklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-  1215
             L  SLS+ALA FPALAGR  T     + I  ND G++F HA AP LS    L  +AD+P 
Sbjct  92    LVSSLSRALAIFPALAGRFVTLPDDRIVIRCNDAGVDFHHAVAPALSLNDFLLPNADVPT  151

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAE  1038
             R  +  F  D T+SY GH +PL + Q+T L D AVF+G   NHAVVDGTSFW+F+NT+A 
Sbjct  152   RLTKDLFPMDRTVSYEGHRRPLTSFQLTVLGDGAVFIGVVANHAVVDGTSFWHFYNTWAA  211

Query  1037  ICKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMK  861
             +C+GA    ++PDF R+    S AVL+F  G GPA TF  D P+RE+IFHF+R+AI ++K
Sbjct  212   LCRGASP--KLPDFRRNFFGESTAVLRFAGGVGPAVTFDADAPLRERIFHFSRDAIRELK  269

Query  860   FRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LE  684
               AN  +   G++ ++ GK+    H+P  +N  A +EISSFQSL AQ+W S TRARK L+
Sbjct  270   AIANR-RSSAGQDAEVYGKMA---HDP--KNQEARTEISSFQSLCAQIWISTTRARKQLD  323

Query  683   ASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVA  504
             A  TTT R+A+NCRHRL P + P YFGNAIQS PT A   EL S+DL WAA  L+ ++ A
Sbjct  324   ADATTTLRLAVNCRHRLRPAVSPAYFGNAIQSAPTTATVAELASNDLRWAASRLNASLAA  383

Query  503   HDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMAN  327
             + D  +R     W+  PR FPLGN DGA++TMGSS RFPMY+ NDFGWGRPLAVRSG AN
Sbjct  384   YGDEAIRGAAAAWQAAPRCFPLGNPDGAVVTMGSSNRFPMYEGNDFGWGRPLAVRSGRAN  443

Query  326   KFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             KFDGK+SAFPGR G+GSVD+EV LAP+TMA L  D  +M+YVS
Sbjct  444   KFDGKMSAFPGRSGDGSVDIEVCLAPDTMAALLRDDGFMRYVS  486



>ref|XP_004970614.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=491

 Score =   412 bits (1060),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 256/462 (55%), Positives = 314/462 (68%), Gaps = 14/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P+S I V+S+  V P+  +S    L LSVSDLPMLSC YIQKG+    P L  A+L+SLL
Sbjct  33    PASGITVVSRQHVRPD-AASAIGDLTLSVSDLPMLSCHYIQKGLFFPAPDLPMASLVSLL  91

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPRE  1209
               SLS+ALA  PALAGRL T     + I  ND G++F+HA AP LS    L   AD+P +
Sbjct  92    VSSLSRALAAVPALAGRLVTLPDDRIVIRCNDAGVDFLHAVAPGLSLDDFLVPDADVPTK  151

Query  1208  F-RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + QVT L D AVF+G   NHAVVDGTSFW+FFNT+A I
Sbjct  152   LTKDLFPMDRTVSYEGHRRPLTSFQVTVLGDGAVFIGIVANHAVVDGTSFWHFFNTWAAI  211

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+G  +  R+ DF R+    S AVL+FP G GPA TF  D P+RE++FHF+ +AI +MK 
Sbjct  212   CRG--EAPRLLDFRRNFFGESTAVLRFPGGVGPAVTFDVDAPLRERVFHFSADAIREMKA  269

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEA  681
              AN  +   G + ++ GK+    H+P  +N  A  EISSFQSL AQ+W +VTRARK L  
Sbjct  270   IANR-RPSGGHDAEVYGKMA---HDP--KNPEARREISSFQSLCAQIWLAVTRARKRLAP  323

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHRL P + P YFGNAIQS  T A   EL  +DL  AA  L+ ++ A+
Sbjct  324   DATTTFRMAVNCRHRLRPAISPTYFGNAIQSAVTTATVSELARYDLRCAAGKLNASLAAY  383

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
              D  +RR    W+  P  FPLGN DG++ITMGSS RFPMY+ NDFGWGRPLAVRSG ANK
Sbjct  384   GDGAIRRAAAAWQAKPGCFPLGNPDGSVITMGSSNRFPMYEGNDFGWGRPLAVRSGRANK  443

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFPGR G+GSVD+EV L PETMA L  D E+MQYVS
Sbjct  444   FDGKMSAFPGRAGDGSVDIEVCLPPETMAALLRDAEFMQYVS  485



>ref|XP_002456651.1| hypothetical protein SORBIDRAFT_03g040180 [Sorghum bicolor]
 gb|EES01771.1| hypothetical protein SORBIDRAFT_03g040180 [Sorghum bicolor]
Length=495

 Score =   412 bits (1060),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 255/462 (55%), Positives = 314/462 (68%), Gaps = 13/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P S I V+S+  V P+  +S    L LSVSDLPMLSC YIQKG+    P L   +L+SLL
Sbjct  36    PPSGITVVSRQHVRPD-AASAIGDLTLSVSDLPMLSCHYIQKGLFFPAPDLPMPSLVSLL  94

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPRE  1209
               SLS+ALA  PALAGRL T     + I  ND G++F+HA AP LS    L   AD+P +
Sbjct  95    LSSLSRALAVVPALAGRLVTLPDDRIVIRCNDAGVDFLHAVAPGLSLDDFLVPDADVPTK  154

Query  1208  F-RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + QVT L D AVF+G   NHAVVDGTSFW FFNT+A I
Sbjct  155   LTKDLFPMDRTVSYEGHRRPLTSFQVTVLGDGAVFIGIVANHAVVDGTSFWQFFNTWAAI  214

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+G     ++PDF R+    S AVL+FP G GP+ TF  D P+RE++FHF+ +AI ++K 
Sbjct  215   CRGESP--KMPDFRRNFFGESTAVLRFPGGVGPSVTFDVDAPLRERVFHFSADAIRELKT  272

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEA  681
              AN  +   G++ ++ GK+      P +  G    EISSFQSL AQ+W +VTRARK L  
Sbjct  273   IANR-RPSGGQDAEVYGKMAHDPKNPQVLRG----EISSFQSLCAQIWLAVTRARKRLAP  327

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHRL+P + P+YFGNAIQS  T+A   EL   DL WAA  L+ ++ A+
Sbjct  328   DATTTFRMAVNCRHRLQPAISPVYFGNAIQSAVTLATVSELARSDLRWAAGKLNESLAAY  387

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
              D T+RR    W+  PR FPLGN DGA+ITMGSS RFPMY+ NDFGWGRPLAVRSG ANK
Sbjct  388   GDGTIRRAAAAWQAAPRCFPLGNPDGAVITMGSSNRFPMYEGNDFGWGRPLAVRSGRANK  447

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFPGR G+GSVD+EV L PETMA L  D E+MQYVS
Sbjct  448   FDGKMSAFPGRAGDGSVDIEVCLPPETMAALLRDAEFMQYVS  489



>ref|XP_004501103.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=600

 Score =   416 bits (1068),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 216/429 (50%), Positives = 289/429 (67%), Gaps = 7/429 (2%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaalisllklslskalAH-FPALAGRLHTDAKGHVYILSND  1293
             ML   YIQKGVL   P L +  ++    ++        FP L+GR  TD+ G++YI  ND
Sbjct  174   MLCWHYIQKGVLFITPSLPSQTVLIPHLITSLSKTLSIFPPLSGRFVTDSNGYIYITCND  233

Query  1292  EGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAV  1113
              G +F+HA A H +   LL S  DI + F  FF +   L+Y  H  P++A+QVT L D V
Sbjct  234   AGADFIHATATHFTLTDLLSSP-DIHQAFEQFFPFHRKLNYDAHFSPILAVQVTYLPDGV  292

Query  1112  FVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAA  933
             F+G  + HAV DG+  WNFFNT+A+I +G   +SR+PDF R+++ NS   ++ P GG   
Sbjct  293   FIGVAVCHAVTDGSILWNFFNTFADISQGVTPLSRIPDFRRESILNSKVAVQLPEGGIEL  352

Query  932   TFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQ----NG  765
              F+ DEP+RE+IF F+REAI K+K R N+ +  + EN  +   I+ ++ +  L+    NG
Sbjct  353   AFNPDEPLRERIFSFSREAIQKLKSRVNHHR-TSPENADVAELISKLSDDTQLKTVTRNG  411

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                 ++SSFQSL A +W+ VTRARKL+ S+TTTFRMA N R+RLEP+L   YFGNAIQSI
Sbjct  412   SEMEDVSSFQSLCAMMWQCVTRARKLDGSETTTFRMAANIRNRLEPKLGEYYFGNAIQSI  471

Query  584   PTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMG  405
              T  K  E+L++DL+W AE L+++V  +D   VRR +++WE  P+ F LG+ DGA++ MG
Sbjct  472   ATCCKVYEVLNNDLTWCAEQLNKSVREYDSVVVRRVVENWEREPKCFKLGSKDGALLLMG  531

Query  404   SSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEN  225
             SS RFPMYDNDFGWGRPLAVRSG ANKFDGKIS +PGR+G GS+DLEV LAPETMA L  
Sbjct  532   SSHRFPMYDNDFGWGRPLAVRSGGANKFDGKISVYPGRKGGGSIDLEVALAPETMALLVT  591

Query  224   DMEYMQYVS  198
             D E+M Y +
Sbjct  592   DSEFMPYAT  600



>ref|XP_002441195.1| hypothetical protein SORBIDRAFT_09g022030 [Sorghum bicolor]
 gb|EES19625.1| hypothetical protein SORBIDRAFT_09g022030 [Sorghum bicolor]
Length=515

 Score =   412 bits (1059),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 254/471 (54%), Positives = 310/471 (66%), Gaps = 20/471 (4%)
 Frame = -3

Query  1556  IVVISKCTVYPEYkssnsks---lklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             I V+SK TV P   +S       L+LSVSD+PMLSC YIQKG+    PP       + L 
Sbjct  43    ISVVSKQTVRPAAGASAPVVGGDLRLSVSDMPMLSCHYIQKGLFFPPPPPSVLTTTASLV  102

Query  1385  lslskalAH----FPALAGRLHTDAKGHVYI------LSNDEGIEFVhakaphlsaaall  1236
              SL  AL+     FPALAGRL T     + I         D  +EF HA AP LS    L
Sbjct  103   SSLVTALSRALGVFPALAGRLVTLHDDSIVIRCGGGGDDADAAVEFYHAVAPSLSLGDFL  162

Query  1235  pshADIPREF-RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFW  1062
                AD+P     + F  D T+SY GH++PL + Q+TEL D AVFVG   NHAVVDGTSFW
Sbjct  163   VPGADVPTSLTNALFPMDRTVSYGGHARPLSSFQLTELGDGAVFVGFVANHAVVDGTSFW  222

Query  1061  NFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFT  885
             +FFNT+A +C+G     R PDF R+    S AVL+FP G GPA TF  + P+RE+I HF+
Sbjct  223   HFFNTWAGLCRGGGAPIREPDFRRNFFGESTAVLRFPGGVGPAVTFDSEAPLRERILHFS  282

Query  884   REAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSV  705
               AI ++K  AN+ K    ++ + NGK+   + +  L +G  + EISSFQSL A +WR+V
Sbjct  283   AAAIRELKATANHSKRTGHQDAEANGKLA--HDDSKLLHGRCSGEISSFQSLCAHIWRAV  340

Query  704   TRARKL-EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAE  528
             TRAR+L  A KTTTFRMA+NCRHRL P + PLYFGNAIQS+ T A   EL S+DL WAA 
Sbjct  341   TRARRLLAADKTTTFRMAVNCRHRLRPAISPLYFGNAIQSVATTATVAELASNDLGWAAA  400

Query  527   MLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPL  351
              LH  V +H+D  +RR   +WE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGR L
Sbjct  401   RLHATVTSHEDGAIRRAAAEWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRAL  460

Query  350   AVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             AVRSG ANKFDGK+SAFPG+ G+GSVD+EV LAP+TMA L  D E++QYVS
Sbjct  461   AVRSGRANKFDGKMSAFPGQAGDGSVDVEVCLAPDTMARLLLDEEFLQYVS  511



>ref|XP_003600860.1| BAHD acyltransferase DCR [Medicago truncatula]
Length=840

 Score =   422 bits (1085),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 312/464 (67%), Gaps = 10/464 (2%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllk  1386
             SS++ ++SKCTV+P+ KS+ +           M+ C YIQKG L + P L +  L+  LK
Sbjct  376   SSAVTILSKCTVFPDQKSTLADLKLSISDLN-MICCHYIQKGNLFTSPSLPSQTLVPHLK  434

Query  1385  lslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREF  1206
              SLSK L+ FP LAGR  TD+ GH++I  ND G++F+HA A  L+   LL    D+   F
Sbjct  435   TSLSKTLSIFPPLAGRFVTDSAGHIFITCNDSGVDFIHASATDLTITHLLSPP-DVHPAF  493

Query  1205  RSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG  1026
             + FF +   ++Y  H  P++A+QVT L+D +F+G  ++HAV DG++FWNFFNT+A+I +G
Sbjct  494   KQFFPFHRKINYTAHFSPILAVQVTSLADGIFIGIAVSHAVTDGSTFWNFFNTFADISRG  553

Query  1025  AKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
                 +R+P F R+++  S   ++ P G    +F+ D P+RE+IF FTRE+I K+K   N 
Sbjct  554   LTVANRIPYFRRESILMSKVPVQLPEGEIKVSFNADAPLRERIFTFTRESIQKLKATVNK  613

Query  845   G--KLCNGENGKLNGKITPVNHEPGLQNGGA------ASEISSFQSLSAQLWRSVTRARK  690
                   + EN  +   I+ + ++       A       +EISSFQSL+A +WR VTRARK
Sbjct  614   NINHRTSPENADVAEIISKMKNDDAQMKAVAERVTVETTEISSFQSLNALMWRCVTRARK  673

Query  689   LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNV  510
             L++SKTTT+R A+N R RLEP+L   YFGNAIQSI T A A E++ +DL+W+A  L ++V
Sbjct  674   LDSSKTTTYRNAVNVRSRLEPKLPEYYFGNAIQSIATYASAREVVENDLTWSAMQLSKSV  733

Query  509   VAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMA  330
               +D ATVRR    W+  P+ FP+GN DGA + MGSS RFPMY+NDFGWGRPLAVRSG A
Sbjct  734   KEYDSATVRRVAGKWDVEPKCFPMGNHDGATLQMGSSHRFPMYENDFGWGRPLAVRSGGA  793

Query  329   NKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             NKFDGK+SAFPGR+G G+VD+EV+LAPETMA LE+D E+M Y S
Sbjct  794   NKFDGKMSAFPGRKGGGAVDVEVLLAPETMARLESDEEFMAYAS  837



>ref|XP_003564637.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brachypodium 
distachyon]
Length=504

 Score =   410 bits (1054),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 256/490 (52%), Positives = 318/490 (65%), Gaps = 21/490 (4%)
 Frame = -3

Query  1631  SSSCKSTRIKDTAkkrrkkKMPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQY  1452
             SS  +  + +D +          S I V+S+  V P+   S    L LSVSDLPMLSC Y
Sbjct  18    SSIMQQPKAQDISTVDAPLSGSGSGITVVSRHAVRPDGPPSAVGDLTLSVSDLPMLSCHY  77

Query  1451  IQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVh  1272
             IQKG+    P +  A+L+SLL  SLS+ALA FPALAGRL T     + I  N  G+EF H
Sbjct  78    IQKGLFFPAPDVPMASLVSLLLSSLSRALAVFPALAGRLVTLPDDRIVIRCNGAGVEFHH  137

Query  1271  akaphlsaaallpshADIPREF-RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCT  1098
             A AP LS    L  +AD+P    +  F  D T+SY GH +PL + QVT L D AVF+G  
Sbjct  138   AVAPALSLDDFLVPNADVPTGLTKDLFPMDRTVSYEGHRRPLTSFQVTVLGDGAVFIGIV  197

Query  1097  MNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSG  921
              NHAVVDGTSFW+FFN +A +C+GA    R+PDF R+   +S AVL+FP G GPA TF  
Sbjct  198   ANHAVVDGTSFWHFFNAWAALCRGASP--RIPDFRRNFFGDSKAVLRFPGGVGPAVTFDA  255

Query  920   DEPIREKIFHFTREAILKMKFRANN-------GKLCNGENGKLNGKITPVNHEPGLQNGG  762
             D PIRE+IFHF+R+AI ++K  AN             G++ ++ GK+    H+P    G 
Sbjct  256   DAPIRERIFHFSRDAIRELKALANRRPSSSSAAAAAGGQDAEVYGKMA---HDPKNTEG-  311

Query  761   AASEISSFQSLSAQLWRSVTRARK-LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                EISSFQSL AQ+W + TRARK L +  TTT R+A+NCRHRL P +   YFGNAIQS 
Sbjct  312   ---EISSFQSLCAQIWIATTRARKRLASDATTTLRVAVNCRHRLRPAISAAYFGNAIQSA  368

Query  584   PTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMG  405
             PT A   EL S DL WAA  LH ++ A+ D+ +R     W+  PR FPLGN DGA++TMG
Sbjct  369   PTTATVSELASGDLRWAAARLHASLAAYGDSAIRGAAAAWQAAPRCFPLGNPDGAVVTMG  428

Query  404   SSPRFPMYD-NDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             SS RFPMY+ NDFGWGRPLAVRSG ANKFDGK+SAFPGR G+GSVD+E+ L P+TMA L 
Sbjct  429   SSNRFPMYEGNDFGWGRPLAVRSGRANKFDGKMSAFPGRAGDGSVDIEICLEPDTMAALL  488

Query  227   NDMEYMQYVS  198
              D ++MQYVS
Sbjct  489   RDAQFMQYVS  498



>gb|KHN13079.1| Putative acetyltransferase [Glycine soja]
Length=395

 Score =   405 bits (1042),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 268/392 (68%), Gaps = 24/392 (6%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSNDE  1290
             MLSC YIQKG L + P L   +LI LLK +LS+ L+ FP LAGRL TD+ G++YI  ND 
Sbjct  1     MLSCHYIQKGCLFTHPNLPLHSLIPLLKSALSRTLSLFPPLAGRLITDSHGYLYIACNDA  60

Query  1289  GIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVF  1110
             G++F+HA A  L    LL    D+P  F+ FF +D  +SY GH  P++A+QVTEL+D +F
Sbjct  61    GVDFIHANATALRICDLLSQL-DVPESFKEFFAFDRKVSYTGHFSPILAVQVTELADGIF  119

Query  1109  VGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-ISRVPDFGRDTVFNSPAVLKFPAGGPAA  933
             +GC +NHAV DGTSFWNFFNT+A++ +GA   I  +PDF R++V  S AVL+ P GGP  
Sbjct  120   IGCAVNHAVTDGTSFWNFFNTFAQLSRGASNCIRNIPDFHRESVLISDAVLRLPEGGPQV  179

Query  932   TFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS  753
             TF  + P+RE+IF F+REAI K+K  ANN +    EN    G++        L     A+
Sbjct  180   TFDANAPLRERIFSFSREAIQKLKAIANNRRW--PENNNFAGELLRKKSNDNLLKENKAT  237

Query  752   --------------------EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                 EISSFQS+ A LWR VTRARKL +SKTTTFRMA+NCRHRL
Sbjct  238   TILENWFKVNSNSISKPQTVEISSFQSVCALLWRGVTRARKLPSSKTTTFRMAVNCRHRL  297

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             EP+L+  YFGNAIQS+PT A AGE+LS DL W AE L++NV AHDD  VRR ++DWE NP
Sbjct  298   EPKLEAYYFGNAIQSVPTYASAGEVLSRDLRWCAEQLNKNVKAHDDTMVRRFVEDWERNP  357

Query  452   RLFPLGNFDGAMITMGSSPRFPMYDNDFGWGR  357
             R FPLGN DGA ITMGSSPRFPMYDN+FGWGR
Sbjct  358   RCFPLGNPDGASITMGSSPRFPMYDNNFGWGR  389



>gb|KCW86101.1| hypothetical protein EUGRSUZ_B028011, partial [Eucalyptus grandis]
Length=282

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 202/294 (69%), Positives = 224/294 (76%), Gaps = 25/294 (9%)
 Frame = -3

Query  1034  CKGAKKISRVPDFGRDTVFNSP-AVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKF  858
              +G+K+ S  PDF RD  F SP AVL+ PAGGPA TFS  EP+RE+IFHF+R AILKMK 
Sbjct  2     ARGSKRPSNSPDFCRDNAFVSPSAVLRLPAGGPAVTFSQHEPLRERIFHFSRAAILKMKS  61

Query  857   RANN-----------GKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWR  711
              AN            GK  N      NGK+ P             +EISSFQSL  QLWR
Sbjct  62    VANGAGVSPAVAEIMGKRSNDGFLAGNGKVAP-------------TEISSFQSLCGQLWR  108

Query  710   SVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAA  531
             SVTRARKL  SKT+TFRMA+NCRHR+EPR++P YFGNAIQSIPT A AGELLS DL+W+A
Sbjct  109   SVTRARKLAPSKTSTFRMAVNCRHRIEPRIEPYYFGNAIQSIPTAAPAGELLSRDLAWSA  168

Query  530   EMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPL  351
              +LHRNVVAH DATVRRG++ WE  PRLFPLGNFDGA ITMGSSPRFPMY NDFGWGRPL
Sbjct  169   GLLHRNVVAHGDATVRRGVEAWEREPRLFPLGNFDGASITMGSSPRFPMYANDFGWGRPL  228

Query  350   AVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQ  189
             AVRSG ANKFDGKISAFPGREG GSVDLEVVLAP TMAGLEND E+MQYVS ++
Sbjct  229   AVRSGRANKFDGKISAFPGREGGGSVDLEVVLAPATMAGLENDAEFMQYVSSVE  282



>ref|XP_010923110.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Elaeis 
guineensis]
Length=463

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 248/437 (57%), Positives = 302/437 (69%), Gaps = 25/437 (6%)
 Frame = -3

Query  1556  IVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisllklsl  1377
             + ++SKCTVYP+   S    LKLSVSDLPMLSC YIQKG+   +PP+  A L++LLK SL
Sbjct  33    VTIVSKCTVYPD-TKSTLGDLKLSVSDLPMLSCHYIQKGLFFPRPPVPFAPLLALLKSSL  91

Query  1376  skalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshA-DIPREFRS  1200
             S+AL+ FPALAGRL T   G + I  ND G EF HA AP L+   LLP  + D+P   +S
Sbjct  92    SRALSLFPALAGRLSTLPDGIIVISCNDAGAEFSHAVAPCLTLPLLLPPSSFDVPLPVKS  151

Query  1199  FFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKGA  1023
              F +D  +SY GH +PL A QVTEL D AVF+GC +NHA+VDGTSFWN FN +AE+C+G 
Sbjct  152   LFPFDGAVSYQGHFRPLAAFQVTELGDGAVFIGCVVNHAIVDGTSFWNIFNVWAELCRGG  211

Query  1022  KKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRANN  846
                 + PDF R+   +S AVL+F  G GP  TF  + P+RE+IFHF+REA+  +K RAN 
Sbjct  212   SP--KPPDFRRNFFGDSTAVLRFADGAGPEVTFPVNAPLRERIFHFSREAVRDLKSRANR  269

Query  845   GKLCNGENGKLNGKITPVNHEPGL--------QNGGAASEISSFQSLSAQLWRSVTRARK  690
                      +  G  T V+    +           G   EISSFQSL AQLWRSVTRARK
Sbjct  270   ---------RAQGVSTGVDQIAEIYGKQIHDRTKAGTEEEISSFQSLCAQLWRSVTRARK  320

Query  689   -LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRN  513
              L    TTTFR+A+NCRHR+ PR+ PLYFGNAIQSIPT A  GE+++ +L WAA +LHR+
Sbjct  321   HLLPEATTTFRLAVNCRHRVLPRVDPLYFGNAIQSIPTAAAVGEVVARELWWAAGLLHRS  380

Query  512   VVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSG  336
             V A+ D  VRR + +WE  PR FPLGN DGA ITMGSS RFPMY+ NDFGWG+PLA+RSG
Sbjct  381   VAAYGDEAVRRVVAEWEGAPRCFPLGNPDGAGITMGSSHRFPMYEGNDFGWGQPLALRSG  440

Query  335   MANKFDGKISAFPGREG  285
              ANKFDGKISAFPGREG
Sbjct  441   RANKFDGKISAFPGREG  457



>gb|EEC79316.1| hypothetical protein OsI_20158 [Oryza sativa Indica Group]
Length=480

 Score =   405 bits (1042),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 316/462 (68%), Gaps = 14/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P++S+ V+SK TV P+  +S    +KLSVSD+PMLSC YIQKG+    P +  A+L+S L
Sbjct  25    PATSVTVVSKQTVRPD-GASAVGDVKLSVSDMPMLSCHYIQKGLFFPPPGVPIASLVSSL  83

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-R  1212
               +LS+ALA FPALAGRL T   G + I  +   +EF HA AP LS    L  +AD+P R
Sbjct  84    VCALSRALAVFPALAGRLVTLDDGRIVIRCDGVAVEFYHAVAPALSLGDFLVPNADVPIR  143

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + Q+T L D AVFVG   NHAVVDGTSFW+FFNT+A +
Sbjct  144   LTKDLFPMDRTVSYDGHRRPLTSFQLTVLGDGAVFVGFVANHAVVDGTSFWHFFNTWAGL  203

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+G     + PD  R+   +S AV++FP G GPA TF  D P+RE++ HF+   I ++K 
Sbjct  204   CRGTP--VQPPDLRRNFFGDSTAVIRFPGGAGPAVTFDADAPLRERVLHFSAAVIRELKA  261

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKL-EA  681
             +AN  K  + +  + NGK     H    +  G   EISSFQSL A +WR+VTR+R+L  A
Sbjct  262   KANQWKRSD-KFAEANGK-----HVDETKAHGGYREISSFQSLCAHIWRAVTRSRRLLAA  315

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHRL P + PLYFGNAIQS+ T A   EL S+DL WAA  L+  VVAH
Sbjct  316   DATTTFRMAVNCRHRLRPAISPLYFGNAIQSVATTATVAELASNDLRWAAARLNATVVAH  375

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
             +D  +RR   +WE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGR +AVRSG ANK
Sbjct  376   EDGAIRRAAAEWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRAIAVRSGRANK  435

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFPG+ G+GSVD+E  LAP+TMA L  D E++QYVS
Sbjct  436   FDGKMSAFPGQAGDGSVDVEFCLAPDTMARLLGDHEFLQYVS  477



>ref|NP_001055699.1| Os05g0449200 [Oryza sativa Japonica Group]
 gb|AAU90108.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17613.1| Os05g0449200 [Oryza sativa Japonica Group]
 gb|EEE63916.1| hypothetical protein OsJ_18741 [Oryza sativa Japonica Group]
Length=480

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 316/462 (68%), Gaps = 14/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P++S+ V+SK TV P+  +S    +KLSVSD+PMLSC YIQKG+    P +  A+L+S L
Sbjct  25    PATSVTVVSKQTVRPD-GASAVGDVKLSVSDMPMLSCHYIQKGLFFPPPGVPIASLVSSL  83

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-R  1212
               +LS+ALA FPALAGRL T   G + I  +   +EF HA AP LS    L  +AD+P R
Sbjct  84    VCALSRALAVFPALAGRLVTLDDGRIVIRCDGVAVEFYHAVAPALSLGDFLVPNADVPTR  143

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + Q+T L D AVFVG   NHAVVDGTSFW+FFNT+A +
Sbjct  144   LTKDLFPMDRTVSYDGHRRPLTSFQLTVLGDGAVFVGFVANHAVVDGTSFWHFFNTWAGL  203

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+G     + PD  R+   +S AV++FP G GPA TF  D P+RE++ HF+  AI ++K 
Sbjct  204   CRGTP--VQPPDLRRNFFGDSTAVIRFPGGAGPAVTFDADAPLRERVLHFSAAAIRELKA  261

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKL-EA  681
             +AN  K  + +  + NGK     H    +  G   EISSFQSL A +WR+VTR+R+L  A
Sbjct  262   KANQWKRSD-KFAEANGK-----HVDETKAHGGYREISSFQSLCAHIWRAVTRSRRLLAA  315

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHRL P + PLYFGNAIQS+ T A   EL S+DL WAA  L+  VVAH
Sbjct  316   DATTTFRMAVNCRHRLRPAISPLYFGNAIQSVATTATVAELASNDLRWAAARLNATVVAH  375

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANK  324
             +D  +RR   +WE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGR +AVRSG ANK
Sbjct  376   EDGAIRRAAAEWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRAIAVRSGRANK  435

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFP + G+GSVD+E  LAP+TMA L  D E++QYVS
Sbjct  436   FDGKMSAFPSQAGDGSVDVEFCLAPDTMARLLGDHEFLQYVS  477



>tpg|DAA56793.1| TPA: AER [Zea mays]
Length=491

 Score =   405 bits (1041),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 311/462 (67%), Gaps = 14/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P S I V+S+  V P+  +S    L LSVSDLPMLSC YIQKG+    P L  ++++SLL
Sbjct  33    PPSGITVVSRQHVRPD-AASAVGDLTLSVSDLPMLSCHYIQKGLFFPAPDLPMSSVVSLL  91

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-R  1212
               SLS+ALA  PALAGR  T     + I  ND G++F+HA AP LS    L   AD+P +
Sbjct  92    LSSLSRALAVVPALAGRFVTLPDDRIVIRCNDAGVDFLHAVAPGLSLDDFLVPDADVPTK  151

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDA-VFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + QVT L D  VF+G   NHAVVDGTSFW FFNT+A I
Sbjct  152   HTKDLFPMDRTVSYEGHRRPLTSFQVTALGDGTVFIGIVANHAVVDGTSFWQFFNTWAAI  211

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+G     ++PDF R     S AVL+FP G GP+ TF  D P+RE++FHF+ +AI ++K 
Sbjct  212   CRGESP--KLPDFRRSFFGESTAVLRFPGGVGPSVTFDVDAPLRERVFHFSADAIRELKA  269

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEA  681
              AN  +   G++ ++ GK+     +P  +N     EISSFQSL AQ+W SVTRARK L  
Sbjct  270   IANR-RPSGGQDAEVYGKMA---QDP--KNPQVRGEISSFQSLCAQIWLSVTRARKRLAP  323

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHRL+P + P+YFGNAIQS  T+A   EL   DL WAA  L+  + A+
Sbjct  324   DATTTFRMAVNCRHRLQPPISPVYFGNAIQSAATMATVSELARSDLRWAAGKLNATLAAY  383

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMY-DNDFGWGRPLAVRSGMANK  324
              D T+RR    W+  PR FPLGN DG++ITMGSS RFPMY  NDFGWGRPLAVRSG ANK
Sbjct  384   GDGTIRRAAAAWQAAPRCFPLGNPDGSVITMGSSNRFPMYVGNDFGWGRPLAVRSGRANK  443

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFPGR G+GSVD+EV L PETMA L +D E+M YVS
Sbjct  444   FDGKMSAFPGRAGDGSVDIEVCLPPETMAALLHDAEFMHYVS  485



>gb|AGE46028.1| putative hydroxycinnamoyl transferase, partial [Elaeis guineensis]
Length=380

 Score =   400 bits (1028),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 266/387 (69%), Gaps = 24/387 (6%)
 Frame = -3

Query  1319  GHVYILSNDEGIEFVhakaphlsaaallpshA-DIPREFRSFFQYDSTLSYAGHSKPLMA  1143
             G + I  ND G EF HA AP L+   LLP  + D+P   +S F +D  +SY GH +PL A
Sbjct  2     GIIVISCNDAGAEFSHAVAPCLTLPLLLPPSSFDVPLPVKSLFPFDGAVSYQGHFRPLAA  61

Query  1142  IQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPA  966
              QVTEL D AVF+GC +NHA+VDGTSFWN FN +AE+C+G     + PDF R+   +S A
Sbjct  62    FQVTELGDGAVFIGCVVNHAIVDGTSFWNIFNVWAELCRGGSP--KPPDFRRNFFGDSTA  119

Query  965   VLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVN  789
             VL+F  G GP  TF  + P+RE+IFHF+REA+  +K RAN          +  G  T V+
Sbjct  120   VLRFADGAGPEVTFPVNAPLRERIFHFSREAVRDLKSRANR---------RAQGVSTGVD  170

Query  788   HEPGL--------QNGGAASEISSFQSLSAQLWRSVTRARK-LEASKTTTFRMAINCRHR  636
                 +           G   EISSFQSL AQLWRSVTRARK L    TTTFR+A+NCRHR
Sbjct  171   QIAEIYGKQIHDRTKAGTEEEISSFQSLCAQLWRSVTRARKHLLPEATTTFRLAVNCRHR  230

Query  635   LEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENN  456
             + PR+ PLYFGNAIQSIPT A  GE+++ +L W A +LHR+V A+ D  VRR + +WE  
Sbjct  231   VLPRVDPLYFGNAIQSIPTAAAVGEVVARELWWVAGLLHRSVAAYGDEAVRRVVAEWEGA  290

Query  455   PRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKFDGKISAFPGREGNG  279
             PR FPLGN DGA ITMGSS RFPMY+ NDFGWG+PLA+RSG ANKFDGKISAFPGREG G
Sbjct  291   PRCFPLGNPDGAGITMGSSHRFPMYEGNDFGWGQPLALRSGRANKFDGKISAFPGREGGG  350

Query  278   SVDLEVVLAPETMAGLENDMEYMQYVS  198
             SVDLEV LAP+TMA L  D E+MQYVS
Sbjct  351   SVDLEVCLAPDTMAALLQDDEFMQYVS  377



>ref|NP_001151798.1| AER [Zea mays]
 gb|ACG44343.1| AER [Zea mays]
Length=492

 Score =   403 bits (1036),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 312/462 (68%), Gaps = 14/462 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P+S I V+S+  V P+  +S    L LSVSDLPMLSC YIQKG+    P L  ++++SLL
Sbjct  34    PASGITVVSRQHVRPD-AASAVGDLTLSVSDLPMLSCHYIQKGLFFPAPDLPMSSVVSLL  92

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP-R  1212
               SLS+ALA  PALAGR  T     + I  ND G++F+HA AP LS    L   AD+P +
Sbjct  93    LSSLSRALAVVPALAGRFVTLPDDRIVIRCNDAGVDFLHAVAPGLSLDDFLVPDADVPTK  152

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDA-VFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + QVT L D  VF+G   NHAVVDGTSFW FFNT+A I
Sbjct  153   HTKDLFPMDRTVSYDGHRRPLTSFQVTALGDGTVFIGIVANHAVVDGTSFWQFFNTWAAI  212

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+G     ++PDF R+    S AVL+FP G GP+ TF  D P+RE++FHF+ +AI ++K 
Sbjct  213   CRGESP--KLPDFRRNFFGESTAVLRFPGGVGPSVTFDVDAPLRERVFHFSADAIRELKA  270

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARK-LEA  681
              AN  +   G++ ++ GK+     +P  +N     EISSFQSL AQ+W SVTRARK L  
Sbjct  271   IANR-RPSGGQDAEVYGKMA---QDP--KNPQVRGEISSFQSLCAQIWLSVTRARKRLAP  324

Query  680   SKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAH  501
               TTTFRMA+NCRHRL+P + P+YFGNAIQS  T+A   EL   DL WAA  L+  + A+
Sbjct  325   DATTTFRMAVNCRHRLQPAISPVYFGNAIQSAATMATVSELARSDLRWAAGKLNATLAAY  384

Query  500   DDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMY-DNDFGWGRPLAVRSGMANK  324
              D T+R     W+  PR FPLGN DG++ITMGSS RFPMY  NDFGWGRPLAVRSG ANK
Sbjct  385   GDGTIRLAAAAWQAAPRCFPLGNPDGSVITMGSSNRFPMYVGNDFGWGRPLAVRSGRANK  444

Query  323   FDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             FDGK+SAFPGR G+GSVD+EV L PETMA L +D E+M YVS
Sbjct  445   FDGKMSAFPGRAGDGSVDIEVCLPPETMAALLHDAEFMHYVS  486



>gb|AFW81723.1| hypothetical protein ZEAMMB73_519077 [Zea mays]
Length=542

 Score =   399 bits (1026),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 254/468 (54%), Positives = 311/468 (66%), Gaps = 18/468 (4%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnsks--lklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             P+ +I V+SK TV P   S+   S  L+LSVSD+PMLSC YIQKG+    PP    A   
Sbjct  78    PAPAISVVSKQTVRPAGASAAVGSGDLRLSVSDMPMLSCHYIQKGLFFPPPPPGVLAASL  137

Query  1394  llklslskalAH--FPALAGRLHTDAKGHVYIL--SNDEGIEFVhakaphlsaaallpsh  1227
             +  L  + + A   FPALAGRL T     + I    +D  +EF HA AP LS    L   
Sbjct  138   VSSLVAALSRALGVFPALAGRLVTLHDDSIVIRCGGDDAAVEFYHAVAPSLSLGDFLVPG  197

Query  1226  ADIP-REFRSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFF  1053
             AD+P R     F  D T+SY GH +PL A Q+T L D AVFVG   NHAVVDGTSFW+FF
Sbjct  198   ADVPTRLTNGLFPMDRTVSYGGHGRPLTAFQLTVLGDGAVFVGFVANHAVVDGTSFWHFF  257

Query  1052  NTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAGG-PAATFSGDEPIREKIFHFTREA  876
             NT+A +C+GA    R PDF R+   +S AVL+FP G  PA TF  D P+RE+I HF+  A
Sbjct  258   NTWAGLCRGAPV--REPDFRRNFFGDSTAVLRFPGGASPAVTFDADAPLRERILHFSAAA  315

Query  875   ILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRA  696
             I ++K  AN  K   G+  + NGK+   + +  L+  G + EISSFQSL A +WR+VTRA
Sbjct  316   ISELKATANRSKRA-GQEAEANGKLA--HDDSRLE--GRSGEISSFQSLCAHIWRAVTRA  370

Query  695   RKL-EASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLH  519
             R+L  A KTTTFRMA+NCRHRL P + PLYFGNAIQS+ T A   EL S+DL WAA  L+
Sbjct  371   RRLLAADKTTTFRMAVNCRHRLRPAISPLYFGNAIQSVATTATVAELASNDLGWAAARLN  430

Query  518   RNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVR  342
               V +H D  +RR   +WE  PR FPLGN DGA +TMGSSPRFPMYD NDFGWGR LAVR
Sbjct  431   ATVASHKDGAIRRAAAEWEAAPRCFPLGNPDGAALTMGSSPRFPMYDGNDFGWGRALAVR  490

Query  341   SGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             SG ANKFDGK+S+FPG+ G+GS+D+EV LAP+TMA L  D E++QYVS
Sbjct  491   SGRANKFDGKMSSFPGQAGDGSIDVEVCLAPDTMAHLLLDKEFLQYVS  538



>ref|XP_008657044.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Zea 
mays]
 gb|AFW84530.1| hypothetical protein ZEAMMB73_932194 [Zea mays]
Length=510

 Score =   383 bits (984),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 252/469 (54%), Positives = 314/469 (67%), Gaps = 14/469 (3%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkss-nskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisl  1392
             P S I V+S+  V P+  S+     L LSVSDLPMLSC YIQKG+    P L   +L+ L
Sbjct  38    PPSGIAVVSRQHVRPDAASAPAVGDLALSVSDLPMLSCHYIQKGLFFPAPDLPMPSLVLL  97

Query  1391  lklslskalAHFPALAGRLHT--DAKGHVYILSND-EGIEFVhakaphlsaaallpshAD  1221
             L+ SLS+ALA  P LAGRL T  D  G V +  ND  G++F+HA AP LS    L   AD
Sbjct  98    LRSSLSRALAAVPPLAGRLVTLPDDDGRVVVRCNDGAGVDFLHAVAPGLSLDDFLVPGAD  157

Query  1220  IPREF-RSFF--QYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFF  1053
             +P +  +  F    D T+SY GH +PL + QVT L D AVF+G   NHAVVDGTSFW+FF
Sbjct  158   VPTKLTKDLFPMDMDRTVSYEGHRRPLASFQVTVLGDGAVFIGIVANHAVVDGTSFWHFF  217

Query  1052  NTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREA  876
             NT+A IC+G    +R+PDF R+    S AVL+FP G GP+ TF  D P+RE++F F+ +A
Sbjct  218   NTWAAICRGDSP-TRLPDFSRNFFGESTAVLRFPGGVGPSVTFDVDAPLRERVFRFSADA  276

Query  875   ILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRA  696
             + ++K  AN  +   G++ ++ GK+        L  G    EISSFQSL AQ+W +VTRA
Sbjct  277   VRQLKAVANR-RPSRGQDAEVYGKMAQDPKNDPLVRGRGGEEISSFQSLCAQIWLAVTRA  335

Query  695   RK-LEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLS-HDLSWAAEML  522
             RK L+   TTTFRMA+NCRHRL P + P YFGNAIQS  T A   ELL+  DL WAA  L
Sbjct  336   RKRLDPDATTTFRMAVNCRHRLRPAVSPAYFGNAIQSAVTTATVTELLACSDLRWAAGKL  395

Query  521   HRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAV  345
             + ++ A+ D  +RR    W+  PR FPLGN DGA+ITMGSS RFPMY+ NDFGWGRPLAV
Sbjct  396   NASLAAYGDGAIRRAAAAWQAAPRCFPLGNPDGAVITMGSSNRFPMYEGNDFGWGRPLAV  455

Query  344   RSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             RSG ANKFDGK+SAFPGR G+GSVD+EV L P+TMA L  D E+MQ+VS
Sbjct  456   RSGRANKFDGKMSAFPGRAGDGSVDIEVCLTPDTMAALLRDTEFMQFVS  504



>ref|XP_011015986.1| PREDICTED: BAHD acyltransferase DCR-like [Populus euphratica]
Length=332

 Score =   360 bits (924),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 212/337 (63%), Positives = 251/337 (74%), Gaps = 29/337 (9%)
 Frame = -3

Query  1571  MPSS-SIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             MPSS +  ++S+CT+YP+ KSS  K+LKLSVSDLPMLSCQYIQKGVLL+ PP     LI+
Sbjct  1     MPSSCNTSIVSRCTIYPDQKSSTIKALKLSVSDLPMLSCQYIQKGVLLTYPPYSINDLIT  60

Query  1394  llklslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIP  1215
              LK SLS AL+HFPALAGRL TD  GHV+I+ ND G++F+ AKA HLS   +L     +P
Sbjct  61    FLKHSLSVALSHFPALAGRLQTDPSGHVHIVCNDAGVDFIQAKARHLSIHTILSPT-HVP  119

Query  1214  REFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               F+ FF  D TLSY+GHSKPL+A+QVTEL D +F+GCT+NHAV DGTSFWNFFNT+AEI
Sbjct  120   ECFKGFFAMDKTLSYSGHSKPLVAVQVTELKDGIFIGCTVNHAVTDGTSFWNFFNTFAEI  179

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFR  855
             CKG+KKIS+ PDF R+T+ NSPAVLKFP GGP  TFSGDEP+RE+IFHF+R+AILK+K R
Sbjct  180   CKGSKKISKSPDFSRNTMLNSPAVLKFPPGGPKVTFSGDEPLRERIFHFSRDAILKLKLR  239

Query  854   ANNG------------------KLCNGE----NGKLNGKITPVNHEPGLQNGGAASEISS  741
             ANN                   K+ NGE    NG  NGK+ P+     L+N   A EISS
Sbjct  240   ANNSNFRSNSAEIFGRQSNDSWKIVNGESNGNNGLSNGKVDPL----FLKNNETA-EISS  294

Query  740   FQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLE  630
             FQSL AQLWRSVTRARKL  SK TTFRMA+NCRHRLE
Sbjct  295   FQSLCAQLWRSVTRARKLSPSKMTTFRMAVNCRHRLE  331



>gb|EEE55688.1| hypothetical protein OsJ_04109 [Oryza sativa Japonica Group]
Length=436

 Score =   333 bits (854),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 224/461 (49%), Positives = 282/461 (61%), Gaps = 59/461 (13%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaalisll  1389
             P+S I V+S+  V P+  +S    L LSVSDLPMLSC YIQKG+    P +  A+L+SLL
Sbjct  31    PASGITVVSRQDVRPD-GASAVGDLTLSVSDLPMLSCHYIQKGLFFPAPDVPMASLVSLL  89

Query  1388  klslskalAHFPALAGRLHTDAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPRE  1209
               SLS+ALA FP LAGRL T     V I  ND G+EF HA AP+LS    +   AD+P +
Sbjct  90    MSSLSRALAIFPTLAGRLVTLPDDRVVIRCNDAGVEFRHAVAPNLSLDDFIVPDADVPTK  149

Query  1208  F-RSFFQYDSTLSYAGHSKPLMAIQVTELSD-AVFVGCTMNHAVVDGTSFWNFFNTYAEI  1035
               +  F  D T+SY GH +PL + QVT L D AVF+G   NHAVVDGTSFW+FFNT+A +
Sbjct  150   LTKDLFPMDRTVSYDGHRRPLTSFQVTVLGDGAVFIGIVANHAVVDGTSFWHFFNTWAAL  209

Query  1034  CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEPIREKIFHFTREAILKMKF  858
             C+GA    ++PDF R     S AVL+FP G GPA TF  D P+RE++FHF+ +AI ++K 
Sbjct  210   CRGASP--KLPDFRRSFFGESTAVLRFPGGVGPAVTFDADAPLRERVFHFSADAIRELK-  266

Query  857   RANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEAS  678
                N +   G++ ++ GK+    H+   +N    S ISSFQSL+ Q              
Sbjct  267   AITNRRPSGGQDAEVYGKMA---HD--RKNPEGLSAISSFQSLAQQ--------------  307

Query  677   KTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHD  498
                             PR                A   EL S+DL WAA  L+ ++ A+D
Sbjct  308   ----------------PR----------------ATVAELASNDLRWAAAKLNASLAAYD  335

Query  497   DATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYD-NDFGWGRPLAVRSGMANKF  321
             D  +RR    W+  PR FPLGN DGA+ITMGSS RFPMY+ NDFGWGRPLAVRSG ANKF
Sbjct  336   DGAIRRAAAAWQGAPRCFPLGNPDGAVITMGSSNRFPMYEGNDFGWGRPLAVRSGRANKF  395

Query  320   DGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             DGK+SAFP R G+GSVD+EV LAP+TMA L  D E+MQ+VS
Sbjct  396   DGKMSAFPARAGDGSVDIEVCLAPDTMAALLRDSEFMQFVS  436



>gb|EPS69004.1| hypothetical protein M569_05767 [Genlisea aurea]
Length=430

 Score =   332 bits (850),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 262/426 (62%), Gaps = 42/426 (10%)
 Frame = -3

Query  1466  LSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSNDEG  1287
             L+  YIQKG L  + PL    L+  LK  LS+ALAHFP LAGRL TD +G +++  ND G
Sbjct  35    LAFNYIQKGNLFEKSPLGTQDLLLRLKSGLSRALAHFPPLAGRLITDDRGFIHVDCNDAG  94

Query  1286  IEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFV  1107
              +F+HA    L A  L       P   R  F  D T+ Y GH K L+A+QVTEL+D+VF+
Sbjct  95    AQFIHADGSSLCAKDLTS-----PSAVRLCFPMDGTIGYQGHFKQLLAVQVTELADSVFI  149

Query  1106  GCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRD--TVFNSPAVLKFPAG--GP  939
              C +NHAVVDGTS+W+FFN++A++ +G  +ISR PDF R   +    P  L  P G  GP
Sbjct  150   ACAVNHAVVDGTSYWHFFNSFAQLSRGEIEISRAPDFCRQESSGLMPPVPLNLPPGLGGP  209

Query  938   AATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGA  759
               T     P  E+ F F++E+ILK+K   ++         + NG                
Sbjct  210   PMTLL---PFSERNFKFSKESILKLKSTVSD---------RANG----------------  241

Query  758   ASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPT  579
                ISSFQ+L   LWR +TRAR L  ++ TTF +A+N RHR++P+L P YFGNAIQ   T
Sbjct  242   ---ISSFQALCGLLWRGITRARNLPPTEITTFGLAVNIRHRIKPKLNPHYFGNAIQLSLT  298

Query  578   VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSS  399
              A A E+L++ L W A  L+++V  + D  VR+G+++W   P+   L +   A + MGSS
Sbjct  299   FASAEEVLNNGLRWCASQLNKSVAGYGDEEVRKGVREWVREPQFPNLRDLGKATVVMGSS  358

Query  398   PRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDM  219
             P FPMY+NDFGWG+P+AV++G ANK DG +SA PGR+G   ++LEV+LAPE MAGL +D 
Sbjct  359   PLFPMYENDFGWGKPIAVKTGTANKGDGAMSALPGRDGG--IELEVILAPEAMAGLVSDP  416

Query  218   EYMQYV  201
             E+M +V
Sbjct  417   EFMMHV  422



>ref|XP_010270496.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Nelumbo 
nucifera]
Length=457

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 210/481 (44%), Positives = 280/481 (58%), Gaps = 69/481 (14%)
 Frame = -3

Query  1547  ISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPld-------aaalisl  1392
             IS+C+V P +    S         DL ML+  YIQKG+L ++PP           A+I+ 
Sbjct  10    ISRCSVKPAHLPDESSQPYYLNPWDLAMLTVHYIQKGLLFAKPPPSDNQDYPSIDAIINR  69

Query  1391  lklslskalAHFPALAGRLHTDAKGH------VYILSNDE-GIEFVhakaphlsaaallp  1233
             LK SLS+ L HF  LAGR  T  K        V++   D  G EF+HA A    A  L P
Sbjct  70    LKHSLSRTLVHFFPLAGRFVTVQKRDNPPPYTVFVDCKDSPGAEFIHAVADVTVADVLSP  129

Query  1232  shADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFF  1053
                D+P   +SFF +D  +++ GH+ PL+A+QVTEL D VFVGC+ NH + DGTSFW+FF
Sbjct  130   I--DVPHFVQSFFTHDGAVNHDGHTMPLLAVQVTELLDGVFVGCSFNHTIGDGTSFWHFF  187

Query  1052  NTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSGDE-----------  915
             NT+AE+ +         D G+D + + P VLK  FP G GP                   
Sbjct  188   NTWAELTR---------DQGKDYI-SRPPVLKRWFPDGQGPIINLPFTHHSEFIDRYRPP  237

Query  914   PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQ  735
             P+RE+IFHF+ +++ ++K RAN                               + IS+FQ
Sbjct  238   PLRERIFHFSPQSLARLKARANAES--------------------------KTTVISTFQ  271

Query  734   SLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELL  555
             SL A +WRSVTR R L +++ T+ R+AIN R RL P + P YFGN IQ++     AGELL
Sbjct  272   SLCALVWRSVTRVRNLPSNQKTSCRLAINNRTRLNPPISPDYFGNCIQTVSGTTTAGELL  331

Query  554   SHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSPRFPMY-  381
             SHDL WAA MLH+ VV H D+ +R  ++ W   P L+ +G  FD   + +GSSPRF MY 
Sbjct  332   SHDLGWAAWMLHQAVVNHTDSVLRSWLETWMKAPSLYQIGRFFDPYSVMIGSSPRFDMYG  391

Query  380   DNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
              NDFGWG+ +A+RSG ANKFDGK+S+FPG+EG GSVDLEV L+PE M+ LE+D E+M+ V
Sbjct  392   GNDFGWGQGVAIRSGFANKFDGKVSSFPGKEGGGSVDLEVCLSPEKMSALESDEEFMEAV  451

Query  200   S  198
             S
Sbjct  452   S  452



>ref|XP_010915552.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=461

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 204/474 (43%), Positives = 273/474 (58%), Gaps = 48/474 (10%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQ--PPldaaalis  1395
             P+  I  +S+CTV P         L        M S  YIQKG+L +   P L    +I 
Sbjct  4     PAPPIHHLSRCTVKPPPLPPKRCHLTPWDLA--MFSVHYIQKGLLFANLPPSLSTDQIID  61

Query  1394  llklslskalAHFPALAGRLHTDAKGH----------VYILSNDEGIEFVhakaphlsaa  1245
              LK SLS AL HF  LAGR  T+ + H          + I  N EG EF+HA A  ++ +
Sbjct  62    RLKSSLSTALLHFYPLAGRFVTE-EAHDENQKVTGLFLSIDCNGEGAEFIHAIADKITVS  120

Query  1244  allpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSF  1065
              +L    D+P   RSFF  D  +++ GH++PL++IQ+TEL+D +F+GC+ NHAV DGTS+
Sbjct  121   DVLSPSDDVPSFIRSFFPLDGAINHDGHTQPLLSIQLTELADGIFIGCSFNHAVGDGTSY  180

Query  1064  WNFFNTYAEIC--KGAKKISRVPDFGRDTVFNS-PAVLKFPAGGP---AATFSGDEPIRE  903
             WNFFN +A+I   KG   +SR P   R  +  S  A +K P   P     +FS   P+RE
Sbjct  181   WNFFNAWAQIARTKGVAPLSRPPVHDRWFIDGSDTAPIKLPFTHPDDFIESFS-PPPLRE  239

Query  902   KIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSA  723
             KIFHF+ ++I ++K +AN                         Q  G  S ISS Q+LSA
Sbjct  240   KIFHFSVQSIARLKAKAN-------------------------QECGTNS-ISSHQALSA  273

Query  722   QLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDL  543
              +WRS+TR R L A + T+ R+A   R RL P L P YFGN+I  I      GELL+HDL
Sbjct  274   LVWRSITRTRNLSADQKTSCRLAAQNRGRLSPPLSPDYFGNSIYPIIGTTTVGELLNHDL  333

Query  542   SWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGW  363
              WAA +L+R V  H+D+T+R  +  W   P ++P   FD   + MGSSPRF +Y  DFGW
Sbjct  334   GWAAWLLNRTVADHNDSTIRGRLMAWMARPVVYPQSLFDPFSVMMGSSPRFDLYGCDFGW  393

Query  362   GRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
             G+P+A RSG ANKFDGK++++ G EG GSVDLEV L PE+M+ LE+D E+M  V
Sbjct  394   GKPVAGRSGSANKFDGKVTSYLGWEGVGSVDLEVCLVPESMSALESDEEFMSVV  447



>ref|XP_008801989.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Phoenix 
dactylifera]
Length=464

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 189/439 (43%), Positives = 254/439 (58%), Gaps = 42/439 (10%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQ--PPldaaalisllklslskalAHFPALAGRLHTD--------AK  1320
             M SC YIQKG+L +   P L    +I  LK SLS AL HF  LAGR  T+          
Sbjct  35    MFSCHYIQKGLLFANLPPSLSTDQIIDRLKSSLSTALLHFYPLAGRFVTEEARDENQKVT  94

Query  1319  GHVY-ILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMA  1143
             G  + I  N EG EF+HA A  ++ + +L    D+P   +SFF  D  + + GH++PL+A
Sbjct  95    GIFWSIDCNGEGAEFIHAIAREVTVSDVLSPSDDVPSFVQSFFPLDGAVDHDGHAQPLLA  154

Query  1142  IQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC--KGAKKISRVPDFGR---DTVF  978
             +Q+TEL+D +F+GC+ NHAV DGTS+WNFFN +A+I   KG   +SR P + R   D   
Sbjct  155   VQLTELADGIFIGCSFNHAVGDGTSYWNFFNAWAQITRTKGVAALSRPPVYDRWFIDGYD  214

Query  977   NSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKIT  798
             N P  L F             P+REKI HF+ ++I ++K RAN  +  N           
Sbjct  215   NPPVKLPFSHPDDFIERFSPPPLREKIVHFSAQSIAQLKARANQARGTNS----------  264

Query  797   PVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLK  618
                             ISSFQ+LSA +WRS+TR R L A + T+ RMA   R RL P L 
Sbjct  265   ----------------ISSFQALSALVWRSITRTRNLPADQKTSCRMAAQNRARLSPPLS  308

Query  617   PLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPL  438
             P YFGN++  I      GELL+HDL WAA +L+R V  HDD+ +R  ++ W   P ++ L
Sbjct  309   PDYFGNSMYPIIATTTVGELLNHDLGWAAWLLNRTVAEHDDSAIRDKLRAWMARPVVYRL  368

Query  437   GNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVV  258
               FD   + MGSSPRF +Y  +FGWG+ +A RSG ANKFDGK++++ G EG GSVDLE+ 
Sbjct  369   SMFDRFSVMMGSSPRFDVYGCEFGWGKAVAARSGSANKFDGKVTSYSGWEGGGSVDLEIC  428

Query  257   LAPETMAGLENDMEYMQYV  201
             L PE+M+ LE+D E+   V
Sbjct  429   LVPESMSVLESDEEFRSAV  447



>gb|ABR18470.1| unknown [Picea sitchensis]
Length=440

 Score =   308 bits (790),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 185/424 (44%), Positives = 251/424 (59%), Gaps = 31/424 (7%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQP--PldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSN  1296
             ML C YIQKG+L   P       +L+ LLK SLS+AL  F  LAGRL T + G VYI  N
Sbjct  42    MLCCDYIQKGLLYHMPFADQHFVSLVELLKKSLSEALVWFYPLAGRLLTSSDGVVYIDCN  101

Query  1295  DEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDA  1116
             D G++ + A AP +    ++ +  ++    R  F  D  ++  GH  PL+ +QVT+L D 
Sbjct  102   DSGVDLIEASAPDVGIQEIMEA--EVGPVVRQLFALDGAINLNGHFLPLLVVQVTKLRDG  159

Query  1115  VFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRD-TVFNSPAVLKFPAGGP  939
             + +G T+NHAVVDGTS W+F N++A++C+GA  IS  P   R   +  S   L  P    
Sbjct  160   ISIGFTVNHAVVDGTSLWHFINSWADLCRGAATISHPPLHSRCFDIKGSRIALNLPKTQT  219

Query  938   AATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGA  759
                FS    + EKIFHF++E I ++K RAN                         +N  A
Sbjct  220   VEKFSPPA-LSEKIFHFSKETIWRLKDRANR------------------------KNPKA  254

Query  758   ASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPT  579
                ISSFQ+LSA +W+++TRAR L  ++ TTF++A+NCR RL+P L   YFGNAIQ + T
Sbjct  255   PIIISSFQALSAHIWQAITRARGLPPNEPTTFKLAVNCRPRLDPPLPYSYFGNAIQIVST  314

Query  578   VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGS  402
                AGELL+ D+S AA +L R +  H D  +R  +Q ++  P +  L        + MGS
Sbjct  315   TVTAGELLACDISSAAGLLQRIIWPHRDGNIRAELQKYKQRPTVVKLDRTIRDNSVMMGS  374

Query  401   SPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLEND  222
             SPRFPMYDNDFGWGRP+ VRSG ANKFDGK+SA+P REG G VD+E+ L P  MA +E D
Sbjct  375   SPRFPMYDNDFGWGRPVGVRSGWANKFDGKMSAYPEREGGGGVDVEICLMPAFMAAMETD  434

Query  221   MEYM  210
              +++
Sbjct  435   PQFL  438



>ref|XP_007017180.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY14405.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=452

 Score =   305 bits (780),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 206/487 (42%), Positives = 280/487 (57%), Gaps = 67/487 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPP------ld  1413
             M  S +  IS+C V P + S  SK      + DL MLS QYIQKG+L ++PP        
Sbjct  1     MNPSKVRCISECFVKPPHVSQESKQPFYLTTWDLAMLSVQYIQKGLLFAKPPPEDCPQDL  60

Query  1412  aaalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphls  1251
                ++  LK SLS +L HF  LAGRL T  + +     V++  +N  G +F+HA      
Sbjct  61    IKNILDRLKKSLSLSLVHFYPLAGRLATRREENPPAYFVFVDCNNSPGAKFIHAAVDATV  120

Query  1250  aaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGT  1071
             +  L P++  +P   +SFF +D  +++ GH++PL++IQVTEL D VF+GC+MNHA+ DG+
Sbjct  121   SHILSPTY--VPLVVQSFFDHDRAINHDGHTRPLLSIQVTELVDGVFIGCSMNHAIGDGS  178

Query  1070  SFWNFFNTYAEICKGAK---KISRVPDFGRDTVFNSPAVLKFPAG-GPAATF---SGDEP  912
             +FW+FFN  +EI +      KISR P   R           FP G GP         DE 
Sbjct  179   TFWHFFNILSEIFQAQGDNVKISRQPVLKR----------WFPEGHGPLINLPFTHQDEL  228

Query  911   IR--------EKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAA  756
             IR        E+IFHF+ E+I K+K RAN+                              
Sbjct  229   IRRFEAPQLLERIFHFSAESIAKLKARANSEY--------------------------NT  262

Query  755   SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTV  576
             S+ISSFQSLSA +W S+T+AR+    + T+ R+AIN R RL+P L P YFGN+IQ++  V
Sbjct  263   SKISSFQSLSAFVWMSITKARRFPNDQLTSCRLAINNRSRLDPPLSPDYFGNSIQTVRAV  322

Query  575   AKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSS  399
               AGEL+  +L WAA  LH  VV H D +VR  + DW  +P ++ LG  FD   + MGSS
Sbjct  323   TTAGELVEQNLGWAAWQLHLAVVNHTDKSVRGFVNDWLRSPFIYQLGQFFDPQSVMMGSS  382

Query  398   PRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDM  219
             PRF  Y N+FG G+ LA+RSG A+KFDGK+S++PGREG GS+DLEV L   +M  LE+D 
Sbjct  383   PRFNKYGNEFGLGKALALRSGYAHKFDGKVSSYPGREGGGSIDLEVCLPAHSMNALESDA  442

Query  218   EYMQYVS  198
             E+M  VS
Sbjct  443   EFMAAVS  449



>ref|XP_010915553.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=469

 Score =   302 bits (773),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 193/473 (41%), Positives = 266/473 (56%), Gaps = 46/473 (10%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSCQYIQKGVLLSQ--PPldaaalis  1395
             P+ ++  +S+CTV P       K   L+  DL M S  YIQKG+L +   P L    +I 
Sbjct  9     PAPAVHYLSRCTVKPP--PLPPKRCHLTPWDLAMFSLHYIQKGLLFANLPPSLSTDQIID  66

Query  1394  llklslskalAHFPALAGRLHTDAKGH----------VYILSNDEGIEFVhakaphlsaa  1245
              LK SLS  L HF  L GR  T+ + H           +I  N EG EF+HA A  ++ +
Sbjct  67    RLKSSLSTTLLHFYPLTGRFVTE-EAHDENQKVIGIFWWIDCNGEGAEFIHAIADKVTVS  125

Query  1244  allpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSF  1065
              +L    D+P   +SFF  D  +++ GH++PL+A+Q+TEL+D +F+GC+ NHAV DGTS+
Sbjct  126   DVLSPSDDVPSFIQSFFPLDGAINHDGHTQPLLAVQLTELADGIFIGCSFNHAVGDGTSY  185

Query  1064  WNFFNTYAEIC--KGAKKISRVPDFGR---DTVFNSPAVLKFPAGGPAATFSGDEPIREK  900
             WNFFN +A+I   KG   +SR P   R   D    +P  L F             P REK
Sbjct  186   WNFFNAWAQIARTKGVAPLSRPPVHDRWFIDGYDTAPIKLPFTHPHDFIERFSPPPFREK  245

Query  899   IFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQ  720
             IFHF+  +I ++K RAN                         Q  G  S +SSFQ+L+A 
Sbjct  246   IFHFSARSIAQLKARAN-------------------------QECGTNS-VSSFQALTAV  279

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             +WRS+TR R L A + T+ R+A   R RL P L P YFGN++  I      GELL+H L 
Sbjct  280   VWRSITRTRNLPADQKTSCRLAAENRSRLNPPLSPAYFGNSVYPIAATTTVGELLNHGLG  339

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             WAA +L+R V  H+D+T+R  +  W   P ++    FD   + MGSSPRF MY  DFGWG
Sbjct  340   WAAWLLNRTVADHNDSTIRGRLMAWMARPMVYRQSGFDRFSVLMGSSPRFDMYGCDFGWG  399

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
             + +A RSG A+KFDGK++++PG EG GS+DLE+ L P++M+ LE D E+   V
Sbjct  400   KAVAARSGSASKFDGKVTSYPGWEGGGSMDLEICLVPKSMSMLETDDEFRSAV  452



>ref|XP_002284916.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Vitis 
vinifera]
Length=454

 Score =   300 bits (769),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 201/486 (41%), Positives = 285/486 (59%), Gaps = 63/486 (13%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPld------  1413
             M + ++ +IS+C + P++ S  +K        DL MLS  YIQKG+L S+PP        
Sbjct  1     MATPTVRLISECFIKPKFTSEETKEPCYLTPWDLAMLSVNYIQKGLLFSKPPDVDDPQNF  60

Query  1412  aaalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphls  1251
              A L+  LK SL+  L HF  LAGRL T  +       V++  +N  G +F+HA A    
Sbjct  61    MATLLDRLKDSLALTLDHFYPLAGRLATKKEDSPPSYVVFVDCNNSPGAKFIHAAADMTI  120

Query  1250  aaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGT  1071
             +  L P +  +P+  +SFF +D  +++ GH+  L++IQVTEL D +F+GC++NH++VDGT
Sbjct  121   SDILSPIY--VPQVIQSFFDHDRVINHDGHTLSLLSIQVTELVDGIFIGCSINHSMVDGT  178

Query  1070  SFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATF---SGDEPI  909
             SFW+FFN ++E+    +K S +         + P +LK  FP G GP         DE I
Sbjct  179   SFWHFFNAWSEVFTAQEKNSPI-------TLSRPPILKRWFPDGYGPIINLPFTHHDEFI  231

Query  908   --------REKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS  753
                     RE+IFHF+ E+I K+K +AN    CN                        ++
Sbjct  232   SRFEAPVLRERIFHFSSESIAKLKAKAN--AQCN------------------------SN  265

Query  752   EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA  573
             +ISSFQ+LSA +WRS+TRAR     + T+ R+AI  R RL+P L   YFGN+IQ++  +A
Sbjct  266   KISSFQALSALVWRSITRARCFPHEQVTSCRLAIGNRTRLDPPLPENYFGNSIQTVRGIA  325

Query  572   KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGSSP  396
              AGELL HDL WAA +LH+ VV H D  VR  ++ W  +  ++ LG  FD   + MGSSP
Sbjct  326   TAGELLEHDLGWAAWLLHQAVVGHTDKAVRGWLESWFQSHFIYQLGLFFDPNSVMMGSSP  385

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RF  Y  +FG G+ LAVRSG A+KFDG +S +PGREG GS+DLEV L P +M+ LE++ E
Sbjct  386   RFNKYGIEFGLGKGLAVRSGYAHKFDGTVSCYPGREGGGSIDLEVCLPPNSMSALESNQE  445

Query  215   YMQYVS  198
             +M+ VS
Sbjct  446   FMEAVS  451



>gb|KDO84111.1| hypothetical protein CISIN_1g044173mg [Citrus sinensis]
Length=455

 Score =   299 bits (765),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 205/492 (42%), Positives = 273/492 (55%), Gaps = 72/492 (15%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPldaaalis  1395
             M S ++  +S+C V PEY S   K        DL MLS QYIQKG+L  +P +  A++  
Sbjct  1     MNSPAVQYMSECFVQPEYFSEEMKQPCYLTPWDLVMLSVQYIQKGLLFRKPAIPPASVDQ  60

Query  1394  l---------lklslskalAHFPALAGRL---HTDAKGHVYIL---SNDEGIEFVhakap  1260
             +         LK SLS  L HF  LAGRL    TD+     +    +N  G +F+HA   
Sbjct  61    VDFIKTLLDRLKHSLSLTLVHFYPLAGRLVTRQTDSPPSYVVFVDCNNSPGAKFIHASLD  120

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
                +  L P++  +P   +SFF +D  L++ GHS+PL++IQVTEL D +F+GC+MNH + 
Sbjct  121   MAISDILSPTY--VPLVVQSFFDHDRALNHDGHSRPLLSIQVTELVDGIFIGCSMNHVLG  178

Query  1079  DGTSFWNFFNTYAEICKGAKK---ISRVPDF------GRDTVFNSPAVLKFPAGGPAATF  927
             DGTSFWNFFN ++EI +   K   ISR P        GRD + N P   +          
Sbjct  179   DGTSFWNFFNAFSEIFQAQGKMDSISRPPVVKRWFPDGRDPIINLPFTHR----------  228

Query  926   SGDEPIR--------EKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQ  771
               DE IR        E+IFHFT E+I ++K +AN                         +
Sbjct  229   --DEFIRRYEAPQLLERIFHFTGESIARLKAKANA------------------------E  262

Query  770   NGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQ  591
              G   ++ISSFQ+LSA +WRS+TR R L   +TT+ RMA + R RLEP L   YFGN+I 
Sbjct  263   AGNNTNKISSFQALSALVWRSITRTRNLPPDQTTSCRMAADNRPRLEPPLPREYFGNSIN  322

Query  590   SIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMI  414
              +  V   GELL HDL WAA  LH+ VV   D  VR  +  W  +P ++ L   FD   I
Sbjct  323   PLRGVTTVGELLGHDLGWAAWKLHQTVVNQTDKAVREWLDAWWKSPFMYHLDRLFDPFSI  382

Query  413   TMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAG  234
              MGSSPRF  Y N+FG G+ +A+RSG A+KFDGK+SA+PG EG GS+DLE+ L P +M  
Sbjct  383   MMGSSPRFNKYGNEFGLGQAVALRSGYAHKFDGKVSAYPGHEGGGSIDLEICLPPHSMTA  442

Query  233   LENDMEYMQYVS  198
             LE D E+M+  S
Sbjct  443   LEADEEFMEVTS  454



>ref|XP_006473294.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=455

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 203/493 (41%), Positives = 273/493 (55%), Gaps = 74/493 (15%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPldaaalis  1395
             M S ++  +S+C V PEY S   K        DL MLS QYIQKG+L  +P +  A++  
Sbjct  1     MNSPAVQYMSECFVQPEYFSEEMKQPCYLTPWDLVMLSVQYIQKGLLFRKPAIPPASVDQ  60

Query  1394  l---------lklslskalAHFPALAGRL---HTDAKGHVYIL---SNDEGIEFVhakap  1260
             +         LK SLS  L HF  LAGRL    TD+     +    +N  G +F+HA   
Sbjct  61    VDFIKTLLDRLKHSLSLTLVHFYPLAGRLVTRQTDSPPSYVVFVDCNNSPGAKFIHASLD  120

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
                +  L P++  +P   +SFF +D  L++ GHS+PL++IQVTEL D +F+GC+MNH + 
Sbjct  121   MAISDILSPTY--VPLVVQSFFDHDRALNHDGHSRPLLSIQVTELVDGIFIGCSMNHVLG  178

Query  1079  DGTSFWNFFNTYAEICKGAKKISRV----------PDFGRDTVFNSPAVLKFPAGGPAAT  930
             DGTSFWNFFN ++EI +   K++ +          PD GRD + N P   +         
Sbjct  179   DGTSFWNFFNAFSEIFQAQGKMASISRPPVIKRWFPD-GRDPIINLPFTHR---------  228

Query  929   FSGDEPIR--------EKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGL  774
                DE IR        E+IFHFT E+I ++K +AN                         
Sbjct  229   ---DEFIRRYEAPQLLERIFHFTGESIARLKAKANA------------------------  261

Query  773   QNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAI  594
             + G   ++ISSFQ+LSA +WRS+TR R L   +TT  RMA + R RLEP L   YFGN+I
Sbjct  262   EAGNNTNKISSFQALSALVWRSITRIRNLPPDQTTGCRMAADNRPRLEPPLPREYFGNSI  321

Query  593   QSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAM  417
               +  V   GELL HDL WAA  LH+ VV   D  VR  +  W  +P ++ L   FD   
Sbjct  322   NPLRGVTTVGELLGHDLGWAAWKLHQTVVNQTDKAVREWLDAWWKSPFMYHLDRLFDPFS  381

Query  416   ITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMA  237
             I MGSSPRF  Y N+FG G+ +A+RSG A+KFDGK+SA+PG EG GS+DLE+ L P +M 
Sbjct  382   IMMGSSPRFNKYGNEFGLGQAVALRSGYAHKFDGKVSAYPGHEGGGSIDLEICLPPHSMT  441

Query  236   GLENDMEYMQYVS  198
              LE D E+M+  S
Sbjct  442   ALEADEEFMEATS  454



>ref|XP_004291089.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   296 bits (758),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 201/482 (42%), Positives = 277/482 (57%), Gaps = 47/482 (10%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPld-----a  1410
             M S ++  IS+C + P   S  SK       SDLPMLS  YIQKG+L ++PP        
Sbjct  1     MESPNVKYISECFIQPHLASEESKQPFYLTPSDLPMLSFHYIQKGLLFTKPPEARNPCFV  60

Query  1409  aalisllklslskalAHFPALAGRLHT--DAKGHVYIL----SNDEGIEFVhakaphlsa  1248
               L++ LK SLS AL HF  LAGRL T  +   H+Y++    SN  G +F+HA      +
Sbjct  61    HTLLAKLKHSLSLALVHFYPLAGRLVTKKEQDPHLYLVYVDCSNSPGAKFIHASLEMSIS  120

Query  1247  aallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTS  1068
               L P+  D+P   +SFF +D  +++ GHS  L+  QVTEL D VF+G +MNH++VDGTS
Sbjct  121   DILSPT--DVPLVVQSFFDHDRAVNHDGHSTSLLTAQVTELVDGVFIGLSMNHSLVDGTS  178

Query  1067  FWNFFNTYAEICKGAKK---ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IRE  903
             +WNFFNT++EI +       +S  P   R        ++  P   P+      EP  +RE
Sbjct  179   YWNFFNTWSEIFQAQNNNITLSNPPVMDRWIPEGLDPIISLPYTEPSEFIDRFEPPKLRE  238

Query  902   KIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSA  723
             ++FHF+ E++ K+K +AN+   CN                         S+IS+FQ+LSA
Sbjct  239   RMFHFSSESLAKLKAKANSE--CN------------------------TSKISTFQALSA  272

Query  722   QLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA-KAGELLSHD  546
              LWR++TRAR L   + T  ++A N R RL+P L P YFGN++  I +   KAGELL H 
Sbjct  273   LLWRTITRARVLPPDQETRCKLAANNRARLDPPLAPNYFGNSVYPITSEPIKAGELLDHG  332

Query  545   LSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFG  366
             L WAA  +HR VV  +   ++  +  W  +P +F    FD   + MGSSPRF MY N+FG
Sbjct  333   LGWAALKVHRAVVTLNHQALKGFLDHWLKSPAVFSPRFFDPFSVMMGSSPRFDMYRNEFG  392

Query  365   WGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQF  186
              G+ +A+RSG ANKF GK+SAF GRE +GS+DLEV L PETM  LE+D E+M+  S   +
Sbjct  393   MGKAVALRSGYANKFSGKVSAFQGRE-SGSIDLEVCLPPETMGALESDDEFMEAASVASY  451

Query  185   DH  180
             D 
Sbjct  452   DQ  453



>emb|CAN78155.1| hypothetical protein VITISV_032623 [Vitis vinifera]
Length=602

 Score =   300 bits (768),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 200/493 (41%), Positives = 287/493 (58%), Gaps = 64/493 (13%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPld------  1413
             M + ++ +IS+C + P++ S  +         DL MLS  YIQKG+L S+PP        
Sbjct  80    MATPTVRLISECFIKPKFTSEETNEPCYLTPWDLAMLSVNYIQKGLLFSKPPDVDDPQNF  139

Query  1412  aaalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphls  1251
              A L+  LK SL+  L HF  LAGRL T  +       V++  +N  G++F+HA A    
Sbjct  140   MATLLDKLKDSLALTLDHFYPLAGRLATKKEDSSPSYVVFVDCNNSPGLKFIHAAADMTI  199

Query  1250  aaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGT  1071
             +  L P +  +P+  +SFF +D  +++ G +  L++IQ+TEL D +F+GC++NH++VDGT
Sbjct  200   SDILSPIY--VPQVIQSFFDHDRVINHDGRTLSLLSIQITELVDGIFIGCSINHSMVDGT  257

Query  1070  SFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATF---SGDEPI  909
             SFW+FFN ++E+     K S +         + P +LK  FP G GP         DE I
Sbjct  258   SFWHFFNAWSEVFTAQGKNSSI-------TLSRPPILKRWFPDGYGPIINLPFTHHDEFI  310

Query  908   --------REKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS  753
                     RE+IFHF+ E+I K+K +AN    CN                        ++
Sbjct  311   SRFEAPVLRERIFHFSSESIAKLKAKANAQ--CN------------------------SN  344

Query  752   EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA  573
             +ISSFQ+LSA +WRS+TRAR     + T+ R+A   R RL+P L   YFGN+IQ++  +A
Sbjct  345   KISSFQALSALVWRSITRARCFPHEQVTSCRLATGNRTRLDPPLPENYFGNSIQTVRGIA  404

Query  572   KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSP  396
              AGELL HDL WAA +LH+ VV H D  VR  ++ W  +  ++ LG  FD   + MGSSP
Sbjct  405   TAGELLEHDLGWAAWLLHQAVVGHTDKAVRGWLESWFQSHFIYQLGLFFDPNSVMMGSSP  464

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RF  Y  +FG G+ LAVRSG A+KFDGK+S +PGREG GS+DLEV L P +M+ LE++ E
Sbjct  465   RFNKYGIEFGLGKGLAVRSGYAHKFDGKVSCYPGREGGGSIDLEVCLPPNSMSALESNQE  524

Query  215   YMQYVS*I-QFDH  180
             +M+ VS + Q +H
Sbjct  525   FMEAVSLLPQLEH  537



>ref|XP_008347613.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=463

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 205/498 (41%), Positives = 282/498 (57%), Gaps = 71/498 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPlda-----  1410
             M S S+  IS+C + P + S  S+       +DL MLS  YIQKG+L ++PP        
Sbjct  1     MNSQSVKHISECFIIPHHVSEESQQPLYLAPTDLAMLSVHYIQKGLLFAKPPEAMDRRHK  60

Query  1409  ----aalisllklslskalAHFPALAGRLHTDAKGH--VYIL----SNDEGIEFVhakap  1260
                  +L+  LK SLS AL HF  LAGR  T  + +  +Y++    SN  G  F++A   
Sbjct  61    AEFVNSLLDKLKHSLSLALVHFYPLAGRFATKKEENPPLYLVYXDCSNSPGARFIYATLD  120

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
                   L P+  D+P   +SFF +D  +++ GH+  L+ +QVTEL D +F+G +MNH + 
Sbjct  121   VSVLDILSPT--DVPLVVQSFFDHDRAVNHDGHTASLLTVQVTELVDGIFIGLSMNHCLC  178

Query  1079  DGTSFWNFFNTYAE----ICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSG  921
             DGTSFW+FFNT++E    I +GA   + VP   R      P VLK  FP G GP  +   
Sbjct  179   DGTSFWHFFNTWSELFQAITQGAHDNTIVPGISR------PPVLKRWFPDGHGPIISLPY  232

Query  920   DEP-----------IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGL  774
               P           +RE++FHF+ E+I K+K +AN                         
Sbjct  233   TNPDEFIGRFEAPELRERMFHFSSESIAKLKAKAN-------------------------  267

Query  773   QNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAI  594
              +   A++ISSFQSLSA LWRS+TRAR+L  +++T  R+A N R RL+P L   YFGN+I
Sbjct  268   -SESNATKISSFQSLSALLWRSITRARRLPPNQSTRCRLAANNRARLDPPLSGDYFGNSI  326

Query  593   QSIPTVA-KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGA  420
               I + A  AGELL H L WAA  LH  VV  DD  +R  +  W  +P ++ LG  FD  
Sbjct  327   HPINSEAVTAGELLQHSLGWAAWKLHEAVVKLDDREIRGFVDAWLQSPTVYLLGQFFDPY  386

Query  419   MITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETM  240
             M+ MGSSPRF MY N+FG G+ +A+RSG ANKF GK+S++ GRE  GS+DLEV L P+ M
Sbjct  387   MVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFGGKVSSYEGRE-RGSIDLEVCLPPDAM  445

Query  239   AGLENDMEYMQYVS*IQF  186
             + LE D E+M++ S  Q+
Sbjct  446   SALECDEEFMEFASVPQY  463



>ref|XP_004141386.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
Length=468

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 268/484 (55%), Gaps = 63/484 (13%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaaal------  1401
             SI  IS+C V P++    S      +  DL MLS  YIQKG+L  +P             
Sbjct  7     SIRRISECFVKPKFLPQQSNQPYHLIPGDLAMLSAHYIQKGLLFPKPSHLINQSPHPFML  66

Query  1400  --isllklslskalAHFPALAGRLHT---DAKGHVYILS---NDEGIEFVhakaphlsaa  1245
               +  L+ SLS AL HF  L+GRL T   D +  V I     N  G +F+HA      + 
Sbjct  67    HLLHRLQNSLSIALFHFYPLSGRLSTVSNDQQSSVSIYVDCLNSPGAKFIHAALDITISD  126

Query  1244  allpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSF  1065
              L P   D+P   +SFF +   ++Y GH+ PL+++QVTEL D VF+ C+ NHA+ DGTS+
Sbjct  127   VLSPV--DVPLLVQSFFDHHKAVNYDGHTMPLLSVQVTELLDGVFIACSFNHAIGDGTSY  184

Query  1064  WNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSGDEP------  912
             WNFFN ++EI +         D       + P +LK  FP G GP        P      
Sbjct  185   WNFFNMWSEIFQATSS-----DGDEIISISQPPILKRWFPDGIGPIINLPFTHPDQFISR  239

Query  911   -----IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEI  747
                  +RE+IFHF+ E+I K+K +AN+   C                         A EI
Sbjct  240   FEAPELRERIFHFSAESIAKLKAKANSE--CK------------------------AKEI  273

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSLSA +WRS+TRAR++  ++ ++  MA N R RL+P+L   YFGN + S+   AKA
Sbjct  274   SSFQSLSALVWRSITRARRVPENQISSCSMAANNRGRLDPKLSENYFGNVVTSVKAEAKA  333

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSPRF  390
             GEL+   + WAA  LH  VV + +  +R+ +  W  +P  F LG  FD   + MGSSPRF
Sbjct  334   GELVERGVGWAAWKLHEAVVQNTNEKLRKALDKWMESPFTFQLGRFFDQYSVLMGSSPRF  393

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
               Y N+FG G+ +A+RSG ANKFDGK+SA+PG EG GS+DLE+ L P+ MA LE+D+E++
Sbjct  394   NKYGNEFGMGKAVALRSGYANKFDGKVSAYPGYEGGGSIDLEICLLPQNMANLESDLEFI  453

Query  209   QYVS  198
             + +S
Sbjct  454   KSIS  457



>ref|XP_007136703.1| hypothetical protein PHAVU_009G066800g [Phaseolus vulgaris]
 gb|ESW08697.1| hypothetical protein PHAVU_009G066800g [Phaseolus vulgaris]
Length=463

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 191/484 (39%), Positives = 267/484 (55%), Gaps = 54/484 (11%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPE-YkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaal--  1401
             M + ++  IS+C V P  Y +  ++   L+  D+ MLS  YIQKG+L S+P         
Sbjct  1     MGTPAVEHISECFVKPHPYNNFPNQICNLTPWDIAMLSVHYIQKGLLFSKPATLVDQQYF  60

Query  1400  ----isllklslskalAHFPALAGRL--HTDAKGHVYILS----NDEGIEFVhakaphls  1251
                 +  LK SLS  L+HF  L+GRL  H   +   Y +S    N +G  F++A      
Sbjct  61    MENLLKKLKHSLSLTLSHFYPLSGRLVTHKTQQPPSYTVSVDCNNSDGARFIYATLDVTI  120

Query  1250  aaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGT  1071
             +  L P   D P  F SFF +   L++ GH+ PL++IQVTEL D VF+GC+MNH++ DGT
Sbjct  121   SDLLSPV--DTPSVFHSFFDHHKALNHDGHTMPLLSIQVTELVDGVFIGCSMNHSLGDGT  178

Query  1070  SFWNFFNTYAEI---------CKGAKKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGD  918
             S+WNFFNT+++I         C+    ISR P   R    N    +  P           
Sbjct  179   SYWNFFNTWSQIFQAQSQAERCEYDVPISRQPIHNRWFPNNCRPPISLPFKHHEEFIERS  238

Query  917   EP---IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEI  747
             E    +RE++FHF+ E+I K+K +AN+                              ++I
Sbjct  239   EKTTLLRERVFHFSAESIAKLKAKANSE--------------------------SNTTQI  272

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSLSA +WRS+TRAR   + + T  R+A N R R+EP L   YFGN I ++      
Sbjct  273   SSFQSLSALVWRSITRARSPPSDQITICRLAANSRSRMEPPLPEEYFGNCIHAVSAETTK  332

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF-DGAMITMGSSPRF  390
             GELL +DL WAA  LH  V    +  V + +Q+W  +P ++ +G F D   + MGSSPRF
Sbjct  333   GELLENDLGWAAWKLHMAVANLSNRVVLQYLQEWLESPLIYQMGRFFDPYCVMMGSSPRF  392

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
              MY ++FG G+ +A RSG ANKFDGK+S++PGREG GS+DLEV L P +M+ LE+D E+M
Sbjct  393   NMYGSEFGMGKAVAARSGHANKFDGKVSSYPGREGGGSIDLEVCLLPHSMSALESDKEFM  452

Query  209   QYVS  198
               VS
Sbjct  453   NAVS  456



>ref|XP_004163245.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
Length=468

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 195/484 (40%), Positives = 267/484 (55%), Gaps = 63/484 (13%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaaal------  1401
             SI  IS+C V P++    S      +  DL MLS  YIQKG+L  +P             
Sbjct  7     SIRRISECFVKPKFLPQQSNQPYHLIPGDLAMLSAHYIQKGLLFPKPSHLINQSPHPFML  66

Query  1400  --isllklslskalAHFPALAGRLHT---DAKGHVYILS---NDEGIEFVhakaphlsaa  1245
               +  L+ SLS AL HF  L+GRL T   D +  V I     N  G +F+HA      + 
Sbjct  67    HLLHRLQNSLSIALFHFYPLSGRLSTVSNDQQSSVSIYVDCLNSPGAKFIHAALDITISD  126

Query  1244  allpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSF  1065
              L P   D+P   +SFF +   ++Y GH+ PL++IQVTEL D VF+ C+ NHA+ DGTS+
Sbjct  127   VLSPV--DVPLLVQSFFDHHKAVNYDGHTMPLLSIQVTELLDGVFIACSFNHAIGDGTSY  184

Query  1064  WNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSGDEP------  912
             WNFFN ++EI +         D       + P +LK  FP G GP        P      
Sbjct  185   WNFFNMWSEIFQATSS-----DGDEIISISQPPILKRWFPDGIGPIINLPFTHPDQFISR  239

Query  911   -----IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEI  747
                  +RE+IFHF+ E+I K+K +AN+   C                         A EI
Sbjct  240   FEAPELRERIFHFSAESIAKLKAKANSE--CK------------------------AKEI  273

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSLSA +WRS+TRAR++  ++ ++  MA N R RL+P+L   YFGN + S+   AKA
Sbjct  274   SSFQSLSALVWRSITRARRVPENQISSCSMAANNRGRLDPKLSENYFGNVVTSVKAEAKA  333

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSPRF  390
             GEL+   + WAA  LH  VV + +  +R+ +  W  +P  F LG  FD   + MGSSPRF
Sbjct  334   GELVERGVGWAAWKLHEAVVQNTNEKLRKALDKWMESPFTFQLGRFFDPYSVLMGSSPRF  393

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
               Y N+FG G+ +A+RSG ANKFDGK+SA+PG EG GS+DLE+ L P+ MA LE+D+E++
Sbjct  394   NKYGNEFGMGKAVALRSGYANKFDGKVSAYPGYEGGGSIDLEICLLPQNMANLESDLEFI  453

Query  209   QYVS  198
               +S
Sbjct  454   NSIS  457



>gb|KGN55211.1| hypothetical protein Csa_4G640970 [Cucumis sativus]
Length=468

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 267/484 (55%), Gaps = 63/484 (13%)
 Frame = -3

Query  1559  SIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaaal------  1401
             SI  IS+C V P++    S      +  DL MLS  YIQKG+L  +P             
Sbjct  7     SIRRISECFVKPKFLPQQSNQPYHLIPGDLAMLSAHYIQKGLLFPKPSHLINQSPHPFML  66

Query  1400  --isllklslskalAHFPALAGRLHT---DAKGHVYILS---NDEGIEFVhakaphlsaa  1245
               +  L+ SLS AL HF  L+GRL T   D +  V I     N  G +F+HA      + 
Sbjct  67    HLLHRLQNSLSIALFHFYPLSGRLSTVSNDQQSSVSIYVDCLNSPGAKFIHAALDITISD  126

Query  1244  allpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSF  1065
              L P   D+P   +SFF +   ++Y GH+ PL+++QVTEL D VF+ C+ NHA+ DGTS+
Sbjct  127   VLSPV--DVPLLVQSFFDHHKAVNYDGHTMPLLSVQVTELLDGVFIACSFNHAIGDGTSY  184

Query  1064  WNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSGDEP------  912
             WNFFN ++EI +         D       + P +LK  FP G GP        P      
Sbjct  185   WNFFNMWSEIFQATSS-----DGDEIISISQPPILKRWFPDGIGPIINLPFTHPDQFISR  239

Query  911   -----IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEI  747
                  +RE+IFHF+ E+I K+K +AN+   C                         A EI
Sbjct  240   FEAPELRERIFHFSAESIAKLKAKANSE--CK------------------------AKEI  273

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSLSA +WRS+TRAR++  ++ ++  MA N R RL+P+L   YFGN + S+   AKA
Sbjct  274   SSFQSLSALVWRSITRARRVPENQISSCSMAANNRGRLDPKLSENYFGNVVTSVKAEAKA  333

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSPRF  390
             GEL+   + WAA  LH  VV + +  +R+ +  W  +P  F LG  FD   + MGSSPRF
Sbjct  334   GELVERGVGWAAWKLHEAVVQNTNEKLRKALDKWMESPFTFQLGRFFDQYSVLMGSSPRF  393

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
               Y N+FG G+ +A+RSG ANKFDGK+SA+PG EG GS+DLE+ L P+ MA LE+D+E++
Sbjct  394   NKYGNEFGMGKAVALRSGYANKFDGKVSAYPGYEGGGSIDLEICLLPQNMANLESDLEFI  453

Query  209   QYVS  198
               +S
Sbjct  454   NSIS  457



>ref|XP_008378023.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=463

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 204/498 (41%), Positives = 281/498 (56%), Gaps = 71/498 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPlda-----  1410
             M S S+  IS+C + P + S  S+       +DL MLS  YIQKG+L ++PP        
Sbjct  1     MNSQSVKHISECFIIPHHVSEESQQPLYLAPTDLAMLSVHYIQKGLLFAKPPEAMDRRHK  60

Query  1409  ----aalisllklslskalAHFPALAGRLHTDAKGH--VYIL----SNDEGIEFVhakap  1260
                  +L+  LK SLS AL HF  LAGR  T  + +  +Y++    SN  G  F++A   
Sbjct  61    AEFVNSLLDKLKHSLSLALVHFYPLAGRFATKKEENPPLYLVYXDCSNSPGARFIYATLD  120

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
                   L P+  D+P   +SFF +D  +++ GH+  L+ +QVTEL D +F+G +MNH + 
Sbjct  121   VSVLDILSPT--DVPLVVQSFFDHDRAVNHDGHTASLLTVQVTELVDGIFIGLSMNHCLC  178

Query  1079  DGTSFWNFFNTYAE----ICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSG  921
             DGTSFW+FFNT++E    I + A   + VP   R      P VLK  FP G GP  +   
Sbjct  179   DGTSFWHFFNTWSELFQAITQXAHDNTIVPGISR------PPVLKRWFPDGHGPIISLPY  232

Query  920   DEP-----------IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGL  774
               P           +RE++FHF+ E+I K+K +AN                         
Sbjct  233   TNPDEFIGRFEAPELRERMFHFSSESIAKLKAKAN-------------------------  267

Query  773   QNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAI  594
              +   A++ISSFQSLSA LWRS+TRAR+L  +++T  R+A N R RL+P L   YFGN+I
Sbjct  268   -SESNATKISSFQSLSALLWRSITRARRLPPNQSTRCRLAANNRARLDPPLSGDYFGNSI  326

Query  593   QSIPTVA-KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGA  420
               I + A  AGELL H L WAA  LH  VV  DD  +R  +  W  +P ++ LG  FD  
Sbjct  327   HPINSEAVTAGELLQHSLGWAAWKLHEAVVKLDDREIRGFVDAWLXSPTVYLLGQXFDPY  386

Query  419   MITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETM  240
             M+ MGSSPRF MY N+FG G+ +A+RSG ANKF GK+S++ GRE  GS+DLEV L P+ M
Sbjct  387   MVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFGGKVSSYEGRE-RGSIDLEVCLPPDAM  445

Query  239   AGLENDMEYMQYVS*IQF  186
             + LE D E+M++ S  Q+
Sbjct  446   SALECDEEFMEFASVPQY  463



>ref|XP_009409404.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Musa 
acuminata subsp. malaccensis]
Length=468

 Score =   291 bits (744),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 186/445 (42%), Positives = 253/445 (57%), Gaps = 49/445 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQ---PPldaaalisllklslskalAHFPALAGRLHT----DAKG--  1317
             M +  YIQKG L S      L  A ++  LK SLS AL HF  LAGRL T    D +G  
Sbjct  35    MFNASYIQKGHLFSTHLLSRLTIADVVDRLKTSLSTALLHFYPLAGRLVTEEAVDEQGNV  94

Query  1316  ---HVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
                +V I  + +G E  H  A  ++ A +L   +D+P   RSFF+ D  ++Y GHS+PL+
Sbjct  95    TGIYVSIDCDGQGAELTHVVADGITVADVLAPSSDVPSFVRSFFRLDGVINYDGHSEPLL  154

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKG---AKKISRVPDFGRDTVFN  975
             A+Q+TEL+D  FVGC+ NH V DGTS+W FFN +AEI +    A ++S  P   R  +  
Sbjct  155   AVQLTELADGFFVGCSFNHVVGDGTSYWQFFNAWAEIARADGAAAEMSHPPVHDRWFIDG  214

Query  974   SPAV-LKFPAGGPAATFSGDEPI-----REKIFHFTREAILKMKFRANNGKLCNGENGKL  813
             S  + +K P   P      D P      RE+IFH + E+I ++K RAN            
Sbjct  215   SGGLPIKLPFTRPDEFI--DRPTQPPLYRERIFHLSAESIARLKARAN------------  260

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                         L+ G   S ISSFQS+++ LWR +TRAR L A +TT  R+A   R RL
Sbjct  261   ------------LECG--TSSISSFQSVASLLWRCITRARGLPAEQTTHCRVATQNRARL  306

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             +P + P YFGN+I  +P  A AGELL+H L WAA ++H  V  H D  +R  ++ W   P
Sbjct  307   QPPMSPDYFGNSIYPLPAAATAGELLAHGLGWAARLIHETVAGHTDTAIREKVEAWMAAP  366

Query  452   RLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSV  273
              ++ +  FD   + MGSSPRF +Y  +FG G+ +AVRSG A+KFDGK++ +PG EG GS+
Sbjct  367   VVYKMNMFDKFSVMMGSSPRFDVYGCNFGLGKAVAVRSGTAHKFDGKVTFYPGWEGGGSM  426

Query  272   DLEVVLAPETMAGLENDMEYMQYVS  198
             DLE+ L P  M+  E D E+M  VS
Sbjct  427   DLEICLEPPFMSAFEADEEFMSAVS  451



>ref|XP_008452574.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=467

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 186/452 (41%), Positives = 253/452 (56%), Gaps = 61/452 (13%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPld-------aaalisllklslskalAHFPALAGRLHT---DAK  1320
             MLS  YIQKG+L  +P             L+  L+ SLS AL HF  L+GRL T   D +
Sbjct  38    MLSAHYIQKGLLFRKPSHLNHYPHPFMLHLLHRLQNSLSIALFHFYPLSGRLSTIKNDQQ  97

Query  1319  GHVYILS---NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
               V I     N  G +F+HA      +  L P   D+P   +SFF     ++Y GH+ PL
Sbjct  98    SSVSIYVDCVNSPGAKFIHAALDITISDVLSPV--DVPLLVQSFFDLHKAVNYDGHTMPL  155

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             ++IQVTEL D VF+ C+ NHA+ DGTS+WNFFN ++EI +         D       + P
Sbjct  156   LSIQVTELLDGVFIACSFNHAIGDGTSYWNFFNMWSEIFQATSS-----DGDEIISISRP  210

Query  968   AVLK--FPAG-GPAATFSGDEP-----------IREKIFHFTREAILKMKFRANNGKLCN  831
              +LK  FP G GP  +     P           +RE+IFHF+ E+I K+K +AN    C 
Sbjct  211   PILKRWFPDGIGPIISLPFTHPDQFISRFEAPELRERIFHFSAESIAKLKAKANAE--CK  268

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
                                     A EISSFQSLSA +WRS+TRAR++  ++ ++  MA 
Sbjct  269   ------------------------AKEISSFQSLSALVWRSITRARRVPENQISSCSMAA  304

Query  650   NCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQ  471
             N R +L+P+L   YFGN + S+   AKAGEL+   L WAA  LH  VV + +  +R+ + 
Sbjct  305   NNRGKLDPKLSENYFGNVVTSVKAEAKAGELVERGLGWAAWKLHEVVVQNTNEKLRKALD  364

Query  470   DWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPG  294
              W  +P  F LG  FD   + MGSSPRF  Y N+FG G+ +A+RSG ANKFDGK+SA+PG
Sbjct  365   KWIESPFTFQLGRFFDAYSVLMGSSPRFNKYGNEFGMGKAVALRSGYANKFDGKVSAYPG  424

Query  293   REGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              EG GS+DLE+ L P+ MA LE+D+E++  +S
Sbjct  425   YEGGGSIDLEICLLPQNMANLESDLEFINSIS  456



>ref|XP_010110811.1| putative acetyltransferase [Morus notabilis]
 gb|EXC28183.1| putative acetyltransferase [Morus notabilis]
Length=455

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 193/467 (41%), Positives = 263/467 (56%), Gaps = 48/467 (10%)
 Frame = -3

Query  1547  ISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPld------aaalisll  1389
             IS+C + P Y   +SK+       DL MLS  YIQKG+L ++PP          +L+  L
Sbjct  10    ISECFIKPHYTPEDSKNHLYLTPWDLAMLSVHYIQKGLLFAKPPHTNKDENFMESLLDRL  69

Query  1388  klslskalAHFPALAGRLHTDAKGH-----VYILSNDE-GIEFVhakaphlsaaallpsh  1227
             K SLS AL HF  LAGRL T    +     V++  ND  G +F++A      +  L P  
Sbjct  70    KQSLSVALVHFYPLAGRLKTVKTENPNSYSVHVDCNDSPGAKFIYATLGMTVSDILSPI-  128

Query  1226  ADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNT  1047
              D+P   +SFF +D  +++ GH+  L+ IQVTEL D VF+GC+MNH + DGTSFWNF+N 
Sbjct  129   -DVPPIVQSFFDHDKAVNHDGHTTSLVTIQVTELVDGVFIGCSMNHIIADGTSFWNFWNM  187

Query  1046  YAEICKGAK----KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFT  885
             ++EI +       +ISR P F R        +L  P   P       E   +RE++FHF+
Sbjct  188   WSEIFRAKDNNDLQISRPPIFKRWFPEGHGPILSLPYRHPNEFIGSFEAPKLRERVFHFS  247

Query  884   REAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSV  705
              E++ K+K  AN                        L+     S+ISS QSLSA +WRS+
Sbjct  248   AESLAKLKASAN------------------------LEYN--TSKISSLQSLSALVWRSI  281

Query  704   TRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEM  525
             TR R L   + T+ R++ N R RL+P +   YFGNA+  I     AGELL HDL WAA  
Sbjct  282   TRVRNLPPDQVTSCRISANNRARLDPPISENYFGNAVYIIRGFTTAGELLQHDLGWAAWK  341

Query  524   LHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLA  348
             LH  VV H+D ++R  +  W  +P ++ L   FD   + MGSSPRF  Y N+FG G+ LA
Sbjct  342   LHEAVVNHNDKSIRGLLDAWLKSPCVYQLRTLFDPHSVIMGSSPRFNKYGNEFGMGKALA  401

Query  347   VRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             +RSG ANKFDG +  +PG EG GS+DLE+ L+PETM  LE+D E+M+
Sbjct  402   LRSGYANKFDGCVYCYPGHEGGGSIDLEMSLSPETMRALESDEEFME  448



>ref|XP_011029557.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Populus 
euphratica]
Length=460

 Score =   289 bits (740),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 186/453 (41%), Positives = 260/453 (57%), Gaps = 66/453 (15%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal-------isllklslskalAHFPALAGRLHTDAKGH-  1314
             MLS QYIQKG+L ++PP             +  LK SLS  L HF  LAGRL T    + 
Sbjct  36    MLSVQYIQKGLLFAKPPKTENQQGFKIMDFLEDLKQSLSLTLVHFYPLAGRLATSKSENP  95

Query  1313  ----VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 V++  +N  G  F +A      +  L P++  +P   +SFF +D  L++ GH+K L
Sbjct  96    PSYVVFVDCNNSPGARFTYATVDLTKSDVLSPTY--VPLVVQSFFDHDRALNHDGHTKSL  153

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             + IQVTEL+D +F+GC++NH++VDG+SFW+FFN ++EI +G          G D   + P
Sbjct  154   LTIQVTELTDGIFIGCSINHSIVDGSSFWHFFNMWSEIFQGK---------GDDVSISRP  204

Query  968   AVLK--FPAG-GPAAT--FSGDEP---------IREKIFHFTREAILKMKFRANNGKLCN  831
              VL   FP G GP  T  F+  +          ++E++FHF+ E+I + K +AN      
Sbjct  205   PVLNRWFPDGHGPVLTLPFTHHDQFLSPFEAPLLKERMFHFSSESIARPKAKAN------  258

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
                 ++N                  ++ISSFQSLSA +WR +TRAR L   + T  RMAI
Sbjct  259   ---AEIN-----------------TNKISSFQSLSALVWRCITRARNLPHDQVTCCRMAI  298

Query  650   NCRHRLEPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
             N R RL P L P YFGN+IQ++   V+ AGELL  +L WAA  LH+ VV+H D   R  +
Sbjct  299   NNRSRLNPPLSPDYFGNSIQALKAGVSTAGELLEQNLGWAAWQLHQAVVSHSDEKAREFL  358

Query  473   QDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFP  297
               W  +  ++ +G  FD   + MGSSPRF  Y N+FG G+ LA+RSG A+KF GK SA+P
Sbjct  359   SLWLKSRFIYQIGKLFDPHSVMMGSSPRFNKYGNEFGLGKALALRSGYAHKFSGKASAYP  418

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             G EG GS++LE+ L+P+ M  LE+D E+M  VS
Sbjct  419   GHEGGGSIELEICLSPDEMTALESDKEFMGVVS  451



>ref|XP_004291090.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 199/487 (41%), Positives = 276/487 (57%), Gaps = 54/487 (11%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPld------  1413
             M S ++  IS+C + P   S  SK        DL MLS  YIQKG+L ++PP        
Sbjct  1     MDSPNVKYISECFIQPHSASEESKKPFYLAPFDLAMLSAHYIQKGLLFTKPPEANNNPNF  60

Query  1412  aaalisllklslskalAHFPALAGRLHT--DAKGHVYIL----SNDEGIEFVhakaphls  1251
                L++ LK SLS AL HF  LAGRL T  +   H+Y++    SN  G +F+HA      
Sbjct  61    LQTLLAKLKHSLSLALVHFYPLAGRLVTKKEQDPHLYLVYVDCSNSPGAKFIHASLDMSI  120

Query  1250  aaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGT  1071
             +  L P+  D+P   +SFF +D  +++ GH+  L+ +QVTEL D VF+G +MNHA+ DGT
Sbjct  121   SHILSPT--DVPLVVQSFFDHDRAVNHDGHTTSLLTVQVTELVDGVFIGMSMNHALGDGT  178

Query  1070  SFWNFFNTYAEICKGAK------KISRVPDFGRDTVFNSPAVLKFPAGGP---AATFSGD  918
             S+W+FFNT++EI +  +      +ISR P   R   +    +   P   P      F   
Sbjct  179   SYWHFFNTWSEIFRAEENNITLSEISRPPVLERWFPYGLGPIFSLPYTNPDEFIERFEAP  238

Query  917   EPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSF  738
             E +RE+IFHF+ E+I K+K +AN+   C                          S+ISSF
Sbjct  239   E-LRERIFHFSSESIAKIKSKANSE--CR------------------------TSKISSF  271

Query  737   QSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTV-AKAGE  561
             Q+LSA LWRS+TRAR    ++ T+ R+A N R R+ P L P YFGN+I  + +   KAGE
Sbjct  272   QALSALLWRSLTRARGFAPNQETSCRLAANNRARINPPLSPNYFGNSIHPVKSQPVKAGE  331

Query  560   LLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGSSPRFPM  384
             LL + L WAA  LH  VV H+D  +R+ I  W  +P ++ L   FD   I MGS PRF M
Sbjct  332   LLENGLGWAAWKLHETVVNHNDKWIRQSIDAWLKSPAVYQLSRTFDPHSIMMGSGPRFDM  391

Query  383   YDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQY  204
             Y N+FG G+ +A+RSG ANKF GK++++ GRE  GS+DLEV L P  M  LE+D+E+M+ 
Sbjct  392   YGNEFGMGKAVALRSGYANKFIGKVTSYSGREA-GSIDLEVCLPPAAMRALESDVEFMEA  450

Query  203   VS*IQFD  183
              S   +D
Sbjct  451   ASVPSYD  457



>ref|XP_007136696.1| hypothetical protein PHAVU_009G066100g [Phaseolus vulgaris]
 gb|ESW08690.1| hypothetical protein PHAVU_009G066100g [Phaseolus vulgaris]
Length=459

 Score =   289 bits (739),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 185/447 (41%), Positives = 254/447 (57%), Gaps = 53/447 (12%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal------isllklslskalAHFPALAGRLHTDAKGH--  1314
             MLS  YIQKG+L  +P             +  LK SLS  L+HF  L+GRL T       
Sbjct  37    MLSAHYIQKGLLYKKPEPLVNQHDFIENLLEKLKHSLSLTLSHFYPLSGRLVTHKTKDPP  96

Query  1313  ---VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
                V++  +N+ G++F+HA      +  L P   D+P   +S F +D  L++ GH+ PL+
Sbjct  97    FYAVFVDCTNNSGVKFIHATLDMTISDILSPL--DVPPIVQSLFDHDRALNHDGHTMPLL  154

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPD---------FG  993
             +IQVTEL D VF+GC+MNH + DGTS+WNFFNT++EI +       VP          F 
Sbjct  155   SIQVTELLDGVFLGCSMNHCIGDGTSYWNFFNTWSEIFQAQGHEHDVPISHPPIHNRWFP  214

Query  992   RDTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKL  813
              D V   P  L F       +      +RE+IFHF+ E+I K+K +AN+   CN      
Sbjct  215   NDCV--PPINLPFKHHEEFISRYEAPLMRERIFHFSAESIAKLKAKANSE--CN------  264

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                ++ISSFQSLSA +WR +TRAR+L   + T+ +++ N R R+
Sbjct  265   ------------------TTKISSFQSLSALVWRCITRARRLGPDQKTSCKLSTNNRRRM  306

Query  632   EPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENN  456
             EP L   YFGN+I ++    A++GELL + L WAA  LH  VV H+D  V   +++W   
Sbjct  307   EPPLAEEYFGNSIHTLGAGTARSGELLGNGLGWAAWKLHLAVVNHNDRVVLGWVREWLEC  366

Query  455   PRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNG  279
             P ++ LG  FD   + MGSSPRF MY N+FG G+ LAVRSG ANKFDGK++++PG EG G
Sbjct  367   PLIYQLGRYFDPYCVMMGSSPRFNMYGNEFGMGKALAVRSGYANKFDGKVTSYPGHEGGG  426

Query  278   SVDLEVVLAPETMAGLENDMEYMQYVS  198
             SVDLEV L+P  M  LE+D E+M   S
Sbjct  427   SVDLEVCLSPLVMTALESDQEFMDSAS  453



>ref|XP_010110810.1| putative acetyltransferase [Morus notabilis]
 gb|EXC28182.1| putative acetyltransferase [Morus notabilis]
Length=454

 Score =   288 bits (738),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 193/466 (41%), Positives = 263/466 (56%), Gaps = 47/466 (10%)
 Frame = -3

Query  1547  ISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaa-----alisllk  1386
             IS+C + P Y   +S++       DL MLS  YIQKG+L ++P  +       +L+  LK
Sbjct  10    ISECFIKPHYTPEDSENPLYLTPWDLAMLSVHYIQKGLLFAKPHTNKDENFMGSLLDRLK  69

Query  1385  lslskalAHFPALAGRLHTDAKGH-----VYILSND-EGIEFVhakaphlsaaallpshA  1224
              SLS AL HF  LAGRL T    +     V++  ND  G +F++A      +  L P   
Sbjct  70    QSLSVALVHFYPLAGRLKTVKTENPHSYSVHVDCNDGPGAKFIYATLDMTVSDILSPV--  127

Query  1223  DIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTY  1044
             D+P   + FF +D  +++ GH+  L+ IQVTEL D VF+GC+MNH + DG SFWNF+N +
Sbjct  128   DVPPIVQLFFDHDRAVNHDGHTTSLVTIQVTELVDGVFIGCSMNHVIADGASFWNFWNMW  187

Query  1043  AEICKGA----KKISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTR  882
             +EI +      K+ISR P F R        +L  P   P       E   +RE++FHF+ 
Sbjct  188   SEIFRAKDNKNKQISRPPIFKRWFPEGHGPILSLPYKHPDEFIGRFEAPKLRERVFHFSV  247

Query  881   EAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVT  702
             E+I K+K RAN          + N +                 +ISSFQSLSA +WRS+ 
Sbjct  248   ESIAKLKARAN---------LEYNTR-----------------KISSFQSLSALVWRSII  281

Query  701   RARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEML  522
             R R L   + T+ R+A N R RL+P +   YFGN I  I     AGELL +DL WAA  L
Sbjct  282   RVRNLPPDQVTSCRLAANNRARLDPPISENYFGNVIYPIRGFTTAGELLQNDLGWAAWKL  341

Query  521   HRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAV  345
             H  VV H+D ++R  +  W  +P ++ +G  FD   + MGSSPRF  Y N+FG GR LA+
Sbjct  342   HEAVVNHNDKSIRGLLDAWLRSPTVYQIGKLFDPYSVMMGSSPRFDKYGNEFGMGRALAL  401

Query  344   RSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             RSG A+KFDGK+S +PG EG GS+DLE  L PETM  LE+D E+M+
Sbjct  402   RSGYAHKFDGKVSCYPGHEGGGSIDLETCLPPETMRALESDKEFME  447



>ref|XP_008452572.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=462

 Score =   288 bits (737),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 188/439 (43%), Positives = 252/439 (57%), Gaps = 47/439 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPlda-------aalisllklslskalAHFPALAGRLHT-----D  1326
             MLS QYIQKG+L S+PP            L+  LK SLS AL HF  LAGRL T     +
Sbjct  40    MLSVQYIQKGLLYSKPPAALNDEGQFIEDLLKKLKHSLSIALVHFYPLAGRLATISYQDE  99

Query  1325  AKGHVYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 VY+  +N  G +F+HA+     +  L P+  D+P   + FF +D   ++ GHS  L
Sbjct  100   GSCLVYVDCNNSPGAKFIHARLNMTISDILSPT--DVPVIVQYFFDHDRAANHDGHSTSL  157

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK---ISRVPDFGRDTVF  978
             ++IQVTEL D VF+GC++NH++VDG+S+W+F N ++EI +   +   ISR P   R    
Sbjct  158   LSIQVTELLDGVFIGCSINHSLVDGSSYWHFLNMWSEIFQAEDENYSISRPPILQRWFPD  217

Query  977   NSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGK  804
                 +LK P   P    +  E   +RE++FHFT  ++  +K RAN     N         
Sbjct  218   GHGPILKLPFTNPDQFITKFEAPQLRERMFHFTSASLAVLKARANTEYKTN---------  268

Query  803   ITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPR  624
                              +ISSFQSLSA +WRS+TRAR L   +TT+ R+A+N R RL P 
Sbjct  269   -----------------KISSFQSLSALVWRSITRARGLSPDQTTSCRLAVNNRLRLNPP  311

Query  623   LKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLF  444
             L   YFGN+IQ+I  VA   ELL ++L WAA  LH  VV HDD  VR  +  W  +P ++
Sbjct  312   LPENYFGNSIQAIRGVAIVKELLENNLGWAAWKLHEAVVNHDDEKVRDHVNKWVESPFVY  371

Query  443   PLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDL  267
              +   FD   + MGSSPRF  Y N FG G+ LA+RSG A+KFDGK+S +PG EG GS+DL
Sbjct  372   HIEQLFDPLSVMMGSSPRFNKYGNVFGMGKALALRSGYAHKFDGKVSCYPGSEGGGSIDL  431

Query  266   EVVLAPETMAGLENDMEYM  210
             E+ L PE M+ LE D E+M
Sbjct  432   ELCLRPEFMSVLEADEEFM  450



>ref|XP_003603067.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73318.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=456

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 184/448 (41%), Positives = 245/448 (55%), Gaps = 67/448 (15%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal------isllklslskalAHFPALAGRLHTDAKG--H  1314
             MLS  YIQKG+L  +P             +  LK SLS  L H+  L+GRL T      H
Sbjct  36    MLSTHYIQKGLLFKKPTSSLNQQHFIENLVDKLKHSLSLTLFHYYPLSGRLVTKKSEDPH  95

Query  1313  VYIL----SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              Y +     N  G  F+HA         L P   D+P   +SFF +D  +S+ GH+  L+
Sbjct  96    SYTVFVDCKNSRGARFIHATLDITINDILSPV--DVPPIVQSFFDHDKAVSHDGHTMSLL  153

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK----ISRVPDFGRDTVF  978
              IQVTEL D VF+GC+MNH + DGT +WNFFN+++EI +        IS  P   R    
Sbjct  154   TIQVTELLDGVFIGCSMNHCIGDGTGYWNFFNSFSEIFQNDIHVLVPISHQPIHNR----  209

Query  977   NSPAVLKFPAG-GPAAT--FSGDEP---------IREKIFHFTREAILKMKFRANNGKLC  834
                    FP G GP     F   E          +RE+IFHF+ E+I+K+K +AN     
Sbjct  210   ------WFPQGYGPIINLPFKHHEEFVHRYETSILRERIFHFSAESIMKLKAKANEE---  260

Query  833   NGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMA  654
                                        +ISSFQSLSA +WRS+TRAR+L+  + TT ++A
Sbjct  261   -----------------------SNTRKISSFQSLSALVWRSITRARQLQHGQRTTCKLA  297

Query  653   INCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
              N R R+EP L   YFGN++ ++      GELL +DL WAA  +H  VV HDD  VRR +
Sbjct  298   TNNRTRMEPPLPKEYFGNSLHAVSAETTVGELLENDLGWAAWKIHLAVVNHDDKVVRRSV  357

Query  473   QDWENNPRLFPLG-NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFP  297
             ++W  +P ++     FD   + MGSSPRF MY N+FG G+ LAVRSG ANKFDGK++++P
Sbjct  358   EEWFRSPFVYRTDLFFDPYTVMMGSSPRFNMYGNEFGMGKVLAVRSGYANKFDGKVTSYP  417

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEY  213
             G+EG GS+DLEV L+PE M  LE D E+
Sbjct  418   GQEGGGSIDLEVCLSPEKMMALEADEEF  445



>ref|XP_006374905.1| transferase family protein [Populus trichocarpa]
 gb|ERP52702.1| transferase family protein [Populus trichocarpa]
Length=460

 Score =   288 bits (736),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 184/453 (41%), Positives = 258/453 (57%), Gaps = 66/453 (15%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal-------isllklslskalAHFPALAGRLHTDAKGH-  1314
             MLS  YIQKG+L ++PP             +  LK SLS  L HF  LAGRL T    + 
Sbjct  36    MLSVHYIQKGLLFAKPPKTENQQGFKIMDFLEDLKQSLSLTLVHFYPLAGRLATSKSENP  95

Query  1313  ----VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 V++  +N  G  F +A     ++  L P++  +P   +SFF +D  L++ GH+K L
Sbjct  96    PSYVVFVDCNNSPGARFTYATVDLTTSDVLSPTY--VPLVVQSFFDHDRALNHDGHTKSL  153

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             + IQVTEL D +F+GC++NH++VDG+SFW+FFN ++EI +G          G D   + P
Sbjct  154   LTIQVTELIDGIFIGCSVNHSIVDGSSFWHFFNMWSEIFQGK---------GDDVSISRP  204

Query  968   AVLK--FPAG-GPAAT--FSGDEP---------IREKIFHFTREAILKMKFRANNGKLCN  831
              VL   FP G GPA +  F+  +          ++E++FHF+ E+I ++K +AN     N
Sbjct  205   PVLNRWFPDGHGPALSLPFTHHDQFLSPFEAPLLKERMFHFSSESIARLKAKANAESNTN  264

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
                                       +ISSFQSLSA +WR +TRAR L   + T  RMAI
Sbjct  265   --------------------------KISSFQSLSALVWRCITRARNLPHDQVTCCRMAI  298

Query  650   NCRHRLEPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
             N R RL P L P YFGN+IQ++   V+  GELL  +L WAA  LH+ VV+H D   R  +
Sbjct  299   NNRSRLNPPLSPDYFGNSIQALKAGVSTVGELLEQNLGWAAWQLHQAVVSHSDEKAREFL  358

Query  473   QDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFP  297
               W  +  ++ +G  FD   + MGSSPRF  Y N+FG G+ LA+RSG A+KF GK SA+P
Sbjct  359   NLWLKSRFIYQIGKLFDPHSVMMGSSPRFNKYGNEFGLGKALALRSGYAHKFSGKASAYP  418

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             G EG GS++LE+ L+P+ M+ LE+D E+M  VS
Sbjct  419   GHEGGGSIELEICLSPDEMSALESDKEFMDVVS  451



>ref|XP_010064180.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66385.1| hypothetical protein EUGRSUZ_F00202 [Eucalyptus grandis]
Length=465

 Score =   286 bits (732),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 186/451 (41%), Positives = 253/451 (56%), Gaps = 55/451 (12%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPP----------ldaaalisllklslskalAHFPALAGRL----H  1332
             MLS  YIQKG+L   PP              + +  LK SLS AL HF  LAGR      
Sbjct  41    MLSVHYIQKGLLFPLPPRCLKAGFDRPAFIHSFLEKLKRSLSSALFHFYPLAGRFATLKQ  100

Query  1331  TDAKGHVYIL--SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHS  1158
             TD   +   +  +N  G  F+HA      A  L P++  +P   +SFF +D  + + GH+
Sbjct  101   TDPPFYTVFVDCANSPGARFIHATLDMTVADILSPTY--VPDVVQSFFDHDRAIDHDGHT  158

Query  1157  KPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPD  999
               L+++QVTEL+D VF+G +MNHA+ DGTSFW FFN+++EI +  +K       +SR P 
Sbjct  159   LSLLSVQVTELADGVFIGLSMNHAIADGTSFWLFFNSWSEIFQAQEKGAVDVVQLSRPPV  218

Query  998   FGRDTVFNSPAVLKFPAGGPAATFSG--DEP-IREKIFHFTREAILKMKFRANNGKLCNG  828
               R    N P  L  P     ++F    + P +RE++FHF+ +AI ++K  AN  + C  
Sbjct  219   LTRWFPENHPGPLSLPYTDDPSSFLARFESPELRERVFHFSADAIAELKAEAN--RQCGT  276

Query  827   ENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAIN  648
              N                        ISSFQSL+A +WR +TRAR    ++ T  RMA N
Sbjct  277   TN------------------------ISSFQSLTALIWRCITRARHFPPNQVTGCRMAAN  312

Query  647   CRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQD  468
              R RL+P+L P YFGN+I  + TVA  GELL   L WAA++LH  V  H +A +R   +D
Sbjct  313   NRARLDPQLSPEYFGNSINFLRTVATVGELLGSGLGWAAQLLHAAVAGHSNAKLREWNED  372

Query  467   WENNPRLF-PLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGR  291
             W   P+++ P   FD   + MGSSPRF  Y ++FG G+ +A+RSG ANK+DGK S +PGR
Sbjct  373   WIKRPQVYNPDKTFDRYSVMMGSSPRFDKYGSEFGLGKAVALRSGYANKWDGKASGYPGR  432

Query  290   EGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             EG GSVDLE+ L P TMA LE D E+M  V+
Sbjct  433   EGGGSVDLEICLPPVTMALLEADPEFMAAVT  463



>ref|XP_010677339.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Beta 
vulgaris subsp. vulgaris]
Length=452

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 177/442 (40%), Positives = 247/442 (56%), Gaps = 45/442 (10%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQP------PldaaalisllklslskalAHFPALAGRLHT--DAKGH  1314
             MLS  YIQKG+L ++P      P      +  LK SLS  L HF  LAG+L T  D   H
Sbjct  37    MLSVHYIQKGLLFTKPSILNDQPFSIHTFLKNLKDSLSLTLVHFYPLAGQLATQIDEDQH  96

Query  1313  ---VYILSND-EGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
                V++  N   G  F+HA      +  L P+  D+P   +SFF +D ++++ GH K L+
Sbjct  97    KCLVFVDCNKGPGARFIHATLDMTISDLLSPT--DVPLVVQSFFDHDKSVNHDGHFKSLL  154

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK----ISRVPDFGRDTVF  978
              IQVTEL D +F+GC+MNHA+ DGTSFW+F+N ++ I  G +      SR+P   R    
Sbjct  155   TIQVTELLDGIFIGCSMNHALGDGTSFWHFWNIWSMIHLGIRDEVVPSSRIPIHNRWFPE  214

Query  977   NSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGK  804
                +V   P   P    S  E   +RE+IFHF+ E++ ++K RAN               
Sbjct  215   GHGSVFLLPFTEPNEFISRYEAPQLRERIFHFSSESMARLKARAN---------------  259

Query  803   ITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPR  624
                       ++    ++ISSFQ+LSA  WR++ R  +L   ++T  R+A N R RL+P 
Sbjct  260   ----------EDINTTNKISSFQALSALCWRAIVRTNRLSNDQSTACRLAANNRQRLDPP  309

Query  623   LKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLF  444
             L   YFGN I ++ T    GELL H+L WAA +LH  VV H D  VR  + +W  +P ++
Sbjct  310   LPQAYFGNCITALKTTTTVGELLDHNLGWAASLLHHTVVNHSDKVVRGFVDEWLKSPFIY  369

Query  443   PLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLE  264
              L       + MGSSPRF MY N+FG G+ +A+RSG ANKF GK++++ G EG GSVDLE
Sbjct  370   HLDKLFDCSVMMGSSPRFDMYGNEFGIGKAVALRSGYANKFVGKVTSYEGCEGGGSVDLE  429

Query  263   VVLAPETMAGLENDMEYMQYVS  198
             + L P+ M  LE+D E+M  VS
Sbjct  430   ICLPPDFMKALESDEEFMNAVS  451



>ref|XP_010677650.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Beta 
vulgaris subsp. vulgaris]
Length=466

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 178/443 (40%), Positives = 246/443 (56%), Gaps = 44/443 (10%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQP------PldaaalisllklslskalAHFPALAGRLHT--DAKGH  1314
             MLS  YIQKG+L  +P      P      +  LK SLS  L HF  LAG+L T  D   H
Sbjct  38    MLSVHYIQKGLLFIKPSHLNDQPFSIHKFLLDLKDSLSLTLIHFYPLAGQLATQVDEDQH  97

Query  1313  VYILSND----EGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              Y++  D     G  F+HA      +  L P+  D+P   +SFF +D  +++ GHS  L+
Sbjct  98    KYLVFVDCNKGPGARFIHATLDMTISDLLSPT--DVPLVVQSFFDHDKNVNHDGHSMSLL  155

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK----ISRVPDFGR--DT  984
              I VTEL D VF+GC+MNHA+ DGTS+W F+  ++EI +   +    +SRVP   R    
Sbjct  156   TILVTELLDGVFIGCSMNHALADGTSYWLFWKMWSEIHRAKHEELVPVSRVPIHKRWFPD  215

Query  983   VFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGK  804
               +SP +L F       +      +RE+IFHF+ E++ ++K +AN    CN +       
Sbjct  216   CCDSPVLLPFAKPDEFVSRYKAPQLRERIFHFSSESMARLKEKANEE--CNTD-------  266

Query  803   ITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPR  624
                              +ISSFQ+LSA  WR++ RA  L   + T  R+A N RHRL+P 
Sbjct  267   --------------TTHKISSFQALSALCWRAIVRANSLSYDQMTNCRLAANNRHRLDPP  312

Query  623   LKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLF  444
             L   YFGN I ++    K GELL H+L WAA +L+  VV H+D  VR  I +W   P ++
Sbjct  313   LPKEYFGNCISTLKATTKVGELLDHNLGWAASLLNHTVVNHNDKVVRDFINEWLKVPLIY  372

Query  443   PLG-NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDL  267
              L  +FD + + MGSSPRF MY N+FG G+ +A+RSG ANK  GK +++ G EG G+VDL
Sbjct  373   QLDKSFDSSSVMMGSSPRFDMYGNEFGLGKAVAIRSGYANKVAGKATSYEGYEGGGTVDL  432

Query  266   EVVLAPETMAGLENDMEYMQYVS  198
             E+ L PE    LE+D E+M  VS
Sbjct  433   EICLPPEAWKALESDEEFMDSVS  455



>ref|XP_010059907.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66382.1| hypothetical protein EUGRSUZ_F00198 [Eucalyptus grandis]
Length=462

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 198/485 (41%), Positives = 268/485 (55%), Gaps = 56/485 (12%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYP-EYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP---------  1419
             P  S+  IS C V P +     ++ L L   DL MLS  YIQKG+L   PP         
Sbjct  4     PPRSVRFISDCFVKPPQLPDGWNRPLHLPPWDLAMLSAHYIQKGLLFPLPPRCLDPGFDR  63

Query  1418  -ldaaalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakap  1260
                  + +  LK SLS AL HF  LAGRL T  +       V++  +N  G  F+HA   
Sbjct  64    PAFIRSFLEKLKRSLSSALFHFYPLAGRLATLKRTDPPFYTVFVDCANSPGARFIHAALD  123

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
               +A  L P++  +P   +SFF +D  +++ GH+  L+++QVTEL+D VF+G +MNH + 
Sbjct  124   MTAADILSPAY--VPDVVQSFFDHDRAINHDGHTLSLLSVQVTELADGVFIGLSMNHTIG  181

Query  1079  DGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSG  921
             DGTSFW FFN++++I +  +K       +SR P   R    N P  L  P     ++F  
Sbjct  182   DGTSFWLFFNSWSKIFQAQEKGAVDVVPLSRPPALTRWFPENLPGPLSLPYTDDPSSFLA  241

Query  920   --DEP-IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASE  750
               + P +RE++FHF+ +AI  +K  AN  + C   N                        
Sbjct  242   RFEAPELRERVFHFSADAIAGLKAEAN--RQCGTTN------------------------  275

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAK  570
             ISSFQSL+A +WR + RAR+   S+ T  RMA N R RL+P L P YFGN+I  + T AK
Sbjct  276   ISSFQSLTALVWRCIARARRFPPSQVTGCRMAANNRARLDPPLSPEYFGNSITPVRTAAK  335

Query  569   AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGSSPR  393
              GELL   L WAA +LH  V  H  A +R   +DW   P+++ L   FD   I MGSSPR
Sbjct  336   VGELLGSGLGWAARLLHTAVAEHSSAKLREWNEDWIKRPQVYHLDKTFDQYSIMMGSSPR  395

Query  392   FPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEY  213
             F  Y N+FG G+ +A+RSG ANKFDGK+SA+PG EG GS+DLE+ L P TMA LE D E+
Sbjct  396   FDKYGNEFGLGKAVALRSGYANKFDGKVSAYPGHEGGGSIDLEICLPPTTMALLEVDPEF  455

Query  212   MQYVS  198
             M  V+
Sbjct  456   MAAVT  460



>ref|XP_010677336.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Beta 
vulgaris subsp. vulgaris]
Length=460

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 187/485 (39%), Positives = 264/485 (54%), Gaps = 67/485 (14%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaaal----  1401
             S+++  IS+C + P+Y+   +K        DL MLS  YIQKG+L ++P           
Sbjct  5     STTVTHISECFIKPKYEVKEAKQPYYLSPMDLAMLSAHYIQKGLLFTKPSNLDNQQFSIH  64

Query  1400  --isllklslskalAHFPALAGRL--HTDAKGHVYILSND----EGIEFVhakaphlsaa  1245
               +  LK SLS  L HF  LAG+L    D   H  ++  D     G  F+HA      + 
Sbjct  65    KFLQNLKDSLSLTLVHFYPLAGQLASEVDKDQHKCLIFVDCNKGPGARFIHATLGMTISN  124

Query  1244  allpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSF  1065
              L P+  D+P   +SFF ++  +++ GH K L+ IQVTEL D +F+ C+MNH++ DGTS+
Sbjct  125   ILSPT--DVPLVVQSFFDHEKNVNHDGHFKSLLTIQVTELLDGIFIACSMNHSLGDGTSY  182

Query  1064  WNFFNTYAEI----CKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAATFSGDEP----  912
             WNF+N +++I    C      SR+P   R           FP G GP       EP    
Sbjct  183   WNFWNIWSKIHLGLCDEGVPSSRIPFHKR----------WFPEGYGPPFLLPFTEPDEFI  232

Query  911   -------IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS  753
                    +RE+IFHF+ E+I ++K +AN              ++  +N            
Sbjct  233   SRFTAPQLRERIFHFSSESIARLKAKAN-------------AELNTIN------------  267

Query  752   EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA  573
             EISSFQ+LSA  WR++ RA  L   + T  R+A N RHRL P L   YFGN I ++ T  
Sbjct  268   EISSFQALSALCWRAIVRANCLSFERFTNCRLAANNRHRLNPPLLHEYFGNCISALETTT  327

Query  572   KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSP  396
               GELL H+L WAA +LH+ V+ H+D  +R+ I  W  +P +F L   FD   + MGSSP
Sbjct  328   TVGELLDHNLGWAASLLHQTVINHNDKVLRKFISGWLKSPIVFQLDKVFDCYSVMMGSSP  387

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RF MY N+FG G+ +A+RSG ANKF GK++++ G EG GSVDLE+ L P++M  LE+D E
Sbjct  388   RFDMYGNEFGLGKAVALRSGYANKFVGKVTSYEGYEGGGSVDLEICLPPDSMKALESDEE  447

Query  215   YMQYV  201
             +M  V
Sbjct  448   FMNAV  452



>ref|XP_007136697.1| hypothetical protein PHAVU_009G066200g [Phaseolus vulgaris]
 gb|ESW08691.1| hypothetical protein PHAVU_009G066200g [Phaseolus vulgaris]
Length=461

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 181/444 (41%), Positives = 249/444 (56%), Gaps = 48/444 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPlda------aalisllklslskalAHFPALAGRLHTD---AKG  1317
             MLS  YIQKG+L  +P            L+  LK SLS  L HF  LAG L T+   +  
Sbjct  36    MLSMHYIQKGLLFRKPATLVDRQDFIENLLKKLKHSLSLTLFHFYPLAGHLVTNKGPSSC  95

Query  1316  HVYILSND-EGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAI  1140
              +++  N+ +G  F++A         L P   D+P    SFF +   +++ GH+ PL++I
Sbjct  96    TIFVDGNNKDGARFIYATLDLTIFDILSPV--DVPPIVHSFFDHHKAVNHDGHTMPLLSI  153

Query  1139  QVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRDTV  981
             +VTEL D VF+GC+MNHA+ DGTS+WNFFNT++EI     +       ISR P   R   
Sbjct  154   KVTELLDGVFIGCSMNHAIGDGTSYWNFFNTWSEIFLAQAQGHEYGVSISRHPIHNRWFP  213

Query  980   FNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNG  807
                  ++  P        S  E   +RE+IFHF+ E+I K+K RAN+             
Sbjct  214   DGCGPLINLPFKHHDEFISRFEAPKMRERIFHFSAESIAKLKARANSDS-----------  262

Query  806   KITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEP  627
                              ++ISSFQSLSA +WR +TRAR L   + T+ ++AIN R R+EP
Sbjct  263   ---------------KTTKISSFQSLSAHVWRCITRARHLPHDEITSCKLAINNRARMEP  307

Query  626   RLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRL  447
              L   YFGN I  +     AGELL +DL WAA  +H  V   +D  VR  +++W   P +
Sbjct  308   PLPYEYFGNLIGVVSAGTTAGELLENDLGWAAWKVHLAVANQNDRVVRDAVKEWLQRPVV  367

Query  446   FPLG-NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVD  270
             + LG +FD   +TM SSPRF MY N+FG GR +AV SG ANKFDG ++++PG EG GS+D
Sbjct  368   YQLGVHFDSCSVTMSSSPRFDMYGNEFGMGRAVAVLSGYANKFDGSVTSYPGSEGGGSID  427

Query  269   LEVVLAPETMAGLENDMEYMQYVS  198
             LE+ L+P+ M  LE+D E+MQ VS
Sbjct  428   LELSLSPKAMTLLESDEEFMQAVS  451



>ref|XP_010059906.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280-like [Eucalyptus grandis]
Length=463

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 199/486 (41%), Positives = 266/486 (55%), Gaps = 58/486 (12%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYP-EYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP---------  1419
             P  S+  IS C V P +     ++ L L   DL MLS  YIQKG+L   PP         
Sbjct  5     PPRSVRFISDCFVKPPQLPDGWNRPLHLPPWDLAMLSVHYIQKGLLFPLPPRCLDPGFDR  64

Query  1418  -ldaaalisllklslskalAHFPALAGRL----HTDAKGHVYIL--SNDEGIEFVhakap  1260
                  + +  LK SLS AL HF  LAGRL     TD   +   +  +N  G  F+HA   
Sbjct  65    PAFIRSFLEKLKRSLSSALFHFYPLAGRLATLKRTDPPFYTVFVDCANSPGARFIHAALD  124

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
                A  L P++  +P   +SFF +D  +++ GH+  L+++QVTEL+D VF+G +MNH + 
Sbjct  125   XTVADILSPTY--VPDVVQSFFDHDRAINHDGHTLSLLSVQVTELADGVFIGLSMNHTIG  182

Query  1079  DGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRDTVFNSPAVLKFP-AGGPA---A  933
             DGTSFW FFN++++I +  +K       +SR P   R    N P  L  P    P+   A
Sbjct  183   DGTSFWLFFNSWSKIFQAQEKGAVDVVPLSRPPALTRWFPENHPGPLSLPYTDDPSSLLA  242

Query  932   TFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS  753
              F   E +RE++FHF+ +AI  +K  AN  + C                          +
Sbjct  243   RFEAPE-LRERVFHFSADAIAGLKAEAN--RQC------------------------GTT  275

Query  752   EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA  573
              ISSFQSL+A +WR + RAR+   S+ T  RMA N R RL+P L P YFGN+I  + T A
Sbjct  276   SISSFQSLTALVWRCIARARRFPPSQVTGCRMAANNRARLDPPLSPEYFGNSITPVRTAA  335

Query  572   KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGSSP  396
             K GELL   L WAA +LH  V  H  A +R   +DW   P+++ L   FD   I MGSSP
Sbjct  336   KVGELLGSGLGWAARLLHTAVAEHSSAKLREWNEDWIKRPQVYHLDKTFDQYSIMMGSSP  395

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
             RF  Y N+FG G+ +A+RSG ANKFDGK+SA+PG EG GS+DLE+ L P TMA LE D E
Sbjct  396   RFDKYGNEFGLGKAVALRSGYANKFDGKVSAYPGHEGGGSIDLEICLPPTTMALLEADPE  455

Query  215   YMQYVS  198
             +M  V+
Sbjct  456   FMAAVT  461



>ref|XP_007224078.1| hypothetical protein PRUPE_ppa015472mg [Prunus persica]
 gb|EMJ25277.1| hypothetical protein PRUPE_ppa015472mg [Prunus persica]
Length=465

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 198/490 (40%), Positives = 272/490 (56%), Gaps = 61/490 (12%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaa----  1407
             M S S+  IS+C V P++ S  SK       +DLPMLS  YIQKG+L ++PP        
Sbjct  1     MSSQSVKHISECFVQPQHASDESKQPLYLAPTDLPMLSAHYIQKGLLFAKPPEAMNDHKK  60

Query  1406  -----alisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakap  1260
                  AL+  LK SLS AL HF  LAGRL T  + +     VYI  +N  G +F++A   
Sbjct  61    ADFINALLEKLKHSLSLALVHFYPLAGRLATKKEENPPLYLVYIDCNNSPGAKFIYATVD  120

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
                +  L P+  D+P   +SFF +D  +++ GH+  L+  QVTEL D +F+G +MNH + 
Sbjct  121   LSISDILSPT--DVPLVVQSFFDHDRAVNHDGHTMSLLTAQVTELVDGIFIGLSMNHCLA  178

Query  1079  DGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSGDEP-  912
             DGTS+W+FFNT++EI +   +     +       + P VLK  FP G  P  +     P 
Sbjct  179   DGTSYWHFFNTWSEIFQAQTQTHASQNNNIIPYISRPPVLKRWFPEGHDPIISLPYTHPD  238

Query  911   ----------IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGG  762
                       +RE++FHF+ EA+ K+K +AN                             
Sbjct  239   EFIGRFEAPKLRERMFHFSSEALAKLKAKAN--------------------------AEA  272

Query  761   AASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIP  582
               ++ISSFQSLSA LWR +TR R+L  S++T+ R+A N R RL+P L   YFGN+I  I 
Sbjct  273   KTTKISSFQSLSALLWRCITRVRRLPPSQSTSCRLAANNRARLDPPLSGDYFGNSIHPIK  332

Query  581   T-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITM  408
             + V  AGELL H L WAA  LH  VV  DD ++R  I  W  +  ++ +G  FD   + M
Sbjct  333   SEVVTAGELLEHGLGWAAWKLHEAVVNLDDKSIREFIDAWLQSRMVYQIGQFFDPHSVMM  392

Query  407   GSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             GSSP F MY N+FG G+ LA+RSG ANKF GK+S++PG E  GS+DLEV L P+ M  +E
Sbjct  393   GSSPWFNMYGNEFGMGKALALRSGYANKFSGKVSSYPGGE-RGSIDLEVCLVPDAMGAIE  451

Query  227   NDMEYMQYVS  198
              D E+M+  S
Sbjct  452   CDHEFMEAAS  461



>ref|XP_003603072.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73323.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=457

 Score =   283 bits (725),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 184/454 (41%), Positives = 249/454 (55%), Gaps = 68/454 (15%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaali-------sllklslskalAHFPALAGRLHTDAKG--  1317
             MLS  YIQKG+L  +P   +             LK SLS  L HF  L+GRL T      
Sbjct  36    MLSAYYIQKGLLFKKPTSSSLNKQHFIENLVEKLKHSLSLTLFHFHPLSGRLVTKKSEDP  95

Query  1316  HVYIL----SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
             H Y +     N  G +F+HA         L P   D+P    SFF +   +++ GH+  L
Sbjct  96    HFYTVFVDCKNSLGAKFIHATLDITINDILSPV--DVPPIVHSFFDHHRAVNHDGHTMSL  153

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK----ISRVPDFGRDTV  981
             ++IQVTEL D+VF+GC+MNH + DGT +WNFFN+++EI +        IS  P   R   
Sbjct  154   LSIQVTELLDSVFIGCSMNHCIGDGTGYWNFFNSFSEIFQNDVHVPVPISHKPIHNR---  210

Query  980   FNSPAVLKFPAG-GPAATF---SGDEPI--------REKIFHFTREAILKMKFRANNGKL  837
                     FP G GP  +      DE I        RE+IFHF+ E+I K+K +AN    
Sbjct  211   -------WFPEGYGPIISLPFKHHDEFIHRYETPILRERIFHFSAESIAKLKAKANKESD  263

Query  836   CNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRM  657
              N                          +ISSFQSLSA +WRS+TRAR+L+  + TT ++
Sbjct  264   TN--------------------------KISSFQSLSALVWRSLTRARQLQQGQRTTCKL  297

Query  656   AINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRG  477
             A+N R R+EP L   YFGN+I ++      GELL +DL WAA  +H  +  +DD  VR  
Sbjct  298   AVNNRTRMEPPLPKEYFGNSIYAVRAETTVGELLENDLGWAAWKIHLAIANYDDKVVRNS  357

Query  476   IQDWENNPRLFPLG-NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAF  300
             +++W  +P ++ +   FD   + MGSSPRF MY N+FG G+ LAVRSG ANKFDGK++++
Sbjct  358   VEEWLRSPFVYRMDLFFDPYTVMMGSSPRFNMYGNEFGMGKALAVRSGYANKFDGKVTSY  417

Query  299   PGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             PG+EG GS+DLEV L+PE M  LE D E+M   S
Sbjct  418   PGQEGGGSIDLEVCLSPEKMMVLETDQEFMNSAS  451



>gb|ACU20865.1| unknown [Glycine max]
Length=459

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 180/451 (40%), Positives = 253/451 (56%), Gaps = 60/451 (13%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal------isllklslskalAHFPALAGRL--HT--DAK  1320
             +LS  YIQKG+L  +PP            +  LK SLS  L+HF  LAGRL  HT  D  
Sbjct  36    LLSYHYIQKGLLFKKPPTLVDQQNFIENLLEKLKHSLSFTLSHFYPLAGRLVTHTTQDPP  95

Query  1319  GHVYILS--NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              + + +   N +G  F++A      +  L P   D+P    SFF +   +++ GH+ PL+
Sbjct  96    SYAFFVDCKNSDGARFIYASLDMTISDILAPV--DVPPILHSFFDHHKAVNHDGHTMPLL  153

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPA  966
             +IQVTEL DAVF+GC+MNH + DGTS+WNFFNT+++I +     S+    G +   + P 
Sbjct  154   SIQVTELVDAVFIGCSMNHTLGDGTSYWNFFNTWSQIFQ-----SQAQGHGYNVPISHPP  208

Query  965   VLK--FPAG-GPAATF---SGDEPI--------REKIFHFTREAILKMKFRANNGKLCNG  828
             +L   FP+   P+        DE I        RE++FHF+ E+I K+K +AN+      
Sbjct  209   ILNRWFPSDCDPSVNLPFKHHDEFICNFEAPFLRERVFHFSAESIAKLKAKANSE-----  263

Query  827   ENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAIN  648
                                     ++ISSFQSLSA +WRS+T AR +   + T+ +MAIN
Sbjct  264   ---------------------SNTTKISSFQSLSALVWRSITLARSVPYEQKTSCKMAIN  302

Query  647   CRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQD  468
              R R+EP +   YFGN +Q +       ELL +DL WAA +LH  V  H+D  V + +Q 
Sbjct  303   NRSRMEPPMPEEYFGNLVQVVSAETTTRELLENDLGWAAWLLHVAVTNHNDKVVLQSLQG  362

Query  467   WENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGR  291
             W  +P +  +G  FD   + MGSSPRF  Y  +FG G+ +A+RSG ANKFDGK++++PGR
Sbjct  363   WLQSPFIPQIGRLFDPYSVLMGSSPRFNKYGCEFGMGKAVAIRSGYANKFDGKVTSYPGR  422

Query  290   EGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             EG GS+DLEV L P  M  LE+D E+M  VS
Sbjct  423   EGGGSIDLEVCLLPHIMRALESDKEFMNAVS  453



>gb|ABC47860.1| N-hydroxycinnamoyl/benzoyltransferase 1 [Glycine max]
Length=455

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 176/447 (39%), Positives = 252/447 (56%), Gaps = 52/447 (12%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaali-------sllklslskalAHFPALAGRLHT----DA  1323
             MLS  YIQKG+L  +PP                LK SLS  L HF  LAGRL T    D 
Sbjct  36    MLSVHYIQKGLLFKKPPTTLVDQHDFIENLLEKLKHSLSLTLFHFYPLAGRLVTQKTQDP  95

Query  1322  KGHVYIL---SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKP  1152
               +  ++   +N +G  F++A      +  + P   D+P    S F +   +++ GH+ P
Sbjct  96    PSYAVLVDCNNNSDGARFIYATLDMTISDIISPI--DVPPIVHSLFDHHKAVNHDGHTMP  153

Query  1151  LMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFG  993
             L++IQVT+L DAVF+GC+MNH + DGTS+WNFFNT++EI +   +       IS  P   
Sbjct  154   LLSIQVTQLVDAVFIGCSMNHVIGDGTSYWNFFNTWSEIFQAQAEGHEYDVPISHNPIHN  213

Query  992   R--DTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENG  819
             R    ++     L F       +      +RE+IFHF+ E+I K+K +AN  K CN    
Sbjct  214   RWFPELYGPLINLPFKNHDEFISRFESPKLRERIFHFSAESIAKLKAKAN--KECN----  267

Query  818   KLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRH  639
                                  ++ISSFQSLSA +WRS+TRAR +   + T+ ++A + R 
Sbjct  268   --------------------TTKISSFQSLSALVWRSITRARSVPQEQRTSCKLATDNRS  307

Query  638   RLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWEN  459
             R+EP L   YFGN++ ++   A   ELL + L WAA  LH  V  H+ + V   +++W  
Sbjct  308   RMEPPLPKEYFGNSLHAVSGEATTRELLENGLGWAAWKLHLAVANHNASAVLDFLKEWLE  367

Query  458   NPRLFPLGNF-DGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGN  282
             +P ++ +G F D   + MGSSPRF MY N+FG G+ +AVRSG ANKFDGK++++PG EG 
Sbjct  368   SPFIYQIGGFFDPYCVMMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGHEGG  427

Query  281   GSVDLEVVLAPETMAGLENDMEYMQYV  201
             GS+DLEV L+P+TM+ LE+D E+M  V
Sbjct  428   GSIDLEVCLSPDTMSALESDDEFMSAV  454



>ref|XP_003525889.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=456

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 176/447 (39%), Positives = 252/447 (56%), Gaps = 52/447 (12%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaali-------sllklslskalAHFPALAGRLHT----DA  1323
             MLS  YIQKG+L  +PP                LK SLS  L HF  LAGRL T    D 
Sbjct  37    MLSVHYIQKGLLFKKPPTTLVDQHDFIENLLEKLKHSLSLTLFHFYPLAGRLVTQKTQDP  96

Query  1322  KGHVYIL---SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKP  1152
               +  ++   +N +G  F++A      +  + P   D+P    S F +   +++ GH+ P
Sbjct  97    PSYAVLVDCNNNSDGARFIYATLDMTISDIISPI--DVPPIVHSLFDHHKAVNHDGHTMP  154

Query  1151  LMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFG  993
             L++IQVT+L DAVF+GC+MNH + DGTS+WNFFNT++EI +   +       IS  P   
Sbjct  155   LLSIQVTQLVDAVFIGCSMNHVIGDGTSYWNFFNTWSEIFQAQAEGHEYDVPISHNPIHN  214

Query  992   R--DTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENG  819
             R    ++     L F       +      +RE+IFHF+ E+I K+K +AN  K CN    
Sbjct  215   RWFPELYGPLINLPFKNHDEFISRFESPKLRERIFHFSAESIAKLKAKAN--KECN----  268

Query  818   KLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRH  639
                                  ++ISSFQSLSA +WRS+TRAR +   + T+ ++A + R 
Sbjct  269   --------------------TTKISSFQSLSALVWRSITRARSVPQEQRTSCKLATDNRS  308

Query  638   RLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWEN  459
             R+EP L   YFGN++ ++   A   ELL + L WAA  LH  V  H+ + V   +++W  
Sbjct  309   RMEPPLPKEYFGNSLHAVSGEATTRELLENGLGWAAWKLHLAVANHNASAVLDFLKEWLE  368

Query  458   NPRLFPLGNF-DGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGN  282
             +P ++ +G F D   + MGSSPRF MY N+FG G+ +AVRSG ANKFDGK++++PG EG 
Sbjct  369   SPFIYQIGGFFDPYCVMMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGHEGG  428

Query  281   GSVDLEVVLAPETMAGLENDMEYMQYV  201
             GS+DLEV L+P+TM+ LE+D E+M  V
Sbjct  429   GSIDLEVCLSPDTMSALESDDEFMSAV  455



>ref|XP_010059908.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66386.1| hypothetical protein EUGRSUZ_F00203 [Eucalyptus grandis]
Length=463

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 195/485 (40%), Positives = 270/485 (56%), Gaps = 56/485 (12%)
 Frame = -3

Query  1568  PSSSIVVISKCTVYP-EYkssnskslklsvsdLPMLSCQYIQKGVLLSQPP---------  1419
             P  S+ +IS C + P +    +++ L L   DL MLS  YIQKG+L   PP         
Sbjct  5     PPQSVQLISDCFIKPSQLPDGSNRPLHLPPWDLTMLSVHYIQKGLLFPLPPRCLQPGFDR  64

Query  1418  -ldaaalisllklslskalAHFPALAGRL----HTDAKGHVYIL--SNDEGIEFVhakap  1260
                  + +  LK SLS AL HF  LAGRL     TD   +   +  +N  G  F+HA   
Sbjct  65    PAFIHSFLEKLKRSLSSALFHFYPLAGRLATLKQTDPPFYTVFVDCANSPGARFIHATLG  124

Query  1259  hlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVV  1080
                A  L P++  +P   +SFF +D  +++ GH+  L+++QVTEL+D VF+G +MNHA+ 
Sbjct  125   MTVADILSPTY--VPDVVQSFFDHDRAINHDGHTLSLLSVQVTELADGVFIGLSMNHAIG  182

Query  1079  DGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSG  921
             DGTSFW FFN+++EI +  +K       +SR P   R    N P  L  P     ++F  
Sbjct  183   DGTSFWLFFNSWSEIFQAQEKGAVDVFQLSRPPVLTRWFPENHPGPLSLPYTDDPSSFLA  242

Query  920   --DEP-IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASE  750
               + P +RE++FHF+ +AI  +K  AN  + C   N                        
Sbjct  243   RYEAPELRERVFHFSADAIAGLKAEAN--RQCGTTN------------------------  276

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAK  570
             ISS+QSL+A +WR +TRAR+   ++ T  RMA + R RL+P+L P YFGN+I  + T A 
Sbjct  277   ISSWQSLTALVWRCITRARRFPPNQVTGCRMAASNRARLDPQLSPEYFGNSITPLRTAAT  336

Query  569   AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGSSPR  393
              GELL   L WAA++LH  V  H +A +R   +DW   P+++ +   FD   I MGSSPR
Sbjct  337   VGELLGSGLGWAAQLLHAAVAGHSNAKLREWNEDWIKRPQVYHMDKTFDRHSIMMGSSPR  396

Query  392   FPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEY  213
             F  Y N+FG G+ +A+RSG A KFDGK S +PGREG GSVDLE+ L P TMA LE D E+
Sbjct  397   FDKYGNEFGLGKAVALRSGYAFKFDGKASGYPGREGGGSVDLEICLPPVTMALLEADPEF  456

Query  212   MQYVS  198
             M  V+
Sbjct  457   MAAVT  461



>ref|XP_007136702.1| hypothetical protein PHAVU_009G066700g [Phaseolus vulgaris]
 gb|ESW08696.1| hypothetical protein PHAVU_009G066700g [Phaseolus vulgaris]
Length=462

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 190/476 (40%), Positives = 259/476 (54%), Gaps = 54/476 (11%)
 Frame = -3

Query  1547  ISKCTVYPE-YkssnskslklsvsdLPMLSCQYIQKGVLLSQPPldaaal------isll  1389
             IS+C V P  +   +S+   L+  D+ MLS  YIQKG+L ++P             +  L
Sbjct  8     ISECFVKPHPFNQVSSQICHLTPWDIAMLSTHYIQKGLLFNKPATLVDQQYFMENLLEKL  67

Query  1388  klslskalAHFPALAGRLHTDAKGH--VYILS----NDEGIEFVhakaphlsaaallpsh  1227
             K SLS  L HF  L+GRL T    H   Y +S    N +G  F++A      +  L P  
Sbjct  68    KHSLSLTLFHFYPLSGRLVTHKTQHPPSYTVSVDCNNSDGARFIYAALDVTISDLLSPV-  126

Query  1226  ADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNT  1047
              D P  F SFF +   L++ GH+ PL++IQVTEL D VF+GC+MNH++ DGTS+WNFFNT
Sbjct  127   -DTPSVFHSFFDHHKALNHDGHTMPLLSIQVTELVDGVFIGCSMNHSLGDGTSYWNFFNT  185

Query  1046  YAEICKGAKK---------ISRVPDFGRDTVFNS--PAVLKFPAGGPAATFSGDEPI-RE  903
             +++I +   +         IS  P   R    N   P  L F           + P+ RE
Sbjct  186   WSQIFQAQSQAESHEYDVPISHQPLHNRWFPNNCSPPISLPFKHHDEFIGRPEETPLPRE  245

Query  902   KIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSA  723
             +IFHF+ E+I  +K +AN+                              + ISSFQSLSA
Sbjct  246   RIFHFSAESIAALKAKANSE--------------------------SNTTRISSFQSLSA  279

Query  722   QLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDL  543
              +WRS+TRAR   + + T  R+A N R R+EP L   YFGN I ++      GELL + L
Sbjct  280   LVWRSITRARSPPSDQITICRLAANNRSRMEPPLPEEYFGNCIHAVSAETTTGELLENGL  339

Query  542   SWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF-DGAMITMGSSPRFPMYDNDFG  366
              WAA  LH+ V   +D  V   ++ W  +P +  +G F D   + MGSSPRF MY ++FG
Sbjct  340   GWAAWKLHKAVTNLNDRVVLEFLEGWLESPLIVQMGRFFDPYSVLMGSSPRFNMYGSEFG  399

Query  365   WGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              G+ +A RSG ANKFDGK+S++PGREG GS+DLEV L P TM+ LE+D E+M  VS
Sbjct  400   MGKAVAARSGYANKFDGKVSSYPGREGGGSIDLEVCLLPHTMSALESDKEFMNAVS  455



>emb|CDP11972.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   281 bits (719),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 185/485 (38%), Positives = 259/485 (53%), Gaps = 63/485 (13%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSC-QYIQKGVLLSQPPl-----da  1410
             M S  I  IS+C + P+     +K           + C  YIQKG+L ++PP        
Sbjct  1     MSSPGIHHISQCFIKPKNTPEEAKQPIYLSQWDLAMVCVNYIQKGLLFAKPPAFDRENQM  60

Query  1409  aalisllklslskalAHFPALAGRLHTDAKGHVYILS------NDEGIEFVhakaphlsa  1248
               L+  LK SL+ AL HF  LAGRL T  + +  I S      N  G   VHA       
Sbjct  61    EDLLEKLKDSLALALDHFYPLAGRLATLKQENPAIYSIYVDCNNSPGASLVHASLNSTID  120

Query  1247  aallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTS  1068
               L P   D+P   +SFF +D  +++ GH++PL+ IQVTEL+D +F+GC++NH +VDGT+
Sbjct  121   DILSPI--DVPEIVQSFFDHDRAINHDGHTRPLLTIQVTELTDGIFIGCSINHMIVDGTA  178

Query  1067  FWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATF----------  927
             FW+FFNT++EI             G+ T  + P + K  FP G GP  +           
Sbjct  179   FWHFFNTWSEIFSAK---------GQKTAISRPPIHKHWFPEGHGPILSLPFTHHDQFVR  229

Query  926   SGDEP-IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASE  750
               + P +RE++FHF+ E++ K+K +AN                               ++
Sbjct  230   RHEAPQMRERVFHFSSESLAKLKAKAN-------------------------AESSHTTK  264

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAK  570
             ISS Q+LSA +WR +TR R     + T+ R+AIN R RL P +   Y GN IQ++   A 
Sbjct  265   ISSLQALSAHVWRCITRTRNFSPDQETSCRLAINNRTRLHPPVPQEYVGNCIQTVRAAAA  324

Query  569   AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF-DGAMITMGSSPR  393
             AGELL   L W+A  LH  V  H D  VR  ++ W  +  ++ L  F D   I MGSSPR
Sbjct  325   AGELLDRGLGWSAWKLHLAVHNHTDEIVRDWVESWLQSRFIYQLAQFFDPCSIMMGSSPR  384

Query  392   FPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEY  213
             F MY N+FG G+ +A+RSG ANKFDGK+S +PG EG GS+DLE+ L P  M+ LE+D E+
Sbjct  385   FNMYGNEFGLGKAVAIRSGYANKFDGKVSLYPGIEGGGSMDLEICLLPHYMSLLESDEEF  444

Query  212   MQYVS  198
             M+ V+
Sbjct  445   METVT  449



>emb|CDP11973.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   281 bits (719),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 184/476 (39%), Positives = 261/476 (55%), Gaps = 46/476 (10%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvsdLPMLSC-QYIQKGVLLSQPPl-----da  1410
             M S  I  IS+C + P+     +K           ++C  YIQKG+L ++PP        
Sbjct  1     MSSPGIQHISQCFIKPKNTPEEAKQPIYLSQWDLAMACANYIQKGLLFAKPPAFDRENQM  60

Query  1409  aalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphlsa  1248
               L+  LK SL+ AL HF  LAGRL T  + +     +Y+  +N  G  FVHA       
Sbjct  61    EDLLEKLKDSLALALDHFYPLAGRLATLKQENPPIYSIYVDCNNSPGARFVHASLNSTID  120

Query  1247  aallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTS  1068
               L P   D+P+  +SFF +D  +++ GH++PL+ IQVTEL D +F+GC+ NH +VDGTS
Sbjct  121   DILSPV--DVPKIVQSFFDHDRAINHDGHTRPLLTIQVTELIDGIFMGCSANHMIVDGTS  178

Query  1067  FWNFFNTYAEI--CKGAK-KISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IRE  903
             +W+FFNT++EI   KG K  ISR P   R  +     +L  P           E   +RE
Sbjct  179   YWHFFNTWSEIFNAKGQKIAISRPPIHKRWFLEGHGPILSLPFTHHDQFVRRHEAPQMRE  238

Query  902   KIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSA  723
             ++FHF+ E++ K+K +AN                               ++ISS Q+L+A
Sbjct  239   RVFHFSSESLAKLKAKANAE--------------------------SDTTKISSLQALAA  272

Query  722   QLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDL  543
              +WR +TR R L   + T+  MAIN R RL P +   Y GN IQ++   A AGELL   L
Sbjct  273   HVWRCITRTRNLPPDQETSCMMAINNRTRLCPPVPQEYVGNCIQAVRATAAAGELLDRGL  332

Query  542   SWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF-DGAMITMGSSPRFPMYDNDFG  366
              W++  LH  V  H D  VR  ++ W  +P ++    F D   + MGSSPRF MY ++FG
Sbjct  333   GWSSSKLHLAVHNHTDEIVRNWVESWLQSPVIYQAAEFIDPCSVLMGSSPRFNMYGSEFG  392

Query  365   WGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              G+ +A+RSG ANKFDGK+S+FPG EG GS+DLE+ L P +M+ LE+D E+M  V+
Sbjct  393   LGKAVAIRSGYANKFDGKVSSFPGVEGGGSMDLEICLRPHSMSLLESDEEFMGAVT  448



>gb|KHN04490.1| Putative acetyltransferase [Glycine soja]
Length=465

 Score =   281 bits (719),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 187/461 (41%), Positives = 257/461 (56%), Gaps = 62/461 (13%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPld------aaalisllklslskalAHFPALAGRLHT----DAK  1320
             M+S  YIQKG+L  +P            L+  LK SLS  L HF  LAG+L T    D  
Sbjct  36    MMSLHYIQKGLLFKKPATLVDPQDFMENLLEKLKHSLSLTLFHFYPLAGQLVTQKTQDPP  95

Query  1319  GHVYIL--SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              +   +  +N  G  F++A      +  L P   D+P    SFF +   +++ GH+ PL+
Sbjct  96    SYTIFVDCNNTSGARFIYATLDITISDILSPV--DVPPIVHSFFDHHKAVNHDGHTMPLL  153

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI-----CKGAKKISRVPDFGRDTV  981
             +IQVTEL D VF+GC+MNH + DGTS+WNFFNT++EI      +G +  + VP   R  +
Sbjct  154   SIQVTELLDGVFIGCSMNHTIGDGTSYWNFFNTWSEIFFQTQAQGLEYDATVP-ISRHPI  212

Query  980   FNSPAVLKFPAG-GPAATF---SGDE--------PIREKIFHFTREAILKMKFRANNGKL  837
              N      FP G GP         DE         +R +IFHF+ E+I K+K RAN+   
Sbjct  213   HNR----WFPDGCGPLINLPFKHEDEFIDRFESPKLRVRIFHFSAESIAKLKARANS---  265

Query  836   CNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRM  657
                                  ++    SEISSFQSLSA +WRSVTRARKL   + T+ ++
Sbjct  266   ---------------------ESKSKTSEISSFQSLSAHVWRSVTRARKLPNDEITSCKL  304

Query  656   AINCRHRLEPRLKPLYFGNAIQSIPTVA-KAGELLSHDLSWAAEMLHRNVVAHDDATVRR  480
             AI+ R RLEP L   YFGNA+  + T    AGELL  DL WAA  +H  V   +D  VR+
Sbjct  305   AISNRSRLEPPLPHEYFGNAVDVVSTAGFTAGELLEKDLGWAAWKVHVAVANQNDKAVRQ  364

Query  479   GIQDWENNPRLFPLG-NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISA  303
              +++W   P ++ LG +FD   +TM SSPRF MY N+FG G+ +AV SG ANK DG ++A
Sbjct  365   KLKEWLKLPVVYQLGVHFDPCTVTMSSSPRFNMYGNEFGMGKAIAVLSGYANKNDGNVTA  424

Query  302   FPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFDH  180
             + G EG GS+DLE+ L+P+ ++ LE+D E+M+  S   F H
Sbjct  425   YQGYEGEGSIDLEICLSPDAVSALESDEEFMEAASVANFLH  465



>gb|ABC47847.1| N-hydroxycinnamoyl/benzoyltransferase 5 [Glycine max]
Length=465

 Score =   281 bits (718),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 187/461 (41%), Positives = 257/461 (56%), Gaps = 62/461 (13%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPld------aaalisllklslskalAHFPALAGRLHT----DAK  1320
             M+S  YIQKG+L  +P            L+  LK SLS  L HF  LAG+L T    D  
Sbjct  36    MMSLHYIQKGLLFKKPATLVDPQDFMENLLEKLKHSLSLTLFHFYPLAGQLVTQKTQDPP  95

Query  1319  GHVYIL--SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              +   +  +N  G  F++A      +  L P   D+P    SFF +   +++ GH+ PL+
Sbjct  96    SYTIFVDCNNTSGARFIYATLDITISDILSPI--DVPPIVHSFFDHHKAVNHDGHTMPLL  153

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI-----CKGAKKISRVPDFGRDTV  981
             +IQVTEL D VF+GC+MNH + DGTS+WNFFNT++EI      +G +  + VP   R  +
Sbjct  154   SIQVTELLDGVFIGCSMNHTIGDGTSYWNFFNTWSEIFFQTQAQGLEYDATVP-ISRHPI  212

Query  980   FNSPAVLKFPAG-GPAATF---SGDE--------PIREKIFHFTREAILKMKFRANNGKL  837
              N      FP G GP         DE         +R +IFHF+ E+I K+K RAN+   
Sbjct  213   HNR----WFPDGCGPLINLPFKHEDEFIDRFESPKLRVRIFHFSAESIAKLKARANS---  265

Query  836   CNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRM  657
                                  ++    SEISSFQSLSA +WRSVTRARKL   + T+ ++
Sbjct  266   ---------------------ESKSKTSEISSFQSLSAHVWRSVTRARKLPNDEITSCKL  304

Query  656   AINCRHRLEPRLKPLYFGNAIQSIPTVA-KAGELLSHDLSWAAEMLHRNVVAHDDATVRR  480
             AI+ R RLEP L   YFGNA+  + T    AGELL  DL WAA  +H  V   +D  VR+
Sbjct  305   AISNRSRLEPPLPHEYFGNAVDVVSTAGFTAGELLEKDLGWAAWKVHVAVANQNDKAVRQ  364

Query  479   GIQDWENNPRLFPLG-NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISA  303
              +++W   P ++ LG +FD   +TM SSPRF MY N+FG G+ +AV SG ANK DG ++A
Sbjct  365   KLKEWLKLPVVYQLGVHFDPCTVTMSSSPRFNMYGNEFGMGKAVAVLSGYANKNDGNVTA  424

Query  302   FPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS*IQFDH  180
             + G EG GS+DLE+ L+P+ ++ LE+D E+M+  S   F H
Sbjct  425   YQGYEGEGSIDLEICLSPDAVSALESDEEFMEAASVANFLH  465



>ref|XP_003523952.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|ABC47845.1| N-hydroxycinnamoyl/benzoyltransferase 3 [Glycine max]
Length=486

 Score =   281 bits (720),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 176/446 (39%), Positives = 247/446 (55%), Gaps = 50/446 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal------isllklslskalAHFPALAGRL--HT--DAK  1320
             +LS  YIQKG+L  +PP            +  LK SLS  L+HF  LAGRL  HT  D  
Sbjct  63    LLSYHYIQKGLLFKKPPTLVDQQNFIENLLEKLKHSLSFTLSHFYPLAGRLVTHTTQDPP  122

Query  1319  GHVYILS--NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              + + +   N +G  F++A      +  L P   D+P    SFF +   +++ GH+ PL+
Sbjct  123   SYAFFVDCKNSDGARFIYASLDMTISDILTPV--DVPPILHSFFDHHKAVNHDGHTMPLL  180

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRD  987
             +IQVTEL DAVF+GC+MNH + DGTS+WNFFNT+++I +   +       IS  P   R 
Sbjct  181   SIQVTELVDAVFIGCSMNHTLGDGTSYWNFFNTWSQIFQSQAQGHEYNVPISHPPILNRW  240

Query  986   TVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKL  813
                +    +  P           E   +RE++FHF+ E+I K+K +AN+           
Sbjct  241   FPSDCDPSVNLPFKHHDEFICNFEAPFLRERVFHFSAESIAKLKAKANSE----------  290

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                ++ISSFQSLSA +WRS+T AR +   + T+ +MAIN R R+
Sbjct  291   ----------------SNTTKISSFQSLSALVWRSITLARSVPYEQKTSCKMAINNRSRM  334

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             EP +   YFGN +Q +       ELL +DL WAA +LH  V  H+D  V + +Q W  +P
Sbjct  335   EPPMPEEYFGNLVQVVSAETTTRELLENDLGWAAWLLHVAVTNHNDKVVLQSLQGWLQSP  394

Query  452   RLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGS  276
              +  +G  FD   + MGSSPRF  Y  +FG G+ +A+RSG ANKFDGK++++PGREG GS
Sbjct  395   FIPQIGRLFDPYSVLMGSSPRFNKYGCEFGMGKAVAIRSGYANKFDGKVTSYPGREGGGS  454

Query  275   VDLEVVLAPETMAGLENDMEYMQYVS  198
             +DLEV L P  M  LE+D E+M  VS
Sbjct  455   IDLEVCLLPHIMRALESDKEFMNAVS  480



>ref|XP_008220248.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Prunus mume]
 ref|XP_008220249.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Prunus mume]
Length=459

 Score =   280 bits (717),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 199/490 (41%), Positives = 270/490 (55%), Gaps = 67/490 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPld------  1413
             M S S+  IS+C V P + S  SK        DL MLS  YIQKG+L S+PP        
Sbjct  1     MNSPSVKYISECFVQPHHASEESKQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLGQED  60

Query  1412  -aaalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphl  1254
                +L+  LK SLS AL HF  LAGR  T+         VY+  +N  G +F++A     
Sbjct  61    FTNSLLERLKHSLSIALVHFYPLAGRFVTEKNEDPPLYLVYVDCNNSPGAKFIYATLDMS  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  L P+  D+P   +SFF +D  +++ GH+  L+ IQVTEL D +F+G +MNH + DG
Sbjct  121   ISDILSPT--DVPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDG  178

Query  1073  TSFWNFFNTYAEICKGAKKISR---VPDFGRDTVFNSPAVLK--FPAG-GPAATF---SG  921
             TS+W+FFN ++EI +   +      VP+  R      P VLK  FP G GP         
Sbjct  179   TSYWHFFNIWSEIFQAQAQGDHNNFVPNISR------PPVLKRWFPDGHGPIINLPFKHS  232

Query  920   DE--------PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNG  765
             DE         +RE++FHF+ E+I K+K +AN                            
Sbjct  233   DEFIGRYEAPKLRERMFHFSSESIAKLKAKANAES-------------------------  267

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                ++ISSFQSLSA +WRS+TR R L   + T+ R+A N R RLEP L   YFGN+I  I
Sbjct  268   -NTTKISSFQSLSALMWRSITRVRGLPQDQGTSCRLAANNRGRLEPPLSGDYFGNSIHPI  326

Query  584   PT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITM  408
              + +  AGELL H L WAA  LH  VV H++  +R  +  W N+P ++ +  FD   + M
Sbjct  327   RSEIVPAGELLDHGLGWAAWKLHEAVVNHNNKWIREHVDGWLNSPAVYQVSFFDPLSVMM  386

Query  407   GSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             GSSPRF MY N FG G+ LA+RSG A+KF GK+S++ GRE  GS+DLEV L P+ M+ LE
Sbjct  387   GSSPRFNMYGNQFGMGKALALRSGYAHKFSGKVSSYEGRE-EGSIDLEVCLPPDAMSALE  445

Query  227   NDMEYMQYVS  198
              D E+M+  S
Sbjct  446   CDTEFMEAAS  455



>gb|KHN22332.1| Putative acetyltransferase [Glycine soja]
Length=456

 Score =   280 bits (717),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 176/447 (39%), Positives = 251/447 (56%), Gaps = 52/447 (12%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaali-------sllklslskalAHFPALAGRLHT----DA  1323
             MLS  YIQKG+L  +PP                LK SLS  L HF  LAGRL T    D 
Sbjct  37    MLSVHYIQKGLLFKKPPTTLVDQHDFIENLLEKLKHSLSLTLFHFYPLAGRLVTQKTQDP  96

Query  1322  KGHVYIL---SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKP  1152
               +  ++   +N +G  F++A      +  + P   D+P    S F +   +++ GH+ P
Sbjct  97    PSYAVLVDCNNNSDGARFIYATLDMTISDIISPI--DVPPIVHSLFDHHKAVNHDGHTMP  154

Query  1151  LMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFG  993
             L++IQVT+L DAVF+GC+MNH + DGTS+WNFFNT++EI +   +       IS  P   
Sbjct  155   LLSIQVTQLVDAVFIGCSMNHVIGDGTSYWNFFNTWSEIFQAQAEGHEYDVPISHNPIHN  214

Query  992   R--DTVFNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENG  819
             R    ++     L F       +      +RE+IFHF+ E+I K+K +AN  K CN    
Sbjct  215   RWFPELYGPLINLPFKNHDEFISRFESPKLRERIFHFSAESIAKLKAKAN--KECN----  268

Query  818   KLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRH  639
                                  ++ISSFQSLSA +WRS+TRAR +   + T+ ++A + R 
Sbjct  269   --------------------TTKISSFQSLSALVWRSITRARSVPQEQRTSCKLATDNRS  308

Query  638   RLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWEN  459
             R+EP L   YFGN++ ++   A   ELL + L WAA  LH  V  H+ + V   ++ W  
Sbjct  309   RMEPPLPKEYFGNSLHAVSGEATTRELLENGLGWAAWKLHLAVANHNASAVLDFLKVWLE  368

Query  458   NPRLFPLGNF-DGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGN  282
             +P ++ +G F D   + MGSSPRF MY N+FG G+ +AVRSG ANKFDGK++++PG EG 
Sbjct  369   SPFIYQIGGFFDPYCVMMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGHEGG  428

Query  281   GSVDLEVVLAPETMAGLENDMEYMQYV  201
             GS+DLEV L+P+TM+ LE+D E+M  V
Sbjct  429   GSIDLEVCLSPDTMSALESDDEFMSAV  455



>ref|XP_006354859.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum tuberosum]
Length=447

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 190/472 (40%), Positives = 269/472 (57%), Gaps = 45/472 (10%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnsks-lklsvsdLPMLSCQYIQKGVLLSQPPldaaa-lisl  1392
             S ++  IS C + P Y S  +K  + LS  DL MLS QYIQKG+L ++P       L+  
Sbjct  4     SPTVQHISDCFIKPLYNSEEAKKPVYLSSWDLAMLSVQYIQKGLLFTKPSSFQLDPLLQK  63

Query  1391  lklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphlsaaallps  1230
             LK SLS  L HF  LAGR  T  + +     V+I   N  G  F+HA      +  L P 
Sbjct  64    LKDSLSITLVHFYPLAGRFKTLKQENPPLYTVFIDCVNSPGARFIHANLDLTVSDILSPK  123

Query  1229  hADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFN  1050
               D+P   +SFF +D  +++ GH   L+ +Q+TEL D VF+G ++NH + DG+SFW+FFN
Sbjct  124   --DVPLVVQSFFDHDRAINHDGHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFWHFFN  181

Query  1049  TYAEICK---GAKK---ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IREKIF  894
             +++E+ K   G K+   IS+ P+F          ++  P        S  E   +RE+ F
Sbjct  182   SFSEVFKANNGQKQSIPISKSPNFNHWFPEGHGPIINLPYTHHDQFISRHESPNLRERFF  241

Query  893   HFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLW  714
             HF+ E++ K+K +AN  + C+                         S+ISS Q+LSA +W
Sbjct  242   HFSAESLKKLKAKAN--QECH------------------------TSKISSLQALSAHMW  275

Query  713   RSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWA  534
             R +TR RK  A   T+ RMAIN R RLEP L   YFGN IQ++  +A AG+LL + L WA
Sbjct  276   RCITRVRKFPADHVTSCRMAINNRARLEPPLPENYFGNCIQTVRGIASAGKLLENSLGWA  335

Query  533   AEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRP  354
             A  +H  VV H +  +R  ++  E+   ++ LG FD + + MGSSPRF MY N+FG G+ 
Sbjct  336   AWEMHEAVVNHKNKDIREWVEKLESG-MIYQLGFFDPSSVMMGSSPRFDMYGNEFGLGKG  394

Query  353   LAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +A+RSG A+KFDGK+S + G EG+GS+DLEV L P+ MA LE D E+M  +S
Sbjct  395   VALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPDFMASLETDKEFMDSLS  446



>gb|KDP41703.1| hypothetical protein JCGZ_16110 [Jatropha curcas]
Length=450

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 192/484 (40%), Positives = 266/484 (55%), Gaps = 63/484 (13%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPld---aaa  1404
             M  ++I  IS+C + P++    ++        DL M+S  YIQKG+L  +PP +      
Sbjct  1     MNPTAIQYISECFIKPQHVVEEAEQPYYLSPWDLAMVSVHYIQKGLLFPKPPREDFNILH  60

Query  1403  lisllklslskalAHFPALAGRLHT----DAKGHVYILS--NDEGIEFVhakaphlsaaa  1242
             L+  LK SL+  L HF  LAGRL T    D   +V  +   N  G  FVHA      +  
Sbjct  61    LLEKLKHSLALTLVHFYPLAGRLATSKSQDPPSYVIYVDCRNSPGARFVHATVDMTVSDI  120

Query  1241  llpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFW  1062
             L P++  +P   +SFF +   L++ GH + L+ IQVTEL D +F+GC+ NHA+ DGTS+W
Sbjct  121   LSPTY--VPSVVQSFFDHHRALNHDGHVRSLLTIQVTELVDGIFIGCSFNHAIGDGTSYW  178

Query  1061  NFFNTYAEICKGAKKISRVPDFGRD-TVFNSPAVLK--FPAG-GPAAT--FSGDEP----  912
             +F NT++EI +           G D    + P VLK  FP G GP     F+  E     
Sbjct  179   HFLNTWSEIFQAE---------GDDGAAISRPPVLKPWFPDGYGPVINLPFTHHEQFLCP  229

Query  911   -----IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEI  747
                  ++E+IFHF+ E+I K+K +AN     N                          +I
Sbjct  230   FESPVLKERIFHFSAESIAKLKEKANAEYNTN--------------------------KI  263

Query  746   SSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKA  567
             SSFQSLSA +WR +TR+R L   + T  R+A N R R  P L P YFGN I +I   + A
Sbjct  264   SSFQSLSAFMWRCITRSRHLPHDQITNCRLACNNRSRFNPPLSPNYFGNCIDAIAASSTA  323

Query  566   GELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGSSPRF  390
             GELL  +L WAA MLH++VV      ++  I+ W+ +P ++ +G +FD   + MGSSPRF
Sbjct  324   GELLQQNLGWAAWMLHQSVVNQTSEKIQERIEAWKKSPFIYHIGRSFDPFSVMMGSSPRF  383

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
               Y   FG G+ L +RSG A+KF GK+SA+PGREG GSVDLEV L P++MA LE+D E+ 
Sbjct  384   NKYGCQFGLGKALTLRSGYAHKFSGKVSAYPGREGGGSVDLEVCLPPDSMAALESDKEFF  443

Query  209   QYVS  198
               VS
Sbjct  444   AVVS  447



>ref|XP_007226559.1| hypothetical protein PRUPE_ppa024441mg [Prunus persica]
 gb|EMJ27758.1| hypothetical protein PRUPE_ppa024441mg [Prunus persica]
Length=459

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 197/490 (40%), Positives = 266/490 (54%), Gaps = 67/490 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaaali-  1398
             M S S+  IS+C V P + S  SK        DL MLS  YIQKG+L S+PP        
Sbjct  1     MNSPSVKYISECFVQPHHASEESKQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLEQED  60

Query  1397  ------sllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphl  1254
                     +K SLS AL HF  LAGR  T+         VY+  +N  G +F++A     
Sbjct  61    FTNSLLERVKHSLSIALVHFYPLAGRFVTEKNEDPPLYLVYVDCNNSPGAKFIYATLDMS  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  L P+  D+P   +SFF +D  +++ GH+  L+ IQVTEL D +F+G +MNH + DG
Sbjct  121   ISDILSPT--DVPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDG  178

Query  1073  TSFWNFFNTYAEICKGAKKISR---VPDFGRDTVFNSPAVLK--FPAG-GPAATF---SG  921
             TS+W+FFN ++EI +   +      VP   R      P VLK  FP G GP         
Sbjct  179   TSYWHFFNIWSEIFQAQAQGDHNNFVPKISR------PPVLKRWFPDGHGPIINLPFKHS  232

Query  920   DE--------PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNG  765
             DE         +RE++FHF+ E+I K+K +AN                            
Sbjct  233   DEFIGRYEAPKLRERMFHFSSESIAKLKAKANAE--------------------------  266

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                ++ISSF+SLSA +WRS+TRAR L   + T+ R+A N R RLEP L   YFGN+I  I
Sbjct  267   SNTTKISSFKSLSALMWRSITRARGLPRDQGTSCRLAANNRGRLEPPLSGDYFGNSIHPI  326

Query  584   PT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITM  408
              + +  AGELL H L WAA  LH  VV H+D  +R  +  W  +P ++ +  FD   + M
Sbjct  327   RSEIVPAGELLEHGLGWAAWKLHEAVVNHNDKLIREHVDGWLKSPAVYQVSFFDPLSVMM  386

Query  407   GSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             GSSPRF MY N FG G+ LA+RSG A+KF GK+S++ GRE  GS+DLEV L P+ M+ LE
Sbjct  387   GSSPRFNMYGNQFGMGKALALRSGYAHKFSGKVSSYEGRE-EGSIDLEVCLPPDAMSALE  445

Query  227   NDMEYMQYVS  198
              D E+M+  S
Sbjct  446   CDSEFMEAAS  455



>ref|XP_003523954.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47844.1| N-hydroxycinnamoyl/benzoyltransferase 2 [Glycine max]
Length=460

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 178/446 (40%), Positives = 246/446 (55%), Gaps = 50/446 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaa------lisllklslskalAHFPALAGRL--HTDAKGH  1314
             MLS  YIQKG+L  +P            L+  LK SLS  L+HF  LAGR   H      
Sbjct  37    MLSMHYIQKGLLFKKPTPLVDQHDFIENLLEKLKHSLSLTLSHFYPLAGRFVTHKTQDPP  96

Query  1313  VYILS----NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              Y +S    N +G  F++A      +  L P   D+P   +S F +   +++ GHS PL+
Sbjct  97    SYAVSVDSKNSDGARFIYATLDMTISDILSPV--DVPLVVQSLFDHHKAVNHDGHSMPLL  154

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRD  987
             +IQVTEL D VF+GC+MNHAV DGTS+WNFFNT+++I +   K       IS  P   R 
Sbjct  155   SIQVTELVDGVFLGCSMNHAVGDGTSYWNFFNTWSQIFQSQAKGHETDVPISHQPILSRW  214

Query  986   TVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKL  813
                +    +  P        S  E   +RE++FHF+ E+I K+K +AN            
Sbjct  215   FPNDCAPPINLPFKHHDEFISRFEAPLMRERVFHFSAESIAKLKAKANME----------  264

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                ++ISSFQSLSA +WRS+TRA  L   + T+ R+  N R R+
Sbjct  265   ----------------SDTTKISSFQSLSALVWRSITRACSLPYEQRTSCRLTANNRTRM  308

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             EP L   YFGN++  +      GELL ++L WAA  LH  V  H+D  V + +++W  +P
Sbjct  309   EPPLPQEYFGNSVSRVSAETTVGELLENNLGWAAWKLHLAVTNHNDRVVLQSLKEWLQSP  368

Query  452   RLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGS  276
              ++ LG   D  ++ + SSPRF MY N+FG G+ +AVRSG ANKFDGK++++PGREG GS
Sbjct  369   LIYQLGQPMDPYVVLISSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGREGGGS  428

Query  275   VDLEVVLAPETMAGLENDMEYMQYVS  198
             +DLEV L P  M+ LE+D E+M  VS
Sbjct  429   IDLEVGLLPHIMSALESDEEFMNVVS  454



>gb|KCW66380.1| hypothetical protein EUGRSUZ_F00196, partial [Eucalyptus grandis]
Length=365

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 207/353 (59%), Gaps = 39/353 (11%)
 Frame = -3

Query  1220  IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYA  1041
             +P   +SFF +D  +++ GH+  L+++QVTEL+D VF+G +MNH + DGTSFW FFN+++
Sbjct  38    VPDVVQSFFDHDRAINHDGHTLSLLSVQVTELADGVFIGLSMNHTIGDGTSFWLFFNSWS  97

Query  1040  EICKGAKK-------ISRVPDFGRDTVFNSPAVLKFP-AGGPA---ATFSGDEPIREKIF  894
             +I +  +K       +SR P   R    N P  L  P    P+   A F   E +RE++F
Sbjct  98    KIFQAQEKGAVDVVPLSRPPALTRWFPENHPGPLSLPYTDDPSSLLARFEAPE-LRERVF  156

Query  893   HFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLW  714
             HF+ +AI  +K  AN  + C                          + ISSFQSL+A +W
Sbjct  157   HFSADAIAGLKAEAN--RQC------------------------GTTSISSFQSLTALVW  190

Query  713   RSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWA  534
             R + RAR+   S+ T  RMA N R RL+P L P YFGN+I  + T AK GELL   L WA
Sbjct  191   RCIARARRFPPSQVTGCRMAANNRARLDPPLSPEYFGNSITPVRTAAKVGELLGSGLGWA  250

Query  533   AEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-NFDGAMITMGSSPRFPMYDNDFGWGR  357
             A +LH  V  H  A +R   +DW   P+++ L   FD   I MGSSPRF  Y N+FG G+
Sbjct  251   ARLLHTAVAEHSSAKLREWNEDWIKRPQVYHLDKTFDQYSIMMGSSPRFDKYGNEFGLGK  310

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              +A+RSG ANKFDGK+SA+PG EG GS+DLE+ L P TMA LE D E+M  V+
Sbjct  311   AVALRSGYANKFDGKVSAYPGHEGGGSIDLEICLPPTTMALLEADPEFMAAVT  363



>ref|XP_007136704.1| hypothetical protein PHAVU_009G066900g [Phaseolus vulgaris]
 gb|ESW08698.1| hypothetical protein PHAVU_009G066900g [Phaseolus vulgaris]
Length=461

 Score =   279 bits (713),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 176/448 (39%), Positives = 247/448 (55%), Gaps = 48/448 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal------isllklslskalAHFPALAGRLHTDAKGH--  1314
             MLS  YIQKG+L  +P             +  LK SLS  L+HF  L+GRL T    +  
Sbjct  36    MLSIHYIQKGLLFKKPETLVHQHDFIQNLLDKLKHSLSLTLSHFYPLSGRLVTHKTQNPP  95

Query  1313  ---VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
                +++  +N +G+ F HA      +  L P   D P  F SFF +   +++ GH+ PL+
Sbjct  96    SYAIFVDCNNSDGVRFTHATLDVTISDILSPV--DTPSIFHSFFDHHKAVNHDGHTMPLL  153

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRD  987
             +IQVTEL D VF+GC+MNH+V DGTS+WNFFN +++I +   +       I   P   R 
Sbjct  154   SIQVTELVDGVFIGCSMNHSVGDGTSYWNFFNAWSKIFQAEPQGQENDVPILHQPIHNRW  213

Query  986   TVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKL  813
                N    +  P        +  E   +RE+IFHF+ E+I K+K +AN+    N      
Sbjct  214   FPNNCSPPINLPFKHHDEFINRFEAPLLRERIFHFSAESIAKLKAKANSESKSN------  267

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                ++ISSFQSLSA +WRS+ RAR L   + T F ++ N R R+
Sbjct  268   ------------------TTKISSFQSLSALVWRSIIRARSLPYEQRTNFTLSANNRSRM  309

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             EP L   YFGN++ S+      GELL +DL WAA  LH  V  H+D  V + IQ+W   P
Sbjct  310   EPPLPHEYFGNSVNSLSAETTVGELLKNDLGWAAWKLHLAVTRHNDKEVMQSIQEWFQCP  369

Query  452   RLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGS  276
              +  +    +  ++ + SSPRF MY ++FG G+ +AVRSG ANKFDGK+++FPGREG GS
Sbjct  370   VIRKICQPLEPYLVLISSSPRFNMYGSEFGMGKAVAVRSGYANKFDGKVTSFPGREGGGS  429

Query  275   VDLEVVLAPETMAGLENDMEYMQYVS*I  192
             +DLE+ L P  M  LE+DM++M  VS I
Sbjct  430   IDLEICLLPHIMTSLESDMDFMNAVSVI  457



>ref|XP_008220250.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Prunus mume]
Length=424

 Score =   277 bits (708),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 186/455 (41%), Positives = 254/455 (56%), Gaps = 66/455 (15%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPld-------aaalisllklslskalAHFPALAGRLHTDAKGH-  1314
             MLS  YIQKG+L S+PP           +L+  LK SLS AL HF  LAGR  T+     
Sbjct  1     MLSVHYIQKGLLFSKPPEAKLGQEDFTNSLLERLKHSLSIALVHFYPLAGRFVTEKNEDP  60

Query  1313  ----VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 VY+  +N  G +F++A      +  L P+  D+P   +SFF +D  +++ GH+  L
Sbjct  61    PLYLVYVDCNNSPGAKFIYATLDMSISDILSPT--DVPLVVQSFFDHDRAVNHDGHTMSL  118

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISR---VPDFGRDTVF  978
             + IQVTEL D +F+G +MNH + DGTS+W+FFN ++EI +   +      VP+  R    
Sbjct  119   LTIQVTELVDGIFIGLSMNHCLGDGTSYWHFFNIWSEIFQAQAQGDHNNFVPNISR----  174

Query  977   NSPAVLK--FPAG-GPAATF---SGDE--------PIREKIFHFTREAILKMKFRANNGK  840
               P VLK  FP G GP         DE         +RE++FHF+ E+I K+K +AN   
Sbjct  175   --PPVLKRWFPDGHGPIINLPFKHSDEFIGRYEAPKLRERMFHFSSESIAKLKAKANAES  232

Query  839   LCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFR  660
                                         ++ISSFQSLSA +WRS+TR R L   + T+ R
Sbjct  233   --------------------------NTTKISSFQSLSALMWRSITRVRGLPQDQGTSCR  266

Query  659   MAINCRHRLEPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVR  483
             +A N R RLEP L   YFGN+I  I + +  AGELL H L WAA  LH  VV H++  +R
Sbjct  267   LAANNRGRLEPPLSGDYFGNSIHPIRSEIVPAGELLDHGLGWAAWKLHEAVVNHNNKWIR  326

Query  482   RGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISA  303
               +  W N+P ++ +  FD   + MGSSPRF MY N FG G+ LA+RSG A+KF GK+S+
Sbjct  327   EHVDGWLNSPAVYQVSFFDPLSVMMGSSPRFNMYGNQFGMGKALALRSGYAHKFSGKVSS  386

Query  302   FPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             + GRE  GS+DLEV L P+ M+ LE D E+M+  S
Sbjct  387   YEGRE-EGSIDLEVCLPPDAMSALECDTEFMEAAS  420



>ref|XP_002510186.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF52373.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=452

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 184/449 (41%), Positives = 251/449 (56%), Gaps = 63/449 (14%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPlda---aalisllklslskalAHFPALAGRLHT----DAKGHV  1311
             MLS  YIQKG+L ++PP +A     L+  LK SL+  L HF  LAGRL T    D   +V
Sbjct  36    MLSVHYIQKGLLFAKPPQEALDIMYLLDKLKHSLALTLVHFYPLAGRLATSKTEDPPSYV  95

Query  1310  YIL--SNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQ  1137
               +  +N  G   VHA      +  L P++  +P   +SFF +   L++ GH + L+ IQ
Sbjct  96    VYVDCTNSPGARLVHAAVNLTVSDVLSPTY--VPLVAQSFFDHHRALNHDGHFRSLLTIQ  153

Query  1136  VTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEI--CKGAK-KISRVPDFGRDTVFNSPA  966
             VT+L D VF+GC+MNHA+ DG+SFW F N+++EI   +G++ +I+  PD  R        
Sbjct  154   VTDLVDGVFIGCSMNHAIGDGSSFWQFLNSFSEIFQAQGSEFQIAHPPDLKR--------  205

Query  965   VLKFPAG-GPAAT--FSGDE---------PIREKIFHFTREAILKMKFRANNGKLCNGEN  822
                FP G GP     F+  E         P RE++FHF+ E+I K+K RAN+    N   
Sbjct  206   --WFPDGYGPIVNLPFTHHEQFLGHFEAPPFRERVFHFSSESIAKLKARANSEYNTN---  260

Query  821   GKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCR  642
                                    +ISSFQSLSA +WR + R RKL   + T+ R+A N R
Sbjct  261   -----------------------KISSFQSLSAFMWRCIMRTRKLPHDQITSCRLACNNR  297

Query  641   HRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWE  462
              RL+P L   YFGN I  +     AGELL ++L WAA   H+ VV   D  +R  ++ W 
Sbjct  298   SRLKPPLSADYFGNCIYPLRASTTAGELLENNLGWAAWRTHQAVVNQSDEKIRESLESWL  357

Query  461   NNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREG  285
              +P ++ +G  FD   + MGSSPRF  Y ++FG G+ LA+ SG A+KF GK+SA+PGREG
Sbjct  358   KSPIIYQIGQLFDPFSVMMGSSPRFNKYGSEFGLGKALALLSGYAHKFSGKVSAYPGREG  417

Query  284   NGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              GSVDLEV L P  M  LE+D E+M  VS
Sbjct  418   GGSVDLEVCLPPNLMTALEDDQEFMDAVS  446



>ref|XP_004238137.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Solanum 
lycopersicum]
Length=470

 Score =   277 bits (708),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 193/476 (41%), Positives = 269/476 (57%), Gaps = 47/476 (10%)
 Frame = -3

Query  1571  MPSSSIVV--ISKCTVYPEYkssnsks-lklsvsdLPMLSCQYIQKGVLLSQPPldaaa-  1404
             M SSS  V  IS C + P Y S  +K  + LS  DL MLS QYIQKG+L ++P       
Sbjct  23    MASSSPTVQHISDCFIKPLYTSEEAKKPVYLSSWDLAMLSVQYIQKGLLFTKPSSFQLDP  82

Query  1403  lisllklslskalAHFPALAGRLHTDAKGH-----VYILSNDE-GIEFVhakaphlsaaa  1242
             L+  LK SLS  L HF  LAGR  T  + +     V+I   D  G  F+HA      +  
Sbjct  83    LLQNLKDSLSITLVHFYPLAGRFKTLKQENPPLYTVFIDCVDTPGARFIHANLDLTVSDI  142

Query  1241  llpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFW  1062
             L P   D+P   +SFF +D  +++ GH   L+ +Q+TEL D VF+G ++NH + DG+SFW
Sbjct  143   LSPK--DVPLVVQSFFDHDRAINHDGHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFW  200

Query  1061  NFFNTYAEICK---GAKKI---SRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IR  906
             +FFN+++++ K   G K+I   S+ P+F          ++  P        S  E   +R
Sbjct  201   HFFNSFSQVFKANNGQKQIIPISKSPNFNHWFPEGHGPIINLPYTHHDQFISRHESPILR  260

Query  905   EKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLS  726
             E+ FHF+ E + K+K +AN    C+                         S+ISS Q+LS
Sbjct  261   ERFFHFSSECLKKLKAKANEE--CH------------------------TSKISSLQALS  294

Query  725   AQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHD  546
             A +WR +TR RK  A   T+ RMAIN R RL+P L   YFGN IQ++  +A AG+LL + 
Sbjct  295   AHMWRCITRVRKFPADHITSCRMAINNRARLDPPLPENYFGNCIQTVRGIASAGKLLENS  354

Query  545   LSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFG  366
             L WAA  +H  VV H +  +R  ++  E+   ++ LG FD + I MGSSPRF MY N+FG
Sbjct  355   LGWAAWEMHEAVVNHKNKDIREWVEKLESG-MIYQLGFFDPSSIMMGSSPRFDMYGNEFG  413

Query  365   WGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              G+ +A+RSG A+KFDGK+S + G EG+GS+DLEV L P+ MA LE D E+M  +S
Sbjct  414   LGKGVALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPDFMASLETDKEFMDSLS  469



>gb|KHN04489.1| Putative acetyltransferase, partial [Glycine soja]
Length=481

 Score =   277 bits (708),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 177/446 (40%), Positives = 245/446 (55%), Gaps = 50/446 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaa------lisllklslskalAHFPALAGRL--HTDAKGH  1314
             MLS  YIQKG+L  +P            L+  LK SLS  L+HF  LAGR   H      
Sbjct  58    MLSMHYIQKGLLFKKPTPLVDQHDFIENLLEKLKHSLSLTLSHFYPLAGRFVTHKTQDPP  117

Query  1313  VYILS----NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              Y +S    N +G  F++A      +  L P   D+P   +S F +   +++ GHS PL+
Sbjct  118   SYAVSVDSKNSDGARFIYATLDMTISDILSPV--DVPLVVQSLFDHHKAVNHDGHSMPLL  175

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRD  987
             +IQVTEL D VF+GC+MNHAV DGTS+WNFFNT+++I +   K       IS  P   R 
Sbjct  176   SIQVTELVDGVFLGCSMNHAVGDGTSYWNFFNTWSQIFQSQAKGHETDVPISHQPILSRW  235

Query  986   TVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKL  813
                +    +  P        S  E   +RE++FHF+ E+I K+K +AN            
Sbjct  236   FPNDCAPPINLPFKHHDEFISRFEAPLMRERVFHFSAESIAKLKAKANME----------  285

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                ++ISSFQSLSA +WR +TRA  L   + T+ R+  N R R+
Sbjct  286   ----------------SDTTKISSFQSLSALVWRCITRACSLPYEQRTSCRLTANNRTRM  329

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             EP L   YFGN++  +      GELL ++L WAA  LH  V  H+D  V + +++W  +P
Sbjct  330   EPPLPQEYFGNSVSRVSAETTVGELLENNLGWAAWKLHLAVTNHNDRVVLQSLKEWLQSP  389

Query  452   RLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGS  276
              ++ LG   D  ++ + SSPRF MY N+FG G+ +AVRSG ANKFDGK++++PGREG GS
Sbjct  390   LIYQLGQPMDPYVVLISSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGREGGGS  449

Query  275   VDLEVVLAPETMAGLENDMEYMQYVS  198
             +DLEV L P  M+ LE+D E+M  VS
Sbjct  450   IDLEVGLLPHIMSALESDEEFMNVVS  475



>ref|XP_009775187.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Nicotiana 
sylvestris]
Length=455

 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 193/474 (41%), Positives = 270/474 (57%), Gaps = 57/474 (12%)
 Frame = -3

Query  1547  ISKCTVYPEYkssnsks-lklsvsdLPMLSCQYIQKGVLLSQPPldaaal-isllklsls  1374
             IS+C + P Y+S  SK  + LS  DL MLS  YIQKG+L ++P      L +  LK SLS
Sbjct  14    ISECFIKPLYESEESKKPVYLSSWDLAMLSVHYIQKGLLFTKPSNFQLDLFLEKLKESLS  73

Query  1373  kalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphlsaaallpshADIPR  1212
               L  F  LAGRL T  + +     V+I   N  G  F+HA      +  L P   D+P 
Sbjct  74    LTLVQFYPLAGRLSTLKQENPPLYTVFIDCVNTPGARFIHANLDLTISDILSPK--DVPL  131

Query  1211  EFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC  1032
               +SFF +D  +++ GH   L+ IQVTEL D VF+GC++NH + DG+SFW FFNT++EI 
Sbjct  132   VVQSFFDHDKAINHDGHELSLLTIQVTELIDGVFIGCSINHVLADGSSFWLFFNTFSEIF  191

Query  1031  KG--AKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATF----------SGDEP-IREK  900
             K    +K  ++P     ++  S  +    FP G GP                + P +RE+
Sbjct  192   KANNEQKKQKIPI----SISKSSPIHNHWFPKGHGPIINLPYTHHNQFISRHEAPHMRER  247

Query  899   IFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQ  720
              FHF+ E++ K+K +AN    CN                         ++IS+ Q+LSA 
Sbjct  248   FFHFSAESLKKLKAKANIE--CN------------------------TTKISTLQALSAH  281

Query  719   LWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLS  540
             +WR +T+ RK  + + T+ RMAIN R RL+P L   YFGN IQ++   A AGE+L H+L 
Sbjct  282   MWRCITKVRKFPSDQMTSCRMAINNRARLDPPLPQEYFGNCIQTVRGNATAGEVLEHNLG  341

Query  539   WAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRFPMYDNDFGWG  360
             WAA  LH+ V+ H++  +R  ++  E    ++ +G FD   I MGSSPRF MY N+FG G
Sbjct  342   WAAWKLHQAVINHNNKEIREWVEKLECG-MVYQMGFFDPCSIMMGSSPRFDMYGNEFGLG  400

Query  359   RPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             + +A+RSG ANKFDGK+S + G EG+GS+DLEV L PE MA LE+D E+M  +S
Sbjct  401   KGVALRSGYANKFDGKVSLYQGIEGDGSMDLEVCLLPEFMASLESDEEFMDSLS  454



>ref|XP_008393786.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=459

 Score =   276 bits (706),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 197/494 (40%), Positives = 270/494 (55%), Gaps = 67/494 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaa----  1407
             M S  +  IS+C V P +    SK        DL MLS  YIQKG+L  +PP        
Sbjct  1     MDSEHVKQISECFVQPHHAPQXSKQPFYLAPGDLAMLSVHYIQKGLLFPKPPEAKRDPKN  60

Query  1406  ---alisllklslskalAHFPALAGRLHTD-----AKGHVYI-LSNDEGIEFVhakaphl  1254
                +L+  LK SLS AL HF  LAGR  T+     A   VY+  +N  G +F++A     
Sbjct  61    FIDSLLERLKQSLSVALVHFYPLAGRFVTEKSEDPASYVVYVDCNNSPGAKFIYATLEMS  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  L P+  D+P   +SFF +D  +++ GH+  L++IQVTEL D +F+G +MNH++ DG
Sbjct  121   VSDILSPT--DVPLVVQSFFDHDRAVNHDGHTMSLLSIQVTELVDGIFIGLSMNHSLGDG  178

Query  1073  TSFWNFFNTYAEICKGAKKISRVPDFGRDTV---FNSPAVLK--FPAG-GPAATF---SG  921
             TSFW FFN ++EI +   +       G D      + P VLK  FP G GP         
Sbjct  179   TSFWLFFNVWSEIFQAQAQE------GHDHFVANISRPPVLKRWFPDGHGPIINLPFKHS  232

Query  920   DE--------PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNG  765
             DE        P+RE++FHF+ E+I K+K +AN                            
Sbjct  233   DEFIGRFEAPPLRERMFHFSSESIAKLKAKANAE--------------------------  266

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                ++ISSFQSLSA LWR++TRAR L   + T+ R+A N R R++P L   YFGN+I  +
Sbjct  267   SDTTKISSFQSLSALLWRTITRARCLAPDQGTSCRLAANNRGRIDPPLSGDYFGNSIYPV  326

Query  584   PT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITM  408
              +    AGELL H + WAA  LH  VV HDD  +R  +  W  +P ++ +  FD   + M
Sbjct  327   KSETVAAGELLEHGIGWAAWKLHEAVVNHDDKVIRGQVDAWLKSPSVYLVSYFDPLSVMM  386

Query  407   GSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             GSSPRF MY N+FG G+ LA+RSG A+KF GK+SA+ GRE   S+DLEV L P+ M+ LE
Sbjct  387   GSSPRFNMYGNEFGMGKALALRSGYAHKFSGKVSAYEGREER-SIDLEVCLPPDAMSALE  445

Query  227   NDMEYMQYVS*IQF  186
              D E+M+  S  Q+
Sbjct  446   CDKEFMEAASVSQY  459



>ref|XP_006374906.1| anthranilate N-hydroxycinamoyl/bensoiltransferase-like family 
protein [Populus trichocarpa]
 gb|ERP52703.1| anthranilate N-hydroxycinamoyl/bensoiltransferase-like family 
protein [Populus trichocarpa]
Length=455

 Score =   276 bits (706),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 182/453 (40%), Positives = 256/453 (57%), Gaps = 66/453 (15%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal-------isllklslskalAHFPALAGRLHTDAKGH-  1314
             MLS  YIQKG+L ++PP     L       +  LK SLS  L HF  LAGRL T    + 
Sbjct  36    MLSSHYIQKGLLFAKPPQTENQLGFKIMDFLEDLKQSLSLTLVHFYPLAGRLATSKSENP  95

Query  1313  ----VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 V++  +N  G  F +A     ++  L P++  +P   +SFF +D  L++ GH+K L
Sbjct  96    PSYVVFVDCNNSPGARFTYATVDLTASDVLSPTY--VPLVVQSFFDHDRALNHDGHTKSL  153

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             + IQVTEL D +F+GC++NH++VDG+SFW+FFN ++EI +G          G D   + P
Sbjct  154   LTIQVTELIDGIFIGCSVNHSIVDGSSFWHFFNMWSEIFQGK---------GDDVSISRP  204

Query  968   AVLK--FPAG-GPAATF---SGDEPIR--------EKIFHFTREAILKMKFRANNGKLCN  831
              VL   FP G GPA +      D+ +R        E++FHF+ E+I ++K +AN      
Sbjct  205   PVLNRWFPDGHGPALSLPFTHHDQFLRPFEAPLLKERMFHFSSESIARLKAKAN------  258

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
                 + N                  ++ISSFQSLSA +WR +TRAR L   + T  R+A 
Sbjct  259   ---AEFN-----------------TNKISSFQSLSALVWRCITRARNLPRDQVTCCRLAT  298

Query  650   NCRHRLEPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
             N R RL P L P YFG +IQ++   V+ AGE+L  +L W A  LH+ VV+H D   R  +
Sbjct  299   NNRSRLNPPLSPDYFGCSIQALRAGVSTAGEVLEQNLGWTAWQLHQAVVSHGDEKAREFL  358

Query  473   QDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFP  297
               W  +P +  +G  FD   + MGSSPRF  Y N+FG G+ LA+RSG A KF GK SA+P
Sbjct  359   NLWLKSPFINHIGKLFDPHSVMMGSSPRFNKYGNEFGLGKALALRSGYALKFSGKASAYP  418

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             G EG GS++LE+ L+P+ M  +E+D E+M  VS
Sbjct  419   GHEGGGSIELEICLSPDEMTAIESDKEFMDVVS  451



>ref|XP_004141385.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 ref|XP_004169665.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55209.1| hypothetical protein Csa_4G639960 [Cucumis sativus]
Length=464

 Score =   276 bits (706),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 183/439 (42%), Positives = 247/439 (56%), Gaps = 47/439 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPlda-------aalisllklslskalAHFPALAGRLHT-----D  1326
             MLS QYIQKG++ S+PP            L+  LK SLS AL HF  LAGR  T     +
Sbjct  42    MLSVQYIQKGLIYSKPPAALNDDGQFIEDLLRKLKHSLSIALVHFYPLAGRFATISYVDE  101

Query  1325  AKGHVYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 VY+  +N  G +F+HA+     +  L P+  D+P   +  F +D   ++ GHS  L
Sbjct  102   GSCLVYVDCNNSPGAKFIHARLDMTISDILSPT--DVPVIVQRLFDHDRATNHDGHSTSL  159

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK---KISRVPDFGRDTVF  978
             ++IQ+TEL D VF+GC++NH++VDG+S+WNFFN ++EI +       ISR P   R    
Sbjct  160   LSIQITELLDGVFIGCSINHSLVDGSSYWNFFNMWSEIFQAEDDNFSISRPPVLQRWFPD  219

Query  977   NSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGK  804
                 +LK P        +  E   +RE++FHF+  ++  +K RAN     N         
Sbjct  220   AHGPILKLPFTNLDQFITKFEAPQLRERMFHFSPASLAVLKARANTEYKTN---------  270

Query  803   ITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPR  624
                              +ISSFQSLSA +WRS+TRAR L   +TT  R+AIN R RL P 
Sbjct  271   -----------------KISSFQSLSALVWRSITRARGLSPDQTTGCRLAINNRTRLNPP  313

Query  623   LKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLF  444
             L   YFGN+IQ+I T A   ELL ++L WAA  LH  VV HD+  VR  +  W  +P ++
Sbjct  314   LPENYFGNSIQAIRTAATVKELLENNLGWAAWKLHEAVVNHDNEKVRDHVNKWVESPFVY  373

Query  443   PLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDL  267
              +   FD   + MGSSPRF  Y N FG G+ LA+RSG A+KFDGK+S +PG EG GS+ L
Sbjct  374   RMEKLFDPLSVMMGSSPRFNKYGNVFGMGKALALRSGYAHKFDGKVSCYPGSEGGGSIVL  433

Query  266   EVVLAPETMAGLENDMEYM  210
             E+ L PE M+ LE D E+M
Sbjct  434   ELCLRPEFMSVLEADEEFM  452



>ref|XP_010107873.1| putative acetyltransferase [Morus notabilis]
 gb|EXC17273.1| putative acetyltransferase [Morus notabilis]
Length=422

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 178/454 (39%), Positives = 257/454 (57%), Gaps = 67/454 (15%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaa--------alisllklslskalAHFPALAGRLHTDAKGH  1314
             MLS  YIQKG+L ++P             AL+  LK SLSKAL HF  L+GRL T    +
Sbjct  1     MLSAHYIQKGLLFAKPRQATKEDGNGFMEALLDRLKNSLSKALVHFYPLSGRLKTIKAQN  60

Query  1313  -----VYILSNDE-GIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKP  1152
                  VY+  ND  G +F++A      +  L  ++  +P   +SFF +   +++ GH+  
Sbjct  61    PPSTLVYVDCNDSPGAKFIYATLNMTMSDILSETY--VPLVVQSFFDHHKAVNHDGHTMS  118

Query  1151  LMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEIC--KG-----AKKIS------  1011
             L+++QVTEL D VF+GC+MNH + DG S+WNFFN+++EI   KG     + KIS      
Sbjct  119   LLSVQVTELVDGVFIGCSMNHCLGDGASYWNFFNSWSEIFQPKGDHDHVSTKISISRPPI  178

Query  1010  ---RVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANN  846
                R PD G D +FN       P   P    S  E   ++E+IFHF+ E+I K+K +AN 
Sbjct  179   LKRRFPD-GHDPLFN------LPYADPDEFISRFEAPELKERIFHFSAESIAKLKAKANA  231

Query  845   GKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTT  666
                CN                        A++ISS QSL+A +WR +TRAR + + + T+
Sbjct  232   E--CN-----------------------VANQISSLQSLAALVWRCITRARNIPSDQITS  266

Query  665   FRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATV  486
              ++A NCR RL+P     YFGN I  +     A ELL HDL WAA  +H+ V   ++  V
Sbjct  267   CKLAANCRSRLDPPAPDNYFGNLIHELRAFTTAAELLEHDLGWAASKVHKAVANFNNKEV  326

Query  485   RRGIQDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKI  309
                +++W  +P ++ +G  FD   + MGSSP+F  Y ++FG G+ +A+RSG ANKFDGK+
Sbjct  327   HEWLEEWLQSPYVYQIGRFFDPNCVMMGSSPKFNKYGSEFGMGKAVALRSGYANKFDGKV  386

Query  308   SAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             S++PGREG GS+DLE+ L P  M  LE+D E+++
Sbjct  387   SSYPGREGGGSIDLEMCLLPHRMRALESDKEFIE  420



>ref|XP_009359877.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=459

 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 196/494 (40%), Positives = 274/494 (55%), Gaps = 67/494 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaa----  1407
             M S  +  IS+C V P +    SK       +DL MLS  YIQKG+L  +PP        
Sbjct  1     MDSEHVKQISECFVQPHHAPQESKQPFYLAPADLAMLSVYYIQKGLLFPKPPEAKRDPKN  60

Query  1406  ---alisllklslskalAHFPALAGRLHTD-----AKGHVYI-LSNDEGIEFVhakaphl  1254
                +L+  LK SLS AL HF  LAGRL T      A   VY+  +N  G +F++A     
Sbjct  61    FIDSLLQRLKQSLSVALVHFYPLAGRLVTKKSEDPASYVVYVDCNNSPGAKFIYATLEMS  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  L P+  D+P   +SFF +D  +++ GH+  L+++QVTEL D +F+G ++NH++VDG
Sbjct  121   VSDILSPT--DVPLVVQSFFDHDRAVNHDGHTMSLLSVQVTELVDGIFIGLSINHSLVDG  178

Query  1073  TSFWNFFNTYAEICKGAKKISR---VPDFGRDTVFNSPAVLK--FPAG-GPAATF---SG  921
             TSFW+FFN ++EI +   +  +   V +  R      P VLK  FP G GP         
Sbjct  179   TSFWHFFNVWSEIFQVQAQEGQNHFVANILR------PPVLKRWFPDGHGPIINLPFKHS  232

Query  920   DE--------PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNG  765
             DE        P+RE++FHF+ E+I K+K +AN                            
Sbjct  233   DEFIGRFEAPPLRERMFHFSSESIAKLKAKANAE--------------------------  266

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                ++ISSF+SLSA LWR++TRAR L   + T+ R+A N R R++P L   YFGN+I  +
Sbjct  267   SDTTKISSFKSLSALLWRTITRARCLAPDEGTSCRLAANNRGRIDPPLSGDYFGNSIHPV  326

Query  584   PT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITM  408
              +    AGELL H + WAA  LH  VV HD   +R  +  W  +P ++ +  FD   + M
Sbjct  327   KSETVAAGELLEHGIGWAAWKLHEAVVNHDGKVIRGQVDAWLKSPSVYLVSYFDPLSVMM  386

Query  407   GSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             GSSPRF MY N+FG G+ LA+RSG A+KF GK+SA+ GRE  GS+DLEV L P+ M+ LE
Sbjct  387   GSSPRFNMYGNEFGMGKALALRSGYAHKFSGKVSAYEGRE-KGSIDLEVCLPPDAMSALE  445

Query  227   NDMEYMQYVS*IQF  186
              D E+M+  S  Q+
Sbjct  446   CDKEFMEAASVPQY  459



>ref|XP_004291088.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   275 bits (704),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 194/491 (40%), Positives = 276/491 (56%), Gaps = 65/491 (13%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaa----  1407
             M S S+  +S+C + P + S  SK       SDL MLS  YIQKG+L ++PP  +     
Sbjct  1     MASPSVRHLSECFIRPHHVSEESKQPFYLTPSDLAMLSAHYIQKGLLFTKPPEASNPSFL  60

Query  1406  -alisllklslskalAHFPALAGRLHTDAKGH--VYIL----SNDEGIEFVhakaphlsa  1248
               L++ LK SLS AL HF  +AGRL T  +    VY++    SN  G +F+HA      +
Sbjct  61    DTLLAKLKHSLSLALVHFYPIAGRLVTKKEQDPPVYLVYVDCSNSPGAKFIHASLEMSIS  120

Query  1247  aallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTS  1068
               L P+  D+P   +SFF +D  +++ GH+  L+  +VTEL D VF+G +MNH + DGTS
Sbjct  121   DILSPT--DVPLVVQSFFDHDRAVNHDGHTTSLLTAKVTELVDGVFIGLSMNHCLGDGTS  178

Query  1067  FWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATFSGDEP-----  912
             +WNFFNT++EI +           G +   ++P VL   FP G GP  +    +P     
Sbjct  179   YWNFFNTWSEIFQAQ---------GSNITLSNPPVLDRCFPEGHGPIISLPFTDPSEFID  229

Query  911   ------IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASE  750
                   +RE++FHF+ E++  +K +AN+   CN                          +
Sbjct  230   RFEAPKLRERMFHFSSESLANLKAKANSE--CNTR------------------------K  263

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA-  573
             IS+FQ+LSA +WR++TRAR L   + T+ R+A N R RL+P L P YFGN++  I +   
Sbjct  264   ISTFQALSALVWRTITRARFLPPDQETSCRLAANNRARLDPPLAPNYFGNSVYPITSKPI  323

Query  572   KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPR  393
             KAGELL H L WAA  +HR VV  +   ++  +     +P +F L  FD   + MGSSPR
Sbjct  324   KAGELLDHGLGWAAFKVHRAVVNLNHQALKGFLDHLLKSPTVFSLRYFDPFSVMMGSSPR  383

Query  392   FPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEY  213
             F MY N+FG G+ +A+RSG ANKF GK+S+F G E  GS+DLEV L PE M  LE+D+E+
Sbjct  384   FDMYRNEFGMGKAVALRSGYANKFSGKVSSFQGGEA-GSIDLEVCLPPEAMRALESDVEF  442

Query  212   MQYVS*IQFDH  180
             M+  S   +D 
Sbjct  443   MEAASVASYDQ  453



>ref|XP_003523950.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47848.1| N-hydroxycinnamoyl/benzoyltransferase 6 [Glycine max]
Length=461

 Score =   275 bits (704),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 177/449 (39%), Positives = 255/449 (57%), Gaps = 64/449 (14%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal-------isllklslskalAHFPALAGRLHTDAKGH-  1314
             MLS  YIQKG+L  +P     +        +  LK SLS  L HF  LAGRL T      
Sbjct  37    MLSAHYIQKGLLFKKPSSPLVSHNNFIENLLQKLKHSLSLTLFHFYPLAGRLVTHQTHDP  96

Query  1313  ----VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 V++  +N +G  F+HA      +  L P   D+P   +S F +   +++ GH+ PL
Sbjct  97    PFYAVFVDCNNSDGARFIHATLDMTISDILSPV--DVPPIVQSLFDHHKAVNHDGHTMPL  154

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             +++QVTE  D VF+GC+MNH + DGTS+WNFFNT+++I +       V     D   + P
Sbjct  155   LSVQVTEFVDGVFIGCSMNHTLGDGTSYWNFFNTWSQIFQ-------VQGHEHDVPISHP  207

Query  968   AVLK--FPAG-GPAATF----------SGDEPI-REKIFHFTREAILKMKFRANNGKLCN  831
              +    FP G GP                + P+ RE+IFHF+ E+I K+K +AN+   CN
Sbjct  208   PIHNRWFPEGCGPLINLPFKHHDDFINRYETPLLRERIFHFSAESIAKLKAKANSE--CN  265

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
                                      ++ISSFQSLSA +WR +TRAR+L   + T+ +++ 
Sbjct  266   ------------------------TTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSA  301

Query  650   NCRHRLEPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
             N R R+EP L   YFGN+I ++    A +G+LL + + WAA  LH++VV H+D  V   +
Sbjct  302   NNRTRMEPPLPQEYFGNSIYTLNAGTATSGKLLENGIGWAAWKLHKSVVNHNDRAVLETL  361

Query  473   QDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFP  297
             ++W  +P ++ LG  FD   + MGSSPRF MY N+FG G+ +A+RSG ANKFDGK++++P
Sbjct  362   KEWLESPLIYDLGRYFDPYCVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFDGKVTSYP  421

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEYM  210
             G EG GSVDLEV L+P  M+ LE+D E+M
Sbjct  422   GHEGGGSVDLEVCLSPAVMSALESDEEFM  450



>gb|KGN55210.1| hypothetical protein Csa_4G640960 [Cucumis sativus]
Length=454

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 181/440 (41%), Positives = 247/440 (56%), Gaps = 47/440 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaa-------lisllklslskalAHFPALAGRLHT-----D  1326
             MLS  YIQKG+L ++P             L+  LK SLS AL HF  LAGRL T     +
Sbjct  38    MLSMHYIQKGLLYAKPLATLDDCSGFIDDLLRKLKHSLSIALVHFYPLAGRLVTTRYEDE  97

Query  1325  AKGHVYILSNDE-GIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
             A   VY+  ND  G +F+HA+     +  L P   D+P    SFF +D  +++ GHS+PL
Sbjct  98    ASCLVYVDCNDSLGAKFIHARVDMTISDVLSPG--DVPLIVESFFDHDRAVNHDGHSRPL  155

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK---KISRVPDFGRDTVF  978
             ++IQVTEL D VF+GC++NH++VDGTS+W+FFN ++EI +       ISR P   R    
Sbjct  156   LSIQVTELHDGVFIGCSINHSIVDGTSYWHFFNMWSEIFEAQDDNVSISRPPILQRWFPE  215

Query  977   NSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGK  804
                 +LK P   P    +  E   + +K FHF+ E++  +K RAN     N         
Sbjct  216   GHGPILKLPFTHPDQFINRFEAPELSKKHFHFSSESVAVLKKRANTEYKTN---------  266

Query  803   ITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPR  624
                              +ISSFQSLSA +WRS+TR R+L   +T    MAIN R RL+P 
Sbjct  267   -----------------KISSFQSLSALVWRSITRVRELPPDQTIGCIMAINNRSRLDPP  309

Query  623   LKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLF  444
             L   YFGN+I +I  VA   ELL ++L WAA  LH  VV H D+ VR  ++ W  +P ++
Sbjct  310   LSENYFGNSIHTIKGVATVKELLENNLGWAAWKLHEAVVNHKDSIVRDFVKKWVESPSIY  369

Query  443   PL-GNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDL  267
              + G FD   + +GSSPRF  Y N FG G+ + +RSG A+KFDG ++ +PG EG GS++L
Sbjct  370   RIAGMFDPLSVMIGSSPRFNKYGNVFGMGKAVGIRSGYAHKFDGIVTCYPGHEGGGSIEL  429

Query  266   EVVLAPETMAGLENDMEYMQ  207
             E+ L    MA LE D E+M 
Sbjct  430   EICLPLHFMAALEADGEFMD  449



>gb|KHN04491.1| Putative acetyltransferase [Glycine soja]
Length=461

 Score =   275 bits (703),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 177/450 (39%), Positives = 255/450 (57%), Gaps = 64/450 (14%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal-------isllklslskalAHFPALAGRLHTDAKGH-  1314
             MLS  YIQKG+L  +P     +        +  LK SLS  L HF  LAGRL T      
Sbjct  37    MLSAHYIQKGLLFKKPSSPLVSHNNFIENLLEKLKHSLSLTLFHFYPLAGRLVTHQTHDP  96

Query  1313  ----VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 V++  +N +G  F+HA      +  L P   D+P   +S F +   +++ GH+ PL
Sbjct  97    PFYAVFVDCNNSDGARFIHATLDMTISDILSPV--DVPPIVQSLFDHHKAVNHDGHTMPL  154

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             +++QVTE  D VF+GC+MNH + DGTS+WNFFNT+++I +       V     D   + P
Sbjct  155   LSVQVTEFVDGVFIGCSMNHTLGDGTSYWNFFNTWSQIFQ-------VQGHEHDVPISHP  207

Query  968   AVLK--FPAG-GPAATF----------SGDEPI-REKIFHFTREAILKMKFRANNGKLCN  831
              +    FP G GP                + P+ RE+IFHF+ E+I K+K +AN+   CN
Sbjct  208   PIHNRWFPEGCGPLINLPFKHHDDFINRYETPLLRERIFHFSAESIAKLKAKANSE--CN  265

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
                                      ++ISSFQSLSA +WR +TRAR+L   + T+ +++ 
Sbjct  266   ------------------------TTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSA  301

Query  650   NCRHRLEPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
             N R R+EP L   YFGN+I ++    A +G+LL + + WAA  LH++VV H+D  V   +
Sbjct  302   NNRTRMEPPLPQEYFGNSIYTLNAGTATSGKLLENGIGWAAWKLHKSVVNHNDRAVLETL  361

Query  473   QDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFP  297
             ++W  +P ++ LG  FD   + MGSSPRF MY N+FG G+ +A+RSG ANKFDGK++++P
Sbjct  362   KEWLESPLIYDLGRYFDPYCVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFDGKVTSYP  421

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEYMQ  207
             G EG GSVDLEV L+P  M+ LE+D E+M 
Sbjct  422   GHEGGGSVDLEVCLSPAVMSALESDEEFMN  451



>gb|ABC47861.1| N-hydroxycinnamoyl/benzoyltransferase 2 [Glycine max]
Length=436

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 175/446 (39%), Positives = 244/446 (55%), Gaps = 50/446 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaa------alisllklslskalAHFPALAGRL--HTDAKGH  1314
             MLS  YIQKG+L  +P            L+  LK SLS  L+HF  LAGRL  H      
Sbjct  15    MLSMHYIQKGLLFKKPTPLVDRHDFIGNLLGKLKHSLSLTLSHFYPLAGRLVTHQTQNPP  74

Query  1313  VYILS----NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              Y +S    N +G  F++A      +  L P   DIP   +S F +   L++ GH+ PL+
Sbjct  75    SYTVSVDCKNSDGARFIYATLDMTISDILSPV--DIPLVVQSLFDHHKALNHDGHTMPLL  132

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRD  987
             +IQVTEL D VF+GC+MNH+V DGTS+WNFFNT++ I +   +       IS  P   R 
Sbjct  133   SIQVTELVDGVFIGCSMNHSVGDGTSYWNFFNTWSHIFQAQAQGHETDLPISHRPIHSRW  192

Query  986   TVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKL  813
                +    +  P        S  E   +RE++F F+ E+I K+K +AN            
Sbjct  193   FPNDCAPPINLPFKHHDEFISRFEAPLMRERVFQFSAESIAKLKAKANME----------  242

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                ++ISSFQSLSA +WRS+TRA  L   + T+ R+  N R R+
Sbjct  243   ----------------SNTTKISSFQSLSAHVWRSITRACSLPYEQRTSCRLTANSRTRM  286

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             EP L   YFGN++  +      GELL +DL WAA  LH  V  H++  V + +++W  +P
Sbjct  287   EPPLPQEYFGNSVNRVSAETTVGELLENDLGWAAWKLHMAVANHNNKVVLQSLKEWLQSP  346

Query  452   RLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGS  276
              ++ +G   D  ++ + SSPRF MY N+FG G+ +A RSG ANKFDGK++++PGREG GS
Sbjct  347   LIYQIGQAMDPYVVLISSSPRFNMYGNEFGMGKAVAARSGYANKFDGKVTSYPGREGGGS  406

Query  275   VDLEVVLAPETMAGLENDMEYMQYVS  198
             +DLEV L P  M+ LE+D E+M  VS
Sbjct  407   IDLEVGLLPHIMSALESDREFMNAVS  432



>ref|XP_008220251.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Prunus 
mume]
Length=459

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 199/490 (41%), Positives = 266/490 (54%), Gaps = 67/490 (14%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPld------  1413
             M S S+  IS+C V P + S  SK        DL MLS  YIQKG+L S+PP        
Sbjct  1     MNSPSVKYISECFVQPHHASEESKQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLGQEG  60

Query  1412  -aaalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphl  1254
                +L+  LK SLS AL  F  LAGR  T          VY+  +N  G +F++A     
Sbjct  61    FTNSLLERLKHSLSIALVRFYPLAGRFVTKKNEDPPLYLVYVDCNNSPGAKFIYATMDMS  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  L P+  D+P   +SFF +D  +++ GH+  L+ IQVTEL D +F+G +MNH + DG
Sbjct  121   ISDILSPT--DVPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDG  178

Query  1073  TSFWNFFNTYAEICKGAKKISR---VPDFGRDTVFNSPAVLK--FPAG-GPAATF---SG  921
             TS+W+FFN ++EI +   +      VP+  R      P VLK  FP G GP         
Sbjct  179   TSYWHFFNIWSEIFQAQAQGDHNNFVPNISR------PPVLKRWFPDGHGPIINLPFKHS  232

Query  920   DE--------PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNG  765
             DE         +RE++FHF+ E+I K+K +AN                            
Sbjct  233   DEFIGRYEAPKLRERMFHFSSESIAKLKAKANAES-------------------------  267

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                ++ISSFQSLSA +WRS+T AR L   + T+ R+A N R RLEP L   YFGN+I  I
Sbjct  268   -NTTKISSFQSLSALMWRSITHARGLPQDQGTSCRLAANNRGRLEPPLSGDYFGNSIHPI  326

Query  584   PT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITM  408
              + +  AGELL H L WAA  LH  VV H+D  +R  +  W  +P ++ L  FD   + M
Sbjct  327   RSEIVPAGELLEHGLGWAAWKLHEAVVNHNDKLIREHVDGWLKSPAVYQLSFFDPFSVMM  386

Query  407   GSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             GSSPRF +Y N FG G+ LA RSG ANKF GK+S++ GRE  GS+DLEV L P+ M+ LE
Sbjct  387   GSSPRFNLYGNQFGMGKALAPRSGYANKFSGKVSSYEGRE-EGSIDLEVCLPPDAMSVLE  445

Query  227   NDMEYMQYVS  198
              D E+M+  S
Sbjct  446   CDREFMEAAS  455



>ref|XP_004964259.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=469

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 182/442 (41%), Positives = 247/442 (56%), Gaps = 38/442 (9%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKG---HVYILS  1299
              LS  YIQKG+L + PP   A L+  L+ +L+ ALA +  +AGR  T+  G    V I  
Sbjct  40    FLSADYIQKGLLYAPPPFPTARLVDHLQAALADALAAYYPVAGRFVTEKHGGGCSVSIDC  99

Query  1298  NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSD  1119
             + +G++ +HA A  ++ A  +P  AD+PR   SFF  D  +++ GH  PL  +QVTEL+D
Sbjct  100   DGQGVDILHAVADGVAVADAIPPDADVPRLVHSFFPLDGAVNHDGHHLPLFVVQVTELAD  159

Query  1118  AVFVGCTMNHAVVDGTSFWNFFNTYAEICK-------GAKKIS----RVPDFGR---DTV  981
              VF+G   NHA+ DGT+FW+F N +A I +       G K+ +    + P   R   D+V
Sbjct  160   GVFIGFAYNHALSDGTAFWDFLNVWAGIARARLPLLSGGKEAASWDFQPPLLERWSPDSV  219

Query  980   FNSPAVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKI  801
                P VL FP           +P+RE++ HF+ E++  +K RA    L  G+        
Sbjct  220   -PGPVVLPFPDLTGLIDRLSPQPLRERMLHFSGESLAALKERARQELLAAGDAAG-----  273

Query  800   TPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRL  621
                           A+ ++ FQ+LS+ +WR VTRAR L A + T  R AIN R RL P+L
Sbjct  274   --------------AAAVTRFQALSSLVWRCVTRARSLPAEQPTACRAAINNRARLRPQL  319

Query  620   KPLYFGNAIQSIPTVA-KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLF  444
              P YFGN I +I T A +AGELL     WA   + R V AH DA +R  +  W   P ++
Sbjct  320   PPDYFGNTIYAISTEAVRAGELLERGHGWATAAMGRAVAAHTDADIRARVAAWMAKPVVY  379

Query  443   PLGNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLE  264
                 FD   + MGSSPRF MY  DFGWG+PLA RSG ANKFDGK S +PGR+  G +D E
Sbjct  380   TNRYFDPNCVMMGSSPRFDMYGCDFGWGKPLAARSGRANKFDGKASLYPGRDDGGGIDAE  439

Query  263   VVLAPETMAGLENDMEYMQYVS  198
             +VLAPE MA LE D E+   V+
Sbjct  440   LVLAPEHMARLEQDQEFWAAVT  461



>ref|XP_007221613.1| hypothetical protein PRUPE_ppb015328mg [Prunus persica]
 gb|EMJ22812.1| hypothetical protein PRUPE_ppb015328mg [Prunus persica]
Length=453

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 201/490 (41%), Positives = 264/490 (54%), Gaps = 73/490 (15%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPld------  1413
             M S S+  IS+C V P + S  SK        DL MLS  YIQKG+L S+PP        
Sbjct  1     MNSPSVKYISECFVQPHHASEESKQPFYLTPGDLAMLSVHYIQKGLLFSKPPEAKLGQED  60

Query  1412  -aaalisllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphl  1254
                +L+  LK SLS AL HF  LAGR  T+         VY+  +N  G +F++A     
Sbjct  61    FTNSLLERLKHSLSIALVHFYPLAGRFVTEKNEDPPLYLVYVDCNNSPGAKFINATLDMS  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  L P+  D P   +SFF +D  +++ GH+  L+ IQVTEL D +F+G +MNH + DG
Sbjct  121   ISDILSPT--DAPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDG  178

Query  1073  TSFWNFFNTYAEICKGAKKISR---VPDFGRDTVFNSPAVLK--FPAG-GPAATF---SG  921
             TS+W+FFN ++EI +   +      VP   R      P VLK  FP G GP         
Sbjct  179   TSYWHFFNIWSEIFQAQAQGDHNNFVPKISR------PPVLKRWFPDGHGPIINLPFKHS  232

Query  920   DE--------PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNG  765
             DE         +RE++FHF+ E+I K+K +AN                            
Sbjct  233   DEFIGRYEAPKLRERMFHFSSESIAKLKAKANAES-------------------------  267

Query  764   GAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSI  585
                ++ISSFQSLSA +WRS+TRAR L   + T      NCR RLEP L   YFGN+I  I
Sbjct  268   -NTTKISSFQSLSALMWRSITRARGLPRDQGT------NCRGRLEPPLSGDYFGNSIHPI  320

Query  584   PT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITM  408
              + +  AGELL H L WAA  LH  VV H+D  +R  +  W  +P ++ L  FD   + M
Sbjct  321   RSEIVPAGELLEHGLGWAAWKLHEAVVNHNDKLIREHVDGWLKSPAVYQLSFFDPFSVMM  380

Query  407   GSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLE  228
             GSSPRF MY N FG G+ LA RSG ANKF GK+S++ GRE  GS+DLEV L P+ M+ LE
Sbjct  381   GSSPRFNMYGNQFGMGKALAPRSGYANKFSGKVSSYEGRE-EGSIDLEVCLPPDAMSALE  439

Query  227   NDMEYMQYVS  198
              D E+M+  S
Sbjct  440   CDSEFMEAAS  449



>ref|XP_003528298.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|KHN22331.1| Putative acetyltransferase [Glycine soja]
Length=457

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 175/446 (39%), Positives = 244/446 (55%), Gaps = 50/446 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaa------alisllklslskalAHFPALAGRL--HTDAKGH  1314
             MLS  YIQKG+L  +P            L+  LK SLS  L+HF  LAGRL  H      
Sbjct  36    MLSMHYIQKGLLFKKPTPLVDRHDFIGNLLGKLKHSLSLTLSHFYPLAGRLVTHQTQNPP  95

Query  1313  VYILS----NDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLM  1146
              Y +S    N +G  F++A      +  L P   DIP   +S F +   L++ GH+ PL+
Sbjct  96    SYTVSVDCKNSDGARFIYATLDMTISDILSPV--DIPLVVQSLFDHHKALNHDGHTMPLL  153

Query  1145  AIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKK-------ISRVPDFGRD  987
             +IQVTEL D VF+GC+MNH+V DGTS+WNFFNT++ I +   +       IS  P   R 
Sbjct  154   SIQVTELVDGVFIGCSMNHSVGDGTSYWNFFNTWSHIFQAQAQGHETDLPISHRPIHSRW  213

Query  986   TVFNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKL  813
                +    +  P        S  E   +RE++F F+ E+I K+K +AN            
Sbjct  214   FPNDCAPPINLPFKHHDEFISRFEAPLMRERVFQFSAESIAKLKAKANME----------  263

Query  812   NGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRL  633
                                ++ISSFQSLSA +WRS+TRA  L   + T+ R+  N R R+
Sbjct  264   ----------------SNTTKISSFQSLSAHVWRSITRACSLPYEQRTSCRLTANSRTRM  307

Query  632   EPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNP  453
             EP L   YFGN++  +      GELL +DL WAA  LH  V  H++  V + +++W  +P
Sbjct  308   EPPLPQEYFGNSVNRVSAETTVGELLENDLGWAAWKLHMAVANHNNKVVLQSLKEWLQSP  367

Query  452   RLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGS  276
              ++ +G   D  ++ + SSPRF MY N+FG G+ +A RSG ANKFDGK++++PGREG GS
Sbjct  368   LIYQIGQAMDPYVVLISSSPRFNMYGNEFGMGKAVAARSGYANKFDGKVTSYPGREGGGS  427

Query  275   VDLEVVLAPETMAGLENDMEYMQYVS  198
             +DLEV L P  M+ LE+D E+M  VS
Sbjct  428   IDLEVGLLPHIMSALESDREFMNAVS  453



>ref|XP_006354860.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X3 [Solanum tuberosum]
Length=457

 Score =   274 bits (700),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 190/481 (40%), Positives = 268/481 (56%), Gaps = 53/481 (11%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnsks-lklsvsdLPMLSCQYIQKGVLLSQPPldaaa-lisl  1392
             S ++  IS C + P Y S  +K  + LS  DL MLS QYIQKG+L ++P       L+  
Sbjct  4     SPTVQHISDCFIKPLYNSEEAKKPVYLSSWDLAMLSVQYIQKGLLFTKPSSFQLDPLLQK  63

Query  1391  lklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphlsaaallps  1230
             LK SLS  L HF  LAGR  T  + +     V+I   N  G  F+HA      +  L P 
Sbjct  64    LKDSLSITLVHFYPLAGRFKTLKQENPPLYTVFIDCVNSPGARFIHANLDLTVSDILSPK  123

Query  1229  hADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFN  1050
               D+P   +SFF +D  +++ GH   L+ +Q+TEL D VF+G ++NH + DG+SFW+FFN
Sbjct  124   --DVPLVVQSFFDHDRAINHDGHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFWHFFN  181

Query  1049  TYAEICK---GAKK---ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IREKIF  894
             +++E+ K   G K+   IS+ P+F          ++  P        S  E   +RE+ F
Sbjct  182   SFSEVFKANNGQKQSIPISKSPNFNHWFPEGHGPIINLPYTHHDQFISRHESPNLRERFF  241

Query  893   HFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLW  714
             HF+ E++ K+K +AN    C+                         S+ISS Q+LSA +W
Sbjct  242   HFSAESLKKLKAKANQE--CH------------------------TSKISSLQALSAHMW  275

Query  713   RSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWA  534
             R +TR RK  A   T+ RMAIN R RLEP L   YFGN IQ++   A  G+LL ++L WA
Sbjct  276   RCITRVRKFPADHVTSCRMAINNRARLEPPLPENYFGNCIQTVRRNASVGKLLENNLGWA  335

Query  533   AEMLHRNVVAHDDATVRRGIQDWE---------NNPRLFPLGNFDGAMITMGSSPRFPMY  381
             A  LH+ VV H +  +R  ++  E          +  ++ LG FD + + MGSSPRF MY
Sbjct  336   AWELHQAVVNHKNKEIREWVEKLEYIREWVEKLESGMIYQLGFFDPSSVMMGSSPRFDMY  395

Query  380   DNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYV  201
              N+FG G+ +A+RSG A+KFDGK+S + G EG+GS+DLEV L P+ MA LE D E+M  +
Sbjct  396   GNEFGLGKGVALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPDFMASLETDKEFMDSL  455

Query  200   S  198
             S
Sbjct  456   S  456



>ref|XP_009365277.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=458

 Score =   273 bits (699),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 189/487 (39%), Positives = 269/487 (55%), Gaps = 62/487 (13%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsv-sdLPMLSCQYIQKGVLLSQPPldaaalis  1395
             M S ++  IS+C ++P + S  SK       +DL +LS  YIQ+G+L S+PP       S
Sbjct  1     MSSKNVKQISECLIHPHHASEESKKPFYLTPNDLALLSVHYIQRGLLFSKPPEAMLDQKS  60

Query  1394  ll-------klslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphl  1254
                      K SLS AL HF  LAGRL T          VY+  +N  G +F++A     
Sbjct  61    FTNSLLERLKQSLSIALVHFYPLAGRLVTKKSEDPVLYLVYVDCNNSPGAKFIYATLDLS  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  LLP   D+P   +SFF +D  +++ GH+  L+ IQVTEL D +F+G +MNH + DG
Sbjct  121   ISDILLPI--DVPLVVQSFFDHDRAVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDG  178

Query  1073  TSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAATF---SGDE-  915
             TSFW+FFN ++EI +   +     D       + P VL+  FP G GP  +      DE 
Sbjct  179   TSFWHFFNIWSEIFQAQAQ----GDNNSVATISRPPVLERWFPDGHGPIISLPFKHSDEF  234

Query  914   -------PIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAA  756
                    P+RE++FHF+ E++ K+K +AN                               
Sbjct  235   IGRFEAPPLRERMFHFSAESLAKLKAKANAE--------------------------SDT  268

Query  755   SEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPT-  579
             ++ISSFQSLSA LWRS+TRAR     + T+ R+A N R RL+P L   YFGN+I  I + 
Sbjct  269   TKISSFQSLSALLWRSITRARCQPPDQGTSCRLAANNRARLDPPLSGDYFGNSIYPISSK  328

Query  578   VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSS  399
             +  AGELL H L WAA  LH  VV H+D  +R     W  +P ++ +  F+   +T+GSS
Sbjct  329   MVPAGELLEHGLGWAARKLHEAVVNHNDKVIREHTNAWLESPVVYQVSVFEPLSVTIGSS  388

Query  398   PRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDM  219
             PRF MY  +FG G+ +A+RSG A+KF GK+S++ GR+  GS+D+EV L P+ M+ LE D 
Sbjct  389   PRFNMYGTEFGMGKAVALRSGYAHKFSGKVSSYEGRK-EGSMDMEVCLVPDAMSALECDK  447

Query  218   EYMQYVS  198
             E+M++ S
Sbjct  448   EFMEFAS  454



>ref|XP_009613516.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
tomentosiformis]
Length=452

 Score =   273 bits (698),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 272/484 (56%), Gaps = 59/484 (12%)
 Frame = -3

Query  1571  MPSSSIVV--ISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPldaaal  1401
             M SSS  V  IS+C + P Y+S  SK      S DL MLS  YIQKG+L ++P      +
Sbjct  1     MSSSSPTVQHISECFIKPLYESEESKKPVYLSSWDLAMLSVHYIQKGLLFTKPSSFKLDI  60

Query  1400  -isllklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphlsaaa  1242
              +  LK SLS  L  F  LAGRL T  + +     V+I   N  G  F+HA      +  
Sbjct  61    FLQKLKESLSLTLVQFYPLAGRLSTLKQENPPLYTVFIDCVNTPGARFIHANLDLTISDI  120

Query  1241  llpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFW  1062
             L P   D+P   +SFF +D  +++ GH   L+ IQVTEL D VF+GC++NH + DG+SFW
Sbjct  121   LSPK--DVPLVVQSFFDHDKAINHDGHELSLLTIQVTELIDGVFIGCSINHVLADGSSFW  178

Query  1061  NFFNTYAEICKG--AKKISRVPDFGRDTVFNSPAVLK--FPAG-GPAA----------TF  927
              FFNT++EI K    +K   +P     ++  SP +    FP G GP            T 
Sbjct  179   LFFNTFSEIFKANNGQKKQNIPI----SISKSPPIHNHWFPKGHGPIINLPYTHHNQFTS  234

Query  926   SGDEP-IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASE  750
               + P +RE+ FHF+  ++ K+K +AN    CN                         ++
Sbjct  235   RHEAPNMRERFFHFSAVSLKKLKAKANIE--CN------------------------TTK  268

Query  749   ISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAK  570
             IS+ Q+LSA +WR +T+ R   + + T+ RMAIN R RL+P L   YFGN IQ++   A 
Sbjct  269   ISTLQALSAHMWRCITKVRNFPSDQMTSCRMAINNRARLDPPLPQEYFGNCIQTVRGNAT  328

Query  569   AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMITMGSSPRF  390
             A ELL  +L WAA  LH++V+ H++  +R  ++  E+   ++ +G FD   I MGSSPRF
Sbjct  329   ASELLDQNLGWAAMKLHKSVINHNNKEIREWVEKLESG-MVYQMGFFDPCSIMMGSSPRF  387

Query  389   PMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
              MY N+FG G+ +A+RSG ANKFDGK+S + G EG+GS+DLEV L PE MA LE+D E++
Sbjct  388   DMYGNEFGLGKGVALRSGYANKFDGKVSLYQGIEGDGSMDLEVCLLPEFMASLESDEEFI  447

Query  209   QYVS  198
               +S
Sbjct  448   DSLS  451



>gb|EPS73996.1| hypothetical protein M569_00760 [Genlisea aurea]
Length=430

 Score =   272 bits (696),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 160/422 (38%), Positives = 226/422 (54%), Gaps = 30/422 (7%)
 Frame = -3

Query  1466  LSCQYIQKGVLLSQPPldaaalisllklslskalAHFPALAGRLHTDAKGHVYILSNDEG  1287
             LS  YI+ G L   PP   + LI  LK +LS+ L HFP LAGRL TD +G VY+  ND+G
Sbjct  32    LSVPYIKMGYLFESPPFPTSELILKLKTALSRTLTHFPVLAGRLITDDEGFVYVTCNDQG  91

Query  1286  IEFVhakaphlsaaallpshAD-IPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVF  1110
              + +H     L+   L     D +P+     F  D  L   G SKPL+ +QVTEL+D V 
Sbjct  92    ADLIHVDGSSLTTRDLTEYSNDELPKHLNHCFPADLLLGSEGFSKPLLVVQVTELADGVS  151

Query  1109  VGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSPAVLKFPAG-GPAA  933
             +   M  A+ DG S+ NFF ++AE+  G  +I+  PDF RD++  S    K P+    + 
Sbjct  152   ITVNMREAIADGISYLNFFLSFAELSSGLTEITHFPDFHRDSILMSNVAPKLPSSIVQSG  211

Query  932   TFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAAS  753
              + G   + +K+F F +E I ++K + N                         +  G  +
Sbjct  212   NYLGKISVEQKVFKFRKETIQRLKTQIN-------------------------ETEGNNT  246

Query  752   EISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVA  573
             +ISS Q L A LWRS+TRAR L  SK T+F   INCRHR+EP+L P  FGNA+Q I   A
Sbjct  247   KISSLQCLFALLWRSITRARNLPPSKKTSFMFTINCRHRVEPKLDPFCFGNAVQIINVTA  306

Query  572   KAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNFDGAMI-TMGSSP  396
              A E+  + L W A   +  V +HD + V+  ++ WE NP+       DG  +  +G SP
Sbjct  307   TAKEVAENGLFWCAREFNDMVTSHDFSAVKNHVETWEYNPQPLTEEILDGTKVYVVGFSP  366

Query  395   RFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDME  216
                M + DFGWG+P+++      + DG +   PGR+  G +DL ++LAPETM  LE D E
Sbjct  367   HLSMNEYDFGWGKPISILYREGVERDGMVIPIPGRD--GGIDLRLILAPETMKNLEGDPE  424

Query  215   YM  210
             +M
Sbjct  425   FM  426



>ref|XP_006354858.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum tuberosum]
Length=448

 Score =   273 bits (697),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 190/473 (40%), Positives = 269/473 (57%), Gaps = 46/473 (10%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnsks-lklsvsdLPMLSCQYIQKGVLLSQPPldaaa-lisl  1392
             S ++  IS C + P Y S  +K  + LS  DL MLS QYIQKG+L ++P       L+  
Sbjct  4     SPTVQHISDCFIKPLYNSEEAKKPVYLSSWDLAMLSVQYIQKGLLFTKPSSFQLDPLLQK  63

Query  1391  lklslskalAHFPALAGRLHTDAKGH-----VYI-LSNDEGIEFVhakaphlsaaallps  1230
             LK SLS  L HF  LAGR  T  + +     V+I   N  G  F+HA      +  L P 
Sbjct  64    LKDSLSITLVHFYPLAGRFKTLKQENPPLYTVFIDCVNSPGARFIHANLDLTVSDILSPK  123

Query  1229  hADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFN  1050
               D+P   +SFF +D  +++ GH   L+ +Q+TEL D VF+G ++NH + DG+SFW+FFN
Sbjct  124   --DVPLVVQSFFDHDRAINHDGHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFWHFFN  181

Query  1049  TYAEICK---GAKK---ISRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--IREKIF  894
             +++E+ K   G K+   IS+ P+F          ++  P        S  E   +RE+ F
Sbjct  182   SFSEVFKANNGQKQSIPISKSPNFNHWFPEGHGPIINLPYTHHDQFISRHESPNLRERFF  241

Query  893   HFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLW  714
             HF+ E++ K+K +AN  + C+                         S+ISS Q+LSA +W
Sbjct  242   HFSAESLKKLKAKAN--QECH------------------------TSKISSLQALSAHMW  275

Query  713   RSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWA  534
             R +TR RK  A   T+ RMAIN R RLEP L   YFGN IQ++   A  G+LL ++L WA
Sbjct  276   RCITRVRKFPADHVTSCRMAINNRARLEPPLPENYFGNCIQTVRRNASVGKLLENNLGWA  335

Query  533   AEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF-DGAMITMGSSPRFPMYDNDFGWGR  357
             A  LH+ VV H +  +R  ++  E    ++ LG+F D   I +GSSPRF MY N+FG+G+
Sbjct  336   AWELHQAVVNHKNKEIREWVEKLECG-VVYQLGSFCDPCSIVIGSSPRFDMYGNEFGFGK  394

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
              +A+RSG A+KFDGK+S + G EG+GS+DLEV L P+ MA LE D E+M  +S
Sbjct  395   GVALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPDFMASLETDKEFMDSLS  447



>ref|XP_003603061.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
Length=448

 Score =   273 bits (697),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 173/440 (39%), Positives = 239/440 (54%), Gaps = 44/440 (10%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaa---alisllklslskalAHFPALAGRLHTDAKGH-----  1314
             M S  YIQKG+L  +P         L+  LK SLS AL HF  L+GRL T          
Sbjct  36    MSSMNYIQKGLLFKKPNNQQHFIHNLLEKLKHSLSLALFHFYPLSGRLVTQKSQDPPTYN  95

Query  1313  --VYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAI  1140
               V   +N+ G  F+HA      +  + P   D+P   +S F  +  +++ GH+ PL++I
Sbjct  96    IFVDCSNNNSGARFIHATLDATVSDIMTPI--DVPSVVKSLFDLNKAINHDGHTMPLLSI  153

Query  1139  QVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK---KISRVPDFGRDTVFNSP  969
             QVTEL D VF+GC+MNH + DGTS+WNFFNT++EI +G     +ISR P   R       
Sbjct  154   QVTELVDGVFIGCSMNHYIGDGTSYWNFFNTWSEIFQGQGHDVRISRQPSHIRWFPEGYG  213

Query  968   AVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITP  795
              ++  P        +  EP  +RE+ FHFT E+I K+K +AN     N            
Sbjct  214   PLINLPFKHHDEIITRYEPPKLRERFFHFTAESIAKLKAKANMESNTN------------  261

Query  794   VNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKP  615
                           +ISSFQSLSA +WR +TRAR L   + TT  +A+N R R++P L  
Sbjct  262   --------------KISSFQSLSAHVWRGITRARDLTNDQVTTCMLAVNNRPRMKPPLPK  307

Query  614   LYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG  435
              YFG ++ ++      GELL +DL WAA  +H  V  H D  +R+ ++ W  +P +  L 
Sbjct  308   EYFGTSVDTVSVKTTVGELLENDLGWAAWKVHSAVANHVDLEIRKMVKKWLESPMILSLK  367

Query  434   -NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVV  258
              +FD   + M SSPRF MY N+FG G+P+AV SG ANK DG ++A+ G EG GS+DLE+ 
Sbjct  368   HHFDAGSVAMISSPRFNMYGNEFGMGKPVAVLSGYANKCDGNVTAYEGHEGGGSMDLEIS  427

Query  257   LAPETMAGLENDMEYMQYVS  198
             L+P  M  LE D  +M  VS
Sbjct  428   LSPNVMRALELDQNFMNAVS  447



>gb|AES73312.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=449

 Score =   272 bits (696),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 173/440 (39%), Positives = 239/440 (54%), Gaps = 44/440 (10%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaa---alisllklslskalAHFPALAGRLHTDAKGH-----  1314
             M S  YIQKG+L  +P         L+  LK SLS AL HF  L+GRL T          
Sbjct  37    MSSMNYIQKGLLFKKPNNQQHFIHNLLEKLKHSLSLALFHFYPLSGRLVTQKSQDPPTYN  96

Query  1313  --VYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAI  1140
               V   +N+ G  F+HA      +  + P   D+P   +S F  +  +++ GH+ PL++I
Sbjct  97    IFVDCSNNNSGARFIHATLDATVSDIMTPI--DVPSVVKSLFDLNKAINHDGHTMPLLSI  154

Query  1139  QVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK---KISRVPDFGRDTVFNSP  969
             QVTEL D VF+GC+MNH + DGTS+WNFFNT++EI +G     +ISR P   R       
Sbjct  155   QVTELVDGVFIGCSMNHYIGDGTSYWNFFNTWSEIFQGQGHDVRISRQPSHIRWFPEGYG  214

Query  968   AVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITP  795
              ++  P        +  EP  +RE+ FHFT E+I K+K +AN     N            
Sbjct  215   PLINLPFKHHDEIITRYEPPKLRERFFHFTAESIAKLKAKANMESNTN------------  262

Query  794   VNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKP  615
                           +ISSFQSLSA +WR +TRAR L   + TT  +A+N R R++P L  
Sbjct  263   --------------KISSFQSLSAHVWRGITRARDLTNDQVTTCMLAVNNRPRMKPPLPK  308

Query  614   LYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG  435
              YFG ++ ++      GELL +DL WAA  +H  V  H D  +R+ ++ W  +P +  L 
Sbjct  309   EYFGTSVDTVSVKTTVGELLENDLGWAAWKVHSAVANHVDLEIRKMVKKWLESPMILSLK  368

Query  434   -NFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVV  258
              +FD   + M SSPRF MY N+FG G+P+AV SG ANK DG ++A+ G EG GS+DLE+ 
Sbjct  369   HHFDAGSVAMISSPRFNMYGNEFGMGKPVAVLSGYANKCDGNVTAYEGHEGGGSMDLEIS  428

Query  257   LAPETMAGLENDMEYMQYVS  198
             L+P  M  LE D  +M  VS
Sbjct  429   LSPNVMRALELDQNFMNAVS  448



>ref|XP_003523951.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47846.1| N-hydroxycinnamoyl/benzoyltransferase 4 [Glycine max]
Length=469

 Score =   273 bits (698),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 185/479 (39%), Positives = 260/479 (54%), Gaps = 49/479 (10%)
 Frame = -3

Query  1571  MPSSSIVVISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPld------  1413
             M + ++  IS+C V P+  +  S  +      D+ MLS  YIQKG+L  +P         
Sbjct  1     MSAPAVRRISECFVKPQLPNQVSNQICNLTHWDIAMLSTNYIQKGLLFKKPATTLVDQHH  60

Query  1412  -aaalisllklslskalAHFPALAGRL--HTDAKGHVYILS----NDEGIEFVhakaphl  1254
                 L+  LK SLS  L HF  LAGRL  H       Y +S    N +G  F++A +   
Sbjct  61    FMENLLEKLKHSLSLTLFHFYPLAGRLVTHQTHDPPSYSVSVDCKNSDGARFIYATSDIT  120

Query  1253  saaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDG  1074
              +  L P   D+P    SFF +   +++ GH+  L++IQVTEL DAVF+GC+MNH V DG
Sbjct  121   ISDILAPI--DVPPILHSFFDHHKAVNHDGHTMSLLSIQVTELVDAVFIGCSMNHVVGDG  178

Query  1073  TSFWNFFNTYAEICKGAKKI----SRVPDFGRDTVFNSPAVLKFPAGGPAATFSGDEP--  912
             TS+WNFFNT+++I +           VP   R    +    +  P        S  E   
Sbjct  179   TSYWNFFNTWSQIFQSQSHALGHEYDVPIHNRWFPKDCAPPINLPFIHHDEIISRYEAPK  238

Query  911   IREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQS  732
             +RE+IFHF+ E+I K+K +AN                          +    ++ISSFQS
Sbjct  239   LRERIFHFSAESIAKLKAKAN--------------------------SESNTTKISSFQS  272

Query  731   LSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLS  552
             LSA +WRSVTRAR     + TT R+A N R R+EP L   YFGN++  +      GELL 
Sbjct  273   LSALVWRSVTRARSPPNDQRTTCRLAANNRSRMEPPLPQEYFGNSVHVVSAETTTGELLE  332

Query  551   HDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDN  375
             + + WAA  LH  V  +++  V + ++ W  +P +  +G  FD   + MGSSPRF +Y N
Sbjct  333   NGIGWAAWKLHMAVANYNNGVVLQSLKVWLESPFVIQMGRFFDPYCVMMGSSPRFNVYGN  392

Query  374   DFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYMQYVS  198
             +FG G+ +A RSG ANKF+GK++++PGREG GS+DLEV L+PE M  LE+D E+M  VS
Sbjct  393   EFGMGKAVAARSGYANKFEGKVTSYPGREGGGSIDLEVCLSPENMTALESDEEFMNAVS  451



>gb|ACU18586.1| unknown [Glycine max]
Length=461

 Score =   273 bits (697),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 176/449 (39%), Positives = 254/449 (57%), Gaps = 64/449 (14%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaal-------isllklslskalAHFPALAGRLHTDAKGH-  1314
             MLS  YIQKG+L  +P     +        +  LK SLS  L HF  LAGRL T      
Sbjct  37    MLSAHYIQKGLLFKKPSSPLVSHNNFIENLLQKLKHSLSLTLFHFYPLAGRLVTHQTHDP  96

Query  1313  ----VYI-LSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
                 V++  +N +G  F+HA      +  L P   D+P   +S F +   +++ GH+ PL
Sbjct  97    PFYAVFVDCNNSDGARFIHATLDMTISDILSPV--DVPPIVQSLFDHHKAVNHDGHTMPL  154

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             +++QVTE  D VF+GC+MNH + DGTS+WNFFNT+++I +       V     D   + P
Sbjct  155   LSVQVTEFVDGVFIGCSMNHTLGDGTSYWNFFNTWSQIFQ-------VQGHEHDVPISHP  207

Query  968   AVLK--FPAG-GPAATF----------SGDEPI-REKIFHFTREAILKMKFRANNGKLCN  831
              +    FP G GP                + P+ RE+IFHF+ E+I K+K +AN+   CN
Sbjct  208   PIHNRWFPEGCGPLINLPFKHHDDFINRYETPLLRERIFHFSAESIAKLKAKANSE--CN  265

Query  830   GENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAI  651
                                      ++ISSFQSLSA +WR +TRAR+L   + T+ +++ 
Sbjct  266   ------------------------TTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSA  301

Query  650   NCRHRLEPRLKPLYFGNAIQSIPT-VAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGI  474
             N R R+EP L   YFGN+I ++    A +G+LL + + WAA  LH++VV H+D  V   +
Sbjct  302   NNRTRMEPPLPQEYFGNSIYTLNAGTATSGKLLENGIGWAAWKLHKSVVNHNDRAVLETL  361

Query  473   QDWENNPRLFPLGN-FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFP  297
             ++W  +P ++ LG  FD   + MGSSPRF MY  +FG G+ +A+RSG ANKFDGK++++P
Sbjct  362   KEWLESPLIYDLGRYFDLYCVMMGSSPRFNMYGKEFGMGKAVALRSGYANKFDGKVTSYP  421

Query  296   GREGNGSVDLEVVLAPETMAGLENDMEYM  210
             G EG GSVDLEV L+P  M+ LE+D E+M
Sbjct  422   GHEGGGSVDLEVCLSPAVMSALESDEEFM  450



>ref|XP_003603068.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73319.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=438

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 171/437 (39%), Positives = 236/437 (54%), Gaps = 50/437 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaali-------sllklslskalAHFPALAGRLHT------  1329
             MLS  Y QKG++  +P   +             LK SLS  L HF  L+GRL T      
Sbjct  36    MLSTHYNQKGLIFKKPTSSSLNQQHFIENLVEKLKHSLSLTLFHFYPLSGRLVTKKSEDP  95

Query  1328  DAKGHVYILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPL  1149
             D+        N  G +F+HA         L P   D+P    SFF +D  +++ GH+  L
Sbjct  96    DSYTVFVDCKNSPGAKFIHATLDITINDILTPI--DVPPIVHSFFDHDKAVNHDGHTMSL  153

Query  1148  MAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAKKISRVPDFGRDTVFNSP  969
             ++IQVTEL D VF+GC+MNH + DGT++WNFFNT++EI +  +   +    G   + N P
Sbjct  154   LSIQVTELVDGVFIGCSMNHCLCDGTAYWNFFNTFSEIFQNDRWFPQ----GYGPIINLP  209

Query  968   AVLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVN  789
                 F              +RE+IFHF+ E+I K+K +AN     N              
Sbjct  210   ----FKHHHEFVHRYETPILRERIFHFSVESIAKLKAKANAESNTN--------------  251

Query  788   HEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLY  609
                         +ISSFQSLSA +WRS+T AR+L+  + TT +MA N R R+EP L   Y
Sbjct  252   ------------KISSFQSLSALVWRSITHARQLQHGQRTTCKMATNNRTRMEPPLPKEY  299

Query  608   FGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLG-N  432
             FGN++  +      GELL +DL WAA  +H  +  HDD  VRR ++ W  +P L+ +   
Sbjct  300   FGNSLYVVSAETTVGELLENDLGWAAWKIHVAIANHDDKVVRRSVEKWFRSPFLYRMDLF  359

Query  431   FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLA  252
             FD   + +  SPRF  Y N+FG G+ LAVRSG ANKFDGK+ ++PG+EG GS+DLEV L+
Sbjct  360   FDPYTVMISGSPRFNTYGNEFGMGKALAVRSGYANKFDGKVISYPGQEGGGSIDLEVCLS  419

Query  251   PETMAGLENDMEYMQYV  201
             P+ M  LE + E+M  V
Sbjct  420   PKKMMVLETNEEFMNSV  436



>ref|XP_008452575.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=455

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 243/441 (55%), Gaps = 48/441 (11%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQP--------PldaaalisllklslskalAHFPALAGRLHT-----  1329
             MLS  YIQKG+L ++P              L+  LK SLS AL HF  LAGRL T     
Sbjct  38    MLSMHYIQKGLLYAKPLPTLDDDCSGFIDDLLRKLKHSLSIALVHFYPLAGRLVTIPYED  97

Query  1328  DAKGHVYILSNDE-GIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKP  1152
             +    VY+  ND  G +F+   A      + + S  D+P    SFF +D  +++ GHS+P
Sbjct  98    EGSCLVYVDCNDSLGAKFI--HARVDMTISDVLSPGDVPLIVESFFDHDRAVNHDGHSRP  155

Query  1151  LMAIQVTELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICKGAK---KISRVPDFGRDTV  981
             L++IQVTEL D VF+GC++NH++VDGTS+W+FFN ++EI +       ISR P   R   
Sbjct  156   LLSIQVTELHDGVFIGCSINHSIVDGTSYWHFFNMWSEIFEAEDDNVSISRPPILQRWFP  215

Query  980   FNSPAVLKFPAGGPAATFSGDEP--IREKIFHFTREAILKMKFRANNGKLCNGENGKLNG  807
                  +LK P   P    +  E   + +K FHF+ E++  +K RAN     N        
Sbjct  216   EGHGPILKLPFTHPDQFINRFEAPQLSKKHFHFSSESVAVLKKRANTEYKTN--------  267

Query  806   KITPVNHEPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEP  627
                               +ISSFQSLSA +WRS+TR R L   +T    MAIN R RL+P
Sbjct  268   ------------------KISSFQSLSALVWRSITRVRGLPPDQTIGCIMAINNRSRLDP  309

Query  626   RLKPLYFGNAIQSIPTVAKAGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRL  447
              L   YFGN+I +I  VA   ELL ++L WAA  LH  VV H D+ VR  ++ W  +P +
Sbjct  310   PLSENYFGNSIHTIKGVATVKELLGNNLGWAAWKLHEAVVNHKDSIVRDFVKKWVESPSI  369

Query  446   FPL-GNFDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVD  270
             + + G FD   + +GSSPRF  Y N FG G+ + +RSG A+KFDG ++ +PG EG GS++
Sbjct  370   YRIAGMFDPLSVMIGSSPRFNKYGNVFGMGKAVGIRSGYAHKFDGIVTCYPGYEGGGSIE  429

Query  269   LEVVLAPETMAGLENDMEYMQ  207
             LE+ L    MA LE D E+M 
Sbjct  430   LEICLPLHFMAALETDGEFMD  450



>ref|XP_010933132.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=452

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 174/435 (40%), Positives = 244/435 (56%), Gaps = 45/435 (10%)
 Frame = -3

Query  1469  MLSCQYIQKGVLLSQPPldaaalisllklslskalA-HFPALAGRLHTDAKGHV------  1311
             +LS +YIQKGVLL QPP  +A  I    LS       HF  LAGRL T    ++      
Sbjct  46    LLSIEYIQKGVLLPQPPNASADSILPRLLSSLSLALDHFFPLAGRLTTKEHQNISPPSLS  105

Query  1310  -YILSNDEGIEFVhakaphlsaaallpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQV  1134
              +I  ND+ +E +HA A  ++ + +L     +P   RSFF     + + GH  PL+A+QV
Sbjct  106   IFIDCNDQAVELIHAAAAKVTVSDILSPLY-VPTVVRSFFPLAGAVCHDGHLLPLLAVQV  164

Query  1133  TELSDAVFVGCTMNHAVVDGTSFWNFFNTYAEICK-GAKKISRVPDFGR---DTVFNSPA  966
             TEL+D VFVGC+ NHAVVDG+SFW+F N+++EI + G+ +ISR P   R   D V + P 
Sbjct  165   TELADGVFVGCSANHAVVDGSSFWHFLNSWSEISRTGSSQISRPPVLHRWFLDPV-SPPI  223

Query  965   VLKFPAGGPAATFSGDEPIREKIFHFTREAILKMKFRANNGKLCNGENGKLNGKITPVNH  786
             +L F +            I E I HF++++I K+K +AN     N               
Sbjct  224   LLPFSSHQEFIRRYITPRIDEAIIHFSKQSIQKLKAKANLEMKTN---------------  268

Query  785   EPGLQNGGAASEISSFQSLSAQLWRSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYF  606
                        ++SS Q+L A +WRSV RAR+LE  + T++ +AI  R R+EP L   YF
Sbjct  269   -----------QLSSLQALLAHVWRSVLRARRLEHDQETSYSLAIGDRWRIEPPLPANYF  317

Query  605   GNAIQSIPTVAK--AGELLSHDLSWAAEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGN  432
             GN+  S+   AK  AGE++   L W A  L+R V AH    V+  ++ W+ NP       
Sbjct  318   GNS--SLRATAKLLAGEVVDRGLGWVAWQLNRAVAAHTTTVVKSWLESWQQNPIFSYFDC  375

Query  431   FDGAMITMGSSPRFPMYDNDFGWGRPLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLA  252
              +   +  GSSPRF +Y NDFGWGRPLAVRSG+ANK DG +  + G E +GS+DLE+ L+
Sbjct  376   LETRNLAAGSSPRFDVYGNDFGWGRPLAVRSGIANKRDGNVMVYEGNE-DGSMDLEICLS  434

Query  251   PETMAGLENDMEYMQ  207
             P+ +A L  D E+M+
Sbjct  435   PQALASLLEDKEFME  449



>ref|XP_010692375.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Beta 
vulgaris subsp. vulgaris]
Length=457

 Score =   271 bits (692),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 180/469 (38%), Positives = 256/469 (55%), Gaps = 43/469 (9%)
 Frame = -3

Query  1565  SSSIVVISKCTVYPEYkssnskslklsvs-dLPMLSCQYIQKGVLLSQPPld-----aaa  1404
             SS++  IS+C + P+   S SK        DL MLS  YIQKG+L ++P +         
Sbjct  4     SSAVKHISECFIKPKLVDSISKQPYYVSPGDLAMLSAHYIQKGLLFTKPSVTDEEFDIET  63

Query  1403  lisllklslskalAHFPALAGRLHT--DAKGHVYILSND----EGIEFVhakaphlsaaa  1242
              +  LK SLS+ L +F   AG+L T  D   H  ++S D     G  F+HA         
Sbjct  64    FLEKLKDSLSRTLVYFYPFAGQLATQIDEDQHTSLISIDCEKGSGARFIHATLDMTIEDI  123

Query  1241  llpshADIPREFRSFFQYDSTLSYAGHSKPLMAIQVTELSDAVFVGCTMNHAVVDGTSFW  1062
             L P+  D+P   +SFF +   +++ GH++PL+++QVTEL D +F+GC+MNH V DGTS+W
Sbjct  124   LSPT--DVPEVVKSFFDHHKAVNHDGHTRPLLSVQVTELVDGIFIGCSMNHVVADGTSYW  181

Query  1061  NFFNTYAEICKGAKKIS--RVPDFGRDTVFNSPAVLKFPAGGPAATFSGDE--PIREKIF  894
             NF+N ++EI +    IS  ++P   R         +  P   P    S  E  P+REK+F
Sbjct  182   NFWNIWSEIHRQHSPISESKLPIHKRWFPEGHGPRITIPFTHPDEYISRYEAPPLREKMF  241

Query  893   HFTREAILKMKFRANNGKLCNGENGKLNGKITPVNHEPGLQNGGAASEISSFQSLSAQLW  714
             HF+ ++I K+K +AN                        +Q      EISS Q+LSA +W
Sbjct  242   HFSSKSISKLKAKAN------------------------MQVKETNKEISSLQALSALVW  277

Query  713   RSVTRARKLEASKTTTFRMAINCRHRLEPRLKPLYFGNAIQSIPTVAKAGELLSHDLSWA  534
             RS+TRAR L   + T   M  N R RL+P L   YFGN+I      A A E+L H L W 
Sbjct  278   RSITRARHLGGDQKTLCSMDANLRQRLDPPLPQSYFGNSIWVAKAAATADEVLEHSLGWT  337

Query  533   AEMLHRNVVAHDDATVRRGIQDWENNPRLFPLGNF-DGAMITMGSSPRFPMYDNDFGWGR  357
             AE L + V+   D  V+     W  +P ++ +  F +   I +GSSPRF MY NDFG G+
Sbjct  338   AEKLQKAVLELTDKRVQSVFNAWMKSPFVYQIDTFFEPNSIVIGSSPRFDMYGNDFGIGK  397

Query  356   PLAVRSGMANKFDGKISAFPGREGNGSVDLEVVLAPETMAGLENDMEYM  210
             P+A RSG ANKF GK++A+PG +G  S+DLE+ L P+ M+ LE+D E++
Sbjct  398   PVAARSGNANKFPGKVTAYPGSDGERSIDLEICLPPDVMSSLESDKEFI  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5024487909309