BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77746_g1_i1 len=1205 path=[1213:0-1204]

Length=1205
                                                                      Score     E

ref|XP_009631227.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    379   9e-126   
ref|XP_009766446.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    375   3e-124   
emb|CDP04479.1|  unnamed protein product                                373   3e-123   
ref|XP_009631228.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    368   2e-121   
ref|XP_009766445.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    362   7e-119   
ref|XP_010312742.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    358   2e-117   
ref|XP_006352358.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    356   1e-116   
ref|XP_006352357.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    356   1e-116   
ref|XP_004250553.2|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    354   4e-116   
ref|XP_010312743.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    352   3e-115   
ref|XP_011095963.1|  PREDICTED: probable long-chain-alcohol O-fat...    343   7e-112   
ref|XP_006352459.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    343   1e-111   
ref|XP_006352461.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    341   6e-111   
ref|XP_010312741.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    340   1e-110   
ref|XP_010312740.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    335   2e-108   
ref|XP_010090982.1|  hypothetical protein L484_013644                   318   5e-102   
ref|XP_006352460.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    318   9e-102   
ref|XP_007212540.1|  hypothetical protein PRUPE_ppa019416mg             315   1e-100   
ref|XP_008227483.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    310   9e-99    
ref|XP_007214572.1|  hypothetical protein PRUPE_ppa019907mg             306   2e-97    
ref|XP_008364074.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    306   6e-97    
ref|XP_009353571.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    305   2e-96    
ref|XP_002272250.3|  PREDICTED: acyl-CoA--sterol O-acyltransferase 1    301   5e-95    Vitis vinifera
emb|CBI29599.3|  unnamed protein product                                300   1e-94    
ref|XP_008384132.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    295   9e-93    
ref|XP_006352462.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    293   1e-92    
ref|XP_008349375.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    294   2e-92    
ref|XP_002308777.1|  hypothetical protein POPTR_0006s01140g             293   4e-92    Populus trichocarpa [western balsam poplar]
ref|XP_002322537.2|  hypothetical protein POPTR_0016s01640g             293   6e-92    Populus trichocarpa [western balsam poplar]
ref|XP_004295308.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    292   9e-92    
ref|XP_007052429.1|  Acyl-CoA sterol acyl transferase 1, putative       289   2e-90    
ref|XP_010090983.1|  hypothetical protein L484_013645                   287   1e-89    
ref|XP_004293358.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    286   2e-89    
ref|XP_010039853.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    285   4e-89    
ref|XP_002299545.2|  hypothetical protein POPTR_0001s09110g             285   6e-89    Populus trichocarpa [western balsam poplar]
gb|KDP39228.1|  hypothetical protein JCGZ_00985                         285   6e-89    
ref|XP_010052914.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    285   9e-89    
ref|XP_010039854.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    284   2e-88    
ref|XP_010090978.1|  hypothetical protein L484_013640                   284   2e-88    
ref|XP_002314065.1|  hypothetical protein POPTR_0009s05990g             282   5e-88    Populus trichocarpa [western balsam poplar]
ref|XP_008384133.1|  PREDICTED: acyl-CoA--sterol O-acyltransferase 1    282   1e-87    
ref|XP_008366078.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    282   1e-87    
emb|CAN64383.1|  hypothetical protein VITISV_017856                     282   2e-87    Vitis vinifera
ref|XP_010646195.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    281   2e-87    
ref|XP_010270116.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    281   2e-87    
ref|XP_011001005.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    281   4e-87    
ref|XP_003635026.2|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    281   5e-87    
ref|XP_009357550.1|  PREDICTED: acyl-CoA--sterol O-acyltransferase 1    280   1e-86    
ref|XP_007052430.1|  Acyl-CoA sterol acyl transferase 1, putative       277   1e-85    
ref|XP_011095962.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    276   3e-85    
ref|XP_002527947.1|  conserved hypothetical protein                     274   5e-85    Ricinus communis
ref|XP_002532421.1|  acyltransferase, putative                          274   1e-84    Ricinus communis
ref|XP_011029375.1|  PREDICTED: probable long-chain-alcohol O-fat...    274   1e-84    
ref|XP_011025512.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    273   2e-84    
ref|XP_010052915.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    272   5e-84    
ref|XP_007020661.1|  Acyltransferase, putative                          270   2e-83    
ref|XP_008231533.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    270   3e-83    
ref|XP_010273158.1|  PREDICTED: probable long-chain-alcohol O-fat...    268   1e-82    
gb|KCW77067.1|  hypothetical protein EUGRSUZ_D01409                     268   3e-82    
gb|KHN40830.1|  Acyl-CoA--sterol O-acyltransferase 1                    268   3e-82    
ref|XP_003534825.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    268   3e-82    
ref|XP_004288487.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    267   4e-82    
ref|XP_008358814.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    267   5e-82    
ref|XP_004305405.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    268   5e-82    
ref|XP_007026258.1|  Acyl-CoA sterol acyl transferase 1, putative       267   7e-82    
ref|XP_010253003.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    267   8e-82    
ref|XP_007213866.1|  hypothetical protein PRUPE_ppa018212mg             266   2e-81    
ref|XP_010052932.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    267   2e-81    
ref|XP_010052933.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    266   2e-81    
ref|XP_007220140.1|  hypothetical protein PRUPE_ppa019942mg             265   3e-81    
gb|KCW77066.1|  hypothetical protein EUGRSUZ_D01408                     265   5e-81    
ref|XP_010270117.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    265   7e-81    
ref|XP_008227482.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    265   7e-81    
ref|XP_010240864.1|  PREDICTED: probable long-chain-alcohol O-fat...    264   8e-81    
ref|XP_010252640.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    263   1e-80    
ref|XP_002322536.2|  hypothetical protein POPTR_0016s01630g             262   2e-80    Populus trichocarpa [western balsam poplar]
gb|KCW54675.1|  hypothetical protein EUGRSUZ_I00619                     264   2e-80    
ref|XP_006373631.1|  hypothetical protein POPTR_0016s01630g             263   4e-80    
ref|XP_010052926.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    263   5e-80    
ref|XP_006438928.1|  hypothetical protein CICLE_v10031885mg             262   7e-80    
ref|XP_011001006.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    262   9e-80    
ref|XP_011097818.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    260   2e-79    
ref|XP_007219317.1|  hypothetical protein PRUPE_ppa019024mg             259   3e-79    
ref|XP_002276902.2|  PREDICTED: probable long-chain-alcohol O-fat...    260   5e-79    Vitis vinifera
ref|XP_011025514.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    258   1e-78    
ref|XP_002313330.2|  hypothetical protein POPTR_0009s05970g             257   4e-78    Populus trichocarpa [western balsam poplar]
ref|XP_002276950.1|  PREDICTED: probable long-chain-alcohol O-fat...    257   4e-78    Vitis vinifera
ref|XP_006482942.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    257   6e-78    
ref|XP_003600196.1|  Annotation was added to scaffolds in Novembe...    256   7e-78    
ref|XP_006586110.1|  PREDICTED: probable long-chain-alcohol O-fat...    254   4e-77    
gb|AFK35478.1|  unknown                                                 253   5e-77    
ref|XP_002313329.1|  hypothetical protein POPTR_0009s05980g             254   6e-77    Populus trichocarpa [western balsam poplar]
ref|XP_009361072.1|  PREDICTED: probable long-chain-alcohol O-fat...    254   6e-77    
ref|XP_009361071.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    253   8e-77    
ref|XP_002529023.1|  acyltransferase, putative                          253   9e-77    Ricinus communis
ref|XP_011025639.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    253   1e-76    
ref|XP_008227052.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    254   1e-76    
gb|AAO18666.1|  wax synthase isoform 3                                  253   1e-76    Vitis vinifera
ref|XP_009343635.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    253   2e-76    
ref|XP_007020663.1|  Wax synthase, putative                             253   2e-76    
ref|XP_009364188.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    250   2e-75    
gb|EYU27706.1|  hypothetical protein MIMGU_mgv1a025777mg                249   3e-75    
ref|XP_007211425.1|  hypothetical protein PRUPE_ppa007091mg             250   4e-75    
ref|XP_010030488.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    251   4e-75    
ref|XP_002527949.1|  acyltransferase, putative                          249   6e-75    Ricinus communis
ref|XP_004486217.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    249   1e-74    
ref|XP_011095804.1|  PREDICTED: probable long-chain-alcohol O-fat...    248   2e-74    
ref|XP_010052966.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    248   2e-74    
ref|XP_004295309.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    247   2e-74    
gb|KGN58563.1|  hypothetical protein Csa_3G684690                       247   4e-74    
gb|KHN11714.1|  Acyl-CoA--sterol O-acyltransferase 1                    246   6e-74    
ref|XP_004149740.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    246   7e-74    
ref|XP_007213137.1|  hypothetical protein PRUPE_ppa024118mg             246   1e-73    
ref|XP_009335436.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    245   2e-73    
ref|XP_006452483.1|  hypothetical protein CICLE_v10008717mg             245   2e-73    
ref|XP_008366430.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    245   2e-73    
emb|CAN76085.1|  hypothetical protein VITISV_034778                     244   4e-73    Vitis vinifera
ref|XP_003534380.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    243   5e-73    
ref|XP_002276970.2|  PREDICTED: probable long-chain-alcohol O-fat...    243   7e-73    Vitis vinifera
gb|KHN32969.1|  Long-chain-alcohol O-fatty-acyltransferase              243   7e-73    
ref|XP_002876112.1|  hypothetical protein ARALYDRAFT_485556             243   1e-72    
ref|XP_004516471.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    243   1e-72    
gb|KHM99510.1|  Putative long-chain-alcohol O-fatty-acyltransfera...    242   2e-72    
ref|XP_003530769.2|  PREDICTED: probable long-chain-alcohol O-fat...    242   2e-72    
emb|CDP13765.1|  unnamed protein product                                242   2e-72    
ref|XP_011025481.1|  PREDICTED: probable long-chain-alcohol O-fat...    241   3e-72    
ref|XP_002311581.1|  hypothetical protein POPTR_0008s14500g             241   3e-72    Populus trichocarpa [western balsam poplar]
ref|XP_008461834.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    241   3e-72    
ref|XP_011097128.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    243   4e-72    
gb|KDO62162.1|  hypothetical protein CISIN_1g037704mg                   241   4e-72    
ref|XP_006373630.1|  hypothetical protein POPTR_0016s01630g             241   5e-72    
ref|XP_007146545.1|  hypothetical protein PHAVU_006G049700g             241   5e-72    
emb|CBI26714.3|  unnamed protein product                                248   7e-72    
emb|CAN61366.1|  hypothetical protein VITISV_020586                     257   8e-72    Vitis vinifera
ref|XP_004500120.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    239   2e-71    
gb|EYU33682.1|  hypothetical protein MIMGU_mgv1a024355mg                239   2e-71    
ref|XP_008227051.1|  PREDICTED: probable long-chain-alcohol O-fat...    239   3e-71    
ref|XP_004241733.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    238   7e-71    
ref|XP_006452482.1|  hypothetical protein CICLE_v10008789mg             236   3e-70    
ref|XP_006474976.1|  PREDICTED: probable long-chain-alcohol O-fat...    236   3e-70    
gb|EPS66090.1|  wax synthase isoform 2                                  235   5e-70    
ref|XP_009335432.1|  PREDICTED: probable long-chain-alcohol O-fat...    236   5e-70    
gb|KEH17665.1|  membrane-bound O-acyltransferase family MBOAT pro...    236   6e-70    
emb|CDP02707.1|  unnamed protein product                                234   1e-69    
ref|XP_009364640.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    235   2e-69    
ref|NP_001240009.1|  uncharacterized protein LOC100809798               234   2e-69    
emb|CDY19924.1|  BnaC09g31900D                                          234   2e-69    
gb|ABD33005.1|  Membrane bound O-acyl transferase, MBOAT                234   5e-69    Medicago truncatula
ref|XP_009364639.1|  PREDICTED: probable long-chain-alcohol O-fat...    233   8e-69    
gb|KFK27129.1|  hypothetical protein AALP_AA8G338700                    232   9e-69    
emb|CDP19938.1|  unnamed protein product                                232   2e-68    
ref|XP_002529022.1|  acyltransferase, putative                          233   2e-68    Ricinus communis
ref|XP_003594218.1|  Annotation was added to scaffolds in Novembe...    234   2e-68    
gb|KCW77062.1|  hypothetical protein EUGRSUZ_D01403                     231   3e-68    
emb|CDX76699.1|  BnaC08g32850D                                          231   3e-68    
ref|XP_007131434.1|  hypothetical protein PHAVU_011G013200g             231   6e-68    
gb|EYU27396.1|  hypothetical protein MIMGU_mgv1a026777mg                230   8e-68    
ref|XP_009116999.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    229   9e-68    
ref|XP_004305991.1|  PREDICTED: probable long-chain-alcohol O-fat...    230   1e-67    
ref|XP_003530770.1|  PREDICTED: probable long-chain-alcohol O-fat...    229   2e-67    
ref|XP_002299916.2|  hypothetical protein POPTR_0001s26800g             229   2e-67    Populus trichocarpa [western balsam poplar]
gb|KCW77061.1|  hypothetical protein EUGRSUZ_D01403                     229   3e-67    
ref|NP_190765.1|  acyl-CoA sterol acyl transferase 1                    228   4e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDP13766.1|  unnamed protein product                                226   2e-66    
ref|XP_009120053.1|  PREDICTED: probable long-chain-alcohol O-fat...    225   5e-66    
emb|CDY17328.1|  BnaA10g09620D                                          224   1e-65    
ref|XP_010449529.1|  PREDICTED: probable long-chain-alcohol O-fat...    224   1e-65    
ref|XP_003610513.1|  hypothetical protein MTR_4g133020                  226   2e-65    
ref|XP_007142352.1|  hypothetical protein PHAVU_008G273300g             223   2e-65    
ref|XP_010449537.1|  PREDICTED: probable long-chain-alcohol O-fat...    223   2e-65    
ref|XP_010443158.1|  PREDICTED: probable long-chain-alcohol O-fat...    223   3e-65    
ref|XP_010060261.1|  PREDICTED: probable long-chain-alcohol O-fat...    223   4e-65    
ref|XP_004244080.1|  PREDICTED: probable long-chain-alcohol O-fat...    222   6e-65    
ref|XP_009784173.1|  PREDICTED: probable long-chain-alcohol O-fat...    222   9e-65    
ref|XP_003617668.1|  hypothetical protein MTR_5g094140                  225   1e-64    
ref|XP_007147656.1|  hypothetical protein PHAVU_006G143200g             222   1e-64    
ref|XP_006401462.1|  hypothetical protein EUTSA_v10014033mg             221   2e-64    
ref|XP_009115902.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    221   2e-64    
emb|CAN61367.1|  hypothetical protein VITISV_020587                     221   3e-64    Vitis vinifera
ref|XP_007146543.1|  hypothetical protein PHAVU_006G049500g             220   4e-64    
ref|NP_200346.1|  putative long-chain-alcohol O-fatty-acyltransfe...    220   5e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507638.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    219   6e-64    
ref|XP_010482974.1|  PREDICTED: probable long-chain-alcohol O-fat...    219   7e-64    
gb|AAO18665.1|  wax synthase isoform 2                                  219   8e-64    Vitis vinifera
ref|XP_010443156.1|  PREDICTED: probable long-chain-alcohol O-fat...    219   9e-64    
ref|XP_002276928.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    219   1e-63    Vitis vinifera
gb|KCW75715.1|  hypothetical protein EUGRSUZ_D00093                     219   2e-63    
gb|KFK27125.1|  hypothetical protein AALP_AA8G338100                    218   2e-63    
ref|XP_002866092.1|  hypothetical protein ARALYDRAFT_495620             218   2e-63    
ref|XP_004491443.1|  PREDICTED: probable long-chain-alcohol O-fat...    218   3e-63    
ref|XP_010060257.1|  PREDICTED: probable long-chain-alcohol O-fat...    217   5e-63    
gb|KGN58561.1|  hypothetical protein Csa_3G684670                       217   6e-63    
ref|XP_002866091.1|  long-chain-alcohol O-fatty-acyltransferase f...    217   7e-63    
ref|XP_006281726.1|  hypothetical protein CARUB_v10027883mg             217   8e-63    
ref|XP_010449487.1|  PREDICTED: probable long-chain-alcohol O-fat...    217   8e-63    
ref|XP_008448090.1|  PREDICTED: probable long-chain-alcohol O-fat...    217   1e-62    
ref|XP_010482976.1|  PREDICTED: LOW QUALITY PROTEIN: probable lon...    216   1e-62    
ref|NP_200345.1|  putative long-chain-alcohol O-fatty-acyltransfe...    216   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401463.1|  hypothetical protein EUTSA_v10015854mg             215   2e-62    
gb|KHN43857.1|  Putative long-chain-alcohol O-fatty-acyltransfera...    215   2e-62    
ref|XP_010503909.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    216   2e-62    
ref|XP_010515642.1|  PREDICTED: acyl-CoA--sterol O-acyltransferase 1    215   3e-62    
ref|XP_010059565.1|  PREDICTED: probable long-chain-alcohol O-fat...    214   3e-62    
ref|XP_008448089.1|  PREDICTED: probable long-chain-alcohol O-fat...    215   4e-62    
ref|XP_004244342.2|  PREDICTED: probable long-chain-alcohol O-fat...    215   4e-62    
ref|XP_009591431.1|  PREDICTED: probable long-chain-alcohol O-fat...    214   7e-62    
ref|XP_010686732.1|  PREDICTED: acyl-CoA--sterol O-acyltransferase 1    215   8e-62    
gb|AES63951.2|  membrane bound O-acyl transferase family protein,...    214   1e-61    
ref|XP_010426792.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    214   1e-61    
ref|XP_010545118.1|  PREDICTED: acyl-CoA--sterol O-acyltransferase 1    214   1e-61    
ref|XP_004173371.1|  PREDICTED: probable long-chain-alcohol O-fat...    214   1e-61    
ref|XP_007020660.1|  Acyltransferase, putative                          214   2e-61    
ref|XP_006282274.1|  hypothetical protein CARUB_v10028555mg             213   3e-61    
ref|XP_009120051.1|  PREDICTED: probable long-chain-alcohol O-fat...    213   4e-61    
ref|XP_004149741.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    212   6e-61    
ref|XP_010688612.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    212   7e-61    
ref|XP_006292828.1|  hypothetical protein CARUB_v10019087mg             211   9e-61    
ref|XP_009115900.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    211   1e-60    
ref|XP_010059563.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    211   2e-60    
gb|KCW75187.1|  hypothetical protein EUGRSUZ_E03938                     210   2e-60    
ref|XP_009107348.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    211   2e-60    
ref|XP_004151617.1|  PREDICTED: probable long-chain-alcohol O-fat...    211   2e-60    
gb|KGN44084.1|  hypothetical protein Csa_7G179120                       211   3e-60    
ref|XP_006401460.1|  hypothetical protein EUTSA_v10015320mg             209   5e-60    
ref|XP_002529021.1|  acyltransferase, putative                          209   6e-60    Ricinus communis
ref|XP_010693141.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    209   1e-59    
gb|EPS68808.1|  hypothetical protein M569_05960                         208   1e-59    
ref|XP_009127005.1|  PREDICTED: probable long-chain-alcohol O-fat...    208   2e-59    
ref|XP_007020662.1|  MBOAT family protein                               207   3e-59    
ref|XP_002532420.1|  acyltransferase, putative                          207   4e-59    Ricinus communis
gb|KCW75181.1|  hypothetical protein EUGRSUZ_E03931                     207   5e-59    
ref|NP_200347.1|  putative long-chain-alcohol O-fatty-acyltransfe...    206   6e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675843.1|  PREDICTED: probable long-chain-alcohol O-fat...    206   7e-59    
ref|XP_010063067.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    206   1e-58    
gb|KFK27009.1|  hypothetical protein AALP_AA8G322600                    206   1e-58    
ref|XP_010467019.1|  PREDICTED: probable long-chain-alcohol O-fat...    205   2e-58    
emb|CDY12003.1|  BnaC03g14290D                                          204   3e-58    
ref|XP_010488707.1|  PREDICTED: probable long-chain-alcohol O-fat...    204   3e-58    
ref|XP_007146544.1|  hypothetical protein PHAVU_006G049600g             204   4e-58    
ref|XP_004250264.2|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    206   5e-58    
ref|XP_002866093.1|  hypothetical protein ARALYDRAFT_495621             204   8e-58    
ref|XP_010057846.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    203   1e-57    
emb|CDY06589.1|  BnaC02g13130D                                          202   2e-57    
ref|XP_009631229.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    204   4e-57    
ref|XP_006352458.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    204   6e-57    
emb|CDY06586.1|  BnaC02g13100D                                          201   6e-57    
ref|XP_003593700.1|  Annotation was added to scaffolds in Novembe...    201   7e-57    
ref|XP_009127057.1|  PREDICTED: probable long-chain-alcohol O-fat...    201   1e-56    
ref|XP_006401465.1|  hypothetical protein EUTSA_v10015572mg             200   1e-56    
ref|XP_006346258.1|  PREDICTED: probable long-chain-alcohol O-fat...    205   2e-56    
ref|XP_006281729.1|  hypothetical protein CARUB_v10027886mg             199   3e-56    
ref|XP_008461836.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    199   3e-56    
gb|EPS62648.1|  hypothetical protein M569_12142                         199   4e-56    
ref|XP_006402271.1|  hypothetical protein EUTSA_v10006422mg             199   5e-56    
ref|XP_008231534.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    201   6e-56    
ref|XP_006280742.1|  hypothetical protein CARUB_v10026711mg             199   6e-56    
ref|XP_004149743.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    199   8e-56    
ref|XP_010485064.1|  PREDICTED: probable long-chain-alcohol O-fat...    198   1e-55    
ref|XP_009132393.1|  PREDICTED: probable long-chain-alcohol O-fat...    198   1e-55    
ref|XP_003553035.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    197   1e-55    
ref|XP_006395415.1|  hypothetical protein EUTSA_v10005628mg             198   1e-55    
emb|CDY20771.1|  BnaA02g09110D                                          197   2e-55    
gb|KFK27126.1|  hypothetical protein AALP_AA8G338200                    197   3e-55    
ref|XP_010675844.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    196   4e-55    
ref|XP_010443165.1|  PREDICTED: probable long-chain-alcohol O-fat...    196   4e-55    
ref|XP_010443164.1|  PREDICTED: probable long-chain-alcohol O-fat...    196   5e-55    
ref|NP_200349.1|  putative long-chain-alcohol O-fatty-acyltransfe...    196   6e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052920.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    191   8e-55    
ref|XP_009766443.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    200   9e-55    
ref|XP_010473574.1|  PREDICTED: probable long-chain-alcohol O-fat...    195   1e-54    
ref|XP_007020650.1|  MBOAT family protein                               195   1e-54    
ref|XP_009111746.1|  PREDICTED: probable long-chain-alcohol O-fat...    195   1e-54    
emb|CDY12000.1|  BnaC03g14260D                                          194   2e-54    
ref|XP_009120054.1|  PREDICTED: probable long-chain-alcohol O-fat...    195   2e-54    
ref|XP_008461835.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    195   2e-54    
ref|NP_174711.2|  MBOAT (membrane bound O-acyl transferase) famil...    194   4e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443157.1|  PREDICTED: probable long-chain-alcohol O-fat...    193   6e-54    
ref|NP_174709.1|  putative long-chain-alcohol O-fatty-acyltransfe...    193   7e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281991.1|  hypothetical protein CARUB_v10028218mg             193   7e-54    
ref|XP_006401461.1|  hypothetical protein EUTSA_v10015807mg             193   9e-54    
ref|XP_010482975.1|  PREDICTED: probable long-chain-alcohol O-fat...    193   1e-53    
ref|XP_010482979.1|  PREDICTED: probable long-chain-alcohol O-fat...    192   2e-53    
emb|CDY20767.1|  BnaA02g09070D                                          192   2e-53    
ref|XP_010040541.1|  PREDICTED: probable long-chain-alcohol O-fat...    192   3e-53    
ref|XP_010463134.1|  PREDICTED: LOW QUALITY PROTEIN: probable lon...    191   3e-53    
ref|XP_010443159.1|  PREDICTED: probable long-chain-alcohol O-fat...    191   3e-53    
gb|KFK28707.1|  hypothetical protein AALP_AA7G036400                    191   4e-53    
ref|XP_009132642.1|  PREDICTED: probable long-chain-alcohol O-fat...    191   6e-53    
ref|XP_010449511.1|  PREDICTED: probable long-chain-alcohol O-fat...    190   1e-52    
ref|XP_006603172.1|  PREDICTED: probable long-chain-alcohol O-fat...    189   2e-52    
emb|CDY06584.1|  BnaC02g13080D                                          189   2e-52    
ref|XP_010482977.1|  PREDICTED: probable long-chain-alcohol O-fat...    189   2e-52    
ref|XP_009127006.1|  PREDICTED: probable long-chain-alcohol O-fat...    189   3e-52    
ref|XP_009132394.1|  PREDICTED: probable long-chain-alcohol O-fat...    189   3e-52    
ref|XP_010446124.1|  PREDICTED: probable long-chain-alcohol O-fat...    189   3e-52    
ref|XP_010449549.1|  PREDICTED: probable long-chain-alcohol O-fat...    188   4e-52    
ref|XP_011025638.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    185   7e-52    
sp|Q9XGY6.1|WAXS1_SIMCH  RecName: Full=Long-chain-alcohol O-fatty...    187   1e-51    
ref|XP_006603175.1|  PREDICTED: probable long-chain-alcohol O-fat...    187   2e-51    
ref|XP_002891107.1|  F12K21.17                                          187   2e-51    
ref|XP_010442639.1|  PREDICTED: probable long-chain-alcohol O-fat...    188   2e-51    
ref|XP_006401466.1|  hypothetical protein EUTSA_v10013992mg             186   6e-51    
gb|KHM98895.1|  Putative long-chain-alcohol O-fatty-acyltransfera...    184   9e-51    
ref|XP_004952414.1|  PREDICTED: probable long-chain-alcohol O-fat...    185   1e-50    
ref|XP_007031522.1|  MBOAT family protein isoform 1                     184   1e-50    
emb|CDY36741.1|  BnaA03g11450D                                          184   2e-50    
ref|NP_200348.1|  putative long-chain-alcohol O-fatty-acyltransfe...    184   2e-50    
gb|ABK28758.1|  unknown                                                 183   4e-50    
ref|NP_200344.1|  putative long-chain-alcohol O-fatty-acyltransfe...    183   4e-50    
ref|NP_174708.1|  putative long-chain-alcohol O-fatty-acyltransfe...    183   5e-50    
ref|XP_009127058.1|  PREDICTED: probable long-chain-alcohol O-fat...    183   5e-50    
ref|XP_010485140.1|  PREDICTED: probable long-chain-alcohol O-fat...    182   6e-50    
ref|XP_010054623.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    177   3e-49    
ref|XP_009127007.1|  PREDICTED: probable long-chain-alcohol O-fat...    180   4e-49    
emb|CAN83207.1|  hypothetical protein VITISV_019938                     178   8e-49    
gb|ACU22791.1|  unknown                                                 179   1e-48    
ref|XP_006280761.1|  hypothetical protein CARUB_v10026728mg             179   2e-48    
gb|KCW45684.1|  hypothetical protein EUGRSUZ_L005402                    175   2e-48    
ref|XP_007020649.1|  MBOAT family protein                               179   2e-48    
ref|XP_006602175.1|  PREDICTED: probable long-chain-alcohol O-fat...    179   2e-48    
gb|KHM99507.1|  Putative long-chain-alcohol O-fatty-acyltransfera...    175   2e-48    
ref|XP_010906443.1|  PREDICTED: probable long-chain-alcohol O-fat...    178   3e-48    
ref|NP_199955.1|  putative long-chain-alcohol O-fatty-acyltransfe...    180   6e-48    
ref|XP_010676043.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    173   7e-48    
ref|XP_004149731.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    177   2e-47    
ref|XP_004166341.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    177   2e-47    
ref|XP_006849038.1|  hypothetical protein AMTR_s00028p00174370          177   3e-47    
emb|CDY17329.1|  BnaA10g09630D                                          175   3e-47    
ref|XP_008461897.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    177   4e-47    
ref|XP_010545867.1|  PREDICTED: probable long-chain-alcohol O-fat...    175   4e-47    
gb|KCW75178.1|  hypothetical protein EUGRSUZ_E03928                     174   6e-47    
gb|ADF57327.1|  1,2-diacyl-sn-glycerol:acetyl-CoA acetyltransferase     175   8e-47    
ref|XP_010675845.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    170   9e-47    
ref|NP_001046772.1|  Os02g0454500                                       174   1e-46    
ref|XP_002468615.1|  hypothetical protein SORBIDRAFT_01g049060          173   3e-46    
ref|XP_010099985.1|  hypothetical protein L484_014022                   169   5e-46    
ref|XP_008447703.1|  PREDICTED: probable long-chain-alcohol O-fat...    172   7e-46    
gb|KDO83287.1|  hypothetical protein CISIN_1g048121mg                   168   8e-46    
gb|AAF79268.1|AC023279_17  F12K21.19                                    176   1e-45    
ref|NP_001147171.1|  acyltransferase                                    171   2e-45    
ref|XP_008363300.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    172   2e-45    
gb|AFW89768.1|  acyltransferase                                         171   3e-45    
ref|XP_010536703.1|  PREDICTED: probable long-chain-alcohol O-fat...    169   5e-45    
ref|XP_007031523.1|  MBOAT family protein isoform 2                     169   6e-45    
ref|XP_006280772.1|  hypothetical protein CARUB_v10026743mg             169   9e-45    
ref|XP_004975092.1|  PREDICTED: probable long-chain-alcohol O-fat...    169   9e-45    
ref|XP_010099989.1|  hypothetical protein L484_014026                   169   2e-44    
ref|XP_004151023.1|  PREDICTED: probable long-chain-alcohol O-fat...    167   2e-44    
ref|XP_009397004.1|  PREDICTED: probable long-chain-alcohol O-fat...    167   4e-44    
ref|XP_006648605.1|  PREDICTED: probable long-chain-alcohol O-fat...    166   1e-43    
ref|XP_010039847.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    162   4e-43    
ref|XP_002447562.1|  hypothetical protein SORBIDRAFT_06g004000          164   6e-43    
ref|XP_009144105.1|  PREDICTED: probable long-chain-alcohol O-fat...    162   9e-43    
gb|KHN28420.1|  Long-chain-alcohol O-fatty-acyltransferase              162   1e-42    
ref|XP_002438765.1|  hypothetical protein SORBIDRAFT_10g025760          163   1e-42    
dbj|BAK00719.1|  predicted protein                                      163   1e-42    
ref|XP_004151329.1|  PREDICTED: probable long-chain-alcohol O-fat...    162   4e-42    
gb|EAY94574.1|  hypothetical protein OsI_16351                          162   5e-42    
ref|XP_006279748.1|  hypothetical protein CARUB_v10027662mg             161   6e-42    
ref|XP_010449475.1|  PREDICTED: LOW QUALITY PROTEIN: probable lon...    159   4e-41    
emb|CDX94217.1|  BnaC07g38510D                                          158   5e-41    
ref|XP_004980510.1|  PREDICTED: probable long-chain-alcohol O-fat...    158   1e-40    
emb|CAH67687.1|  H0510A06.12                                            157   1e-40    
ref|XP_003553040.1|  PREDICTED: probable long-chain-alcohol O-fat...    157   2e-40    
ref|XP_004154117.1|  PREDICTED: probable long-chain-alcohol O-fat...    154   2e-40    
ref|XP_002448060.1|  hypothetical protein SORBIDRAFT_06g020360          157   3e-40    
ref|XP_010539317.1|  PREDICTED: probable long-chain-alcohol O-fat...    154   4e-40    
ref|XP_004967129.1|  PREDICTED: probable long-chain-alcohol O-fat...    156   5e-40    
ref|NP_001053115.2|  Os04g0481900                                       156   7e-40    
ref|XP_002866089.1|  hypothetical protein ARALYDRAFT_495618             154   3e-39    
emb|CDX75136.1|  BnaC09g25460D                                          154   5e-39    
ref|XP_003576211.1|  PREDICTED: probable long-chain-alcohol O-fat...    154   5e-39    
gb|KEH32657.1|  MBOAT (membrane bound O-acyl transferase) family ...    150   5e-39    
emb|CAH67957.1|  H0117D06-OSIGBa0088B06.9                               153   6e-39    
ref|NP_001052355.1|  Os04g0277400                                       153   8e-39    
ref|XP_006603166.1|  PREDICTED: uncharacterized protein LOC100806796    156   8e-39    
ref|XP_008667087.1|  PREDICTED: uncharacterized protein LOC100192...    151   4e-38    
ref|XP_009113503.1|  PREDICTED: probable long-chain-alcohol O-fat...    151   4e-38    
emb|CDY12001.1|  BnaC03g14270D                                          149   7e-38    
ref|NP_001131179.1|  uncharacterized protein LOC100192487               151   7e-38    
gb|KCW70255.1|  hypothetical protein EUGRSUZ_F03512                     146   1e-37    
ref|NP_001151683.1|  wax synthase                                       149   3e-37    
gb|AFW58617.1|  wax synthase isoform 1                                  148   4e-37    
tpg|DAA38381.1|  TPA: putative cytochrome P450 superfamily protein      150   6e-37    
ref|XP_008447704.1|  PREDICTED: probable long-chain-alcohol O-fat...    147   6e-37    
ref|XP_007031524.1|  MBOAT family protein                               143   8e-37    
ref|XP_010449519.1|  PREDICTED: probable long-chain-alcohol O-fat...    146   1e-36    
ref|XP_004140072.1|  PREDICTED: probable long-chain-alcohol O-fat...    146   2e-36    
ref|XP_004172162.1|  PREDICTED: probable long-chain-alcohol O-fat...    145   2e-36    
ref|XP_010064305.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    141   3e-36    
emb|CAH67686.1|  H0510A06.11                                            145   5e-36    
ref|NP_001053114.1|  Os04g0481800                                       144   1e-35    
ref|XP_002522741.1|  acyltransferase, putative                          144   1e-35    
ref|XP_010090980.1|  hypothetical protein L484_013642                   138   2e-35    
gb|EAY94573.1|  hypothetical protein OsI_16350                          144   2e-35    
ref|NP_200343.1|  putative long-chain-alcohol O-fatty-acyltransfe...    144   2e-35    
ref|XP_003560121.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    144   2e-35    
ref|XP_006369602.1|  hypothetical protein POPTR_0001s26740g             139   4e-35    
emb|CDY36739.1|  BnaA03g11470D                                          137   1e-34    
emb|CDY06588.1|  BnaC02g13120D                                          139   1e-34    
emb|CDY20770.1|  BnaA02g09100D                                          136   2e-34    
ref|XP_004975882.1|  PREDICTED: probable long-chain-alcohol O-fat...    140   3e-34    
gb|ACG39975.1|  wax synthase isoform 1                                  140   4e-34    
ref|XP_004978084.1|  PREDICTED: probable long-chain-alcohol O-fat...    140   6e-34    
ref|XP_001765175.1|  predicted protein                                  139   8e-34    
emb|CDY36742.1|  BnaA03g11440D                                          137   9e-34    
ref|XP_003581182.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    139   1e-33    
ref|XP_009138621.1|  PREDICTED: probable long-chain-alcohol O-fat...    135   3e-33    
ref|XP_010906442.1|  PREDICTED: probable long-chain-alcohol O-fat...    137   5e-33    
emb|CDY19926.1|  BnaC09g31920D                                          134   2e-32    
emb|CDY12004.1|  BnaC03g14300D                                          135   2e-32    
ref|XP_008798537.1|  PREDICTED: probable long-chain-alcohol O-fat...    134   3e-32    
ref|XP_008354946.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    132   4e-32    
gb|KDP43612.1|  hypothetical protein JCGZ_16899                         129   4e-32    
ref|XP_006648606.1|  PREDICTED: probable long-chain-alcohol O-fat...    134   6e-32    
emb|CDY17327.1|  BnaA10g09610D                                          132   9e-32    
ref|XP_009137721.1|  PREDICTED: probable long-chain-alcohol O-fat...    129   9e-32    
ref|XP_010051876.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    127   1e-31    
ref|XP_008364696.1|  PREDICTED: probable long-chain-alcohol O-fat...    129   4e-31    
ref|XP_002447982.1|  hypothetical protein SORBIDRAFT_06g019240          134   1e-30    
ref|XP_010090977.1|  hypothetical protein L484_013639                   129   1e-30    
ref|XP_009138696.1|  PREDICTED: probable long-chain-alcohol O-fat...    127   2e-30    
ref|XP_008798544.1|  PREDICTED: probable long-chain-alcohol O-fat...    129   2e-30    
dbj|BAD19360.1|  putative wax synthase                                  128   6e-30    
gb|KCW44850.1|  hypothetical protein EUGRSUZ_L015841                    122   3e-29    
gb|EAY85793.1|  hypothetical protein OsI_07156                          126   3e-29    
dbj|BAC65039.1|  putative wax synthase isoform protein                  126   3e-29    
gb|EEC82207.1|  hypothetical protein OsI_26351                          126   4e-29    
gb|EEE60653.1|  hypothetical protein OsJ_14102                          121   4e-29    
ref|XP_002866088.1|  hypothetical protein ARALYDRAFT_495617             121   5e-29    
gb|EAZ22980.1|  hypothetical protein OsJ_06674                          125   6e-29    
ref|XP_010424416.1|  PREDICTED: probable long-chain-alcohol O-fat...    119   1e-28    
ref|XP_011008630.1|  PREDICTED: probable long-chain-alcohol O-fat...    121   4e-28    
gb|EMT12362.1|  hypothetical protein F775_21732                         122   4e-28    
ref|XP_008780825.1|  PREDICTED: probable long-chain-alcohol O-fat...    119   8e-28    
gb|EAZ22913.1|  hypothetical protein OsJ_06606                          120   1e-27    
ref|XP_002307873.1|  hypothetical protein POPTR_0006s01120g             120   2e-27    
ref|XP_006644444.1|  PREDICTED: probable long-chain-alcohol O-fat...    121   2e-27    
ref|XP_010090981.1|  hypothetical protein L484_013643                   115   1e-26    
gb|EMS63394.1|  hypothetical protein TRIUR3_17334                       118   2e-26    
ref|XP_002456060.1|  hypothetical protein SORBIDRAFT_03g029660          117   3e-26    
ref|XP_008672930.1|  PREDICTED: wax synthase isoform X1                 117   5e-26    
ref|XP_007031518.1|  MBOAT family protein                               114   5e-26    
ref|XP_008344645.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    114   5e-26    
ref|XP_010675841.1|  PREDICTED: probable long-chain-alcohol O-fat...    114   7e-26    
gb|KCW45685.1|  hypothetical protein EUGRSUZ_L005401                    111   8e-26    
ref|NP_001150127.1|  wax synthase                                       116   1e-25    
ref|XP_010064306.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    111   1e-25    
gb|ACG31412.1|  wax synthase isoform 3                                  116   1e-25    
ref|XP_006653531.1|  PREDICTED: probable long-chain-alcohol O-fat...    115   1e-25    
tpg|DAA58325.1|  TPA: wax synthase isoform 3                            115   2e-25    
ref|XP_010064307.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    110   2e-25    
ref|XP_003566946.1|  PREDICTED: probable long-chain-alcohol O-fat...    115   2e-25    
ref|XP_009132392.1|  PREDICTED: probable long-chain-alcohol O-fat...    110   7e-25    
ref|XP_002530692.1|  hypothetical protein RCOM_0070050                  110   8e-25    
gb|EMT27175.1|  hypothetical protein F775_43029                         110   9e-25    
gb|KCW66887.1|  hypothetical protein EUGRSUZ_F00640                     108   2e-24    
gb|KCW44642.1|  hypothetical protein EUGRSUZ_L01838                     108   2e-24    
ref|XP_002444113.1|  hypothetical protein SORBIDRAFT_07g008310          110   7e-24    
dbj|BAK07830.1|  predicted protein                                      110   9e-24    
ref|XP_007022334.1|  MBOAT family protein                               107   1e-23    
ref|XP_004486218.1|  PREDICTED: long-chain-alcohol O-fatty-acyltr...    105   5e-23    
ref|XP_002527948.1|  hypothetical protein RCOM_1184880                  106   6e-23    
ref|XP_002989109.1|  hypothetical protein SELMODRAFT_447564             107   1e-22    
ref|XP_010314632.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    106   1e-22    
gb|EMT29922.1|  hypothetical protein F775_08860                         106   2e-22    
emb|CDM83553.1|  unnamed protein product                                105   5e-22    
ref|XP_002983828.1|  hypothetical protein SELMODRAFT_156138             105   5e-22    
ref|XP_007026257.1|  MBOAT family protein, putative                     103   6e-22    
emb|CDY17319.1|  BnaA10g09530D                                          100   1e-21    
ref|XP_009354394.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...    102   6e-21    
ref|XP_006648626.1|  PREDICTED: probable long-chain-alcohol O-fat...    100   7e-21    
emb|CDY20768.1|  BnaA02g09080D                                        97.1    1e-20    
gb|EMT08225.1|  hypothetical protein F775_16118                       98.2    2e-20    
ref|XP_004969331.1|  PREDICTED: probable long-chain-alcohol O-fat...    100   3e-20    
ref|NP_001043733.1|  Os01g0651500                                     99.8    4e-20    
gb|KCW66890.1|  hypothetical protein EUGRSUZ_F00643                   95.5    4e-20    
ref|XP_001758438.1|  predicted protein                                98.6    2e-19    
gb|EAY75194.1|  hypothetical protein OsI_03086                        96.7    5e-19    
emb|CDY06585.1|  BnaC02g13090D                                        94.4    9e-19    
ref|XP_004292019.1|  PREDICTED: purple acid phosphatase 2-like        97.8    1e-18    
gb|AEW07952.1|  hypothetical protein 0_15142_01                       90.1    3e-18    
ref|XP_010059568.1|  PREDICTED: probable long-chain-alcohol O-fat...  87.4    5e-17    
gb|EYU27204.1|  hypothetical protein MIMGU_mgv11b023119mg             86.3    9e-17    
ref|XP_009767053.1|  PREDICTED: acyl-CoA--sterol O-acyltransferas...  85.9    3e-16    
ref|XP_010446125.1|  PREDICTED: probable long-chain-alcohol O-fat...  84.0    4e-16    
gb|ADI60058.1|  wax synthase                                          87.8    5e-16    
gb|KHM98892.1|  Putative long-chain-alcohol O-fatty-acyltransfera...  85.1    5e-16    
ref|XP_002507934.1|  predicted protein                                87.0    2e-15    
ref|XP_010059570.1|  PREDICTED: probable long-chain-alcohol O-fat...  83.2    2e-15    
gb|EAZ31121.1|  hypothetical protein OsJ_15218                        84.0    1e-14    
emb|CDY19925.1|  BnaC09g31910D                                        80.1    5e-14    
emb|CDY20766.1|  BnaA02g09060D                                        83.6    8e-14    
emb|CDY06583.1|  BnaC02g13070D                                        82.8    1e-13    
ref|XP_006658652.1|  PREDICTED: probable long-chain-alcohol O-fat...  75.9    2e-12    
ref|XP_010475947.1|  PREDICTED: probable long-chain-alcohol O-fat...  73.6    3e-12    
ref|XP_005707728.1|  hypothetical protein Gasu_14540                  73.2    1e-11    
ref|XP_010042400.1|  PREDICTED: probable long-chain-alcohol O-fat...  69.3    2e-10    
ref|XP_006403860.1|  hypothetical protein EUTSA_v10010933mg           68.6    3e-10    
ref|XP_010059564.1|  PREDICTED: probable long-chain-alcohol O-fat...  69.3    3e-10    



>ref|XP_009631227.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=352

 Score =   379 bits (974),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 204/350 (58%), Positives = 265/350 (76%), Gaps = 7/350 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VW  VL  LCY HTI   FPK + +RF AI P+ CLF +LPL LTSI+L 
Sbjct  1     MEGEIHNFIVVWAIVLASLCYSHTIVKFFPKGN-SRFLAIIPIVCLFFILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK--KVAGNFKF  754
             GT++FFI WL +FKL LFA  +GPLSSTPPLPL TFIP ACLPIK Q     KV    K 
Sbjct  60    GTTSFFIAWLANFKLLLFAFGKGPLSSTPPLPLLTFIPLACLPIKFQNSSISKVETTKKS  119

Query  753   SGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
             + S    + K+ LL ++  VY YK++LHPK+ L  + +H+Y +LE +L MVS +VR V R
Sbjct  120   TRSTLNHVTKIALLAILIRVYSYKDYLHPKIILFLYCLHIYFMLEIILTMVSTMVRVVTR  179

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
             VELE PFD+P+L++SLQDFWG+RWN+MVTNILRPTVYDPVRS++  ++P   A LPAV+A
Sbjct  180   VELEPPFDKPYLASSLQDFWGKRWNLMVTNILRPTVYDPVRSIAMDWIPRKWAPLPAVLA  239

Query  405   SFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPL  226
             +F VSG+MHE++FY IGR  P+GEVM FFL++G  +ALEI +K+ ++G+  +P I+SGPL
Sbjct  240   TFFVSGLMHEVIFYYIGRLKPSGEVMVFFLLHGLALALEIVIKKVLNGRIWIPRIISGPL  299

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
             AL  +I TSFWLFFPP+ R + + KAC ESLAF+EF+ + +LVSP ++TC
Sbjct  300   ALAFIIFTSFWLFFPPFLRGETELKACTESLAFLEFLKHGKLVSPTNITC  349



>ref|XP_009766446.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nicotiana 
sylvestris]
Length=352

 Score =   375 bits (964),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 204/350 (58%), Positives = 261/350 (75%), Gaps = 7/350 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI+VW  VL  LCY HTI   FPK   +RF AI P+ CLF +LPL LTSI+L 
Sbjct  1     MEGEIYNFIIVWAIVLASLCYSHTIVKFFPKGK-SRFLAIIPIVCLFFILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR--RKKVAGNFKF  754
             GT++FFI WL +FKL LFA  +GPLSSTPPLPLSTFIP ACLPIK Q+     V    K 
Sbjct  60    GTTSFFIAWLANFKLLLFAFGQGPLSSTPPLPLSTFIPLACLPIKFQKYSTSDVETTKKR  119

Query  753   SGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
             + S    + K  LL ++  VY YK++LHPK+ L  + +H+Y +LE +L MVS +VR V R
Sbjct  120   TRSTLNHVTKFALLAILIRVYSYKDYLHPKIILFLYCLHIYFMLEIILTMVSTMVRVVTR  179

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
             VELE PFDEP+L++SLQDFWG+RWN+MVTNILRPT+YDPVRS+    +P   A LPAV+A
Sbjct  180   VELEPPFDEPYLASSLQDFWGKRWNLMVTNILRPTIYDPVRSIMLDRIPRKWAPLPAVLA  239

Query  405   SFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPL  226
             +F VSG+MHE++FY IGR  P+GEVM FFL++G  +ALEI +K+ ++G+  +P I+SGPL
Sbjct  240   TFFVSGLMHEVIFYYIGRLKPSGEVMIFFLIHGLALALEIVIKKVLNGRIWIPRIISGPL  299

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
             AL  +I TSFWLFFPP+ R + + KAC ESLAF+EF+ + +LVSP ++TC
Sbjct  300   ALAFIIFTSFWLFFPPFLRGETELKACTESLAFLEFLKHGKLVSPTNITC  349



>emb|CDP04479.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 251/353 (71%), Gaps = 6/353 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NF+ V  T+L  LCYC+T++ +FPK    R  A+ PVACLF+ LPLNLT+IHL 
Sbjct  1     MEGEISNFVFVSATILSSLCYCYTVDKIFPK-GILRLLALIPVACLFIYLPLNLTTIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR-----RKKVAGN  763
             GTS+FFI WLGSFKL LFA  +GPLSS+  +PLS FIP ACLPIK Q+          G 
Sbjct  60    GTSSFFIAWLGSFKLLLFAFNKGPLSSSESIPLSRFIPLACLPIKFQQAPSPQESTKKGQ  119

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                   + K+VLL +   VY YK+ +   +   F+ +H+Y  LE +L MV+GL R +  V
Sbjct  120   RSPLNHVIKIVLLVLCIRVYSYKDSIQQNIIWFFYCLHIYFTLELVLAMVAGLARGLIGV  179

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
              LE  FDEP+L+TSLQDFWGRRWN+MV+NILRPTVY+PVRS+S+  + +   +LPAV+A+
Sbjct  180   RLEPHFDEPYLATSLQDFWGRRWNLMVSNILRPTVYEPVRSISSSLIGKKWRALPAVVAT  239

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLA  223
             F+VSGIMHELVFYNIGR  PTGEV  FFL++G  + +EI  KRA+ GK  +PGI+SGPL 
Sbjct  240   FLVSGIMHELVFYNIGRLKPTGEVTCFFLLHGVSLVVEIAAKRALKGKIWIPGIISGPLT  299

Query  222   LTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQFFS  64
             L  VI TSFWLF PP+ R + D K C ESLAFIEFV + RL+SP  ++C F  
Sbjct  300   LAFVIYTSFWLFLPPFLRGRADWKGCTESLAFIEFVKHQRLISPNDLSCPFLQ  352



>ref|XP_009631228.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=349

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 253/349 (72%), Gaps = 4/349 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI VW  VL  LCY HTI   FPK   +RF AI P+ CLF +LP  LTSI+L 
Sbjct  1     MEGEIQNFIAVWAIVLTSLCYSHTIAKFFPKGK-SRFLAITPIVCLFFILPFYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
              T++FFI WL +FKL LFA  +GPLSSTPPLPLSTFIP ACLPIK Q    K +  + K 
Sbjct  60    STTSFFIAWLANFKLLLFAFGKGPLSSTPPLPLSTFIPLACLPIKCQTSSIKTIQKSTKS  119

Query  753   SGSL-RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
             + +L  K+ LL ++  VY YK+ LHPK+ L F+ +H+Y +LE ML  VS +VR V RVEL
Sbjct  120   TLNLVTKIALLAILIRVYNYKDHLHPKIILFFYCLHIYFMLEIMLTTVSTMVRVVSRVEL  179

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFV  397
             E PFDEP+ ++SLQDFWGRRWN+MVTNILRPTVYDPVRS+    +P   A LP V+A+F 
Sbjct  180   EPPFDEPYKTSSLQDFWGRRWNLMVTNILRPTVYDPVRSIMLDRIPRKWAPLPPVLATFF  239

Query  396   VSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALT  217
             VSG+MHEL+FY I R  P+ EV  FF+++G  + LEI +K+ ++GKF +P I+SGPLAL 
Sbjct  240   VSGLMHELIFYYISRQNPSWEVTCFFIIHGVTLTLEIMIKKLLNGKFLVPRIISGPLALG  299

Query  216   LVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQF  70
              +ILTSFWLFFPP  R K D K C ESLAF+EFV   +LVSP ++TC F
Sbjct  300   FIILTSFWLFFPPLLRGKPDVKGCTESLAFLEFVRYGKLVSPSNITCPF  348



>ref|XP_009766445.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nicotiana 
sylvestris]
Length=356

 Score =   362 bits (928),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 205/356 (58%), Positives = 256/356 (72%), Gaps = 11/356 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NF+++W  VL  LCY HTI   FPK   +RF AI P+ CLF  LPL LTSI+L 
Sbjct  1     MEGEIHNFMVIWAIVLTSLCYSHTIAKFFPKGK-SRFLAIIPIVCLFFTLPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
              T++FFI WL +FKL LFA  +GPLSSTPPLPLSTFIP ACLPIK Q    K +  N K 
Sbjct  60    STTSFFIAWLANFKLLLFAFGKGPLSSTPPLPLSTFIPLACLPIKFQSSSTKTIQKNTKS  119

Query  753   SGSL-RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
             S +L  K+ LL ++  VY YK+ LHPK+ L F+ +H+Y VLE ML  VS +VR V RVEL
Sbjct  120   SLNLVTKIALLAILIKVYNYKDHLHPKIILFFYCLHIYFVLEIMLTTVSTMVRVVSRVEL  179

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSV-SARF------LPESLASLP  418
             E PFDEP+ ++SLQDFWG+RWN+MVTNILRP VYDPVR + S R       +P   A LP
Sbjct  180   EPPFDEPYKTSSLQDFWGKRWNLMVTNILRPAVYDPVRFIMSDRIPRKWAPIPAKWAPLP  239

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
             AV+A+F VSG+MHEL+FY I R  P+ EV  FF+++G  + LEI +K+ ++GKF +P I+
Sbjct  240   AVLATFFVSGLMHELIFYYISRLNPSWEVTCFFIIHGVALTLEIMIKKLLNGKFLVPRII  299

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQF  70
             SGPLAL  +ILTSFWLFFPP  R K D K C ESLAF+EF+   +LV+P ++TC F
Sbjct  300   SGPLALGFIILTSFWLFFPPLLRGKPDVKGCTESLAFLEFIRYGKLVNPSNITCPF  355



>ref|XP_010312742.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
lycopersicum]
Length=353

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 254/352 (72%), Gaps = 10/352 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VWT VL  LCY HTI    PK    RF AIFP+ CLFL LPL LTSI+L 
Sbjct  1     MEGEIHNFIVVWTIVLASLCYSHTIAKFIPKGK-ARFVAIFPIVCLFLTLPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK--------KV  772
              T++FFI WL +FK+ LF   +GPLSSTP LPLSTFIP ACLPIK Q+          K 
Sbjct  60    CTTSFFIAWLATFKILLFVFGKGPLSSTPSLPLSTFIPLACLPIKFQKYSTSDDVETTKK  119

Query  771   AGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
             A N  F+  + K+ LL  +  VY YK+ LHPK+ L  + +H+Y +LE +L MVS  VR V
Sbjct  120   ATNSTFNLVI-KIALLATLIRVYNYKDNLHPKIILFCYCLHIYFMLEIILIMVSATVRRV  178

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
              RVELE PF+EP+L++SLQDFWG+RWN+MVTNILRPT+YDP+ S+ A  +    A LPAV
Sbjct  179   SRVELEPPFNEPYLASSLQDFWGKRWNLMVTNILRPTIYDPIHSMVANRISRKWAPLPAV  238

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F VSG+MHEL+FY  GR  P GEVM FFL++G  +++EI +K+ ++GKF +P I+SG
Sbjct  239   IATFFVSGLMHELIFYYNGRLKPNGEVMMFFLIHGVALSVEIVIKKILNGKFLVPRIISG  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
             PLAL+ +I TSFWLFFPP+ R   + KAC E +AF+EF+   +L+SP ++TC
Sbjct  299   PLALSFIIFTSFWLFFPPFLRGNTELKACTEFIAFLEFIRYGKLISPTNITC  350



>ref|XP_006352358.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
tuberosum]
Length=353

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 256/352 (73%), Gaps = 10/352 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VWT V+  LCY HTI    PK   +RF AIFP+ CLF +LPL LTSI+L 
Sbjct  1     MEGEIHNFIVVWTIVIASLCYSHTIAKFVPKGK-SRFVAIFPIICLFFILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK--------KV  772
              T++FFI WL +FK+ LF   +GPLSSTPPLPLSTFIP ACLPIK Q+          K 
Sbjct  60    CTTSFFIAWLANFKILLFVFGKGPLSSTPPLPLSTFIPLACLPIKFQKNSTSDNVETTKK  119

Query  771   AGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
             A N  F+  + K+ LL  +  VY YK+ LHPK+ L  + +H+Y +LE +L MVS  VR V
Sbjct  120   ATNSTFN-LVTKIALLATLIRVYNYKDNLHPKIILFCYCLHIYFMLEIILIMVSATVRRV  178

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
              RVELE PF+EP+L++SLQDFWG+RWN+MVTNILRPT+YDP+ S+ A  +    A LPAV
Sbjct  179   SRVELEPPFNEPYLASSLQDFWGKRWNLMVTNILRPTIYDPIHSMVADRISRKWAPLPAV  238

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F VSG+MHEL+FY  GR  P GEVM FFL++G  ++LEI +K+  +GKF +P I+SG
Sbjct  239   IATFFVSGVMHELIFYYNGRLKPNGEVMMFFLIHGVALSLEIVIKKIFNGKFLVPRIISG  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
             PLAL+ +I TSFWLFFPP+ R+  + KAC E +AF+EF+   +L++P ++TC
Sbjct  299   PLALSFIIFTSFWLFFPPFLRSNTELKACTEFIAFLEFIRYGKLINPTNITC  350



>ref|XP_006352357.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
tuberosum]
Length=354

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 197/354 (56%), Positives = 248/354 (70%), Gaps = 9/354 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VWT VL  LCY HTI   FP    +RF AI P+ CLF +LPL LTSI+L 
Sbjct  1     MEGEIHNFIVVWTIVLISLCYSHTIVKFFPNGK-SRFVAIVPIVCLFFILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK--------KV  772
             GT++FFI WL +FK+ LFA  +GPLSS PPLPLSTFIP ACLPIK Q+          K 
Sbjct  60    GTTSFFIAWLANFKILLFAFGKGPLSSIPPLPLSTFIPLACLPIKYQKYSTSDNVETTKK  119

Query  771   AGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
               N      + K+ LL  +  VY YK  LHPK+ L  + +H+Y  LE +L MVS +VR  
Sbjct  120   TTNSTLINLVTKITLLATLIRVYNYKHNLHPKLLLFCYCLHIYFFLEILLTMVSTMVRVA  179

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
              RVELE PFDEP+ + SLQDFWG+RWN+MVTNILRPTVYDPVRS+    +P   A LPAV
Sbjct  180   SRVELEPPFDEPYKTRSLQDFWGKRWNLMVTNILRPTVYDPVRSLMLDRIPRKWAPLPAV  239

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F +SG+MHEL+FY I R  P+ EV  FF+++G  +++EI VK+ ++ KF +P  +SG
Sbjct  240   LATFFISGLMHELIFYYISREKPSWEVTYFFIIHGVALSIEIMVKKLLNDKFLVPRFISG  299

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQF  70
             PLAL  +ILTSFWLFFPP  R K D K C E++A +EFV   +LVSPE++TC F
Sbjct  300   PLALGFIILTSFWLFFPPLLRGKPDVKGCNEAIALLEFVRYGKLVSPENITCPF  353



>ref|XP_004250553.2| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
lycopersicum]
Length=350

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 244/347 (70%), Gaps = 4/347 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M GEI+NFI++WT VL  LCYCHTI   FP    +RF AI P+ CLF +LPLNLTSI+L 
Sbjct  1     MVGEIHNFIVIWTIVLTSLCYCHTIVKFFPNGK-SRFVAIIPIVCLFFILPLNLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               ++FFI WL +FKL LFA  +GPLSST PLPL TFIP ACLPIK Q           + 
Sbjct  60    AITSFFIAWLATFKLILFAFGKGPLSSTTPLPLLTFIPLACLPIKFQTPSTNTTQKSTNS  119

Query  747   SLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
             +L    K+ LL  +  VY +K  LHP + LL +  H+Y  LE +L MVS +VR V +VEL
Sbjct  120   TLNIVIKIALLATLIWVYSFKAHLHPYIILLLYCFHIYFSLEIILTMVSTMVRVVSQVEL  179

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFV  397
             E PFDEP+ ++SLQDFWG+RWN+MVTNIL PTVY PVR +    +    A LPAV+A+F 
Sbjct  180   EPPFDEPYKTSSLQDFWGKRWNLMVTNILHPTVYVPVRLMMTERISRKWAPLPAVLATFF  239

Query  396   VSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALT  217
             VSG+MHEL+FYNIGR  P+GEV  FF+++G  + LEI +K+ ++G   +P I+SGPLAL 
Sbjct  240   VSGLMHELIFYNIGRLKPSGEVTCFFIIHGVALTLEIVIKKLLNGTVLVPKIISGPLALG  299

Query  216   LVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
              +ILTSFWLFFPP+ R K + KAC E +AF+EFV   +LVSP ++TC
Sbjct  300   FIILTSFWLFFPPFLRGKAEIKACTEFIAFLEFVKYGKLVSPSNITC  346



>ref|XP_010312743.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
lycopersicum]
Length=353

 Score =   352 bits (904),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 252/353 (71%), Gaps = 8/353 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEI+NFI+VWT VL  LCYCHTI   FP    +RF AI P+ CLF +LPL LTSI+L 
Sbjct  1     MKGEIHNFIVVWTIVLISLCYCHTIIKFFPNGK-SRFVAIIPIVCLFFILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR---KKVAGNFK  757
             GT+ FFI WL +FK+ LFA  +GPLSS PPLPLSTFIP ACLPIK Q+      V    K
Sbjct  60    GTTCFFIAWLANFKILLFAFGKGPLSSIPPLPLSTFIPLACLPIKYQKHSPSDNVETTKK  119

Query  756   FSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
              + S    + K+ LL ++  VY YK+ LHPK+ L  + +H+Y  LE +L MVS +VR   
Sbjct  120   TTNSTLNLVTKITLLAILIRVYNYKDNLHPKLLLFCYCLHIYFFLEILLTMVSTMVRVAS  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
             +VELE PFDEP+ ++SLQDFWG+RWN+MVTNILRPTVY+ VRS+    +P   A LPAV+
Sbjct  180   QVELEPPFDEPYKTSSLQDFWGKRWNLMVTNILRPTVYNLVRSLMLDRIPRKWAPLPAVL  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+F VSGIMHEL+FY I R  P+ EV  FF+++G  +++EI VK+ ++GK  +P  +SGP
Sbjct  240   ATFFVSGIMHELIFYYISREKPSWEVTCFFIIHGVALSVEIMVKKLLNGKLLVPRFISGP  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQF  70
             L L  +ILTSFWLFFPP  R K D K C ES+AF+EFV   +LVSP+++TC F
Sbjct  300   LTLGFIILTSFWLFFPPLLRGKPDVKGCNESIAFLEFVRYGKLVSPDNITCPF  352



>ref|XP_011095963.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Sesamum indicum]
Length=345

 Score =   343 bits (881),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 190/346 (55%), Positives = 250/346 (72%), Gaps = 2/346 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE+ N I+VW+TV+  LCYCH +  LFP     R FAIFPV  LF +LPLNLTSIH  
Sbjct  1     MEGEVKNVILVWSTVVASLCYCHRVGKLFPS-GIARRFAIFPVVFLFFLLPLNLTSIHFG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             GT++FFI WL SFKL LFA  + PLSS P +PLS FI  AC PIK  +  ++        
Sbjct  60    GTTSFFIAWLASFKLILFAFNKPPLSSIPSIPLSRFILLACFPIKFHQSHRITHRSPLI-  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+++  ++  +Y+YK+ LHPK+ L  + +H+Y++LE +L +V+ L +A+  VELE  
Sbjct  119   YFAKILIFALILRIYHYKQHLHPKIILFCYCLHVYLMLETVLALVAALTKALLHVELEEQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWGRRWN+MV NIL+PTVY PVRSV+ RF+    A++P V+A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGRRWNLMVPNILQPTVYHPVRSVATRFMDRKWAAIPGVLATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVI  208
             +MHELV YNIGR  P+GE+M FFL++G  ++LEI +K+ + GKF LPGIVSGPL L  V+
Sbjct  239   LMHELVLYNIGRLRPSGEMMCFFLLHGVSLSLEIVIKKILRGKFSLPGIVSGPLTLAYVM  298

Query  207   LTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQF  70
              TSF LFFPP+ R+K D K C ESLAFIE + NHRLVSP  ++C F
Sbjct  299   YTSFLLFFPPFLRSKADVKGCTESLAFIESIKNHRLVSPNDISCPF  344



>ref|XP_006352459.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
tuberosum]
Length=350

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 239/347 (69%), Gaps = 4/347 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI++WT VL  LCY HTI   FP    +RF AI P+ CLF +LPL LTSI+L 
Sbjct  1     MEGEIHNFIVIWTIVLTSLCYSHTIVKFFPNGK-SRFVAIIPIVCLFFILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               ++FFI WL +FKL LF+  +GPLSS PPL L TFIP ACLPIK Q             
Sbjct  60    AITSFFIAWLATFKLILFSFGKGPLSSIPPLSLLTFIPLACLPIKFQTPSTNTTQRGTKS  119

Query  747   SLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
             +L     + LL ++  VY +K  LHP + LL +  H+Y  LE +L MVS +VR V +VEL
Sbjct  120   TLNVVINIALLAILIWVYTFKAHLHPNIILLLYCFHIYFSLEIILTMVSTMVRVVSQVEL  179

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFV  397
             E PFDEP+ ++SLQDFWG+RWN+MVT +L  TVY PVRS+    +    A LPAV+A+F 
Sbjct  180   EPPFDEPYKTSSLQDFWGKRWNLMVTKLLHMTVYVPVRSMMTDRISRKWAPLPAVIATFF  239

Query  396   VSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALT  217
             VSGIMHEL+FYNIGR  P+GEV  FF++NG  + +EI +K+ ++GK  +P I+SGPLA+ 
Sbjct  240   VSGIMHELIFYNIGRLKPSGEVTCFFIINGVALTIEIVIKKLLNGKVLVPKIISGPLAIG  299

Query  216   LVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
              +ILTSFWLFFPP+ R K + KAC E +AF+EF     LVSP ++TC
Sbjct  300   FIILTSFWLFFPPFLRGKAEIKACTEFIAFLEFAKYGNLVSPTNITC  346



>ref|XP_006352461.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
tuberosum]
Length=353

 Score =   341 bits (875),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 249/352 (71%), Gaps = 10/352 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VW  V+  LCY HTI    P    +RF AIFP+ CLFL LPL LTSIHL 
Sbjct  1     MEGEIHNFIVVWAIVIVSLCYSHTIAKFIPIGK-SRFVAIFPIVCLFLFLPLYLTSIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFS-  751
             GT++FFI WL +FKL LFA  +GPLSSTPPLPLSTFIP ACLPIK  ++  +  N +   
Sbjct  60    GTTSFFIAWLATFKLILFAFGKGPLSSTPPLPLSTFIPLACLPIKF-KKYSINDNVETKK  118

Query  750   -------GSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
                      + K+ LL +   VY YK++LHPK+ L F+  H+Y +LE +  M+S +VR V
Sbjct  119   KTTKSTLNHVTKIALLAIFIRVYSYKDYLHPKIILSFYCFHIYFMLEIIFNMISAVVRGV  178

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
              RVELE PFDEP+L++SLQDFWG+RWN+MVTNILRPTVYDPVRS+ A  +    A LPAV
Sbjct  179   SRVELEPPFDEPYLASSLQDFWGKRWNLMVTNILRPTVYDPVRSIVADRISRKWAPLPAV  238

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F VSG+MHEL+F   GR  P GE + FFL++G  +++EI +K+  +GKF +P I+S 
Sbjct  239   LATFFVSGLMHELIFNYNGRLMPNGEYILFFLIHGVALSVEIVIKKISNGKFFVPRIISC  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
             PLAL  +  TS W+FFP + R   + KAC+ES+AF +F+   +L+SP ++TC
Sbjct  299   PLALAFIFFTSCWMFFPSFLRGNTEFKACSESIAFFKFIRYGQLISPTNITC  350



>ref|XP_010312741.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
lycopersicum]
Length=353

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 247/352 (70%), Gaps = 10/352 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VW  VL  LCY HTI    P    +RF A+FP+ CLFL LPL LTSIHL 
Sbjct  1     MEGEIHNFIVVWAIVLVSLCYSHTIAKFIPIGK-SRFVAVFPIVCLFLFLPLYLTSIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFS-  751
             GT++FFI WL +FKL LFA  +GPLSSTPPLPLSTFIP ACLPIK Q+   +  N +   
Sbjct  60    GTTSFFIAWLATFKLILFAFGKGPLSSTPPLPLSTFIPLACLPIKFQK-NSINDNVETKK  118

Query  750   -------GSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
                      + K+ LL +   VY YK++LHPK+ L F+  H+Y +LE +  M+S +VR V
Sbjct  119   KTTKSTLNHVTKIALLAIFIRVYSYKDYLHPKIILSFYCFHIYFMLEIIFNMISAVVRGV  178

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
              RVELE PF EP+L++SLQDFWG+RWN+MVTNILRPTVYDPVRS+ A  +    A LPA+
Sbjct  179   SRVELEPPFYEPYLASSLQDFWGKRWNLMVTNILRPTVYDPVRSIVADRIARKWAPLPAI  238

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F VSG+MHEL+F   GR  P G+ + FFL++G  +++EI +K+   G F LP I+S 
Sbjct  239   LATFFVSGLMHELIFNYNGRLMPNGDYIIFFLIHGVTLSVEITIKKNSKGNFFLPRIISC  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTC  76
             PLAL  +  TSFW+FFP + R   + KAC+ES+AF +F+   +L+SP ++TC
Sbjct  299   PLALGFIFFTSFWMFFPSFLRGNTEFKACSESIAFFKFIRYGQLISPANITC  350



>ref|XP_010312740.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
lycopersicum]
Length=353

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 247/353 (70%), Gaps = 8/353 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VW  VL  LCY HTI    PK   +RF A FP+ CLF +LPL  TSI+L 
Sbjct  1     MEGEIHNFIVVWVIVLASLCYSHTIAKFIPKGK-SRFVATFPIVCLFYILPLYFTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR---KKVAGNFK  757
              T++FFI  L +FKL LFA  +GPLSST PLPLSTFIP ACLPIK+++    K V    K
Sbjct  60    ATTSFFITGLATFKLILFAFGKGPLSSTSPLPLSTFIPLACLPIKLKKSSKTKDVETTKK  119

Query  756   FSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
              + S    + K+ +L ++  VY YKE LHPK  L  + +H+Y +LE ML +VS +VR V 
Sbjct  120   ATNSTFNLVTKIAILAILIRVYNYKENLHPKFILFCYCLHIYFMLEIMLNIVSIMVRVVS  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
             RVELE   + PHL++SLQDFWG+RWN+MVTNILR T+YD VR V    +P   A +PAV+
Sbjct  180   RVELEPAINNPHLASSLQDFWGKRWNLMVTNILRLTIYDHVRLVIVDQIPRKWAPIPAVL  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+F VSG+MHEL FY IGR  P+GE M+FFL++G  +++EI VK+ ++GKF +P I+SGP
Sbjct  240   ATFFVSGLMHELFFYYIGRLKPSGEAMTFFLIHGVALSVEIVVKKILNGKFLVPRIISGP  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQF  70
             L L  +I TSFWLFFPP+ R   + K C E +AF +F+   +L+SP ++TC F
Sbjct  300   LTLAFIIFTSFWLFFPPFLRGNTELKLCNEYIAFFKFIRYGQLLSPTNITCPF  352



>ref|XP_010090982.1| hypothetical protein L484_013644 [Morus notabilis]
 gb|EXB41567.1| hypothetical protein L484_013644 [Morus notabilis]
Length=348

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 232/343 (68%), Gaps = 16/343 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW +V+  LCYCHTI  +  K   TR  AI PV  LFLVLP +LTS+ L 
Sbjct  1     MEGEIRNFIMVWMSVVASLCYCHTIGKII-KHGPTRLLAILPVMFLFLVLPFSLTSVFLV  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ----------RRK  778
             G ++FF+ WL +FKL LF+  +GPLSS PPL L  FIP AC PIK+           +R 
Sbjct  60    GPTSFFVSWLATFKLLLFSFGKGPLSSYPPLSLPRFIPIACFPIKITQHHPSPDHHPKRH  119

Query  777   KVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
             K   N+       KL++     L Y  +EFLHPKVF+  F I+ YI+ E +L ++  L R
Sbjct  120   KSPLNYAI-----KLLIYSTNLLAYKKREFLHPKVFMFLFSIYTYIIFEAILALIGSLAR  174

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
             A   VELE  F+EP+LSTSLQDFWGRRWN+M +NILRPTVYDPVRS S R++ +  A LP
Sbjct  175   AALGVELEPQFNEPYLSTSLQDFWGRRWNLMASNILRPTVYDPVRSFSIRWIGKMWAPLP  234

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
             A++A+F VSG+MHEL+F+ +GR+ PT ++  FFL++G C+A+E+ VK+AV GK RLP +V
Sbjct  235   AIVAAFFVSGMMHELIFFYLGRSKPTWDLTCFFLIHGVCLAVEVAVKKAVKGKGRLPPLV  294

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             SG LA++ V++T  WLF+P   R   D +   E LA IEFV N
Sbjct  295   SGVLAMSFVMVTGSWLFWPAVRRCGADERGHRELLAAIEFVKN  337



>ref|XP_006352460.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
tuberosum]
Length=356

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 250/357 (70%), Gaps = 13/357 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VWT VL  LCY HTI    PK   +RF AIFP+ CLF +LPL LTSI+L 
Sbjct  1     MEGEIHNFIVVWTIVLASLCYSHTIAKFIPKGK-SRFVAIFPIVCLFFILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKV--------  772
              T+ FFI  L +FKL LF   +GPLSSTPPLPLSTFIP ACLPIK ++  K         
Sbjct  60    ATTFFFITGLATFKLILFTFGKGPLSSTPPLPLSTFIPLACLPIKFKKSSKTKDVETIKK  119

Query  771   AGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
             A N  F+  + K+ LL ++  VY YK+ LHPK  L  + I++YI+LE +L MVS +VR V
Sbjct  120   ATNSTFN-LVTKITLLAILVRVYNYKDNLHPKFILFCYCINIYIMLEIILNMVSAVVRGV  178

Query  591   FRVELE--APFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
              RV+L+   PF+EP+L++SLQDFWG+RWN+MV+NILR TVYDPVR   A  +P   A +P
Sbjct  179   SRVDLDLDPPFNEPYLTSSLQDFWGKRWNLMVSNILRLTVYDPVRLFVADRIPRKWAPIP  238

Query  417   AVMASFVVSGIMHELV-FYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGI  241
             AV+A+F  SG++HEL+ +Y I R   +GE M FFL++G  +++EI +K+ ++GK  +P I
Sbjct  239   AVLATFFASGLVHELLLYYIIERLKLSGEAMIFFLIHGVALSVEIVMKKMLNGKILVPRI  298

Query  240   VSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQF  70
             +SGPLAL  +I TSFW FFPP+ R+  + K C E +AF +F+   +L+SP ++TC F
Sbjct  299   ISGPLALAFIIFTSFWFFFPPFLRSNTEFKLCTEYIAFFKFIRYGQLISPTNITCSF  355



>ref|XP_007212540.1| hypothetical protein PRUPE_ppa019416mg [Prunus persica]
 gb|EMJ13739.1| hypothetical protein PRUPE_ppa019416mg [Prunus persica]
Length=348

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/352 (50%), Positives = 227/352 (64%), Gaps = 18/352 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW   +  L YCHTI G    P  TR  AI PV   F  LPLNLT+I L 
Sbjct  1     MEGEIPNFIMVWILAVASLSYCHTI-GKLTSPGLTRLLAILPVIFFFFFLPLNLTTIFLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G S+FF+ WL +FKL LFA  +GPLS+T P+ +  FIP ACLPIK    +KV    K   
Sbjct  60    GPSSFFLAWLANFKLLLFAYGKGPLSTTSPICIYHFIPLACLPIKF---RKVENKIKSGS  116

Query  747   SLR-------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
             S               K ++      V++ K+++HPK+ L  + I++Y  LE +L +V+ 
Sbjct  117   SASAPKGQKSPFNYAIKALIFVTSLHVFHNKQYIHPKIILFLYSIYMYTGLELVLALVAS  176

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             L +A   V+ E  FDEP+L+TSLQDFWGRRWN+MV+ IL PTVYDPVRS+S+R +    A
Sbjct  177   LAQAFLGVDFEPQFDEPYLATSLQDFWGRRWNIMVSRILHPTVYDPVRSISSRVIGNRWA  236

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
              LPAVMASF VS +MHEL+FY IGR  PT E+  FFL++G C+A+EI +K+A DGK+RLP
Sbjct  237   PLPAVMASFFVSAVMHELIFYYIGRTKPTWELTCFFLLHGVCLAVEIMLKQAFDGKWRLP  296

Query  246   GIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFVINHRLVS  94
               VSGPLA+T V++T  WLF P    R + D  A  E +AF EF+ N ++ +
Sbjct  297   AAVSGPLAMTFVVVTGLWLFLPSLLVRCEADVMAYREYVAFTEFIENIQIAN  348



>ref|XP_008227483.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Prunus 
mume]
Length=359

 Score =   310 bits (795),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 176/357 (49%), Positives = 229/357 (64%), Gaps = 19/357 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW   +  L YCHTI G    P  TR  AI PV   F  LPLNLT+I L 
Sbjct  1     MEGEIPNFIMVWILAVASLSYCHTI-GKLTSPGLTRLLAILPVIFFFFFLPLNLTTIFLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G S+FF+ WL +FKL LFA  +GPLS+TPP+ +S FIP ACLPIK    +KV    K   
Sbjct  60    GPSSFFLAWLANFKLLLFAYGKGPLSTTPPISISHFIPLACLPIKF---RKVENKIKSGS  116

Query  747   SLR-------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
             S               K ++      V++ K+++HPK+ L  + I++Y  LE +L +V+ 
Sbjct  117   STSAPKGQKSPFNYAIKALIFATSLHVFHNKQYIHPKIILFLYSIYMYTGLELVLALVAS  176

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             L +A   V+ E  FDEP+L+TSLQDFWGRRWN+MV+ IL PTVYDPVRS+S+R +    A
Sbjct  177   LAQAFLGVDFEPQFDEPYLATSLQDFWGRRWNIMVSRILHPTVYDPVRSISSRVIGNRWA  236

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
              LPAV+A+F VS +MHEL+FY IGR  PT E+  FFL++G C+A+EI +K+  DGK+RLP
Sbjct  237   PLPAVIATFFVSAVMHELIFYYIGRTKPTWELTCFFLLHGVCLAVEIMLKQTFDGKWRLP  296

Query  246   GIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFVIN-HRLVSPESM  82
               +SGPLA+T V++T  WLF P    R + D  A  E +AF EF+ N    V P S+
Sbjct  297   AALSGPLAMTFVVVTGLWLFLPSLLVRCEADVMAYREYVAFTEFMENVSNFVKPNSL  353



>ref|XP_007214572.1| hypothetical protein PRUPE_ppa019907mg [Prunus persica]
 gb|EMJ15771.1| hypothetical protein PRUPE_ppa019907mg [Prunus persica]
Length=348

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 226/352 (64%), Gaps = 18/352 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW   +  L YCHTI G    P  TR  AI PV   F  LPLNLTSI L 
Sbjct  1     MEGEIPNFIMVWILAVASLSYCHTI-GKLTSPGLTRLLAILPVISFFFFLPLNLTSICLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G S+FF+ WL +FKL LFA  +GPLS+TPP+ +S FIP ACLPIK    +KV    K   
Sbjct  60    GPSSFFLAWLANFKLLLFAYGKGPLSTTPPICISHFIPLACLPIKF---RKVENKIKSGP  116

Query  747   SLR-------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
             S               K ++L     V++ K+++HPK+ L  + I++Y  LE ++ +V+ 
Sbjct  117   STSAPKGQKSPLNYAIKALILATSLHVFHNKQYIHPKIILFLYSIYMYTGLELVMALVAS  176

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             L +A   V+ E  FDEP+L+TSLQDFWGRRWN+MV+ IL PTVYDPVRS+S R +    A
Sbjct  177   LAQAFLGVDFEPQFDEPYLATSLQDFWGRRWNIMVSRILHPTVYDPVRSISRRVIGNRWA  236

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
              LPAV+ASF VS +MHEL+FY IGR  PT E+  FFL++G C+A+EI +K+A  GK+RLP
Sbjct  237   PLPAVLASFFVSAVMHELIFYYIGRTKPTWELTCFFLLHGVCLAVEIMLKQAFAGKWRLP  296

Query  246   GIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFVINHRLVS  94
               VSGPLA+  V +T  WLF P    R + D  A  E LAF EF+ N ++ +
Sbjct  297   AAVSGPLAMMFVGVTGLWLFLPSLLVRCEADVMAYREYLAFTEFMKNIKIAN  348



>ref|XP_008364074.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Malus 
domestica]
Length=376

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 219/351 (62%), Gaps = 21/351 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             +EGEI NFIMVW  V+  L YCHT+  L   P  TR  AI PV   F  LPLNLT+I L 
Sbjct  8     LEGEIPNFIMVWILVVASLSYCHTVGNL-TSPGTTRLLAILPVVFFFFYLPLNLTTIFLG  66

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV--------QRRKKV  772
             G S+FF+ WL +FKL LFA  +GPL +TPP  +  FIP ACLPIK         ++ ++ 
Sbjct  67    GPSSFFLAWLANFKLLLFAFNKGPLXTTPPTSIYHFIPLACLPIKFRNDPKNPEKKTERP  126

Query  771   AGNFKFSGSLRKlvllg-----------vvflvyyYKEFLHPKVFLLFFVIHLYIVLEFM  625
             A     S  L K                    VY+ K+F+HPK+ L  + I++Y  LE +
Sbjct  127   AQRISNSKPLPKGKKSTLNYVIKALIFATSVQVYHKKQFIHPKILLFLYSIYMYTGLELI  186

Query  624   LFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARF  445
             L +V+ L R    V+ E  FDEP+L+TSLQDFWGRRWN+MV+ IL PTVY+PVR +S R 
Sbjct  187   LALVASLARVFLGVDFEPQFDEPYLATSLQDFWGRRWNIMVSKILHPTVYEPVRKISTRA  246

Query  444   LPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD  265
             L + LA LPAV+ASF VS +MHEL+FY IGR  PT E+  FFL++G CVA+EI +K+A D
Sbjct  247   LGKKLAPLPAVIASFFVSAVMHELIFYYIGRTWPTWELTCFFLLHGICVAVEIVIKKAFD  306

Query  264   GKFRLPGIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFV  115
             GK+RLP  VSGPLA+  V+ T  WLF P    R + D  A  E  AF EF+
Sbjct  307   GKWRLPAAVSGPLAMAFVVATGVWLFLPSLMVRCEADVMAYREYTAFTEFM  357



>ref|XP_009353571.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Pyrus 
x bretschneideri]
Length=376

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 217/351 (62%), Gaps = 21/351 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             +EGEI NF MVW  V+  L YCHT+  L   P  TR  AI PV   F  LPLNLT+I L 
Sbjct  8     LEGEIPNFFMVWILVVASLSYCHTVGNL-TSPGTTRLLAILPVVFFFFYLPLNLTTIFLG  66

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G S+FF+ WL +FKL LFA  +GPL++TPP  +  FIP ACLPIK +   K         
Sbjct  67    GPSSFFLAWLANFKLLLFAFNKGPLATTPPTSIYHFIPLACLPIKFRNDPKTPEKKTERP  126

Query  747   SLR-------------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFM  625
             + R                   K ++      VY+ K+F+HPK+ L  + I++Y  LE +
Sbjct  127   AQRISNSKPLPKGQKSTLNYVIKALIFATSVQVYHKKQFIHPKILLFLYSIYMYTGLELI  186

Query  624   LFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARF  445
             L +V+ L R    V+ E  FDEP+L+TSLQDFWGRRWN+MV+ IL PTVY+P+R +S R 
Sbjct  187   LALVASLARVFLGVDFEPQFDEPYLATSLQDFWGRRWNIMVSKILHPTVYEPIRKMSTRA  246

Query  444   LPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD  265
             L   LA LPAV+ASF VS +MHEL+FY IGR  PT E+  FFL++G CVA+EI +K+A D
Sbjct  247   LGRKLAPLPAVLASFFVSAVMHELIFYYIGRKWPTWELTCFFLLHGICVAVEIEIKKAFD  306

Query  264   GKFRLPGIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFV  115
             GK+RLP  VSGPLA+  V+ T  WLF P    R + D  A  E  AF EF+
Sbjct  307   GKWRLPAAVSGPLAMAFVVATGVWLFLPSLMVRCEADAMAYREYTAFTEFM  357



>ref|XP_002272250.3| PREDICTED: acyl-CoA--sterol O-acyltransferase 1 [Vitis vinifera]
Length=364

 Score =   301 bits (770),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 166/334 (50%), Positives = 221/334 (66%), Gaps = 5/334 (1%)
 Frame = -3

Query  1119  KKKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTS  940
             K + M+GEI+NF+MVW  V   L YC++I  + PK   TRF AI P+  +FL+LPLNL +
Sbjct  10    KLRKMKGEISNFVMVWVLVYASLIYCYSIAKILPK-GITRFLAIIPIVFVFLILPLNLHT  68

Query  939   IHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNF  760
             +HL GTSAFFI WL +FKL LFA  +GPLS+ P + L  FI  ACLPIK+Q++     + 
Sbjct  69    MHLGGTSAFFIAWLANFKLLLFAFGKGPLSADPSISLLRFIAVACLPIKIQQKPSPKTSR  128

Query  759   KFSGSLR----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
             K   S      K +LL +V     Y +++HPKV L  + + +Y  LE +L +   L R +
Sbjct  129   KPQKSTLNYAVKALLLALVVRSLDYNKYMHPKVILCVYSLIIYFTLELILAVAGFLPRLL  188

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
               VELEA FDEP+LSTSLQDFWGRRWN+MV+NILRPTVY+P    S+R L    A LPA+
Sbjct  189   LGVELEAQFDEPYLSTSLQDFWGRRWNIMVSNILRPTVYEPTLWASSRILGRKWAPLPAI  248

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             + +FVVS +MHEL+FY + R  PT E+  FFL++G C+A+E+ +K+A+    RLP  +SG
Sbjct  249   LGTFVVSALMHELMFYYLARVRPTWEITWFFLLHGLCLAVEVLLKKALPDTCRLPRFISG  308

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             PLA+  V+ T FWLFFP   R K D +A  E  A
Sbjct  309   PLAVVFVMGTGFWLFFPQLLRCKADVRAFDEYAA  342



>emb|CBI29599.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 219/330 (66%), Gaps = 5/330 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEI+NF+MVW  V   L YC++I  + PK   TRF AI P+  +FL+LPLNL ++HL 
Sbjct  1     MKGEISNFVMVWVLVYASLIYCYSIAKILPK-GITRFLAIIPIVFVFLILPLNLHTMHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             GTSAFFI WL +FKL LFA  +GPLS+ P + L  FI  ACLPIK+Q++     + K   
Sbjct  60    GTSAFFIAWLANFKLLLFAFGKGPLSADPSISLLRFIAVACLPIKIQQKPSPKTSRKPQK  119

Query  747   SLR----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
             S      K +LL +V     Y +++HPKV L  + + +Y  LE +L +   L R +  VE
Sbjct  120   STLNYAVKALLLALVVRSLDYNKYMHPKVILCVYSLIIYFTLELILAVAGFLPRLLLGVE  179

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             LEA FDEP+LSTSLQDFWGRRWN+MV+NILRPTVY+P    S+R L    A LPA++ +F
Sbjct  180   LEAQFDEPYLSTSLQDFWGRRWNIMVSNILRPTVYEPTLWASSRILGRKWAPLPAILGTF  239

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
             VVS +MHEL+FY + R  PT E+  FFL++G C+A+E+ +K+A+    RLP  +SGPLA+
Sbjct  240   VVSALMHELMFYYLARVRPTWEITWFFLLHGLCLAVEVLLKKALPDTCRLPRFISGPLAV  299

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAESLA  130
               V+ T FWLFFP   R K D +A  E  A
Sbjct  300   VFVMGTGFWLFFPQLLRCKADVRAFDEYAA  329



>ref|XP_008384132.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Malus 
domestica]
Length=369

 Score =   295 bits (756),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 169/352 (48%), Positives = 219/352 (62%), Gaps = 20/352 (6%)
 Frame = -3

Query  1113  KTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIH  934
             K +EGEI  F MVW  V+  L YCHT+ G    P  TR  A+ PV   F  LPLNLT+I 
Sbjct  2     KKLEGEIPIFFMVWILVVASLSYCHTV-GNVTSPGTTRLLAVLPVVFFFFYLPLNLTTIF  60

Query  933   LAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV-------QRRKK  775
             L G S+FF+ WL +FKL LFA  +GPL++TPP  +S FIP ACLPIK        +++++
Sbjct  61    LGGPSSFFLAWLANFKLLLFAFNKGPLATTPPTSISHFIPLACLPIKFRNDPKNHEKKER  120

Query  774   VAGNFKFSGSL-----------RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEF  628
              A     S SL            K ++      VY+ K+F+HPK+ L  + I++Y  LE 
Sbjct  121   PAQRISASKSLPKGQKSTLNYVTKALIFSTSVHVYHNKQFIHPKILLFLYSIYMYTGLEL  180

Query  627   MLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSAR  448
             +L +V+ L R    V+ E  FDEP+LSTSLQDFWG RWN+MV+ IL PTVY PVR +S  
Sbjct  181   ILALVASLARVFLGVDFEPQFDEPYLSTSLQDFWGSRWNIMVSRILHPTVYQPVREISTG  240

Query  447   FLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV  268
              L    A +PAV+ASF VS +MHEL+FY IGR  PT E+  FFL++G C+++EI +K+A 
Sbjct  241   ALGTKWAPIPAVIASFFVSAVMHELIFYYIGRTLPTWELTCFFLLHGICLSIEIVIKKAF  300

Query  267   DGKFRLPGIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFV  115
             DGK+RLP  VSGPLA+  V+ T  WLF P    R K D  A  E  AF EF+
Sbjct  301   DGKWRLPAAVSGPLAMAFVVATGVWLFLPSIMVRCKPDVMAYREYTAFTEFM  352



>ref|XP_006352462.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
tuberosum]
Length=327

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 217/315 (69%), Gaps = 14/315 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI+VW  VL  LCY HTI    PK   +RF AI P+ CLF +LPL LTSI+L 
Sbjct  1     MEGEIHNFIVVWVIVLASLCYSHTIAKFIPKGK-SRFVAIIPIVCLFYILPLYLTSINLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR----------RK  778
              T++FFI  L +FKL LFA  +GPLSSTP LPLSTFIP ACLPIK+++          +K
Sbjct  60    ATTSFFITGLATFKLILFAFGKGPLSSTPSLPLSTFIPLACLPIKLKKYSTSDNVETKKK  119

Query  777   KVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
               +  F     + K+ LL ++  VY YKE LHPK  L  + +H+Y +LE ML +VS  VR
Sbjct  120   TTSSTFNL---VTKIALLAILIRVYNYKENLHPKFILFCYCLHIYFMLEIMLNIVSIAVR  176

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
              V RVELE   + PHL++SLQDFWG+RWN+MVTNILR  VYD VR V    +P   A +P
Sbjct  177   VVRRVELEPAINNPHLASSLQDFWGKRWNLMVTNILRLAVYDHVRLVIVDRIPRKWAPIP  236

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
             AV+A+F VSG+MHEL FY IGR  P+GE M FFL++G  +++EI +K+  +GKF +P I+
Sbjct  237   AVLATFFVSGLMHELFFYYIGRLKPSGEAMMFFLIHGVALSVEIAIKKMFNGKFLVPRII  296

Query  237   SGPLALTLVILTSFW  193
             SGPLAL  +I TSFW
Sbjct  297   SGPLALAFIIFTSFW  311



>ref|XP_008349375.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Malus 
domestica]
Length=369

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/352 (48%), Positives = 219/352 (62%), Gaps = 20/352 (6%)
 Frame = -3

Query  1113  KTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIH  934
             K +EGEI  F MVW  V+  L YCHT+ G    P  TR  A+ PV   F  LPLNLT+I 
Sbjct  2     KKLEGEIPIFFMVWILVVASLSYCHTV-GNVTSPGTTRLLAVLPVVFFFFYLPLNLTTIF  60

Query  933   LAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV-------QRRKK  775
             L G S+FF+ WL +FKL LFA  +GPL++TPP  +S FIP ACLPIK        +++++
Sbjct  61    LGGPSSFFLAWLANFKLLLFAFNKGPLATTPPTSISHFIPLACLPIKFRNDPKNHEKKER  120

Query  774   VAGNFKFSGSL-----------RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEF  628
              A     S SL            K ++      VY+ K+F+HPK+ L  + I++Y  LE 
Sbjct  121   PAQRISASKSLPKGQKSTLNYVTKALIFSTSVHVYHNKQFIHPKILLFLYSIYMYTGLEL  180

Query  627   MLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSAR  448
             +L +V+ L R    V+ E  FDEP+LSTSLQDFWG RWN+MV+ IL PTVY PVR +S  
Sbjct  181   ILALVASLARVFLGVDFEPQFDEPYLSTSLQDFWGSRWNIMVSRILHPTVYQPVREISTG  240

Query  447   FLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV  268
              L    A +PAV+ASF VS +MHEL+FY IGR  PT E+  FFL++G C+++EI +K+A 
Sbjct  241   ALGTKWARIPAVIASFFVSAVMHELIFYYIGRTLPTWELTCFFLLHGICLSIEIVIKKAF  300

Query  267   DGKFRLPGIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFV  115
             DGK+RLP  VSGPLA+  V+ T  WLF P    R + D  A  E  AF EF+
Sbjct  301   DGKWRLPAAVSGPLAMAFVVATGVWLFLPSIMVRCEPDVMAYREYTAFTEFM  352



>ref|XP_002308777.1| hypothetical protein POPTR_0006s01140g [Populus trichocarpa]
 gb|EEE92300.1| hypothetical protein POPTR_0006s01140g [Populus trichocarpa]
Length=351

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 165/344 (48%), Positives = 225/344 (65%), Gaps = 17/344 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M G + NF++VW  VL  LCYCH I  L  K + TR FAI PV C+FLVLPL ++  +L 
Sbjct  1     MGGGLPNFLLVWILVLALLCYCHKIGKLIDKGT-TRLFAILPVICIFLVLPLYISVFNLR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQR-----------  784
               S+FF+ WL +FKL LFAL +GPLS  P       FI  ACLPIK+Q+           
Sbjct  60    ALSSFFLSWLANFKLLLFALDQGPLSPQPVPLSLPHFIALACLPIKIQQNPPPNLSPHKV  119

Query  783   -RKKVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
              RK ++   K+     K +LL +   +Y  +E++H K+  L +VIH+YI LEF+L MV  
Sbjct  120   PRKGLSTPLKY---FIKFLLLVLFGYMYTKEEYIHSKIIFLVYVIHIYIGLEFILAMVGA  176

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             + RA   +ELE  FDEP+L++SLQDFWG+RWN+MVT++L P V++PVRSV +RF+ +   
Sbjct  177   VARAFLGIELEPQFDEPYLASSLQDFWGKRWNLMVTSVLHPAVFNPVRSVFSRFMTKKWT  236

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
              LPA +ASF+VSGIMHEL+FY+IGR  PT EV  FFL++G C+ +EI +KR ++  + LP
Sbjct  237   LLPAAIASFLVSGIMHELIFYHIGRRKPTWEVTCFFLLHGVCLTIEIVIKRELNCSWGLP  296

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              +V+ PL +  V+ T+ WLF P   R K D +A  E +AFI FV
Sbjct  297   RVVAAPLVVGFVVATAVWLFMPTVVRCKIDVEARMEIIAFINFV  340



>ref|XP_002322537.2| hypothetical protein POPTR_0016s01640g [Populus trichocarpa]
 gb|EEF04298.2| hypothetical protein POPTR_0016s01640g [Populus trichocarpa]
Length=382

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 166/367 (45%), Positives = 229/367 (62%), Gaps = 37/367 (10%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M GE+ NF++VW + +  LCYCH I  L  K + TR  AI PV C+FLV+PL++ S+ L 
Sbjct  1     MGGELGNFLLVWVSAVALLCYCHKIGQLTHKGT-TRLLAILPVVCIFLVMPLSILSLSLR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
               ++FF+ WL +FKL LF   +GPLSS PPL L  F+ FAC PIK+Q+            
Sbjct  60    AITSFFLCWLANFKLLLFVFDQGPLSSNPPLSLPHFVAFACFPIKIQQDPAPTVLPHDQE  119

Query  783   ----------RKKVAGNFKFSGSLR--------------KlvllgvvflvyyYKEFLHPK  676
                        K V+   K + S +              K  LL +   +Y  +++ HPK
Sbjct  120   LVNVDDNQDLEKLVSVENKDTPSQKIAPKGLKSHLNYALKFFLLVIFGYIYAKEDYFHPK  179

Query  675   VFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTN  496
               L  +VIH+YI LE +L M   L RA   VELE  FDEP+L++SLQDFWG+RWN+MVT+
Sbjct  180   FILFLYVIHIYIALELILAMFGALARACLGVELEPQFDEPYLASSLQDFWGKRWNLMVTS  239

Query  495   ILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFL  316
             IL PTVY P+RS  +R++ +  ASLPAV+ +F+VSG+MHEL+FY+IGR  P GEV  FFL
Sbjct  240   ILHPTVYSPIRSTFSRWIAKKWASLPAVIGTFLVSGLMHELIFYHIGRQKPKGEVTCFFL  299

Query  315   VNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAES  136
             ++G C+A+EIG+KR + G   LP +V+ PL +  V++T+ WLF P   R K D +A  ++
Sbjct  300   LHGFCLAIEIGIKREIKGTRGLPRVVAAPLVVGFVVVTAMWLFMPTVVRCKIDAEARMQT  359

Query  135   LAFIEFV  115
             +AFI FV
Sbjct  360   IAFINFV  366



>ref|XP_004295308.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=357

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 169/339 (50%), Positives = 218/339 (64%), Gaps = 11/339 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF+MVWT V+  L YCHTI  L   P  TR   + PV   F  LPL+LT+I L 
Sbjct  1     MEGEIPNFVMVWTLVVASLTYCHTIGNL-TSPGKTRLLFVLPVVLFFFYLPLHLTTIFLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR--RKKVAGNFKF  754
             G ++FF+ WL +FKL LFA  +GPLSS PPL    FIP ACLPIK +    KKV    K 
Sbjct  60    GPTSFFLCWLANFKLLLFAFGKGPLSSDPPLAH--FIPLACLPIKFRSDSEKKVQNVKKG  117

Query  753   SGSLR----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
               S      K ++      V++ KE +HPK+ +  + I+LY  LE +L MV+   R    
Sbjct  118   QKSTLNYAVKALIFSTSIQVFHNKESIHPKIVMFLYAIYLYTGLELILAMVAAAARVFLG  177

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
             V+ E  FDEP+L+TSLQDFWGRRWN+MV  IL PTVY+PVR +S R + +  A LPAV+A
Sbjct  178   VDFEPQFDEPYLATSLQDFWGRRWNIMVNRILHPTVYEPVRDISIRLIGKEWAPLPAVLA  237

Query  405   SFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGIVSGP  229
             +F+VS +MHE VFY IGR  PT E+  FFL++G C+++EI VK+A  G  +RLP IVSGP
Sbjct  238   TFLVSALMHEFVFYYIGRTKPTWELTCFFLLHGVCLSIEITVKKAFRGSTWRLPAIVSGP  297

Query  228   LALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFV  115
             LA+  V++T  WLF P    R + D  A  E +AF+EF+
Sbjct  298   LAMAFVVVTGSWLFLPSLMGRCQADVMAVREYMAFLEFM  336



>ref|XP_007052429.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao]
 gb|EOX96586.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao]
Length=371

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/352 (46%), Positives = 224/352 (64%), Gaps = 32/352 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI +FI VW +VL  LCYC+ I  + PK +  R   + PV CLFL LPLNL S +L 
Sbjct  1     MEGEIGSFIKVWLSVLTSLCYCYAIGKMVPKGT-NRLIFLLPVVCLFLFLPLNLYSPNLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G +AFFI WLG+FKL LFA  +GPL++   LPL  F+  ACLPIK+QR            
Sbjct  60    GVTAFFIAWLGNFKLLLFAFDKGPLTAHTSLPL--FLAVACLPIKIQRNQPSKSQLNGQV  117

Query  783   ------RKKVAGNFKFSGSLRKlvllgvvflvy-----------yYKEFLHPKVFLLFFV  655
                   +    G+ K + S RK     V + +             Y E++HPK+ LL + 
Sbjct  118   KENPSSKSHQNGHEKENSSTRKSKEGAVNYAIKGLLLVIMIRVYDYSEYMHPKIILLLYS  177

Query  654   IHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVY  475
             +H+Y  LE +L + + + R++ R+ELE  F++P+LSTSLQDFWG+RWN+MVT+ILRPTVY
Sbjct  178   MHMYFHLEIILAISAAMARSLSRLELEPQFNKPYLSTSLQDFWGKRWNLMVTSILRPTVY  237

Query  474   DPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             +P    S+  +    A +P+V+++FVVS +MHEL+FY +GR TPTGEV  FFL++G  + 
Sbjct  238   EPTLRFSSTLIGRKWAPIPSVLSTFVVSALMHELMFYYLGRMTPTGEVTLFFLIHGFFLT  297

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             +EI +K+A++GK RLP +V+GPL +  V+ T FWLF P + R K D +A  E
Sbjct  298   VEIALKKALNGKCRLPRLVTGPLTVGFVLGTGFWLFIPQFTRCKVDVRAFEE  349



>ref|XP_010090983.1| hypothetical protein L484_013645 [Morus notabilis]
 gb|EXB41568.1| hypothetical protein L484_013645 [Morus notabilis]
Length=363

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 220/342 (64%), Gaps = 10/342 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+  F+ VW T    L YC+ +  L PK    R   I P+  LFL LPLNL+S+HL 
Sbjct  1     MEREMITFVKVWLTAYASLFYCYVMGKLVPK-GIPRLLGIAPIVILFLFLPLNLSSMHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK---  757
             G ++FF+ WL +FKL LFA  +GPLSS P +    F+  ACLPIK+Q  +K     K   
Sbjct  60    GATSFFLAWLANFKLLLFAFAKGPLSSDPSISPRRFVAVACLPIKIQPHQKPQNPQKPRK  119

Query  756   ------FSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA  595
                    + S++ L+L  +V    YY  F+   + L+ +  H+Y+ LE ML + + L RA
Sbjct  120   RGQKSLLNYSIKGLILALLVQAHRYYTHFMPKNLVLILYSFHIYLCLEIMLAIAAALARA  179

Query  594   VFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPA  415
             V  +ELE  FDEP+LSTSLQDFWGRRWN+MVT+ILRPTVY+PV +++ R +    ASLPA
Sbjct  180   VLGIELEPQFDEPYLSTSLQDFWGRRWNIMVTSILRPTVYEPVVNIATRVIGRKWASLPA  239

Query  414   VMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVS  235
             VM +F VS IMHEL+F+ +GR   T E+  FF+++GAC+  EIG+K+AV GKFRLP IVS
Sbjct  240   VMGTFAVSAIMHELIFFYLGRLKSTWEITWFFVLHGACLTAEIGLKKAVAGKFRLPRIVS  299

Query  234   GPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             GPL +  V++T FWLFFPP  R + D +A  E  A   F+ N
Sbjct  300   GPLTVGFVMVTGFWLFFPPLLRFQADVRAFEEYAAVGAFLKN  341



>ref|XP_004293358.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 220/342 (64%), Gaps = 12/342 (4%)
 Frame = -3

Query  1101  GEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGT  922
             GE+ +FI VW TV   LCYC+ +    PK    R   I P+ CLFL LPL+LTS+HL GT
Sbjct  6     GEMGSFIKVWLTVFLSLCYCYALPKFVPK-GIPRLLCILPIVCLFLDLPLHLTSVHLGGT  64

Query  921   SAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ----------RRKKV  772
             + FFI WL +FKL LFA  +GPLSS   + L+ FI  ACLPIK+Q          + K  
Sbjct  65    TGFFIAWLANFKLLLFAFGKGPLSSDNSISLARFIAVACLPIKIQQVQKHQNGSSKEKPK  124

Query  771   AGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
              G         K +LLG++  VY Y E +HPK+  + +  H+Y +LE +L +V+ + RAV
Sbjct  125   KGQKSPVNYATKGLLLGLLLRVYDYSEHIHPKLLWVMYCFHIYFMLEIILVVVATVARAV  184

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
               +ELE  FDEP+L++SLQDFWGRRWN+MVT+ILRP+VY+PV   + R +    A LPAV
Sbjct  185   MGLELEPQFDEPYLASSLQDFWGRRWNIMVTSILRPSVYEPVLMAATRLVGRKWAPLPAV  244

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG-KFRLPGIVS  235
             M +FVVS IMHEL+FY +GR +PT +V  FFL++G C+ +EI +K+AV   +F+LP ++S
Sbjct  245   MGTFVVSAIMHELIFYYLGRMSPTWQVTWFFLLHGVCLVVEIAIKKAVSSRRFQLPRVIS  304

Query  234   GPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             GPL +  V+ T FWLF P   R K D +A  E  A   FV N
Sbjct  305   GPLTVVFVMATVFWLFLPALLRCKADVRAFEEYAAVGTFVKN  346



>ref|XP_010039853.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW45683.1| hypothetical protein EUGRSUZ_L00539 [Eucalyptus grandis]
Length=360

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 164/344 (48%), Positives = 219/344 (64%), Gaps = 14/344 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF+ VWT V+  L YCHTI+   P  +  R  AI PV  LF +LPL+LT+I L 
Sbjct  1     MEGEIGNFMTVWTLVVISLTYCHTISKTVPAGT-KRLLAISPVIVLFFILPLSLTTISLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIK----VQRRKKVAG--  766
             G ++FFI WL +FKL LFA  +GPLS +    L+ FIP ACLPIK    V+  KK  G  
Sbjct  60    GLTSFFIAWLCNFKLILFAFGKGPLSPSRSCSLAYFIPVACLPIKIHNPVESTKKEEGPC  119

Query  765   ---NFKFSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
                N +   S    + K +++      Y  K  +HP +  L +++H+Y+ LE  L  V  
Sbjct  120   SEINERGLKSPMNYVVKCLVIVAFLPAYERKVRVHPVILNLMYLVHVYVGLEVSLAAVGA  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             +VRA+  + LE  F+EP+LSTSLQDFWGRRWN+MVTNIL P VY PVRS+S+R +    A
Sbjct  180   MVRALTGIGLEPQFEEPYLSTSLQDFWGRRWNLMVTNILHPAVYLPVRSISSRVIGRRWA  239

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
             +LPA  A F+VS +MHEL+FY IGR  P   V SFFL++G CVA EI  K+A+ G+F LP
Sbjct  240   ALPASFACFLVSALMHELIFYYIGRKEPRWVVTSFFLLHGFCVAAEIAAKKALTGRFHLP  299

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               VSGP+A+  +++T+ WLF P       + KA +E+ A ++FV
Sbjct  300   RAVSGPMAVGFILVTALWLFLPALLWCDAEDKARSEATAVVDFV  343



>ref|XP_002299545.2| hypothetical protein POPTR_0001s09110g [Populus trichocarpa]
 gb|EEE84350.2| hypothetical protein POPTR_0001s09110g [Populus trichocarpa]
Length=359

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 218/341 (64%), Gaps = 11/341 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW + L  L YCH +  +  K    RFFAI PV      LPLNL +I L 
Sbjct  1     MEGEIKNFIMVWASALLLLWYCHMVGKIISK-GVIRFFAILPVILFLFYLPLNLFTIWLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQR------RKKVA  769
             G ++FF+ WL +FKL LFA  +GPLS++P       FI  ACLPIK Q+       K+V+
Sbjct  60    GPTSFFLAWLANFKLLLFAFGQGPLSTSPVPLSLPYFISLACLPIKFQQVPQKSVDKEVS  119

Query  768   GNFKFSGSLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
                     L    K+V+L +   +Y  K+ +HPK+ LL + ++LYI LE +L +V+   R
Sbjct  120   KGSGHKSPLNHGLKIVVLAISAPIYLQKDHIHPKMVLLLYCVYLYIGLELVLAVVAAFAR  179

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
                R+ELE  F EP+L+TSLQDFWGRRWN+MVT+IL PTVY+PV S+S+R +    A+LP
Sbjct  180   VYLRLELEPQFHEPYLATSLQDFWGRRWNLMVTSILHPTVYNPVMSISSRLIGRKWAALP  239

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
              V+ASF+VSGIMHE++FY IGR  PT E+  FF ++G  +A+EI +K+A +GK++L  +V
Sbjct  240   GVLASFLVSGIMHEIIFYYIGRKKPTWELTCFFFLHGISLAIEIVIKKAFNGKWQLATVV  299

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             S  L L  V+ T+ WLF P       D KA  E +AF+ FV
Sbjct  300   SRLLTLAFVVATAMWLFMPQVLYADFDVKARRECIAFVNFV  340



>gb|KDP39228.1| hypothetical protein JCGZ_00985 [Jatropha curcas]
Length=344

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 163/342 (48%), Positives = 221/342 (65%), Gaps = 11/342 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E  NFI VW   + CL YC+ I    PK  F R  ++FPV  LF++LP NLT+ HL 
Sbjct  1     MEEEAKNFIKVWFLAITCLSYCYYIASRIPK-GFLRLLSLFPVFYLFIILPFNLTTAHLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AFF+ WL +FKL LF+  +GPLS +P      FI  ACLPIK+   K      ++S 
Sbjct  60    GPTAFFLTWLANFKLLLFSFDQGPLSPSPLKLFH-FISLACLPIKLTNSKNNTN--RYSV  116

Query  747   SLR------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
             S R      K++L  ++F  Y YK+F++P V L+ + +HLYI LE +L + +   RA+F 
Sbjct  117   STRSFLLAIKVILFAIIFHSYSYKQFMYPYVILILYCLHLYIELELVLAICAAPARALFG  176

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
              ELE  F EP+L+TSLQDFWGRRWN+MVT+ILRPTVY+P+R +S R +    ASLPAV  
Sbjct  177   FELEPQFSEPYLTTSLQDFWGRRWNLMVTSILRPTVYNPIRDLSIRLIGPVWASLPAVFV  236

Query  405   SFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPL  226
             +FVVSG++HEL+++ + R +PT EV  FF+++G CVA+E+ VKR V  ++RL  +VSG L
Sbjct  237   TFVVSGLIHELLYFYLTRVSPTWEVTWFFVLHGICVAIEVAVKRVVKDRWRLHPVVSGAL  296

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
              +  V +T  WLFFP   RN  DTK   E    ++FV  H L
Sbjct  297   TIVFVAVTGLWLFFPQLTRNGVDTKVIKELSIVVDFV-KHNL  337



>ref|XP_010052914.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW77056.1| hypothetical protein EUGRSUZ_D01396 [Eucalyptus grandis]
Length=360

 Score =   285 bits (728),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 218/344 (63%), Gaps = 14/344 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NF+ VWT V+  L YCHTI+   P  +  R  AI PV  LF +LPL+LT+I L 
Sbjct  1     MEGEISNFMTVWTLVVISLTYCHTISKTVPAGT-RRLLAISPVIVLFFILPLSLTAISLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR----RKKVAG--  766
             G ++FFI WL +FKL LFA  +GPLS +    L+ FIP ACLPIK+       KK  G  
Sbjct  60    GLTSFFIAWLCNFKLILFAFGKGPLSPSRSCSLAYFIPVACLPIKIHNPVVSTKKEEGPC  119

Query  765   ---NFKFSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
                N +   S    + K +++      Y  K  +HP +  L +++H+Y+ LE  L +V  
Sbjct  120   SEINERGLKSPMNYVVKCLVIVAFLPAYEGKVRVHPVILNLMYLVHVYVGLEVSLAVVGA  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             +VRA+  + LE  F+EP+LSTSLQDFWGRRWN+MVTNIL P VY PVRS+S+R +    A
Sbjct  180   MVRALTGIGLEPQFEEPYLSTSLQDFWGRRWNLMVTNILHPAVYLPVRSISSRLIGRRWA  239

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
             +LPA  A F+VS +MHEL+FY IGR  P  EV SFFL++G CVA EI  K+A+ G+F LP
Sbjct  240   ALPASFACFLVSALMHELIFYYIGRKEPRWEVTSFFLLHGLCVAAEIAAKKALAGRFHLP  299

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               VSG +A+  ++ T+ WLF P       + KA  E+ A ++FV
Sbjct  300   RAVSGAMAVGFILATALWLFLPALLWCDAEDKARREATAVVDFV  343



>ref|XP_010039854.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Eucalyptus 
grandis]
Length=362

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 219/344 (64%), Gaps = 14/344 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NF+ VW  V+  L YCHTI+   P  +  R  AI PV  LF +LPL+LT+I L 
Sbjct  1     MEGEISNFMTVWAVVVISLTYCHTISKTVPAGT-RRLLAISPVIVLFFILPLSLTTISLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIK----VQRRKKVAG--  766
             G ++FFI WL +FKL LFA  +GPLS +    L+ FIP ACLPIK    V+  KK  G  
Sbjct  60    GLTSFFIAWLCNFKLVLFAFGKGPLSPSRSCSLAYFIPVACLPIKIHNPVESTKKEEGPC  119

Query  765   ---NFKFSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
                N +   S    + K +++      Y  K  +HP +  L +++H+Y+ LE  L +V  
Sbjct  120   SEINERGLKSPMNYVVKCLVIVAFLPAYERKVRVHPVIINLMYLVHVYVGLEVSLAVVGA  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             +VRA+  + LE  F+EP+LSTSLQDFWGRRWN+MVT+IL P VY PVRS+S+R +    A
Sbjct  180   MVRALTGIGLEPQFEEPYLSTSLQDFWGRRWNLMVTDILHPAVYLPVRSISSRVIGRRWA  239

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
             +LPA  A F+VS +MHEL+FY IGR  P  EV SFFL++G CVA EI  K+A+ G+F LP
Sbjct  240   ALPASFACFLVSALMHELIFYYIGRKEPRWEVTSFFLLHGLCVAAEIAAKKALAGRFHLP  299

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               VSG +A+  ++ T+ WLF P       + KA +E+ A ++FV
Sbjct  300   RAVSGAMAVGFILATALWLFLPALLWCDAEDKARSEATAVVDFV  343



>ref|XP_010090978.1| hypothetical protein L484_013640 [Morus notabilis]
 gb|EXB41563.1| hypothetical protein L484_013640 [Morus notabilis]
Length=379

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 216/350 (62%), Gaps = 20/350 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             +E E+ NF  VW  VL  LCYCH I  +  K   TRF  I PV  LF VLPL LT+I L 
Sbjct  5     VEEELRNFSTVWIFVLASLCYCHFIAKII-KHGITRFVLILPVLILFFVLPLKLTTICLG  63

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK----------  778
             G ++FFI WL +FKL LF+  +GPLSS PP  ++ FI FAC P+K++             
Sbjct  64    GPTSFFIAWLATFKLILFSFGKGPLSSDPPHSMARFISFACFPVKLEENPTNSTTNGDDP  123

Query  777   ---------KVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFM  625
                      K          L K ++   +F VY  K  LHPK+FLL + ++ Y  LE M
Sbjct  124   NYPTPEKPVKKPAQKSLHSYLLKGIIFSSMFFVYQNKSSLHPKLFLLMYSVYTYTSLEVM  183

Query  624   LFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARF  445
             L +V+ +VRA   VELE  FD+P+++TS+QDFW RRWN+MV+ +LRPTVY PVR+VS   
Sbjct  184   LAIVAAIVRAYLGVELEPQFDDPYMATSVQDFWSRRWNIMVSKVLRPTVYVPVRTVSKHV  243

Query  444   LPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD  265
             +  + A++P V+A F+VSGIMHE +FY IGR+ PTGE+  FF++ G C+ALEI VKR   
Sbjct  244   VGNNWAAIPGVVAVFIVSGIMHEWIFYIIGRSKPTGEIGLFFVLQGVCMALEIIVKRMAH  303

Query  264   GKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             GK+RLP  VSG +A++ V++T+ WLF P   R   D  A  E +  I +V
Sbjct  304   GKWRLPPRVSGTMAVSFVLVTAVWLFLPGMMRYNSDVMAYREMVGLIRYV  353



>ref|XP_002314065.1| hypothetical protein POPTR_0009s05990g [Populus trichocarpa]
 gb|EEE88020.1| hypothetical protein POPTR_0009s05990g [Populus trichocarpa]
Length=347

 Score =   282 bits (722),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 217/326 (67%), Gaps = 4/326 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI VW +VL  LC+C++I  + PK +  R  ++ PV CLFL LPL ++S+HL 
Sbjct  1     MEGEILNFIRVWISVLVSLCFCYSIRNIVPKGT-KRLLSVLPVVCLFLYLPLKISSVHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVA---GNFK  757
             G++AFFI WL +FK+ LFA  +GPLSS P + L  FI  ACLPIK+++++  A   G   
Sbjct  60    GSTAFFIAWLANFKVLLFAFGKGPLSSDPSISLPLFIALACLPIKIRQKENPAPSRGKEG  119

Query  756   FSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
                   K VLL ++   Y Y +++HP V L+ +  H+Y +LE +L + + L R    +EL
Sbjct  120   LRNYAVKGVLLAMLIRAYDYSDYIHPNVILIMYSFHVYFLLEILLAVGAVLARNFLGLEL  179

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFV  397
             E  F+EP+L+TSLQDFWG RWN++VT+ILRPTVY+P R++ +  +    A LPAV A+FV
Sbjct  180   EPQFNEPYLATSLQDFWGCRWNLVVTSILRPTVYEPTRAIGSHLIGRKWAPLPAVFATFV  239

Query  396   VSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALT  217
             VS IMHE++FY +GR  P  E+  FFL++G C+  EI +K+ ++ ++RLP ++S  L + 
Sbjct  240   VSAIMHEIIFYYLGRVRPNWEISWFFLLHGFCLTAEIALKKVLNDRWRLPKMISTMLTVG  299

Query  216   LVILTSFWLFFPPYFRNKGDTKACAE  139
              V+ T FWLFFP +   K D +A  E
Sbjct  300   FVMSTGFWLFFPKFVEYKVDVRAFEE  325



>ref|XP_008384133.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1 [Malus domestica]
Length=368

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 222/349 (64%), Gaps = 17/349 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF+ VW +V   LCYC+ I    PK    R   I P+  LFL LPL+L+S+HL 
Sbjct  1     MEGEIGNFVKVWLSVYLSLCYCYAIAKFVPK-GVPRLLLIIPIVSLFLYLPLHLSSLHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             GT+AFFI WL +FKL LFA  +GPL S P + L  F+  ACLPIK+Q+ +      K + 
Sbjct  60    GTTAFFISWLANFKLLLFAFGKGPLCSDPSISLLRFVAVACLPIKIQQNQYSKTQNKZNP  119

Query  747   SLR--------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
             + +              K +L  ++  +Y YKE +HPK+  + +  H+Y  LE +L + +
Sbjct  120   APKITKNGTKSPLNYAVKGLLFALLVKLYDYKEHIHPKLLWIMYCFHIYFALEIILVIAA  179

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              L RA+  +ELE  FDEP+LS+SLQDFWGRRWN+MVT+ILRPTVY+P+ +++ R +    
Sbjct  180   TLARALLGLELEPQFDEPYLSSSLQDFWGRRWNIMVTSILRPTVYEPILALATRVVGRRW  239

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD--GKF  256
             A+L  VM +F+VS IMHEL+FY +GR  PT E+  FFL++GAC+  EIGVK+AV    K 
Sbjct  240   ATLAGVMGTFLVSAIMHELIFYYLGRTRPTWEITWFFLLHGACLVAEIGVKKAVGKRKKL  299

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             +LP  VSGPL +  V+ T FWLFFPP  R K D +A  E  A   FV N
Sbjct  300   QLPRSVSGPLTVAFVMATVFWLFFPPLLRCKADXRALEEYAAVGAFVKN  348



>ref|XP_008366078.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Malus domestica]
Length=368

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/349 (48%), Positives = 222/349 (64%), Gaps = 17/349 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF+ VW +V   LCYC+ I    PK    R   I P+  LFL LPL+L+S+HL 
Sbjct  1     MEGEIGNFVKVWLSVYLSLCYCYAIAKFVPK-GVPRLLLIIPIVSLFLYLPLHLSSLHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             GT+AFFI WL +FKL LFA  +GPL S P + L  F+  ACLPIK+Q+ +      K + 
Sbjct  60    GTTAFFISWLANFKLLLFAFGKGPLCSDPSISLLRFVAVACLPIKIQQNQYSKTQNKENP  119

Query  747   SLR--------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
             + +              K +L  ++  +Y YKE +HPK+  + +  H+Y  LE +L + +
Sbjct  120   APKITKNGTKSPLNYAVKGLLFALLVKLYDYKEHIHPKLLWIMYCFHIYFALEIILVIAA  179

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              L RA+  +ELE  FDEP+LS+SLQDFWGRRWN+MVT+ILRPTVY+P+ +++ R +    
Sbjct  180   TLARALLGLELEPQFDEPYLSSSLQDFWGRRWNIMVTSILRPTVYEPILALATRVVGRRW  239

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD--GKF  256
             A+L  VM +F+VS IMHEL+FY +GR  PT E+  FFL++GAC+  EIGVK+AV    K 
Sbjct  240   ATLAGVMGTFLVSAIMHELIFYYLGRTRPTWEITWFFLLHGACLVAEIGVKKAVGKRKKL  299

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             +LP  VSGPL +  V+ T FWLFFPP  R K D +A  E  A   FV N
Sbjct  300   QLPRSVSGPLTVAFVMATVFWLFFPPLLRCKADMRALEEYAAVGAFVKN  348



>emb|CAN64383.1| hypothetical protein VITISV_017856 [Vitis vinifera]
Length=382

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 204/350 (58%), Gaps = 15/350 (4%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
             ++ MEGE NNF+MVW        YC+T+  + P     R   I PV  LFL LPL L ++
Sbjct  8     REKMEGEFNNFVMVWVLAFVSFSYCYTMAKIIPS-GRARLLTIIPVMALFLFLPLRLNTL  66

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK  757
             HL GT AFFI WL +FKL LFA   GPL+S P + L  F   A LPIK+Q+     G ++
Sbjct  67    HLGGTFAFFIAWLANFKLLLFAFGEGPLASDPSISLLRFAALASLPIKIQQNPPPNGPYR  126

Query  756   FSGSLRKlvllgvvflvyyYK--------------EFLHPKVFLLFFVIHLYIVLEFMLF  619
              + SL K         V   K              E +HP V L      +Y+ LEF+L 
Sbjct  127   ENPSLEKPKKGQKSPXVXTVKGVVLAMVIVAAHFSEDMHPIVSLFLLJFQMYLSLEFILA  186

Query  618   MVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLP  439
             +V+ L R +  +EL   F+EP+LSTSLQDFWGRRWN+M  +ILRPTVY P   VSAR   
Sbjct  187   LVATLPRVLLGMELAPQFNEPYLSTSLQDFWGRRWNIMAXSILRPTVYLPTLHVSARLFG  246

Query  438   ESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK  259
                A +PAVMA+F+VS +MHEL+FY +GR  PT  +  FF+++G C+ +E+ +K+ + G 
Sbjct  247   RKWAPIPAVMATFIVSAVMHELIFYYMGRTAPTWHISFFFVLHGLCLTVELALKKVLGGI  306

Query  258   FRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
               LP  VSGPL +  V+ T FWLFFP   R K D +A  E  AF+ F+ +
Sbjct  307   XALPAFVSGPLTVAFVVSTGFWLFFPQLLRLKADVRAIEEYAAFVAFLKD  356



>ref|XP_010646195.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Vitis vinifera]
Length=382

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 208/350 (59%), Gaps = 15/350 (4%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
             ++ MEGE+NNF+MVW        YC+T+  + P     R   I PV   FL LPL L ++
Sbjct  8     REKMEGELNNFVMVWVLAFVSFSYCYTMAKIIPS-GRARLLTIIPVMAFFLFLPLRLNTL  66

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK  757
             HL GT AFFI WL +FKL LFA   GPL+S P + L  F   A LPIK+Q+     G ++
Sbjct  67    HLGGTFAFFIAWLANFKLLLFAFGEGPLASDPSISLLRFAALASLPIKIQQNPPPNGPYR  126

Query  756   FSGSLRKlvllgvvflvyyYK--------------EFLHPKVFLLFFVIHLYIVLEFMLF  619
              + SL K        +VY  K              E +HP V L   +  +Y+ LEF+L 
Sbjct  127   ENPSLEKPKKGQKSPVVYTVKGVVLAMVIVAAHFSEDMHPIVSLFLLLFQMYLSLEFILA  186

Query  618   MVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLP  439
             +V+ L R +  +EL   F+EP+LSTSLQDFWGRRWN+M T+ILRPTVY P   VSAR   
Sbjct  187   LVATLPRVLLGMELAPQFNEPYLSTSLQDFWGRRWNIMATSILRPTVYLPTLHVSARLFG  246

Query  438   ESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK  259
                A +PAVMA+F+VS +MHEL+FY +GR  PT  +  FF+++G C+ +E+ +K+ + G 
Sbjct  247   RKWAPIPAVMATFIVSAVMHELIFYYMGRTAPTWHISFFFVLHGLCLTVELALKKVLGGI  306

Query  258   FRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
               LP  VSGPL +  V+ T FWLFFP   R K D +A  E  AF+ F+ +
Sbjct  307   PALPAFVSGPLTVAFVVSTGFWLFFPQLLRLKADVRAIEEYAAFVAFLKD  356



>ref|XP_010270116.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nelumbo 
nucifera]
Length=352

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 221/336 (66%), Gaps = 6/336 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  EINNFI VW +VL  L +C+ I    PK    R   I P+ CLFL+LPL+L S+HL 
Sbjct  1     MGREINNFIKVWVSVLASLSFCYLIASKVPKGKL-RLLTILPICCLFLLLPLSLHSVHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-----KVAGN  763
             GT+AFF+ WL +FKL LF+  RGPLSS P L L  FI  AC PI+++++         G 
Sbjct  60    GTTAFFVAWLANFKLLLFSFGRGPLSSDPSLSLFRFISLACFPIRIKKQNPSPQITKNGT  119

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                     K +L+ ++   Y Y+ +LHPKV L  +  H+Y +LE +L +V+ L RA+  +
Sbjct  120   QSLLNYAIKGLLVALLIRAYDYRPYLHPKVILALYCFHIYFLLEIILAVVAYLARALLGL  179

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             ELE  FD+P+LSTSLQDFWGRRWN+M +NILR TVY+P RS++ R      ASLPA++A+
Sbjct  180   ELEPQFDDPYLSTSLQDFWGRRWNIMASNILRSTVYEPTRSLAERITGRKWASLPAILAT  239

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLA  223
             FVVSG+MHEL+ + +GR+ PT E+  FF+++G C+ALEI  K A+  ++RL   VSGPL 
Sbjct  240   FVVSGLMHELIIFYLGRSEPTWEMTWFFILHGFCLALEIPAKSALASRWRLHRSVSGPLT  299

Query  222   LTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +  V+ TSFWLFFP + R   D +A  E +A  EFV
Sbjct  300   IAFVMGTSFWLFFPQFLRCGADIRALGEYVAVGEFV  335



>ref|XP_011001005.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Populus 
euphratica]
Length=385

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 224/367 (61%), Gaps = 37/367 (10%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  ++++F++VW + +  LCYCH I  L  K + TR  AI PV C+FLV+PL++ ++ L 
Sbjct  1     MGADLSSFLLVWVSAVALLCYCHKIGQLAHKGT-TRLLAILPVVCIFLVMPLSILNLSLR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR--------RKKV  772
               ++F   WL +FKL LF   +GPLSS PPL L  F+ FAC PIK+Q+          + 
Sbjct  60    AITSFLFCWLANFKLLLFVFDQGPLSSNPPLSLPHFLAFACFPIKIQQDPTPTVSPHDQE  119

Query  771   AGNFKFSGSLRKlvllgvvfl----------------------------vyyYKEFLHPK  676
               N   +  L KLV +                                 +Y  ++++HPK
Sbjct  120   LVNVDDNQDLEKLVNVENKDTPSQKIAPKGLKSHLNYALKFFLLVIFGFIYTKEDYVHPK  179

Query  675   VFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTN  496
               L  +VIH+YI LE +L M   L RA   VELE  FDEP+L++SLQDFWG+RWN+MVT+
Sbjct  180   FILFLYVIHIYIALELILAMFGALARACLGVELEPQFDEPYLASSLQDFWGKRWNLMVTS  239

Query  495   ILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFL  316
             IL PTVY P+RS  + ++ ++ ASLPAVM +F+VSG+MHEL+FY+IGR  P  EV  FFL
Sbjct  240   ILHPTVYSPIRSTFSHWIAKTWASLPAVMGTFLVSGLMHELIFYHIGRQKPKWEVTCFFL  299

Query  315   VNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAES  136
             ++G C+ +EIG+KR + G + LP +V+ PL +  V++T+ WLF P   R K D +A  E+
Sbjct  300   LHGFCLDIEIGIKRVIKGTWGLPRVVAAPLVVGFVVVTAMWLFMPTVVRCKIDAEARMET  359

Query  135   LAFIEFV  115
             +AFI FV
Sbjct  360   IAFINFV  366



>ref|XP_003635026.2| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Vitis vinifera]
Length=382

 Score =   281 bits (718),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 205/350 (59%), Gaps = 15/350 (4%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
             ++ MEGE NNF+MVW        YC+T+  + P     R   I PV  LFL LPL L ++
Sbjct  8     REKMEGEFNNFVMVWVLAFVSFSYCYTMAKIIPS-GRARLLTIIPVMALFLFLPLRLNTL  66

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK  757
             HL GT AFFI WL +FKL LFA   GPL+S P + L  F   A LPIK+Q+       ++
Sbjct  67    HLGGTFAFFIAWLANFKLLLFAFGEGPLASDPSISLLRFAALASLPIKIQQNPPPNDPYR  126

Query  756   FSGSLRKlvllgvvflvyyYK--------------EFLHPKVFLLFFVIHLYIVLEFMLF  619
              + SL K        LV   K              E +HP V L   +  +Y+ LEF+L 
Sbjct  127   ENPSLEKPKKGQKSPLVSTVKGVVLAVVIVAAHFSEDMHPIVSLFLLIFQMYLSLEFILA  186

Query  618   MVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLP  439
             +V+ L R +  +EL   F+EP+LSTSLQDFWGRRWN+M ++ILRPTVY P   VSAR   
Sbjct  187   LVATLPRVLLGMELAPQFNEPYLSTSLQDFWGRRWNIMASSILRPTVYLPTLHVSARLFG  246

Query  438   ESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK  259
                A +PAVMA+F+VS +MHEL+FY +GR  PT  +  FF+++G C+  E+ +K+ + G 
Sbjct  247   RKWAPIPAVMATFIVSAVMHELIFYYMGRTAPTWHISFFFVLHGLCLTFELALKKVLGGI  306

Query  258   FRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
               LP  VSGPL +  V+ T FWLFFP   R K D +A  E  AF+ F+ +
Sbjct  307   LALPAFVSGPLTVAFVVSTGFWLFFPQLLRLKADVRAIEEYAAFVAFLKD  356



>ref|XP_009357550.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1 [Pyrus x bretschneideri]
Length=368

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 170/356 (48%), Positives = 224/356 (63%), Gaps = 19/356 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI VW +V   LCYC+ I    PK    R   I P+  LFL LPL+L+S+HL 
Sbjct  1     MEGEIGNFIKVWLSVYLSLCYCYAIAKFVPK-GVPRLLLIIPIVSLFLYLPLHLSSLHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR--------RKKV  772
             GT+AFFI WL +FKL L A  +GPL S P + L  F+  ACLPIK+Q+        ++  
Sbjct  60    GTTAFFISWLANFKLLLLAFGKGPLCSDPSISLLRFVAVACLPIKIQQNPYSKTQNKENP  119

Query  771   AGNFKFSGSLR------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
             A     +G+        K++L  ++  +Y YKE +HPK+  + +  H+Y  LE +L + +
Sbjct  120   APKITKNGTKSPLNYAVKVLLFALLVKLYDYKEHIHPKLLWIMYCFHIYFALEIILVIAA  179

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              L RA+  +ELE  F+EP+LS+SLQDFWGRRWN+MVT+ILRPTVY+P+ +++ R +    
Sbjct  180   TLARALLGLELEPQFNEPYLSSSLQDFWGRRWNIMVTSILRPTVYEPILALATRVVGRRW  239

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD--GKF  256
             ASL  VM +FVVS IMHEL+FY +GR  PT E+  FFL++GAC+  EIGVK+AV    K 
Sbjct  240   ASLAGVMGTFVVSAIMHELIFYYLGRTRPTWEITWFFLLHGACLMAEIGVKKAVGKRKKL  299

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV--INHRLVS  94
             +LP  VSGPL +  V  T FWLFFPP  R K D +A  E  A   FV  I H   S
Sbjct  300   QLPRSVSGPLTVAFVTATVFWLFFPPLLRCKADVRALEEYAAVGAFVKHIGHAFAS  355



>ref|XP_007052430.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao]
 gb|EOX96587.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao]
Length=371

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/352 (44%), Positives = 216/352 (61%), Gaps = 32/352 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI++FI VW +VL  LC+C+ I  + PK +  R   + PV  LFL LPL L+S HL 
Sbjct  1     MEGEISSFIKVWLSVLTSLCFCYAIGKMVPKGT-KRLIFLLPVVSLFLFLPLKLSSPHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G +AFF+ WLG+FKL LFA  +G    T    L  F+  ACLPIK+Q             
Sbjct  60    GVTAFFVAWLGTFKLFLFAFDKG--PLTAHTSLPLFVAVACLPIKIQHNQPPKSQLNGQI  117

Query  783   ------RKKVAGNFKFSGSLRKlvl-----------lgvvflvyyYKEFLHPKVFLLFFV  655
                   +    G+ K S S RK              L ++  VY Y E++HPK+ +L + 
Sbjct  118   KENPSSKSHQNGHEKESSSPRKSKEGPVNYAIKGILLAMIVRVYDYSEYMHPKIIMLLYS  177

Query  654   IHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVY  475
             +H+Y +LE +L + + +VR+   +ELE  F+EP+LSTSLQDFWG+RWN+MV++ILRPTVY
Sbjct  178   MHIYFLLEIILAIGAAMVRSFSGLELEPQFNEPYLSTSLQDFWGKRWNLMVSSILRPTVY  237

Query  474   DPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             +P    S+  +    A +P+V ++F VS IMHEL+FY +GR TP+GEV  FFL++G C+ 
Sbjct  238   EPTLRFSSTLIGRKWAPIPSVFSTFAVSAIMHELMFYYLGRMTPSGEVTWFFLIHGFCLT  297

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
              EI  K+A++GK +LP +V+GPL +  V+ T  WLF P + R K D +A  E
Sbjct  298   AEIAFKKALNGKCQLPWLVTGPLTVVFVLGTGLWLFIPQFTRCKVDVRAFEE  349



>ref|XP_011095962.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Sesamum 
indicum]
Length=368

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 214/342 (63%), Gaps = 11/342 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEIN FI VW +    LCYC+    + PK    R  A  PV  LF +LPL L S+HL 
Sbjct  13    MEGEINTFIKVWISAYLSLCYCYFAGKMLPK-GHRRLAAFLPVMALFPLLPLQLHSLHLG  71

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK---  757
             G ++FF+ WL +FKL LFA  +GPLS         F+  ACLPIK+ +  K   N K   
Sbjct  72    GITSFFLAWLTTFKLLLFAFDQGPLSIPSISLPR-FLAVACLPIKLIQPSKSRENGKIHS  130

Query  756   ------FSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA  595
                   F     K +L  ++   Y Y++ +HP++ ++ +  H+Y+ LE +L + + + R 
Sbjct  131   EKGHKSFLNYAIKALLFALIIKSYDYEDHIHPRIIMVMYCFHIYLSLEIILAIAAAMARG  190

Query  594   VFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPA  415
             +   ELE  F+EP+LSTSLQDFWGRRWN+MVT ILRPTVY PV   S+  L    A+LPA
Sbjct  191   LLGAELEPQFNEPYLSTSLQDFWGRRWNLMVTRILRPTVYLPVLDWSSSILGREWAALPA  250

Query  414   VMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVS  235
             VMA+F+VSG+MHEL+FY +GR  PT E+  FF+++GAC+ +EI VK+AV+G++RLP ++ 
Sbjct  251   VMATFIVSGLMHELIFYQLGRVKPTWEITWFFVLHGACLMVEIVVKKAVNGRWRLPRLIG  310

Query  234   GPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
               L++ LV++T  WLFFP   R K D +  AE  A   FV +
Sbjct  311   TILSIGLVMVTGSWLFFPQLLRCKADERGLAELAAIGTFVKD  352



>ref|XP_002527947.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34436.1| conserved hypothetical protein [Ricinus communis]
Length=327

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 212/335 (63%), Gaps = 24/335 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+ F+ VW  V   L YC+ +    P+   +RF  + P+ CLFL LPLNL++IHL 
Sbjct  1     MEGEISKFLKVWLLVFASLIYCYALGKNVPEGK-SRFILLLPIICLFLYLPLNLSTIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AFFI WL +FKL LFA  +GPLSS P + L +F+  +CLPIK+Q         +   
Sbjct  60    GMTAFFIAWLANFKLLLFAFGKGPLSSNPSISLPSFLALSCLPIKIQDNPSPKSQLE---  116

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHL-YIVLEFMLFMVSGLVRAVFRVELEA  571
                               +  +PK+        L Y + E +L MV+ +VR + RVELE 
Sbjct  117   ------------------QNPYPKISKQAKKSSLNYAIKEIVLAMVTAVVRTILRVELEP  158

Query  570   PFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVS  391
             PF++P+LSTSLQDFWG+RWN+MV++ILR T+Y+P  ++SAR +    A +P V+ASF+VS
Sbjct  159   PFNDPYLSTSLQDFWGKRWNLMVSSILRSTIYEPTLTISARIIGRKWAPIPGVLASFLVS  218

Query  390   GIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLV  211
              +MHEL+FY +GR  PT EV  FF+++G CV +EI +K+A+ G++RLP ++SG LA+  V
Sbjct  219   AVMHELMFYYLGRVRPTWEVTWFFILHGFCVVVEIAIKKALKGRWRLPELISGVLAVGFV  278

Query  210   ILTSFWLFFPPYFRN-KGDTKACAESLAFIEFVIN  109
             ++T FWLFFP + +  + D +A  E  A   F+ N
Sbjct  279   VVTGFWLFFPQFLQQCRADVRAFEEYAALGPFLKN  313



>ref|XP_002532421.1| acyltransferase, putative [Ricinus communis]
 gb|EEF29962.1| acyltransferase, putative [Ricinus communis]
Length=369

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/350 (46%), Positives = 217/350 (62%), Gaps = 20/350 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEG+ +NFI  W  +   L YC     + PK S TR F + P+ CLFL+LPLN++S+H  
Sbjct  1     MEGKAHNFIKAWLLIFASLSYCFATGKIIPKGS-TRLFFLLPIVCLFLILPLNISSVHFQ  59

Query  927   GTSAFFIGWLGSFKLTLFALCRG-plsstpplplsTFIPFACLPIKVQR--------RKK  775
             G +AFFI WL +FKL LFA  +G   S       + F+  ACLPIK+Q           K
Sbjct  60    GMTAFFIAWLANFKLLLFAFGKGPLSSDNSSTSFTRFVLNACLPIKIQENPSQGSHINSK  119

Query  774   VAGNFKFSGSLR----------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFM  625
                N   + S +          K +LL ++  VY Y EF+HP V L+ + +H+Y+ LE +
Sbjct  120   NKENPHLNSSKKCHKSFPNYAIKGILLALLIRVYDYHEFIHPNVILVLYYLHIYLFLELV  179

Query  624   LFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARF  445
             L M++ L RA+  VELE  F+EP+LSTSLQDFWGRRWN+MVT+ILRPTVYDP+   S+  
Sbjct  180   LAMLAALARAMIGVELEPQFNEPYLSTSLQDFWGRRWNLMVTSILRPTVYDPLIRTSSPI  239

Query  444   LPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD  265
             +    ASLPA++ +F VS IMHEL+FY++GR  PT E+  FF+++G C+  E+  K+AV+
Sbjct  240   IGRRWASLPAILGTFTVSAIMHELIFYHLGRVRPTWEITWFFMLHGVCLVAEVAFKKAVN  299

Query  264   GKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             G++RL   VS PL +  V +T FWLFFP   R K D +A  E  A  EFV
Sbjct  300   GRWRLSRFVSTPLTIGFVAVTGFWLFFPSLLRCKTDVRAFEEYSALSEFV  349



>ref|XP_011029375.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Populus euphratica]
Length=359

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 163/343 (48%), Positives = 218/343 (64%), Gaps = 11/343 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW + L  L YCH +  +  K    RFFAI PV      LPLNL +I L 
Sbjct  1     MEGEIKNFIMVWASALLLLSYCHMVGKIISK-GVIRFFAILPVILFLFFLPLNLFTIWLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRR-KKVAGNFKF  754
             G + FF+ WL +FKL LFA  +GPLS+ P       FI  ACLPIK Q+  +K   N   
Sbjct  60    GPTCFFLAWLANFKLLLFAFGQGPLSTYPVPLSFPYFISLACLPIKFQQHPQKSVDNKVC  119

Query  753   SGSLRKl--------vllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
              GS  K         V+L +   +Y  K+ +HPK+ LL + ++LYI LE +L +V+   R
Sbjct  120   KGSGHKSPLNRGLKIVVLAITAPIYLQKDHIHPKMVLLLYCVYLYIGLELVLAVVAAFAR  179

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
                R+ELE  F EP+L+TSLQDFWGRRWN+MVT+IL+PTVY+PV S+S+R +    A+LP
Sbjct  180   VYLRLELEPQFHEPYLATSLQDFWGRRWNLMVTSILQPTVYNPVMSISSRLIGRKWAALP  239

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
              V+ASF+VSGIMHE++FY IGR  PT E+  FF ++G  +A+EI +K+  +GK++L  +V
Sbjct  240   GVLASFLVSGIMHEIIFYYIGRKKPTWELTCFFFLHGISLAIEIVIKKVFNGKWQLATVV  299

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             S  L L  V++T+ WLF P     + D KA  E +AFI FV +
Sbjct  300   SRFLTLAFVVVTAMWLFMPQVLYAEFDVKARRECIAFINFVKD  342



>ref|XP_011025512.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Populus 
euphratica]
Length=366

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/345 (44%), Positives = 219/345 (63%), Gaps = 23/345 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI VW +VL  LC+C++I  + PK +  R  ++ PV CLFL LPL ++S+HL 
Sbjct  1     MEGEILNFIKVWISVLVSLCFCYSIRNIVPKGT-KRLLSVLPVVCLFLYLPLKISSVHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKV----AGNF  760
             G++AFFI WL +FK+ LFA  +GPLSS P + L  FI  ACLPIK++++ K     + N 
Sbjct  60    GSTAFFIAWLANFKVLLFAFGKGPLSSDPSISLPLFIALACLPIKIRQKDKNKETPSPNP  119

Query  759   KFSGSLR------------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVL  634
             +  G  +                  K VLL ++   Y Y +++HP V L+ +  H+Y +L
Sbjct  120   RLDGQSKENPAPSRAGKEGLRNYAIKGVLLAMLIRAYDYSDYIHPNVILIMYSFHVYFLL  179

Query  633   EFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVS  454
             E +L + + L R    +ELE  F EP+L+TSLQDFWG RWN++VT+ILRPTVY+P R++ 
Sbjct  180   EILLAVGAVLARNFLGLELEPQFKEPYLATSLQDFWGCRWNLVVTSILRPTVYEPTRAIG  239

Query  453   ARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR  274
             +  +    A LPAV A+FVVS +MHE++FY +GR  P  E+  FFL++G C+  EI +K+
Sbjct  240   SHLIGRKWAPLPAVCATFVVSALMHEIIFYYLGRVRPNWEISWFFLLHGFCLTAEIALKK  299

Query  273   AVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
              ++ ++RLP ++S  L +  V+ T FWLFFP +   K D +A  E
Sbjct  300   VLNDRWRLPKMISTMLTVGFVMSTGFWLFFPKFVEYKVDVRAFEE  344



>ref|XP_010052915.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like isoform 
X2 [Eucalyptus grandis]
Length=356

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 214/344 (62%), Gaps = 18/344 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NF+ VWT V+  L YCHTI+   P  +  R  AI PV  LF +LPL+LT+I L 
Sbjct  1     MEGEISNFMTVWTLVVISLTYCHTISKTVPAGT-RRLLAISPVIVLFFILPLSLTAISLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR----RKKVAG--  766
             G ++FFI WL +FKL LFA  +GPLS +    L+ FIP ACLPIK+       KK  G  
Sbjct  60    GLTSFFIAWLCNFKLILFAFGKGPLSPSRSCSLAYFIPVACLPIKIHNPVVSTKKEEGPC  119

Query  765   ---NFKFSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
                N +   S    + K +++      Y  K  +HP +  L +++H+Y+ LE  L +V  
Sbjct  120   SEINERGLKSPMNYVVKCLVIVAFLPAYEGKVRVHPVILNLMYLVHVYVGLEVSLAVVGA  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
             +VRA+  + LE  F+EP+LSTSLQDFWGRRWN+MVTNIL P VY PV    +R +    A
Sbjct  180   MVRALTGIGLEPQFEEPYLSTSLQDFWGRRWNLMVTNILHPAVYLPV----SRLIGRRWA  235

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
             +LPA  A F+VS +MHEL+FY IGR  P  EV SFFL++G CVA EI  K+A+ G+F LP
Sbjct  236   ALPASFACFLVSALMHELIFYYIGRKEPRWEVTSFFLLHGLCVAAEIAAKKALAGRFHLP  295

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               VSG +A+  ++ T+ WLF P       + KA  E+ A ++FV
Sbjct  296   RAVSGAMAVGFILATALWLFLPALLWCDAEDKARREATAVVDFV  339



>ref|XP_007020661.1| Acyltransferase, putative [Theobroma cacao]
 gb|EOY12186.1| Acyltransferase, putative [Theobroma cacao]
Length=350

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/351 (45%), Positives = 215/351 (61%), Gaps = 11/351 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E++NFI VWT  +   CYC  ++         R  ++ P+  LFL+LPLNL+S HL+
Sbjct  1     MDVELHNFIKVWTLAITSFCYCFYVSARLVPKGMLRLISLLPIFFLFLILPLNLSSFHLS  60

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR----------RK  778
             G +AFF+ WL SFKL LF   +GPLS  PP     FI  A LPIK +R          + 
Sbjct  61    GPTAFFLAWLASFKLLLFCFDQGPLSPPPPSVFH-FISIASLPIKTKRNPIQNKALPPQS  119

Query  777   KVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
               +G  K      K++LL V+F  Y YK+ LH  + L  + +H Y+ LE +L + +   R
Sbjct  120   SSSGYAKSILLAVKVLLLAVLFHSYNYKQHLHKNLILAMYCVHTYLELEIVLAISAIPAR  179

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
             A+F  E+E  F+EP+L+TSLQDFWG RWN+MVT+ILRPTVY P+R +S   +     SLP
Sbjct  180   AIFGFEIEPQFNEPYLATSLQDFWGHRWNLMVTSILRPTVYHPIRRISTHIVRPRWISLP  239

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
             AV+A FVVSG+MHEL++Y I R  PT EV  FF++ G  VA+E+  K+     ++LP +V
Sbjct  240   AVIAVFVVSGLMHELIYYYITRVYPTWEVTWFFILQGVAVAIEVVAKKVTPVNWKLPPVV  299

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPES  85
             SGPLAL  V ++ FWLFFP   RN+ D KA  E    ++F+ NH L  P +
Sbjct  300   SGPLALGFVAVSGFWLFFPQLLRNRVDEKAIGEYFMLVDFIKNHVLPFPSN  350



>ref|XP_008231533.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Prunus 
mume]
Length=362

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 155/355 (44%), Positives = 222/355 (63%), Gaps = 23/355 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE  +FI VWT+V  C+ YC++I  + PK + TR     PV CLF  LPLN +SIHL 
Sbjct  1     MEGEFGSFIKVWTSVFVCIFYCYSIGKIVPKGT-TRLVCALPVVCLFFYLPLNFSSIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G ++FFI WLGSFKL LFA  +GPL+S P + +  F+  ACLPI++Q             
Sbjct  60    GGTSFFISWLGSFKLLLFAFGKGPLASDPSISIGRFLAIACLPIEIQENPSPSASHLNGQ  119

Query  783   -RKKVAGNFKFSGS---------LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVL  634
              RK    N +   +         + K  LL ++  V  Y + +HPK+ L+   +++Y++L
Sbjct  120   NRKNPPQNPQIETNPSPKNTIHIVIKGFLLAILIGVLNYSQQIHPKLILVLHCLYIYLLL  179

Query  633   EFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVS  454
             E  L +V+ L   +  ++L+  F+EP+LSTSLQ+FWGRRWN++VT+ILR +VY+P  + S
Sbjct  180   ETQLIIVAALAWGLLGLDLKPHFNEPYLSTSLQNFWGRRWNLVVTSILRQSVYEPTLNFS  239

Query  453   ARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR  274
                +    ASLPAV ASF+VSG+MHEL++Y +GR  PT EV  FF+++G C+ LEI +K+
Sbjct  240   TCVIGRRWASLPAVFASFLVSGLMHELIYYYMGRVRPTWEVTWFFVLHGFCLMLEIVLKK  299

Query  273   AVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             A+ G  RLP ++S  L +  V+ T FWLFFP + R K D +   E  AF+ F+ N
Sbjct  300   ALKGSCRLPRLISVVLTVGFVVATCFWLFFPQFLRCKADVRMLQEYRAFVVFLKN  354



>ref|XP_010273158.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1 [Nelumbo nucifera]
Length=347

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 213/336 (63%), Gaps = 6/336 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M GE+ +FI V  +VL  L YC+ +    PK    R  ++ PV  +F  LPL L+++HL 
Sbjct  1     MNGELQSFIKVLLSVLSSLTYCYFVASKIPKGKL-RLLSLLPVFSIFTFLPLLLSTVHLT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-----KVAGN  763
             GT++FFI WL +FKL LFA  +GPLSS PP     FI  A LPIK+++       +    
Sbjct  60    GTTSFFITWLANFKLLLFAFDQGPLSSHPPKSFLRFISIASLPIKIKQNPSPQFIRNETK  119

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                +    K  L  ++  +Y YK++L  KV +L +  H +++LEF+L + + L R +   
Sbjct  120   SPLNNLAIKAFLFALLIRIYDYKQYLQRKVVILLYCCHAFLLLEFILALGAFLARLLLGQ  179

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             +LE   DEP+LSTSLQDFWGRRWN+MVT ILRPTVY+PVRS+S R +   L+ L  V+A+
Sbjct  180   DLEPQSDEPYLSTSLQDFWGRRWNLMVTGILRPTVYNPVRSISERVVGRELSPLAGVLAA  239

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLA  223
             F+VSG+MHEL+FY I   TPT EV  FFL++G C A+E+ VK+ V+G+ RL   +SG L 
Sbjct  240   FLVSGLMHELIFYYITHVTPTWEVTCFFLLHGVCTAMEVVVKKTVNGRLRLHRAISGLLT  299

Query  222   LTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +  V++T+ WLFFPP  RN  D +   E+L  I +V
Sbjct  300   VGFVVVTAMWLFFPPPLRNGADARLIGENLVAIAYV  335



>gb|KCW77067.1| hypothetical protein EUGRSUZ_D01409 [Eucalyptus grandis]
Length=379

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 162/379 (43%), Positives = 229/379 (60%), Gaps = 35/379 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF  V  T L  LCYC+ +  + PK +  R   I PV  LFL LPLNL++++L 
Sbjct  1     MEGEIYNFFKVCITALMSLCYCYIVGRIIPKGT-RRLLPILPVVALFLYLPLNLSAVNLI  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G ++F I WLG+ KL LFA  +GPLSS PP+ L  F+  ACLPIK+QR            
Sbjct  60    GQTSFIISWLGNSKLLLFAFGKGPLSSDPPISLPRFLAIACLPIKIQRTPLKKSPQRTQN  119

Query  783   -----RKKVAGNFKFS------GSLR-----------KlvllgvvflvyyYKEFLHPKVF  670
                  R    G+ K +       ++R           K +L  ++  VY Y +  HP + 
Sbjct  120   TKDHIRSPQNGHHKENPLPQNPENIRPKTILLLNYPTKALLFVMLLRVYDYGDHFHPNLI  179

Query  669   LLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNIL  490
             LL +  HLY+ L+ +L  +    RA F +ELE  F EP+LS+SLQDFWG+RWN+MVTNIL
Sbjct  180   LLIYSCHLYLALDLILSSIQATARAAFGMELEPQFREPYLSSSLQDFWGKRWNLMVTNIL  239

Query  489   RPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVN  310
             R T+Y+PV   ++  +    A+LPAVMASF+VSG+MHEL+F+++GR  PT EVM FF+++
Sbjct  240   RVTIYEPVHYAASAAIGRKWAALPAVMASFLVSGLMHELMFFHMGRVKPTWEVMWFFVLH  299

Query  309   GACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             GAC+ +E+ VKR    K+RLP +++G + +T V++T+ WLFFP   R+    KA  E  A
Sbjct  300   GACLVIEVVVKRKCGTKWRLPRVLTGLMTVTFVMVTASWLFFPQLLRDGVIKKALEEYAA  359

Query  129   FIEFVINHRLVSPESMTCQ  73
               EF+ +  +  P  + C+
Sbjct  360   AGEFLKDVAVEDPVVVKCR  378



>gb|KHN40830.1| Acyl-CoA--sterol O-acyltransferase 1 [Glycine soja]
Length=361

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 220/349 (63%), Gaps = 18/349 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW+     +CYCH I  L P+ + +R  A+FP   + L+LPL L S+HL 
Sbjct  3     MEGEIKNFIMVWSVASATMCYCHRIGKLIPEGT-SRLIALFPAIGILLLLPLRLISVHLG  61

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR-------RKKVA  769
             G SAFF+GWL +FKL LFA  +GPLSS PPL L  F+P ACLPIK +        +KK  
Sbjct  62    GPSAFFLGWLSTFKLILFAFGKGPLSSNPPLSLPHFVPIACLPIKFEHDPKHQIPQKKHK  121

Query  768   GNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
               F ++ S   +++L  +  +Y  KE+ HPK     + +H+YI LEF+   VS   R + 
Sbjct  122   SPFSYA-STSMVIILAALIPLYGKKEYFHPKFVFFLYGLHMYIGLEFIFATVSAATRKLI  180

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              V+LE  F EP+L TSLQDFWGRRWN+MV  +L PTVYDPV+++SAR L    A LPA++
Sbjct  181   GVQLEPQFKEPYLCTSLQDFWGRRWNIMVNRVLHPTVYDPVKNLSARVLGRKWAPLPAIL  240

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMS-------FFLVNGACVALEIGVKRAVDGK--F  256
             ASF VSG+MHELVFY I R   T EV         FFL++G CVA+E+G+K+++ GK  +
Sbjct  241   ASFAVSGMMHELVFYYIKREKRTWEVWEPSWDATCFFLIHGVCVAMEVGIKKSLRGKKQW  300

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             ++P ++S  L L  V+ T+   F P   R +   KA  E  A  +F+++
Sbjct  301   QVPRVLSWMLTLLFVLYTAMAFFLPALARCRVYEKATRELTALTQFLMD  349



>ref|XP_003534825.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Glycine 
max]
Length=361

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 220/349 (63%), Gaps = 18/349 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFIMVW+     +CYCH I  L P+ + +R  A+FP   + L+LPL L S+HL 
Sbjct  3     MEGEIKNFIMVWSIASATMCYCHRIGKLIPEGT-SRLIALFPAIGILLLLPLRLISVHLG  61

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR-------RKKVA  769
             G SAFF+GWL +FKL LFA  +GPLSS PPL L  F+P ACLPIK +        +KK  
Sbjct  62    GPSAFFLGWLSTFKLILFAFGKGPLSSNPPLSLPHFVPIACLPIKFEHDPKHQIPQKKHK  121

Query  768   GNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
               F ++ S   +++L  +  +Y  KE+ HPK     + +H+YI LEF+   VS   R + 
Sbjct  122   SPFSYA-STSMVIILAALIPLYGKKEYFHPKFVFFLYGLHMYIGLEFIFATVSAATRKLI  180

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              V+LE  F EP+L TSLQDFWGRRWN+MV  +L PTVYDPV+++SAR L    A LPA++
Sbjct  181   GVQLEPQFKEPYLCTSLQDFWGRRWNIMVNRVLHPTVYDPVKNLSARVLGRKWAPLPAIL  240

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMS-------FFLVNGACVALEIGVKRAVDGK--F  256
             ASF VSG+MHELVFY I R   T EV         FFL++G CVA+E+G+K+++ GK  +
Sbjct  241   ASFAVSGMMHELVFYYIKREKRTWEVWEPSWDATCFFLIHGVCVAMEVGIKKSLRGKKQW  300

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             ++P ++S  L L  V+ T+   F P   R +   KA  E  A  +F+++
Sbjct  301   QVPRVLSWMLTLLFVLYTAMAFFLPALARCRVYEKATRELTALTQFLMD  349



>ref|XP_004288487.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=349

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 166/342 (49%), Positives = 215/342 (63%), Gaps = 13/342 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTI-NGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
             ME E+ NFI VW T + CLCYCH I + L PK   T   ++ PV  LF+  PL L S HL
Sbjct  1     MEEELKNFIKVWITTILCLCYCHNIVSRLIPKGLLT-LISLLPVFYLFITTPLTLHSFHL  59

Query  930   AGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFS  751
              G + FF+ WLG FKL LF+   GPLS  PP     FI  ACLPIK+++        K  
Sbjct  60    CGPTTFFLVWLGIFKLLLFSFNLGPLSPPPPSLFH-FISIACLPIKIKQNPNPKATQKPR  118

Query  750   GSLR----------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLV  601
               +           K +LLG++   Y Y+  LHP V L  +  H+Y+ L+ +L + +   
Sbjct  119   NPIGLPNKSIVVAVKALLLGLIIHSYEYRPHLHPYVILALYCCHMYLALDILLALSATPA  178

Query  600   RAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASL  421
             RA+F  ELE   DEP+LSTSLQDFWGRRWN+MVTNILRP+VYDP+R VSAR +   LA L
Sbjct  179   RALFGFELEPQSDEPYLSTSLQDFWGRRWNLMVTNILRPSVYDPIRRVSARVVGRRLARL  238

Query  420   PAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGI  241
             PAVMA+F VSG+MHE+++Y + R  PT EV  FF+++GACV +E+ VK+AV G++RL  +
Sbjct  239   PAVMATFGVSGLMHEVIYYYLTRVQPTWEVTWFFVLHGACVVVEVEVKKAVKGRWRLHPV  298

Query  240   VSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             VS PL L  + +T  WLFFP   RN  DTKA  E    ++FV
Sbjct  299   VSRPLTLVFLAVTGNWLFFPQLIRNGVDTKAIGEYAIMVDFV  340



>ref|XP_008358814.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Malus domestica]
Length=367

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 218/349 (62%), Gaps = 18/349 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF+ VW +V   LCYC+ I    PK    R   I P+  LFL LPL+L+S+HL 
Sbjct  1     MEGEIGNFVKVWLSVYLSLCYCYAIAKFVPK-GVPRLLLIIPIVSLFLYLPLHLSSLHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             GT+AFFI WL +FKL LFA  +GPL S P + L  F+  ACLPIK+Q+ +      K + 
Sbjct  60    GTTAFFISWLANFKLLLFAFGKGPLCSDPSISLLRFVAVACLPIKIQQNQYSKTQNKENP  119

Query  747   SLR--------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
             + +              K +L  ++  +Y YKE +HPK+  + +  H+Y  LE +L + +
Sbjct  120   APKITKNGTKSPLNYAVKGLLFALLVKLYDYKEHIHPKLLWIMYCFHIYFALEIILVIAA  179

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              L RA+  +ELE  FDEP+LS+SLQDFWGRRWN+MVT+ILRPTVY+P+ +++ R +    
Sbjct  180   TLARALLGLELEPQFDEPYLSSSLQDFWGRRWNIMVTSILRPTVYEPILALATRVVGRRW  239

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD--GKF  256
             A+L  VM +F+VS IMHEL+FY +GR  PT E+  FFL++GAC+  EIGVK+AV    K 
Sbjct  240   ATLAGVMGTFLVSAIMHELIFYYLGRTRPTWEITWFFLLHGACLVAEIGVKKAVGKRKKL  299

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             +LP      + +  V+ T FWLFFPP  R K D +A  E  A   FV N
Sbjct  300   QLPRSCRA-VTVAFVMATVFWLFFPPLLRCKADMRALEEYAAVGAFVKN  347



>ref|XP_004305405.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 159/362 (44%), Positives = 224/362 (62%), Gaps = 30/362 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE  NFI V +++  CL Y +++  + PK   TR   + PV CLFL LPL+L+S+HL 
Sbjct  1     MEGEFGNFIEVLSSIFVCLFYSYSLGKIVPKGK-TRLLCVVPVVCLFLYLPLHLSSVHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR---KKVAGNFK  757
             G +AFFI WLGSFKL LFA  + PL+S   + +  F+  ACLPI+++     K   G+ K
Sbjct  60    GATAFFISWLGSFKLLLFAFGKRPLASDQSISIGRFMAIACLPIEIEEIPPPKHQNGHIK  119

Query  756   FSGS--------------------------LRKlvllgvvflvyyYKEFLHPKVFLLFFV  655
                S                          + K  LL ++  + YY E  HP + L+   
Sbjct  120   TDPSPSKPHLNGQNGNTPHPRSAKSTTLNHVIKGFLLVILIGILYYSEHFHPNLILVLHC  179

Query  654   IHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVY  475
             +++Y++LEF+L MV  L +A+  +EL+  F+EP+LSTSLQDFWGRRWN+M T+ILRP VY
Sbjct  180   LYIYLLLEFLLVMVGVLAQALLGLELKPHFNEPYLSTSLQDFWGRRWNLMATSILRPAVY  239

Query  474   DPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             +P+   S RF+    A LPAVM SFVVSG+MHEL++Y  GR  PT EV  FF++ G+C+ 
Sbjct  240   EPILDCSTRFIGRKWAPLPAVMGSFVVSGLMHELIYYYQGRVQPTWEVTWFFILQGSCLM  299

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +EI +K+A+ G+FRLP  VS  L +  V++T FWLFFP + R+K D +   E +AF  ++
Sbjct  300   VEILLKKALRGRFRLPTPVSVVLTVGFVVVTCFWLFFPQFLRSKADVRMLEEYVAFGAYM  359

Query  114   IN  109
              N
Sbjct  360   KN  361



>ref|XP_007026258.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao]
 gb|EOY28880.1| Acyl-CoA sterol acyl transferase 1, putative [Theobroma cacao]
Length=376

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 159/364 (44%), Positives = 217/364 (60%), Gaps = 35/364 (10%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
              GE+NNF+ +W  V+  L YC+ I  + PK +  R   + PV CL+++LPLNL+S+HL G
Sbjct  3     SGEMNNFMKIWLCVVISLSYCYAIGKIIPKGT-ARLLCLLPVVCLYVLLPLNLSSLHLGG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV---------------  790
              +AFFI WLG+FKL LFA  +G    +PPL L  F+  ACLPIK+               
Sbjct  62    ATAFFIAWLGNFKLLLFAFGKG--PLSPPLSLLRFLAVACLPIKILHNPTPKSHPNGLNK  119

Query  789   ----------QRRKKVAGNFKFSGSLR-------KlvllgvvflvyyYKEFLHPKVFLLF  661
                        + K++ G  K     +       K +LL ++   Y Y E++HP   L+ 
Sbjct  120   ENPSLKKTLDSQNKEIPGPVKPKKGQKSPINYAIKFLLLALLLRAYDYSEYIHPTFMLVL  179

Query  660   FVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPT  481
             +  H+Y  LE +L MV+ L RA+  +ELE  F+EP+LSTSLQDFWGRRWN+MVT+ILRPT
Sbjct  180   YCGHVYFCLEIILAMVAALARAMLGLELEQQFNEPYLSTSLQDFWGRRWNIMVTSILRPT  239

Query  480   VYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGAC  301
             VY+PV ++ AR +    A LPAV  SFVVS +MHEL+FY +GR  PT E+  FFL++G C
Sbjct  240   VYEPVLNMGARLVGRKWAPLPAVFGSFVVSAVMHELIFYYLGRVRPTWEITWFFLLHGGC  299

Query  300   VALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIE  121
             +  EI +K+ +  K RLP  VS PL +  +++T  WLFFP   R K D +A  E  A   
Sbjct  300   LMAEIALKKTLRDKLRLPTAVSTPLTIGFIMVTGSWLFFPQLLRIKADERALEEYAALGA  359

Query  120   FVIN  109
             F  N
Sbjct  360   FFKN  363



>ref|XP_010253003.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nelumbo 
nucifera]
Length=376

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 161/348 (46%), Positives = 227/348 (65%), Gaps = 26/348 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI +FI VW  V+  L +C+ +    PK  F R   I P+ CLFL+LPLNL S+HL 
Sbjct  1     MEGEIKSFIKVWFLVIASLSFCYYVVSRIPKGKF-RLLPILPICCLFLLLPLNLQSVHLV  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR---KKVAGNFK  757
             GT+AFF+ WL +FKL LF+  +GPLSS P +PL  FI  ACLPIK+++    +K      
Sbjct  60    GTTAFFVAWLANFKLLLFSFGQGPLSSNPSIPLIHFIFLACLPIKIKQDPPPRKTQQPVP  119

Query  756   FSGSLR----------------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLY  643
              + + R                      K +L  +V  +Y Y+ +LHPK+ L  + IH+Y
Sbjct  120   NASTERDLDNPSHQITRKGTKSPLNYAIKGLLAALVVRLYDYRPYLHPKIILSLYCIHVY  179

Query  642   IVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVR  463
             I LE +L +V+ LV+ +  +ELEA FDEP+LSTSLQDFWGRRWN+MVT+ILRPTVY+P +
Sbjct  180   ISLEILLAVVAYLVQPLLNLELEAQFDEPYLSTSLQDFWGRRWNIMVTSILRPTVYEPTK  239

Query  462   SVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIG  283
             S + R +    A LPA++++FVVSG++HEL+F+ +GR  PT EV  FF+++G C+ +EI 
Sbjct  240   SFARRIVGRKWAPLPAILSTFVVSGLIHELIFFYLGRLEPTWEVTCFFILHGVCLVMEII  299

Query  282   VKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
              KRA+ G+++L G VSG L++  +++TSFWLFFP + R     +  AE
Sbjct  300   AKRALAGRWKLHGAVSGMLSIAFLMITSFWLFFPQFLRCGLVVRGLAE  347



>ref|XP_007213866.1| hypothetical protein PRUPE_ppa018212mg [Prunus persica]
 gb|EMJ15065.1| hypothetical protein PRUPE_ppa018212mg [Prunus persica]
Length=378

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/362 (46%), Positives = 213/362 (59%), Gaps = 30/362 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI VW +V   L YC+      PK  F R   I PV  LFL LPL+L++IHL 
Sbjct  1     MEGEIGNFIKVWLSVFLSLFYCYAFGKFVPK-GFPRLLLIIPVVALFLDLPLHLSTIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             GT+AFFI WL +FKL LFA  +GPL S P + L  F+  ACLPIK+Q+            
Sbjct  60    GTTAFFISWLANFKLLLFAFGKGPLCSDPSISLPRFVAVACLPIKIQQNPPPKTPQFQTS  119

Query  780   -KKVAGNFKFSGSLRKlvllgvvf---------------lvyyYKEFLHPKVFLLFFVIH  649
               +   N   +G                            VY YKE LHP +  + +  H
Sbjct  120   NHQNGHNSNTNGHATTKQNPAPKSPLNYALKGLLLALLIKVYDYKEHLHPNLIWVMYCFH  179

Query  648   LYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDP  469
             +Y  LE +L M + L RA+  +ELE  F+EP+LS+SLQDFWGRRWN+MVT+ILRPTVY+P
Sbjct  180   IYFALEIILLMAAALARALLGLELEPQFNEPYLSSSLQDFWGRRWNIMVTSILRPTVYEP  239

Query  468   VRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALE  289
             V ++S R +    A LPAVM +F+VS IMHEL+FY +GR  PT E+  FFL++G C+ +E
Sbjct  240   VVALSTRVVGRRWAPLPAVMGTFIVSAIMHELIFYYLGRLPPTWEISWFFLLHGLCLVVE  299

Query  288   IGVKRAV--DGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             I VK+A+    KF++P +VSGPL +  V  T FWLFFPP  R   D +A  E  A   F 
Sbjct  300   IAVKKAIAKRKKFQVPRLVSGPLTVAFVTGTVFWLFFPPLLRCNADVRALGEYAAVGAFF  359

Query  114   IN  109
              N
Sbjct  360   KN  361



>ref|XP_010052932.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like isoform 
X1 [Eucalyptus grandis]
Length=400

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/368 (43%), Positives = 225/368 (61%), Gaps = 35/368 (10%)
 Frame = -3

Query  1110  TMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
             +MEGEI NF  V  T L  LCYC+ +  + PK +  R   I PV  LFL LPLNL++++L
Sbjct  24    SMEGEIYNFFKVCITALMSLCYCYIVGRIIPKGT-RRLLPILPVVALFLYLPLNLSAVNL  82

Query  930   AGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR-----------  784
              G ++F I WLG+ KL LFA  +GPLSS PP+ L  F+  ACLPIK+QR           
Sbjct  83    IGQTSFIISWLGNSKLLLFAFGKGPLSSDPPISLPRFLAIACLPIKIQRTPLKKSPQRTQ  142

Query  783   ------RKKVAGNFKFS------GSLR-----------KlvllgvvflvyyYKEFLHPKV  673
                   R    G+ K +       ++R           K +L  ++  VY Y +  HP +
Sbjct  143   NTKDHIRSPQNGHHKENPLPQNPENIRPKTILLLNYPTKALLFVMLLRVYDYGDHFHPNL  202

Query  672   FLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNI  493
              LL +  HLY+ L+ +L  +    RA F +ELE  F EP+LS+SLQDFWG+RWN+MVTNI
Sbjct  203   ILLIYSCHLYLALDLILSSIQATARAAFGMELEPQFREPYLSSSLQDFWGKRWNLMVTNI  262

Query  492   LRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLV  313
             LR T+Y+PV   ++  +    A+LPAVMASF+VSG+MHEL+F+++GR  PT EVM FF++
Sbjct  263   LRVTIYEPVHYAASAAIGRKWAALPAVMASFLVSGLMHELMFFHMGRVKPTWEVMWFFVL  322

Query  312   NGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESL  133
             +GAC+ +E+ VKR    K+RLP +++G + +T V++T+ WLFFP   R+    KA  E  
Sbjct  323   HGACLVIEVVVKRKCGTKWRLPRVLTGLMTVTFVMVTASWLFFPQLLRDGVIKKALEEYA  382

Query  132   AFIEFVIN  109
             A  EF+ +
Sbjct  383   AAGEFLKD  390



>ref|XP_010052933.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like isoform 
X2 [Eucalyptus grandis]
Length=376

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/367 (44%), Positives = 224/367 (61%), Gaps = 35/367 (10%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF  V  T L  LCYC+ +  + PK +  R   I PV  LFL LPLNL++++L 
Sbjct  1     MEGEIYNFFKVCITALMSLCYCYIVGRIIPKGT-RRLLPILPVVALFLYLPLNLSAVNLI  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G ++F I WLG+ KL LFA  +GPLSS PP+ L  F+  ACLPIK+QR            
Sbjct  60    GQTSFIISWLGNSKLLLFAFGKGPLSSDPPISLPRFLAIACLPIKIQRTPLKKSPQRTQN  119

Query  783   -----RKKVAGNFKFS------GSLR-----------KlvllgvvflvyyYKEFLHPKVF  670
                  R    G+ K +       ++R           K +L  ++  VY Y +  HP + 
Sbjct  120   TKDHIRSPQNGHHKENPLPQNPENIRPKTILLLNYPTKALLFVMLLRVYDYGDHFHPNLI  179

Query  669   LLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNIL  490
             LL +  HLY+ L+ +L  +    RA F +ELE  F EP+LS+SLQDFWG+RWN+MVTNIL
Sbjct  180   LLIYSCHLYLALDLILSSIQATARAAFGMELEPQFREPYLSSSLQDFWGKRWNLMVTNIL  239

Query  489   RPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVN  310
             R T+Y+PV   ++  +    A+LPAVMASF+VSG+MHEL+F+++GR  PT EVM FF+++
Sbjct  240   RVTIYEPVHYAASAAIGRKWAALPAVMASFLVSGLMHELMFFHMGRVKPTWEVMWFFVLH  299

Query  309   GACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             GAC+ +E+ VKR    K+RLP +++G + +T V++T+ WLFFP   R+    KA  E  A
Sbjct  300   GACLVIEVVVKRKCGTKWRLPRVLTGLMTVTFVMVTASWLFFPQLLRDGVIKKALEEYAA  359

Query  129   FIEFVIN  109
               EF+ +
Sbjct  360   AGEFLKD  366



>ref|XP_007220140.1| hypothetical protein PRUPE_ppa019942mg [Prunus persica]
 gb|EMJ21339.1| hypothetical protein PRUPE_ppa019942mg [Prunus persica]
Length=362

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 223/355 (63%), Gaps = 23/355 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE  +FI VWT+V  C+ YC++I  + PK + TR  +  PV CLF  LPLNL+SIHL 
Sbjct  1     MEGEFGSFIKVWTSVFVCIFYCYSIGKIVPKGT-TRLVSALPVVCLFFYLPLNLSSIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G ++FFI WLGSFKL LFA  +GPL+S P + +  F+  ACLPI++Q             
Sbjct  60    GGTSFFISWLGSFKLLLFAFGKGPLASDPSISIGRFLAIACLPIEIQENPSPSKSHLNGQ  119

Query  783   -RKKVAGNFKFSGS---------LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVL  634
              RK    N +   +         + K  LL ++  V  Y + +HPK+ L+   +++Y++L
Sbjct  120   NRKSPPQNPQIETNPSPKNTIHIVIKGFLLAILIGVLNYSQQIHPKLILVLHCLYIYLLL  179

Query  633   EFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVS  454
             E  L +V+ L   +  ++L+  F+EP+LSTSLQ+FWGRRWN++VT+ILR +VY+P  + S
Sbjct  180   ETQLIIVAALAWGLLGLDLKPHFNEPYLSTSLQNFWGRRWNLVVTSILRQSVYEPTLNFS  239

Query  453   ARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR  274
                +    ASLPAV ASF+VSG+MHEL++Y +GR  PT EV  FF+++G C+ +EI +K+
Sbjct  240   TCVIGRRWASLPAVFASFLVSGLMHELIYYYMGRVRPTWEVTWFFVLHGFCLMVEIVLKK  299

Query  273   AVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             A+ G  RLP ++S  L +  V+ T F LFFP + R K D +   E  AF+ F+ N
Sbjct  300   ALRGGCRLPRLISVVLTVGFVVATCFRLFFPQFLRCKADVRMLQEYRAFVLFLKN  354



>gb|KCW77066.1| hypothetical protein EUGRSUZ_D01408 [Eucalyptus grandis]
Length=379

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 161/379 (42%), Positives = 228/379 (60%), Gaps = 35/379 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF  V  T L  LCYC+ +  + PK +  R   I PV  LFL LPLNL++++L 
Sbjct  1     MEGEIYNFFKVCITALMSLCYCYIVGRIIPKGT-RRLLPILPVVALFLYLPLNLSAVNLI  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G ++F I WLG+ KL LFA  +GPLSS PP+ L  F+  ACLPIK+QR            
Sbjct  60    GQTSFIISWLGNSKLLLFAFGKGPLSSDPPISLPRFLAIACLPIKIQRTPLKKSPQRTQN  119

Query  783   -----RKKVAGNFKFS------GSLR-----------KlvllgvvflvyyYKEFLHPKVF  670
                  R    G+ K +       ++R           K +L  ++  VY Y +  HP + 
Sbjct  120   TKDHTRSPQNGHHKENPLPQNPENIRPKTILLLNYPTKALLFVMLLRVYDYGDHFHPNLI  179

Query  669   LLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNIL  490
             LL +  HLY+ L+ +L  +    RA F +ELE  F EP+LS+SLQDFWG+RWN+MVTNIL
Sbjct  180   LLIYCCHLYLALDLILSSIQATARAAFGMELEPQFREPYLSSSLQDFWGKRWNLMVTNIL  239

Query  489   RPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVN  310
             R T+Y+PV   ++  +    A+LPAVMASF+VSG+MHEL+F+ +GR  PT EVM FF+++
Sbjct  240   RLTIYEPVHYAASVAIGRKWAALPAVMASFLVSGLMHELMFFYMGRVKPTWEVMWFFVLH  299

Query  309   GACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             GAC+ +E+ VKR    K+RLP +++G + +T V++T+ WLFFP   ++    KA  E  A
Sbjct  300   GACLVIEVVVKRKCGTKWRLPRVLTGLMTVTFVMVTASWLFFPQLLKDGVIKKALEEYAA  359

Query  129   FIEFVINHRLVSPESMTCQ  73
               EF+ +  +  P  + C+
Sbjct  360   AGEFLKDVAVEEPVIVKCR  378



>ref|XP_010270117.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nelumbo 
nucifera]
Length=376

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 163/360 (45%), Positives = 216/360 (60%), Gaps = 28/360 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEINNFI VW TV   LC+C+ +    PK    R     P+  LFL+LPL L ++HL 
Sbjct  1     MEGEINNFIQVWITVFVSLCFCYFVASKVPKGKL-RLLTTLPICGLFLLLPLKLHTVHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             GT+AFF+ WL +FKL LF+  +GPLSS P +    FI  ACLPIK+++          S 
Sbjct  60    GTTAFFVAWLANFKLLLFSFGKGPLSSHPSISPFCFISVACLPIKIKQDPSPPQTPNPSA  119

Query  747   SLR-------------------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLY  643
              L                          K +LL ++  VY Y+ + H KV L  +  H+Y
Sbjct  120   DLNNKRDNPSPHNHIARKSPKSLLNYAIKALLLALLIRVYDYRPYFHQKVILTLYCFHVY  179

Query  642   IVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVR  463
              +LE +L   + L R +  +ELE  FDEP+LSTSLQDFWGRRWN+MVTNILRPTVY+P R
Sbjct  180   FLLEVILAGAAYLARVLLNLELEGQFDEPYLSTSLQDFWGRRWNIMVTNILRPTVYEPTR  239

Query  462   SVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIG  283
                 + +    A+LPA MA+FVVSG++HEL+F+ +GR  PT EV  FF+++G C+ LEI 
Sbjct  240   GFFTQVIGRKWAALPATMATFVVSGLIHELIFFYLGRVEPTWEVTWFFILHGLCLVLEIA  299

Query  282   VKRAVDGK--FRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
              K+A+ G+  +RL G VS PL  + V+ TS WLFFP + R + D +A  E  A  EFV N
Sbjct  300   AKKALVGRWGWRLHGAVSRPLVASFVLATSSWLFFPQFLRCRADVRALDEYAAVAEFVRN  359



>ref|XP_008227482.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Prunus 
mume]
Length=375

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 210/355 (59%), Gaps = 30/355 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI VW +V   L YC+      PK  F R   I PV  LFL LPL+L++IHL 
Sbjct  3     MEGEIGNFIKVWLSVFLSLFYCYAFGKFVPK-GFPRLLLIIPVVALFLDLPLHLSTIHLG  61

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             GT+AFFI WL +FKL LFA  +GPL S P + L  F+  ACLPIK+Q+            
Sbjct  62    GTTAFFISWLANFKLLLFAFGKGPLCSDPSISLPRFVAVACLPIKIQQNPPPKTPQFQTS  121

Query  780   -KKVAGNFKFSGSLRKlvllgvvf---------------lvyyYKEFLHPKVFLLFFVIH  649
               +   N   +G                            VY YKE LHP +    +  H
Sbjct  122   NHQNGHNSNTNGHATTKQNPAPKSPFNYALKGLLLALLIKVYDYKEHLHPNLIWAMYCFH  181

Query  648   LYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDP  469
             +Y  LE +L M + L RA+  +ELE  F+EP+LS+SLQDFWGRRWN+MVT+ILRPTVY+P
Sbjct  182   IYFALEIILLMAAALARALLGLELEPQFNEPYLSSSLQDFWGRRWNIMVTSILRPTVYEP  241

Query  468   VRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALE  289
             V ++S R +    A LPAVM +F+VS IMHEL+FY +GR  PT E+  FFL++G C+ +E
Sbjct  242   VVALSTRVVGRRWAPLPAVMGTFIVSAIMHELIFYYLGRLPPTWEISWFFLLHGLCLVVE  301

Query  288   IGVKRAV--DGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             I VK+A+    KF++P +VSGPL +  V  T FWLFFPP  R   D +A  E  A
Sbjct  302   IAVKKAIAKRKKFQVPRLVSGPLTVAFVTGTVFWLFFPPLLRCNADVRALGEYAA  356



>ref|XP_010240864.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Nelumbo nucifera]
Length=366

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 160/357 (45%), Positives = 212/357 (59%), Gaps = 27/357 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE+   I V  +VL  L YCH I    PK    R   + P+ C+F +LP  L+S+HL 
Sbjct  1     MDGELKGLIKVCLSVLASLSYCHFIVSKIPKGKL-RLLFLVPILCIFTLLPSLLSSVHLT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAG-----N  763
               S F I WL +FKL LFA  +GPL+S PP    +F+  A LPIK++    V       N
Sbjct  60    AGSCFLITWLANFKLILFAFDQGPLASHPPKSFLSFVSIAFLPIKIKHDVDVPSPTNNLN  119

Query  762   FKF--------------SGSLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHL  646
              K+              SG+         K +L  ++  +Y YK++LH  + +  +  H+
Sbjct  120   LKYCKSNPSPPHFTKGKSGTKSPLKNLSIKALLYAILLRIYDYKQYLHRNLVITLYCCHV  179

Query  645   YIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPV  466
             +++LEF+L   + L RA+   ELE   DEP+LSTSLQDFWGRRWN+MVT+ILRPTVYDP+
Sbjct  180   FLLLEFLLAPAAFLARALLGQELEPQSDEPYLSTSLQDFWGRRWNLMVTSILRPTVYDPM  239

Query  465   RSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEI  286
             RS+S R      ASLPAV+A+F+VS +MHEL++Y   RA PTGEV  FFL++G C ALE 
Sbjct  240   RSLSERVFGRKWASLPAVLAAFLVSALMHELIYYYATRAAPTGEVTCFFLLHGVCTALET  299

Query  285   GVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              VK AV G+ +L   +S  L L  V+ T+ WL FPP  RN  DT A  ES A I FV
Sbjct  300   VVKNAVKGRLQLHRAISRALTLGFVVATAVWLLFPPLVRNGTDTTAIWESRAVIAFV  356



>ref|XP_010252640.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Nelumbo 
nucifera]
Length=358

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/354 (44%), Positives = 219/354 (62%), Gaps = 21/354 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ EINNFI VW + L  L YC++I G FPK    R  ++ PV CLF +LPLNL+S HL 
Sbjct  1     MDDEINNFIKVWISALASLFYCYSIAGKFPK-GVIRLLSLLPVLCLFTILPLNLSSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AF++ WLG+FKL LF+L +GPLSS P   L  F+  A LPIKV+    +  + + SG
Sbjct  60    APTAFYLAWLGNFKLLLFSLDQGPLSSRPAKSLLGFVSIASLPIKVKPDPSLGKSHQNSG  119

Query  747   -SLRKlv-------------------llgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEF  628
              SL+                         ++ ++Y YK+ +HP +FL  +  +L++ LE 
Sbjct  120   KSLQSRAEESPSPCGSHLKLAVECLVSAVLIKIIYDYKQQIHPSIFLCMYCCNLFLGLEI  179

Query  627   MLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSAR  448
              L M + + RA+  ++LE  F+EP+L+TSLQDFWGRRWN+MV++ILRPTVYDPVR +SA 
Sbjct  180   TLAMGAAVARALLGLDLEPQFNEPYLTTSLQDFWGRRWNLMVSSILRPTVYDPVRRISAP  239

Query  447   FLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV  268
                   A LPAV+A+F VSG+MHEL++Y + R  PT EV  FF+  G CVA E+ VK+ V
Sbjct  240   VFGTRWAPLPAVVAAFTVSGLMHELIYYYLTRVDPTWEVTWFFVFQGLCVATEVAVKKWV  299

Query  267   DGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             +G+++L   VSGPL L+ +  T   LFFP    N  D +A  E    ++F+ N 
Sbjct  300   NGRWKLQRQVSGPLTLSFIAATGARLFFPQLLWNGVDERAIGEYAIVVKFLRNR  353



>ref|XP_002322536.2| hypothetical protein POPTR_0016s01630g [Populus trichocarpa]
 gb|EEF04297.2| hypothetical protein POPTR_0016s01630g [Populus trichocarpa]
Length=332

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 203/331 (61%), Gaps = 17/331 (5%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
             +GE+ N + VW ++   L YC+ +  + P+  FTR   + P+ CLFLVLPL LTSIH  G
Sbjct  3     DGEMYNMMKVWLSIFASLTYCYIMGKMIPR-GFTRLLCVLPIVCLFLVLPLELTSIHFGG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK-FSG  748
              +AFF+ WL +FKL LFA  +GPL               CL  K+   + V+G  K F  
Sbjct  62    MTAFFVAWLANFKLLLFAFGKGPL---------------CLDPKISFGRFVSGPHKSFLN  106

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K +LL ++   Y Y +++HPK+  L + +H+Y  LE  L M++ +VR +  +ELE  
Sbjct  107   YATKGLLLAMLVATYDYSDYIHPKIMWLLYCLHIYFFLETFLAMLASVVRTLSGLELEPQ  166

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F++P+LSTSLQDFWGRRWN+MVT+ILRP  YDP+      F+    A   A++ +F+VS 
Sbjct  167   FNDPYLSTSLQDFWGRRWNLMVTSILRPIAYDPILYTCKNFIGRRWAQGIAILGTFLVSA  226

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVI  208
             +MHEL+FY +GR  PT E+  FFL++G C+ +EI +KRAV+G+++ P  +   L +  VI
Sbjct  227   LMHELIFYYLGRGKPTWEITWFFLLHGVCLPVEIVLKRAVNGRWQFPRPMQTILTIGFVI  286

Query  207   LTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              T FWLFFPP+   K   +A  E  A  E++
Sbjct  287   ATGFWLFFPPFLACKAGVRAIEEYAAVREYL  317



>gb|KCW54675.1| hypothetical protein EUGRSUZ_I00619 [Eucalyptus grandis]
Length=390

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 201/326 (62%), Gaps = 14/326 (4%)
 Frame = -3

Query  1053  LCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLF  874
             L YCHTI    P  +  R  AI PV  LF VLPL+LT+I L G ++FFI WL +FKL LF
Sbjct  45    LTYCHTIGQTVPTGT-KRLLAISPVIGLFFVLPLSLTTISLGGLTSFFIAWLSNFKLILF  103

Query  873   ALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGS-------------LRKl  733
             A  +GPLSS+    L+ FIP ACLPIK+    +   N +   S               K 
Sbjct  104   AYGKGPLSSSQSCLLAYFIPIACLPIKIHNPIESTKNEEHPCSEINERGLKSPMNYAIKC  163

Query  732   vllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPH  553
             ++       Y  K+ +HP +  L + +++Y+ LE  L +V  +VR +  V LE  F+EP+
Sbjct  164   LVTVAFLPAYERKDRVHPVMINLMYCVYVYVGLEMSLAVVGAMVRTLVGVRLEPQFEEPY  223

Query  552   LSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHEL  373
             LSTSLQ+FWGRRWN+MVTNILRPTVY PV+S+S+R +    A LPA  A F+VSG+MHEL
Sbjct  224   LSTSLQEFWGRRWNLMVTNILRPTVYLPVKSISSRVIGRMWAPLPASFACFLVSGLMHEL  283

Query  372   VFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFW  193
             +FY IGR  P   V SFFL++G CVA+EI  K+    KFRLP  VSGP+A+  ++ T+ W
Sbjct  284   IFYYIGRKEPRWVVTSFFLMHGLCVAIEIAAKKVFANKFRLPRAVSGPMAVGFILTTALW  343

Query  192   LFFPPYFRNKGDTKACAESLAFIEFV  115
             LF P       + KA  E++A ++FV
Sbjct  344   LFLPALLWCDAEDKARGEAMAVVDFV  369



>ref|XP_006373631.1| hypothetical protein POPTR_0016s01630g [Populus trichocarpa]
 gb|ABK94277.1| unknown [Populus trichocarpa]
 gb|ERP51428.1| hypothetical protein POPTR_0016s01630g [Populus trichocarpa]
Length=376

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 211/360 (59%), Gaps = 31/360 (9%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
             +GE+ N + VW ++   L YC+ +  + P+  FTR   + P+ CLFLVLPL LTSIH  G
Sbjct  3     DGEMYNMMKVWLSIFASLTYCYIMGKMIPR-GFTRLLCVLPIVCLFLVLPLELTSIHFGG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV---------------  790
              +AFF+ WL +FKL LFA  +GPL   P +    F+  AC PIK+               
Sbjct  62    MTAFFVAWLANFKLLLFAFGKGPLCLDPKISFGRFVSVACFPIKILQIPPQKPNLNGHSH  121

Query  789   -----------QRRKKV---AGNFK-FSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFV  655
                        Q R+K+    G  K F     K +LL ++   Y Y +++HPK+  L + 
Sbjct  122   ENQAQKSLLNGQDRQKLISRKGPHKSFLNYATKGLLLAMLVATYDYSDYIHPKIMWLLYC  181

Query  654   IHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVY  475
             +H+Y  LE  L M++ +VR +  +ELE  F++P+LSTSLQDFWGRRWN+MVT+ILRP  Y
Sbjct  182   LHIYFFLETFLAMLASVVRTLSGLELEPQFNDPYLSTSLQDFWGRRWNLMVTSILRPIAY  241

Query  474   DPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             DP+      F+    A   A++ +F+VS +MHEL+FY +GR  PT E+  FFL++G C+ 
Sbjct  242   DPILYTCKNFIGRRWAQGIAILGTFLVSALMHELIFYYLGRGKPTWEITWFFLLHGVCLP  301

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +EI +KRAV+G+++ P  +   L +  VI T FWLFFPP+   K   +A  E  A  E++
Sbjct  302   VEIVLKRAVNGRWQFPRPMQTILTIGFVIATGFWLFFPPFLACKAGVRAIEEYAAVREYL  361



>ref|XP_010052926.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Eucalyptus 
grandis]
Length=376

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 223/367 (61%), Gaps = 35/367 (10%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF  V  T L  LCYC+ +  + PK +  R   I PV  LFL LPLNL++++L 
Sbjct  1     MEGEIYNFFKVCITALMSLCYCYIVGRIIPKGT-RRLLPILPVVALFLYLPLNLSAVNLI  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
             G ++F I WLG+ KL LFA  +GPLSS PP+ L  F+  ACLPIK+QR            
Sbjct  60    GQTSFIISWLGNSKLLLFAFGKGPLSSDPPISLPRFLAIACLPIKIQRTPLKKSPQRTQN  119

Query  783   -----RKKVAGNFKFS------GSLR-----------KlvllgvvflvyyYKEFLHPKVF  670
                  R    G+ K +       ++R           K +L  ++  VY Y +  HP + 
Sbjct  120   TKDHTRSPQNGHHKENPLPQNPENIRPKTILLLNYPTKALLFVMLLRVYDYGDHFHPNLI  179

Query  669   LLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNIL  490
             LL +  HLY+ L+ +L  +    RA F +ELE  F EP+LS+SLQDFWG+RWN+MVTNIL
Sbjct  180   LLIYCCHLYLALDLILSSIQATARAAFGMELEPQFREPYLSSSLQDFWGKRWNLMVTNIL  239

Query  489   RPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVN  310
             R T+Y+PV   ++  +    A+LPAVMASF+VSG+MHEL+F+ +GR  PT EVM FF+++
Sbjct  240   RLTIYEPVHYAASVAIGRKWAALPAVMASFLVSGLMHELMFFYMGRVKPTWEVMWFFVLH  299

Query  309   GACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             GAC+ +E+ VKR    K+RLP +++G + +T V++T+ WLFFP   ++    KA  E  A
Sbjct  300   GACLVIEVVVKRKCGTKWRLPRVLTGLMTVTFVMVTASWLFFPQLLKDGVIKKALEEYAA  359

Query  129   FIEFVIN  109
               EF+ +
Sbjct  360   AGEFLKD  366



>ref|XP_006438928.1| hypothetical protein CICLE_v10031885mg [Citrus clementina]
 gb|ESR52168.1| hypothetical protein CICLE_v10031885mg [Citrus clementina]
Length=367

 Score =   262 bits (669),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 161/356 (45%), Positives = 216/356 (61%), Gaps = 24/356 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE+ NFI VW +V   LCYC+ I  +  K    R   + PV C+FL LPL LTS+H+ 
Sbjct  1     MEGEMKNFIKVWLSVTISLCYCYAIGKMASK-GIKRLICLIPVVCIFLYLPLCLTSVHIG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ------RRKKVAG  766
             GT+AFFI WL +FKL LFA   GPLSS PP+ L  F+  +CLPIK+Q       +   + 
Sbjct  60    GTTAFFIAWLANFKLLLFAFGLGPLSSHPPISLPLFVIVSCLPIKIQNNNNHNSKPNPSQ  119

Query  765   NFKFSGSLR--------KlvllgvvflvyyYKE------FLHPKVFLLFFVIHLYIVLEF  628
             N   S   R        K +L+ ++  +    E      F+HPK+ LL + IH+Y +LE 
Sbjct  120   NNNPSPGAREGPLNYAIKGLLVAILVQLQLAYEYSDYVLFVHPKLILLVYSIHMYFLLEL  179

Query  627   MLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSAR  448
             +L   + + RA   +ELE  F EP+LSTSLQDFWG+RWN+MVT ILRPTVY P   +  R
Sbjct  180   ILAASAAVARATLGLELEPQFKEPYLSTSLQDFWGKRWNLMVTGILRPTVYKPTLHIFTR  239

Query  447   FLPESLASLPAVMASFVVSGIMHELVFYNIGRAT---PTGEVMSFFLVNGACVALEIGVK  277
                   ASLPAV A+F+VSG MH+L+F+ +GR     PT  V  FF+++G C+A+E+ +K
Sbjct  240   VTGRKWASLPAVFATFLVSGFMHQLMFFYLGRGAGLKPTWGVTWFFVLHGVCLAVELALK  299

Query  276   RAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             +AV G+FRLP I+SG L +  V++T  WLFFP +   K D +A  E  A   F  N
Sbjct  300   KAVTGRFRLPRIISGLLTVAFVMVTGCWLFFPQFTHCKLDERAFEEYAALGAFFRN  355



>ref|XP_011001006.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Populus 
euphratica]
Length=386

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 146/355 (41%), Positives = 208/355 (59%), Gaps = 31/355 (9%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
             +GE+N+ + VW ++   L YC+ I  + PK   TR   + P+ CLFLVLPL LTSIH  G
Sbjct  3     DGEMNSMMKVWLSIFASLTYCYIIGKMIPK-GLTRLLCVLPIVCLFLVLPLELTSIHFGG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV---------------  790
              +AFF+ WL +FKL LFA  +GPL   P +    F+  AC PIK+               
Sbjct  62    MTAFFVAWLANFKLLLFAFGKGPLCLDPKISFGRFVSVACFPIKILQIPPQKPNLNGHSH  121

Query  789   ------------QRRKKVA--GNFK-FSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFV  655
                          R+K ++  G  K F     K +LL ++   Y Y +++HPK+  L + 
Sbjct  122   GNQSQKSHLNGHDRQKLISRKGPHKSFLNYATKGLLLAMLVATYDYSDYIHPKIMWLLYC  181

Query  654   IHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVY  475
              H+Y  LE  L M++ +VR +  +ELE  F++P+LSTSLQDFWGRRWN+MVT+ILRP VY
Sbjct  182   FHIYFFLEIFLAMLASVVRTLSGLELEPQFNDPYLSTSLQDFWGRRWNLMVTSILRPIVY  241

Query  474   DPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             DP+      F+    A   A++ +F+VS +MHEL+FY +GR  PT E+  FFL++G C+ 
Sbjct  242   DPIIYTCKNFIGRRWAQGVAILGTFLVSALMHELIFYYLGRVKPTWEITWFFLLHGVCLP  301

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             +EI +KRAV+G+++ P  +   L +  VI T FWLFFPP+   K   +A  E  A
Sbjct  302   VEIALKRAVNGRWQFPRPIQTILTIGFVIATGFWLFFPPFLACKAGVRAIDEYAA  356



>ref|XP_011097818.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase [Sesamum 
indicum]
Length=353

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/350 (44%), Positives = 218/350 (62%), Gaps = 9/350 (3%)
 Frame = -3

Query  1119  KKKTM-EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLT  943
             KK  M + EI     +W T +  L +CH I    P  +  R  ++ PV  LF  LPL L+
Sbjct  3     KKPVMVDPEIQALTEIWLTAIVSLIFCHQIAARIPSGA-ARLLSVLPVIYLFPPLPLRLS  61

Query  942   SIHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGN  763
             SIHL G + F++ WLG+FKL LF+  +GPLS+TPPL L  FI    LPIK ++      +
Sbjct  62    SIHLGGPTIFYLVWLGNFKLLLFSFNQGPLSATPPLALLRFISVGLLPIKTKQTPSPESS  121

Query  762   FKFSGSLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
                   +    K  LL V+  +Y Y+EFLHP +    +  H+Y+ +E +L + +   RA+
Sbjct  122   SDHKRPILLPLKCGLLAVIVALYKYREFLHPYLITALYCCHVYLGVELILSITALPARAL  181

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASL-PA  415
               VELE  FDEP+L+TSLQDFWGRRWN+MVT+ILRPTVY PVR +S R L  S  +L PA
Sbjct  182   LGVELEPQFDEPYLATSLQDFWGRRWNLMVTSILRPTVYHPVRRISTRILGRSSWALAPA  241

Query  414   VMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVS  235
             ++A+F+VSG+MHE+++Y + RA+PT EV  FF+++G CVA E+ +K+AV G+++L   VS
Sbjct  242   ILATFLVSGLMHEVIYYYMSRASPTWEVTGFFVLHGVCVAAEVALKKAVGGRWQLHRAVS  301

Query  234   GPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV---INHRLVS  94
             G L +   ++T  WLFFP   RN  DT+A  E      F+   + H L+S
Sbjct  302   GTLTVGFAVVTGAWLFFPQVTRNGIDTRAINEYSMIARFIAERVGHNLIS  351



>ref|XP_007219317.1| hypothetical protein PRUPE_ppa019024mg, partial [Prunus persica]
 gb|EMJ20516.1| hypothetical protein PRUPE_ppa019024mg, partial [Prunus persica]
Length=332

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 211/327 (65%), Gaps = 12/327 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE++NF  VW +V  CLCYC+    L PK   TR   + P+ CLFL LPL L+SIHL 
Sbjct  1     MEGEMSNFFKVWLSVYLCLCYCYATAKLVPK-GCTRLLCLLPIVCLFLYLPLFLSSIHLV  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G ++FFI WL +FKL L A  +GPLSS P + L   IP          +K   G+     
Sbjct  60    GVTSFFISWLANFKLFLLAFGKGPLSSDPSISLENPIP----------QKPKQGHRVPLN  109

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
             ++ K +L G++   Y Y + +HPK  LL + +H+Y++LE +L + + L RA+  +ELE  
Sbjct  110   NVTKGLLFGILLRAYDYSDQIHPKALLLLYSLHIYLLLELILAVAATLARALLAIELEPQ  169

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+LSTSLQDFWGRRWN+MVT+ILRPTVY+P   +S R +    A LPAV+A+FVVS 
Sbjct  170   FNEPYLSTSLQDFWGRRWNLMVTSILRPTVYEPTLDISRRVVDRKWAPLPAVLATFVVSA  229

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD-GKFRLPGIVSGPLALTLV  211
              MHE+VFY++GR  PT  V  FFL++G C+ +EI +K+A   G++RLP +V+G L +  V
Sbjct  230   FMHEIVFYHMGRMRPTWGVTCFFLLHGICLTVEIALKKAWSAGRWRLPRLVAGLLTVGFV  289

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLA  130
             + T FWLF P +FR     KA  E  A
Sbjct  290   MGTCFWLFLPQFFRFGAHVKAFEEYAA  316



>ref|XP_002276902.2| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Vitis vinifera]
Length=378

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 156/360 (43%), Positives = 215/360 (60%), Gaps = 20/360 (6%)
 Frame = -3

Query  1113  KTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIH  934
             + M+GEI + I VW + +  +CYC+      P   F R   + P+  LF++LPLNL+S H
Sbjct  13    RDMDGEIKSLIKVWISAISSICYCYFFVVRLPVGLF-RLLFLLPMFYLFIILPLNLSSAH  71

Query  933   LAGTSAFFIGWLGSFKLTLFALCRGpls--stpplplsTFIPFACLPIKVQ-----RRKK  775
             L GT+AF++ WL +FK  LF+   GPLS  S PP  +  FI  ACLPIK++     +   
Sbjct  72    LVGTTAFYLAWLANFKFILFSFGHGPLSFPSHPPKSVLRFISIACLPIKIKTVPSPKSHS  131

Query  774   VAGN---------FKFSGSLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLE  631
             V+ N          K    L    K +L  ++  +Y YK  LHP V L  +  H+Y+ LE
Sbjct  132   VSENSTDPLSEIVMKLPRPLLLAIKALLFAILIRIYNYKRHLHPNVVLFLYCCHMYLALE  191

Query  630   FMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSA  451
              +  M +   RA+   ELE  F+EP+L+TSLQDFWGRRWN+ VTNILRPTVYDPVRS+  
Sbjct  192   IVQAMAAIPARAIPGFELEPQFNEPYLTTSLQDFWGRRWNLSVTNILRPTVYDPVRSICT  251

Query  450   RFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA  271
             R L +  A +P V+A+F+VSG+MHE ++Y I R +PT EV  FF++ G C   E+ VK+A
Sbjct  252   RILGKKWAPVPGVLAAFLVSGLMHESLYYYITRVSPTWEVTGFFVLQGLCTVSEVVVKKA  311

Query  270   VDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSP  91
             + G++RL   VSGPL +  V +T+ WLFFP   RN  D +A  E    ++FV    L  P
Sbjct  312   LGGRWRLHRAVSGPLTIGFVCVTAAWLFFPQLLRNHIDERAIREYSILVDFVKQKFLTLP  371



>ref|XP_011025514.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Populus 
euphratica]
Length=363

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 215/347 (62%), Gaps = 27/347 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF+ VW ++  CLC C+ I    PK   TRF  + P  CLF  LPL+L++I L 
Sbjct  1     MEGEIRNFLKVWLSIFFCLCCCYAIGKAIPKGK-TRFLFLIPFVCLFFYLPLSLSTIFLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRG-plsstpplplsTFIPFACLPIKVQ------------  787
             G +AF+I WLG+FKL LFA  +G   S      L TF+  ACLPIK+Q            
Sbjct  60    GNTAFYIAWLGNFKLLLFACGKGPLSSQYSSRSLLTFVSVACLPIKIQENPPPKSQNQEN  119

Query  786   --------RRKKVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLE  631
                     +  K + N+   G L        + +V+ Y E++HPK+ L    +HLYI L+
Sbjct  120   QPPVIPTDQTHKSSLNYAIKGVL-----WAFLVVVHDYNEYIHPKIILCLLCLHLYIFLD  174

Query  630   FMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSA  451
              +L +V+ L R +  +ELE  F+EPHLSTSLQDFWG+RWN+MV++ILR TVYDP R++S 
Sbjct  175   VVLALVAVLARNILGLELEPQFNEPHLSTSLQDFWGKRWNLMVSSILRQTVYDPTRNIST  234

Query  450   RFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA  271
             R +    + +PAV+A+F++S +MHE++FY + R  PT EV  FFL++G CV +EI +K+A
Sbjct  235   RVVGRRWSPIPAVLATFLLSAVMHEVMFYYLLRVKPTWEVTWFFLLHGFCVTVEIAIKKA  294

Query  270   VDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             + G+++LP ++SG   +  V++TS WLFFP   + + D +A  E  A
Sbjct  295   LKGRWQLPRLISGLFTIGFVMVTSCWLFFPKPLQCRADVRAFEEYAA  341



>ref|XP_002313330.2| hypothetical protein POPTR_0009s05970g [Populus trichocarpa]
 gb|EEE87285.2| hypothetical protein POPTR_0009s05970g [Populus trichocarpa]
Length=360

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 216/351 (62%), Gaps = 27/351 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF+ VW ++L CLC C+ I    PK   TR   + P  CLF  LPLNL++I L 
Sbjct  1     MEGEIRNFLKVWLSILFCLCCCYAIGKAIPKGK-TRLLFLIPFVCLFFYLPLNLSTIFLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRG-plsstpplplsTFIPFACLPIKVQ------------  787
             G +AF+I WLG+FKL LFA  +G   S      L TF+  ACLPIK+Q            
Sbjct  60    GNTAFYIAWLGNFKLLLFACGKGPLSSQYSSRSLLTFVSVACLPIKIQENPPPKSQNQEN  119

Query  786   --------RRKKVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLE  631
                     +  K + N+   G L        + +++ Y E++HPK+ L    +HLYI L+
Sbjct  120   QPPVIPTDQTHKSSLNYAIKGVL-----WAFLVVIHDYNEYIHPKIILCLLCLHLYIFLD  174

Query  630   FMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSA  451
              +L +V+ L R +  +ELE  F+EPHLSTSLQDFWG+RWN+MV++ILR TVY+P R++S 
Sbjct  175   VVLAVVAVLARTILGLELEPQFNEPHLSTSLQDFWGKRWNLMVSSILRRTVYEPTRNIST  234

Query  450   RFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA  271
             R +    + +PAV+A+F+ S IMHE++FY + RA PT EV  FFL++G CV +EI +K+A
Sbjct  235   RVVGRRWSPIPAVLATFLSSAIMHEVMFYYLLRAKPTWEVTWFFLLHGFCVTVEIVIKKA  294

Query  270   VDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             + G+++LP ++SG   +  V++TS WLFFP   + + D +A  E  A   F
Sbjct  295   LKGRWQLPRLISGLFTIGFVMVTSCWLFFPKPLQRRADVRAFEEYAALRAF  345



>ref|XP_002276950.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Vitis vinifera]
 emb|CAN61368.1| hypothetical protein VITISV_020588 [Vitis vinifera]
Length=364

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 206/336 (61%), Gaps = 8/336 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M GEI   I V  +VL  LCY + I    PK  F R  ++ P+  LF+ LPL L++  L+
Sbjct  1     MGGEIKGLIKVCLSVLASLCYSYFIVSKIPKGKF-RLLSLLPIFSLFVALPLFLSTAILS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AFFI WL +F+L LF+   GPLS+  P  L  FI  ACLPIK++  ++     +   
Sbjct  60    GITAFFITWLATFRLALFSFDLGPLSTGSPKSLLVFIAIACLPIKIKPNQQHPSRQEPHK  119

Query  747   SLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
               R       K++  GV    Y YKE +HPK+FL      +++ LE +  + S LVR   
Sbjct  120   PPRLPLNFAVKVLAFGVFIGFYQYKELVHPKIFLGLLCCQVFLFLEVLFSLCSALVRCTM  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +E+E P DEP+LSTSLQDFWGRRWN+MVTN+LR TVY PV+S +   + E  + LPAV+
Sbjct  180   GLEVEQPSDEPYLSTSLQDFWGRRWNLMVTNLLRHTVYKPVKSAAETVMSERWSPLPAVV  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+F+VSG+MHEL+FY + R +P+ E+ SFF+++G C+ +E+GVK    G++RL    S P
Sbjct  240   ATFLVSGLMHELLFYYVNRVSPSWEMTSFFVLHGVCLVVEVGVKSVFSGRWRLHWAASVP  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIE  121
             L +  V+ TSFWLFFPP  R   D +   E    +E
Sbjct  300   LTVGFVVATSFWLFFPPLIRAGADMRVMEEVKVLLE  335



>ref|XP_006482942.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Citrus 
sinensis]
Length=367

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 210/356 (59%), Gaps = 24/356 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE+ NFI VW +V   L YC+ I  +  K    R   + PV C+FL LPL LTS+H+ 
Sbjct  1     MEGEMKNFIKVWLSVTISLYYCYAIGKMASK-GIKRLICLIPVVCIFLYLPLCLTSVHIG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAG------  766
             GT+AFFI WL +FKL LFA   GPLSS PP+ L  F+  +CLPIK+Q             
Sbjct  60    GTTAFFIAWLANFKLLLFAFGLGPLSSHPPISLPLFVIVSCLPIKIQNNNHHNSKPNPSQ  119

Query  765   -------------NFKFSGSLRKlvllgvvflvyyYKE-FLHPKVFLLFFVIHLYIVLEF  628
                          N+   G L  +++   +   Y     F+HPK+ LL + IH+Y +LE 
Sbjct  120   NNNPSPGAREGPLNYAIKGLLVAILVQLQLAYEYSDYVLFVHPKLILLVYSIHMYFLLEL  179

Query  627   MLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSAR  448
             +L   + + RA   +ELE    EP+LSTSLQDFWG+RWN+MVT ILRPTVY P   +  R
Sbjct  180   ILAASAAVARATLGLELEPQLKEPYLSTSLQDFWGKRWNLMVTGILRPTVYKPTLHIFTR  239

Query  447   FLPESLASLPAVMASFVVSGIMHELVFYNIGRAT---PTGEVMSFFLVNGACVALEIGVK  277
                   ASLPAV A+F+VSG MH+L+F+ +GR     PT  V  FF+++G C+A+E+ +K
Sbjct  240   VTGRKWASLPAVFATFLVSGFMHQLMFFYLGRGAGLKPTWGVTWFFVLHGVCLAVELALK  299

Query  276   RAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             +AV G+FRLP I+SG L +  V++T  WLFFP +   K D +A  E  A   F  N
Sbjct  300   KAVTGRFRLPRIISGLLTVAFVMVTGCWLFFPQFTHCKLDERAFEEYAALGAFFRN  355



>ref|XP_003600196.1| Annotation was added to scaffolds in November 2011~Long-chain-alcohol 
O-fatty-acyltransferase [Medicago truncatula]
 gb|AES70447.1| membrane-bound O-acyltransferase family MBOAT protein [Medicago 
truncatula]
Length=344

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 207/337 (61%), Gaps = 9/337 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEI  FI VW     CLCYC+ I+   PK  F R  +I P+  LFL+LPLNL+S HL 
Sbjct  1     MDGEIERFIKVWLISTTCLCYCYYISSKIPK-GFLRLLSILPILYLFLILPLNLSSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G + FF+ WL +FKL LF+  + PL   P      FI  A LPI  Q+       F    
Sbjct  60    GPTTFFLVWLSTFKLILFSFNQPPLFPLPNNIFH-FISIASLPINPQQSNSTT-TFSSKK  117

Query  747   SLR-----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
             S+      K+V+L  +   Y Y+E++HP   L+ +  H+Y+ +E +L + +  VR +F  
Sbjct  118   SILPLTCLKVVILVAIICSYEYREYMHPYFILVLYCCHMYLGIELVLAISAAPVRTMFGF  177

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             E+E  F+EP+LSTSLQDFWGRRWN+MVT ILRPTVY+PVR +   ++  + A+  A +A+
Sbjct  178   EIEPQFNEPYLSTSLQDFWGRRWNLMVTGILRPTVYNPVRHIIRSYVGSTYATSAATLAT  237

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGIVSGPL  226
             FVVSG+MHE+++Y + RA PT EV  FF+++G C ++E+ VK+ +  + +RL   VSGPL
Sbjct  238   FVVSGLMHEVIYYYLARAPPTWEVTWFFVLHGVCTSVEVAVKKILLRRGWRLHRAVSGPL  297

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              +T + +T  WLFFP   RN   +K   E    + FV
Sbjct  298   TITFLAVTGNWLFFPQLLRNGVVSKGIGEYAILVNFV  334



>ref|XP_006586110.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1-like [Glycine max]
Length=348

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 149/338 (44%), Positives = 209/338 (62%), Gaps = 11/338 (3%)
 Frame = -3

Query  1101  GEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGT  922
             GE+  FI VW T + CLCYC+ I    PK  F R  ++FP+  LFL+LPLNL+S HLAG 
Sbjct  4     GEVERFIKVWLTTISCLCYCYYITSRIPK-GFLRLLSLFPILYLFLILPLNLSSFHLAGP  62

Query  921   SAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGS-  745
             + FF+ WLG+FKL LF+  +GPL+ +PP  L  FI  A LPI  ++          + + 
Sbjct  63    TTFFLVWLGTFKLILFSFNQGPLALSPPNILH-FISIASLPINPKQLPPPTNKNHTNNTT  121

Query  744   -------LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
                    L K+++  ++   Y Y+E LHP   L+ +  H+Y+ +E +L + +  VR V  
Sbjct  122   QKPKWLFLLKVLIFAMIIRAYDYRENLHPHFILVLYCCHMYLGIELVLALSAAPVRTVLG  181

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
              E+E  F+EP+LSTSLQDFWGRRWN+MVT ILRPTVY PV  +   F+  S A   AV+A
Sbjct  182   FEIEPQFNEPYLSTSLQDFWGRRWNLMVTRILRPTVYHPVYRIFIHFVGPSCAKSSAVLA  241

Query  405   SFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFRLPGIVSGP  229
             +F+VSG+MHEL++Y + RA PT EV  FF+++G C A E+  K+ +    +RL  +VSGP
Sbjct  242   TFLVSGLMHELIYYYLSRAPPTWEVTCFFVLHGVCTAAEVVAKKVMLRHGWRLHRVVSGP  301

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             L +  + +T  WLFFP   R+  D KA  E    ++FV
Sbjct  302   LVVAFLAVTGRWLFFPQLLRSGLDRKAIGEYAILVDFV  339



>gb|AFK35478.1| unknown [Medicago truncatula]
Length=344

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 205/337 (61%), Gaps = 9/337 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEI  FI VW     CLCYC+ I+   PK  F R  +I P+  LFL+LPLNL+S HL 
Sbjct  1     MDGEIERFIKVWLISTTCLCYCYYISSKIPK-GFLRLLSILPILYLFLILPLNLSSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G + FF+ WL +FKL LF+  + PL   P      FI  A LPI  Q+       F    
Sbjct  60    GPTTFFLVWLSTFKLILFSFNQPPLFPLPNNIFH-FISIASLPINPQQSNSTT-TFSSKK  117

Query  747   SLR-----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
             S+      K+V+L  +   Y Y+E++HP   L+ +  H+Y+ +E +L + +  VR +F  
Sbjct  118   SILPLTCLKVVILVAIICSYEYREYMHPYFILVLYCCHMYLGIELVLAISAAPVRTMFGF  177

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             E+E  F+EP+LSTSLQDFWGRRWN+MVT ILRPTVY+PVR +   ++  + A+  A +A+
Sbjct  178   EIEPQFNEPYLSTSLQDFWGRRWNLMVTGILRPTVYNPVRHIIRSYVGSTYATSAATLAT  237

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGIVSGPL  226
             FVVSG MHE+++Y + RA PT EV  FF+++G C ++E+ VK+    + +RL   VSGPL
Sbjct  238   FVVSGFMHEVIYYYLARAPPTWEVTWFFVLHGVCTSVEVAVKKIFFRRGWRLHRAVSGPL  297

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              +T + +T  WLFFP   RN   +K   E    + FV
Sbjct  298   TITFLAVTGNWLFFPQLLRNGVVSKGIGEYAILVNFV  334



>ref|XP_002313329.1| hypothetical protein POPTR_0009s05980g [Populus trichocarpa]
 gb|EEE87284.1| hypothetical protein POPTR_0009s05980g [Populus trichocarpa]
Length=352

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 151/352 (43%), Positives = 214/352 (61%), Gaps = 18/352 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI N I VW +V   +CYC+ I    PK +  R   + P+ CLFL LPL+L +IH  
Sbjct  1     MENEICNLIKVWFSVFASVCYCYAIGKAVPKGT-RRLIFLLPIVCLFLYLPLHLFAIHFR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRR------KKVA  769
             G +AFFI WL +FKL LFA  +GPLSS  P      F+  ACLPIK+Q        K   
Sbjct  60    GPTAFFIAWLANFKLLLFAFGKGPLSSDNPSISLPHFVAVACLPIKIQHNVNDSSPKSHI  119

Query  768   GNFKFSGSLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
              + K     R       K +LL ++  V+ Y +++HPKV  L ++++LYI LE +L + +
Sbjct  120   HSQKLEDGKRSSPNYGVKTLLLAILVNVHNYSDYIHPKVVSLLYIMYLYIQLELLLAIAA  179

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              + + +   ELE  F+EP+LSTSLQDFWGRRWN+MV++ILR  VY+P  ++++  +    
Sbjct  180   TMAKVLLGQELEPQFNEPYLSTSLQDFWGRRWNLMVSSILRLAVYEPTGNIASGLVGRKW  239

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRL  250
             A +PAVM +F VSGIMHEL+F+ +GR   T E+  FFL++G C+ +E  +K+   G+++L
Sbjct  240   ARIPAVMGTFFVSGIMHELMFFYLGRDKLTMELTCFFLLHGLCLIVEGVLKKRFGGRWKL  299

Query  249   PGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAES---LAFIEFVINHR  103
             P ++SG L    V+LT +WLF P  +  K   KA AE    + FIE  I HR
Sbjct  300   PTVISGLLTTGFVMLTGYWLFLPSMYSCKVFEKASAEYAQLVTFIENTIIHR  351



>ref|XP_009361072.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Pyrus x bretschneideri]
Length=368

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 217/341 (64%), Gaps = 15/341 (4%)
 Frame = -3

Query  1110  TMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
             +ME EI + I V  ++   LCY + I    PK    R  ++ P+  LF  LPL+L++   
Sbjct  16    SMEEEIKSLIKVCLSIFASLCYTYFIASKIPKGKL-RLLSLLPIFYLFTTLPLSLSTALP  74

Query  930   AGTSAFFIGWLGSFKLTLFALCRGplsstp-plplsTFIPFACLPIK--------VQRRK  778
             AG  A FI W+GSFKL LF+   GPLSS P    L  FI  ACLPIK        ++R  
Sbjct  75    AGVFAMFITWVGSFKLLLFSFGHGPLSSDPPLNSLILFIFTACLPIKTSQQLFPNLERTP  134

Query  777   KVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
             K+  N        K++L G++  +  YK++LHP++ L  +   LY+ ++ ++ + +  +R
Sbjct  135   KLPLNLP-----TKILLFGILVALTDYKKYLHPRILLGQYCCMLYLFVDVLVGVANATMR  189

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
             AV  +ELE+P +EP+LSTSLQDFWG RWN+M+TN LR TV+ PVRS +  FL  + A LP
Sbjct  190   AVLGIELESPSNEPYLSTSLQDFWGWRWNLMITNTLRQTVHKPVRSAAETFLGTAWAPLP  249

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
             AV+A+F+VSG+MHEL+++ + RATPT EV  FF+++G C+ +E GVK+A+ G++RL  +V
Sbjct  250   AVLATFLVSGLMHELIYFYMTRATPTWEVTWFFVLHGVCLVVEFGVKKALGGRWRLHWVV  309

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             S PL +  V+ T+ WLFFPP  RN  DT+A  E    +EFV
Sbjct  310   STPLTIVFVVATATWLFFPPLVRNGVDTRAIEECKELVEFV  350



>ref|XP_009361071.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Pyrus 
x bretschneideri]
Length=350

 Score =   253 bits (647),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 207/347 (60%), Gaps = 15/347 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E NNFI VW      LCYC  I+   PK    R  ++ P+  LF++LP NL S HL 
Sbjct  1     MESETNNFIKVWILTNISLCYCFYISSRIPK-GILRLISLLPIFYLFIMLPFNLHSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G + FF+ W G FKL LF+   GPL + PP     FI  A LPIK+ +    + N  +  
Sbjct  60    GPTTFFLVWFGIFKLLLFSFDLGPLCAPPPTLFQ-FISIAILPIKIIQNPTNSENPNYPV  118

Query  747   SLR-------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
                             K +LL +V   Y Y++ LHP V L+ +  H+Y+ LE ++ + + 
Sbjct  119   GKTVTNMPKMSVLFAVKALLLALVVRSYDYRQRLHPYVILVLYFCHMYLGLEIVMPLCAT  178

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
               RA+FR ELE   ++P+LSTSLQDFWGRRWN+MVTNILRPT YDPV  +S R +    A
Sbjct  179   PARALFRFELEPQSNKPYLSTSLQDFWGRRWNLMVTNILRPTTYDPVLRISKRVVGLRWA  238

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
                A+M++F VSG+MHE+++Y + R +PT EV  FF+++G CVA+E+ VK+AV  ++R  
Sbjct  239   RFLALMSAFAVSGLMHEVIYYYLTRVSPTWEVTWFFVLHGLCVAIEVEVKKAVAERWRFH  298

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
              +VSGPL L  + +T+ WLFFP   RN  D KA  E    ++FV  H
Sbjct  299   PLVSGPLTLGFLAVTANWLFFPQLLRNGVDVKAIDEYPVMVDFVKAH  345



>ref|XP_002529023.1| acyltransferase, putative [Ricinus communis]
 gb|EEF33334.1| acyltransferase, putative [Ricinus communis]
Length=359

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 205/345 (59%), Gaps = 16/345 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE  NFI VW     CLCYC+ +    PK  F R  ++ P+  LF++LPL LTS HL 
Sbjct  1     MEGEFKNFIKVWILATTCLCYCYYVASKIPKGVF-RLISLLPIFYLFIILPLVLTSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               + FF+ WL +FKL LF+  +G   S   L L  FI    LPIK+++    +   K   
Sbjct  60    APTTFFLIWLANFKLLLFSFDQG-PLSPASLKLFHFISLTYLPIKLRQNNDPSHTQKHQT  118

Query  747   SLRKlv--------------llgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
             +                   L+ ++F  Y YK+FLHP + L  + +H+Y+ LE +L + +
Sbjct  119   AYTTSAPFLPRRVVLPLKVLLVALLFHCYSYKQFLHPYLILALYCLHMYLELEIILAISA  178

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
                R +F  ELE  F+EP+L+TSLQDFWGRRWN+MVT+IL PTVY PVR      + ++ 
Sbjct  179   TPARVLFGFELEPQFNEPYLATSLQDFWGRRWNLMVTSILHPTVYYPVRQFFMGLIGQTW  238

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRL  250
             ASLPA +A+FVVSG+MHE++++ + R +PT EV  FF+V+G CV +E+ +K+   G++ L
Sbjct  239   ASLPAFVATFVVSGLMHEIIYFYVTRVSPTWEVTWFFIVHGVCVVIEVALKKMAKGRWEL  298

Query  249   PGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
                +S PL +  V +T+ WLFFP   RN+ D KA  E   F+  +
Sbjct  299   DRAISIPLTVVFVGVTAVWLFFPQLTRNRIDDKAIGEYSIFVNLL  343



>ref|XP_011025639.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Populus 
euphratica]
Length=351

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 212/347 (61%), Gaps = 15/347 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI N + VW++V   +CYC+ I  + PK +  R   + P+ CLFL LPL+L +IH  
Sbjct  1     MENEICNLMKVWSSVFASVCYCYAIGKVVPKGT-RRLIFLLPIVCLFLYLPLHLFAIHFR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRR------KKVA  769
             G +AFFI WL +FKL LFA  +GPLSS  P      F+  ACLPIK+Q        K   
Sbjct  60    GPTAFFIAWLANFKLLLFAFGKGPLSSDNPSIPLPQFVAVACLPIKIQHNVNDSSPKSHI  119

Query  768   GNFKFSGSLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
              + K     R       K +LL ++  V+ Y +++HPKV  L +V++LYI LE +L +V+
Sbjct  120   HSQKLEDGKRSSPNYGVKTLLLAILVNVHNYSDYIHPKVVSLLYVMYLYIQLEILLAIVA  179

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              + + +   E E  F+EP+LSTSLQDFWGRRWN+MV++ILR  VY+P  ++++  +    
Sbjct  180   TMAKVLLGQEFEPQFNEPYLSTSLQDFWGRRWNLMVSSILRLAVYEPTGNIASGLVGRKW  239

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRL  250
             A +PAVM +F VSGIMHEL+F+ +GR   T E+  FFL++G C+  E  +K+   G+++L
Sbjct  240   ARIPAVMGTFFVSGIMHELMFFYLGRDKLTMELTCFFLLHGLCLIAESVLKKCFGGRWKL  299

Query  249   PGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             P ++SG L    V+LT +WLF P  +  K   +A AE    + F+ N
Sbjct  300   PTVISGLLTTGFVMLTGYWLFLPSMYSCKVFERASAEYAQLVTFIEN  346



>ref|XP_008227052.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase [Prunus 
mume]
Length=382

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 203/373 (54%), Gaps = 41/373 (11%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEINNFI VW      LCYC+ I    PK    R  ++ P+  +F++LPLNL S HL 
Sbjct  1     MDGEINNFIKVWILTNTSLCYCYYIAAKIPK-GIIRLISLLPIFYIFIILPLNLHSFHLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV-----QRRKKVAGN  763
             G + FF+ WLG FKL LF+   GPLS TPP  +  FI  ACLPIK+     Q+  +    
Sbjct  60    GPTTFFLVWLGIFKLLLFSFNLGPLSPTPPTLVQ-FISIACLPIKIKQNPPQKSPQNTDQ  118

Query  762   FKFSGSLRKlvllgvv----------------------------------flvyyYKEFL  685
                +    K                                            Y Y+  L
Sbjct  119   NPLTPQNNKNPSHQTTPKPKKSVNPIDQTLTNVPNKSILLAIKALLLALVIRTYEYRPHL  178

Query  684   HPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVM  505
             HP + L  +  H+Y+ +E +L + +   RA+   ELE  F EP+LSTSLQDFWGRRWN+M
Sbjct  179   HPYIILALYCCHMYLGIELVLALSAVPARAILGFELEPQFTEPYLSTSLQDFWGRRWNLM  238

Query  504   VTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMS  325
             VTNILRP  YDPVR +S R L    A   AVM++F VSG+MHE ++Y + R +PT EV  
Sbjct  239   VTNILRPVAYDPVRRISMRILGPRWARFLAVMSTFAVSGLMHEAIYYYLTRVSPTWEVTW  298

Query  324   FFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKAC  145
             FF+++G CVA+E+ VK+A   ++RL  +VSGPL +  + +T  WLFFP   RN  D KA 
Sbjct  299   FFVLHGVCVAVEVEVKKAAADRWRLHPVVSGPLTIVFLAVTGNWLFFPQLLRNGVDLKAI  358

Query  144   AESLAFIEFVINH  106
              E    ++FV  H
Sbjct  359   HEYGIMVDFVKAH  371



>gb|AAO18666.1| wax synthase isoform 3 [Vitis vinifera]
Length=364

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 147/336 (44%), Positives = 204/336 (61%), Gaps = 8/336 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M GEI   I V  +VL  LCY + I    PK  F R  ++ P+  LF+ LPL L++  L+
Sbjct  1     MGGEIKGLIKVCLSVLASLCYSYFIVSKIPKGKF-RLLSLLPIFSLFVALPLFLSTAILS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AFFI WL +F+L LF+   GPLS+  P  L  FI  ACLPIK++  ++         
Sbjct  60    GITAFFITWLATFRLALFSFDLGPLSTGSPKSLLVFIAIACLPIKIKPNQQHPSRQDPHK  119

Query  747   SLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
               R       K++  GV    Y YKE +HPK+FL      +++ LE +  + S LVR   
Sbjct  120   PPRLPLNFAVKVLAFGVFIGFYQYKELVHPKIFLGLLCCQVFLFLEVLFSLCSALVRCTT  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +E+E P DEP+LST LQDFWGRRWN+MVTN+LR TVY PV+S +   + E  + LPAV+
Sbjct  180   GLEVEQPSDEPYLSTLLQDFWGRRWNLMVTNLLRHTVYKPVKSAAETVMSERWSPLPAVV  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+F+VSG+MHEL+FY + R +P+ E+ SFF+++G C+ +E+GVK    G++RL    S P
Sbjct  240   ATFLVSGLMHELLFYYVNRVSPSWEMTSFFVLHGVCLVVEVGVKSVFSGRWRLHWAASVP  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIE  121
             L +  V+ TSFWLFFPP  R   D +   E    +E
Sbjct  300   LTVGFVVATSFWLFFPPLIRAGADMRVMEEVKVLLE  335



>ref|XP_009343635.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Pyrus 
x bretschneideri]
Length=367

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 161/358 (45%), Positives = 211/358 (59%), Gaps = 25/358 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI NFI V       LCYC  I+   PK    R F++ P+  LF++LPLNL S HL 
Sbjct  1     MEDEIYNFIKVCFLANISLCYCFYISSRIPK-GILRLFSLLPIFYLFILLPLNLHSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             G + FF+ WL +FKL LF+   GPLSS  PL L  FI  A LPIK+++            
Sbjct  60    GPTTFFLVWLATFKLLLFSFDHGPLSSPRPLTLFQFISLAILPIKIKQNPPQKSPPNQNP  119

Query  780   -KKVAGNFKFSGSLR------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYI  640
               K+  N   S +              K +LL +V   Y YK+ LHP V L  +  HLY+
Sbjct  120   DHKIPPNPTKSENPSYPIGKKSILFAVKALLLALVVGSYDYKQHLHPYVILALYCCHLYL  179

Query  639   VLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRS  460
              LE +L + +   RAVF  ELE   +EP+LSTSLQDFWG RWN+MVTNILRPT Y PVR+
Sbjct  180   GLEILLPLFATPARAVFGFELEPHSNEPYLSTSLQDFWGCRWNLMVTNILRPTTYYPVRN  239

Query  459   VSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV  280
             V  R +   LA   A+M +F VSG+MHE+++Y + R  PT EV  FF+++G CVA+E+ V
Sbjct  240   VFTRVVGSRLARFLAMMFTFAVSGLMHEVIYYYLARVPPTWEVTWFFMLHGLCVAIEVEV  299

Query  279   KRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             K+AV  + RL  ++SGPL L  + +T+ WLFFP   RN  D KA  E    ++FV +H
Sbjct  300   KKAVADRCRLKPVISGPLTLLFLAVTANWLFFPQLLRNGVDVKAINEYPVMVDFVKSH  357



>ref|XP_007020663.1| Wax synthase, putative [Theobroma cacao]
 gb|EOY12188.1| Wax synthase, putative [Theobroma cacao]
Length=357

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 203/339 (60%), Gaps = 17/339 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI   + VW ++L  LCYC+ +    P+    R  AI P+  LF +LPL L+ +   
Sbjct  1     MEGEIKTLVKVWLSILPSLCYCYFVALKLPEGKL-RLLAILPILFLFTILPLFLSHVFPI  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstppl--plsTFIPFACLPIKVQRRKKVAGNFKF  754
             G +A F+ WLG+FKL LFA  +GPLSS       L  FI  AC PI+++   K   +   
Sbjct  60    GLTALFLSWLGNFKLLLFAFGKGPLSSHHYPPCSLIHFILIACFPIRIKENGKYPSSKST  119

Query  753   SGSLR--------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFM  616
                 +              K ++  ++   + Y+ F+HPK+ LL +   +Y++++ +  +
Sbjct  120   QSPQQTCPKHPRLPLNWPTKALVFAMLVGAHDYEHFVHPKIVLLLYCCMVYLLIDIIFGV  179

Query  615   VSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPE  436
              +GLV A   +ELE P DEP+LSTSLQDFWG+RWN+MVTN+LR TVY P+RS +   L  
Sbjct  180   SNGLVHATSGLELEPPSDEPYLSTSLQDFWGKRWNLMVTNLLRHTVYKPMRSFTDNMLGP  239

Query  435   SLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKF  256
               A LPAV+A+F+VSG+MHEL+FY + R +PT EV  +F+++GACV  E GVKRA  GK 
Sbjct  240   KWAPLPAVLAAFLVSGLMHELLFYYVTRVSPTWEVTWYFVLHGACVVAEFGVKRAFPGKP  299

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             RL   +S PL +  V+ T+ WLFFPP  R     +A  E
Sbjct  300   RLHWAMSAPLTIGFVVATAMWLFFPPLLRTGAAERAIGE  338



>ref|XP_009364188.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Pyrus 
x bretschneideri]
Length=367

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 211/358 (59%), Gaps = 25/358 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI NFI V       LCYC  I+   PK    R  ++ P+  LF++LPLNL S HL 
Sbjct  1     MEDEIYNFIKVCFLANISLCYCFYISSRIPK-GILRLISLLPILYLFILLPLNLHSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             G + FF+ WL +FKL LF+L  GPLSS  PL L  FI  A LPIK+++            
Sbjct  60    GPTTFFLIWLATFKLLLFSLDHGPLSSPAPLTLFQFISLAILPIKIKQNPPQKSPPNQNP  119

Query  780   -KKVAGNFKFSGSLR------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYI  640
               K+  N   S +              K +LL +V   Y Y++ LHP V L  +  HLY+
Sbjct  120   DHKIPPNPTKSENPSYPIGKKSILFAVKALLLALVVGSYDYRQHLHPYVILALYCCHLYL  179

Query  639   VLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRS  460
              LE +L + +   RAVF  ELE   +EP+LSTSLQDFWG RWN+MVTNILRPT Y PVR+
Sbjct  180   GLEILLPLFATPARAVFGFELEPHSNEPYLSTSLQDFWGCRWNLMVTNILRPTTYYPVRN  239

Query  459   VSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV  280
             +  R +   LA   A+M++F VSG+MHE+++Y + R  PT EV  FF+++G CVA+E+ V
Sbjct  240   IFTRVVGSRLARFLAMMSTFAVSGLMHEVIYYYLARVPPTWEVTWFFVLHGVCVAIEVEV  299

Query  279   KRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             K+AV  + RL  ++SG L L  + +T+ WLFFP   RN  D KA  E    ++FV +H
Sbjct  300   KKAVADRCRLKPVISGSLTLLFLAVTANWLFFPQLLRNGVDVKAINEYPVMVDFVKSH  357



>gb|EYU27706.1| hypothetical protein MIMGU_mgv1a025777mg, partial [Erythranthe 
guttata]
Length=341

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 153/334 (46%), Positives = 201/334 (60%), Gaps = 4/334 (1%)
 Frame = -3

Query  1101  GEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGT  922
             GEI NFI VW T    L YC+    + PK    R  A  PV CLFL+LPL L S+HL GT
Sbjct  1     GEITNFIKVWLTAYASLSYCYFSAKVLPKGGAARLAAFLPVVCLFLLLPLQLHSVHLIGT  60

Query  921   SAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGSL  742
             + FF+ WL +FKL LFA  +GPLS+        FI  A LPI +Q++ K  G       L
Sbjct  61    TGFFLAWLSTFKLLLFAFDKGPLSTPLISLPR-FIAVASLPIVLQQKSKSQGKLNQKSFL  119

Query  741   R---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEA  571
                 K VL  ++   Y Y++ +H ++ ++ +  H+Y+ LE ML + +   R +   ELE 
Sbjct  120   NYAIKAVLFALIIKTYDYEDRIHRRIIVVLYCFHIYLCLEIMLAVAAAAARWLLSAELEP  179

Query  570   PFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVS  391
              F+EP+LSTSLQDFWGRRWN+MVT +LRPTVY PV   S   +    A LPAVM++FVVS
Sbjct  180   QFNEPYLSTSLQDFWGRRWNLMVTRMLRPTVYFPVLDWSTGIVGRDWAQLPAVMSTFVVS  239

Query  390   GIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLV  211
             G+MHEL+FY  GR  PT E+  FF+++GACV +EI VK+AV  ++RLP  V   +    V
Sbjct  240   GMMHELIFYYFGRVRPTWEITWFFVLHGACVVVEIAVKKAVGCRWRLPRFVGTAMTAGFV  299

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
               T  WLFFP + R K D +  AE  A   FV +
Sbjct  300   FSTGMWLFFPQFLRCKADERGLAEIAAAGAFVKD  333



>ref|XP_007211425.1| hypothetical protein PRUPE_ppa007091mg [Prunus persica]
 gb|EMJ12624.1| hypothetical protein PRUPE_ppa007091mg [Prunus persica]
Length=382

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 150/373 (40%), Positives = 203/373 (54%), Gaps = 41/373 (11%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEINNFI VW      LCYC+ I    PK    R  ++ P+  +F++LPLNL S HL 
Sbjct  1     MDGEINNFIKVWILTNTSLCYCYYIAAKIPK-GIIRLISLLPIFYIFIILPLNLHSFHLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
             G + FF+ WLG FKL LF+   GPLS TPP  +  FI  ACLPIK+++   +K   N   
Sbjct  60    GPTTFFLVWLGIFKLLLFSFNLGPLSPTPPTLVQ-FISIACLPIKIKQNPPQKSPQNTDQ  118

Query  753   SGSLRKlvllgvvflvyyYKE-------------------------------------FL  685
             +    +             K+                                      L
Sbjct  119   NPPTPQNNKNPSHQTTPKPKKSVNPIDQTLTNVPNKSILLAIKALLLALVIRTYEYRPHL  178

Query  684   HPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVM  505
             HP + L  +  H+Y+ +E +L + +   RA+   ELE  F EP+LSTSLQDFWGRRWN+M
Sbjct  179   HPYIILALYCCHMYLGIELVLALSAVPARAILGFELEPQFTEPYLSTSLQDFWGRRWNLM  238

Query  504   VTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMS  325
             VTNILRP  YDPVR +S R L    +   AVM++F VSG+MHE ++Y + R +PT EV  
Sbjct  239   VTNILRPVAYDPVRRISMRILGPRWSRFLAVMSTFAVSGLMHEAIYYYLTRVSPTWEVTW  298

Query  324   FFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKAC  145
             FF+++G CVA+E+ +K+A   ++RL  +VS PL +  + +T  WLFFP   RN  D KA 
Sbjct  299   FFVLHGVCVAVEVEMKKAATDRWRLHPMVSRPLTIVFLGVTGNWLFFPQLLRNGVDLKAI  358

Query  144   AESLAFIEFVINH  106
              E    I+FV  H
Sbjct  359   DEYGIMIDFVKAH  371



>ref|XP_010030488.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Eucalyptus 
grandis]
Length=412

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 202/348 (58%), Gaps = 36/348 (10%)
 Frame = -3

Query  1053  LCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLF  874
             L YCHTI    P  +  R  AI PV  LF VLPL+LT+I L G ++FFI WL +FKL LF
Sbjct  45    LTYCHTIGQTVPTGT-KRLLAISPVIGLFFVLPLSLTTISLGGLTSFFIAWLSNFKLILF  103

Query  873   ALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGS------LR-------Kl  733
             A  +GPLSS+    L+ FIP ACLPIK+    +   N +   S      L+       K 
Sbjct  104   AYGKGPLSSSQSCLLAYFIPIACLPIKIHNPIESTKNEEHPCSEINERGLKSPMNYAIKC  163

Query  732   vllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPH  553
             ++       Y  K+ +HP +  L + +++Y+ LE  L +V  +VR +  V LE  F+EP+
Sbjct  164   LVTVAFLPAYERKDRVHPVMINLMYCVYVYVGLEMSLAVVGAMVRTLVGVRLEPQFEEPY  223

Query  552   LSTSLQDFWGRRWNVMVTNILRPTVYDP----------------------VRSVSARFLP  439
             LSTSLQ+FWGRRWN+MVTNILRPTVY P                       RS+S+R + 
Sbjct  224   LSTSLQEFWGRRWNLMVTNILRPTVYLPDFQYAYFKKNSEYDAFFSSLSYTRSISSRVIG  283

Query  438   ESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK  259
                A LPA  A F+VSG+MHEL+FY IGR  P   V SFFL++G CVA+EI  K+    K
Sbjct  284   RMWAPLPASFACFLVSGLMHELIFYYIGRKEPRWVVTSFFLMHGLCVAIEIAAKKVFANK  343

Query  258   FRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             FRLP  VSGP+A+  ++ T+ WLF P       + KA  E++A ++FV
Sbjct  344   FRLPRAVSGPMAVGFILTTALWLFLPALLWCDAEDKARGEAMAVVDFV  391



>ref|XP_002527949.1| acyltransferase, putative [Ricinus communis]
 gb|EEF34438.1| acyltransferase, putative [Ricinus communis]
Length=367

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 221/356 (62%), Gaps = 24/356 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI N I VW TVL  LCYC+ I  L  + +  R   I PV CLFL LPLNL S  L 
Sbjct  1     MEGEIYNLICVWITVLVTLCYCYAIGKLVSQGT-KRLLFILPVVCLFLFLPLNLFSPQLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------RKKVAG  766
             G +AFFI WL +FKL LFA  +GPLSS P + L  F+  +CLPIK+Q+        K + 
Sbjct  60    GLTAFFIAWLANFKLLLFAFGKGPLSSDPSISLPVFVAVSCLPIKIQKNPSPKSHPKNSP  119

Query  765   NFKFSGSLR-----------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIV  637
             N   +G ++                 K  L+ ++  VY Y + +HP++ L+ +V+H+Y+ 
Sbjct  120   NPSPNGQIKEDPSPKILKDGFLDYAVKATLVALMVRVYDYSDHIHPRIVLVIYVLHVYLF  179

Query  636   LEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSV  457
             LE  L + + L R +  +ELE  F++P+LSTSLQDFWG+RWN+MVTNILR TVY+P+ ++
Sbjct  180   LELNLAITAALARIILGIELEPQFNDPYLSTSLQDFWGKRWNLMVTNILRLTVYEPICNL  239

Query  456   SARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVK  277
             S+R L    + L AV  +F+VS +MHE++FY + RA PTG++ +FFL+NG C+  EI +K
Sbjct  240   SSRALGLKRSRLLAVWLTFLVSALMHEVLFYYLARARPTGDISAFFLLNGLCLTAEINLK  299

Query  276   RAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
               ++G+++LP +VS  L +  V  T  WLFFP + R++ D +A  +      F+ N
Sbjct  300   MWLNGRWQLPRLVSRFLTIGFVTTTGLWLFFPMFVRHQIDVRAFEDLAVLAVFLKN  355



>ref|XP_004486217.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Cicer arietinum]
Length=383

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 208/370 (56%), Gaps = 38/370 (10%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ EINNFIMVW+     +CYCHTI  L  + +  R  AIFP   L  +LPL LTSIHL 
Sbjct  1     MDAEINNFIMVWSVAASTMCYCHTIGKLISQGT-PRLIAIFPAIILLFLLPLRLTSIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK----------  778
             G ++FF+GWL +FKL LF+  +GPLS+ PPL L  FI  ACLPIK Q +           
Sbjct  60    GPTSFFLGWLSTFKLFLFSFNKGPLSTNPPLSLLHFISLACLPIKFQNQPNNNINTHTDN  119

Query  777   ---------------KVAGNFKFSGSLRKlvllgvvflvy-----yYKEFLHPKVFLLFF  658
                            +++  +  S +LR      ++ L         KE  HPK  LL +
Sbjct  120   NNNPSKSQNRNYPSPQISKKYNKSSNLRYGYATMIIILASLIPLYAKKENFHPKFVLLLY  179

Query  657   VIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTV  478
              +H+YI LEF   + S   + +  VELE  FD+P+LSTSLQDFWG+RWN+ V  +L PTV
Sbjct  180   TLHMYIGLEFFFALASTFTKKILSVELEPQFDKPYLSTSLQDFWGKRWNITVNRVLHPTV  239

Query  477   YDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMS-------FF  319
             Y+P      R +    A LPA++A+F VS +MHE+VFY I R   T E          FF
Sbjct  240   YEPAVKFFCRLIGRKWAPLPAIVATFSVSALMHEVVFYYIKREKRTWEAWEPSWNATCFF  299

Query  318   LVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             +++G C+A+++G+K+AV  K +LP ++S  L +  V+ T+ WLF P   R +   KA  E
Sbjct  300   ILHGVCLAVQVGIKKAVGEKLKLPRMMSWLLTVVFVLYTALWLFVPALVRCRVYDKASRE  359

Query  138   SLAFIEFVIN  109
               A  +FV N
Sbjct  360   LTALTDFVKN  369



>ref|XP_011095804.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Sesamum indicum]
Length=357

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 205/329 (62%), Gaps = 7/329 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI N   VW  V+  L YCH ++   PK  + R  ++ P+  +F +LPL  TS  L 
Sbjct  1     MEGEIKNLSRVWLAVIASLSYCHFVSARLPKGKW-RLISLLPIFYVFAILPLYTTSAFLT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFFI WL SFKL LFA  +GPL S PP  L  F   A LP K++ +    G  K   
Sbjct  60    AITAFFITWLASFKLLLFAFDQGPLYSNPPKSLPVFAAVAALPFKIKPKNDAPGPRKSKK  119

Query  747   -----SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                  +    +   ++ ++Y YKE++H  + L+ +   +++++E ++ + S LV+A+  +
Sbjct  120   LPLYLATEIPISTVLISILYDYKEYIHTHIVLIAYCCLVFLLIEILVELSSLLVQALLGL  179

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             ELE P DEP+L+TSL++FWGRRWN+ V NILR TVY P+RS +A  +    A+LPAV+A+
Sbjct  180   ELETPSDEPYLATSLREFWGRRWNLTVNNILRQTVYKPIRSSAAAVVGRDWAALPAVLAA  239

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFRLPGIVSGPL  226
             F+VSG+MHEL+F+ + RA+P+ E+  FF++ G CV +E G+  A+ + K+RLP  VS  L
Sbjct  240   FLVSGLMHELLFWYVTRASPSWEMTMFFVIQGVCVVVEFGLHVALAEKKWRLPWYVSRTL  299

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAE  139
              +  V+ TSFWLFFPP  RN  D +   E
Sbjct  300   TVGFVVGTSFWLFFPPLMRNGADVRVIEE  328



>ref|XP_010052966.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW77119.1| hypothetical protein EUGRSUZ_D01457 [Eucalyptus grandis]
Length=388

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 201/355 (57%), Gaps = 33/355 (9%)
 Frame = -3

Query  1098  EINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTS  919
             E++NFI VW +V   L YC+    +  K    R  AI PV  LFLVLPL L SIHL G++
Sbjct  6     EVHNFIKVWLSVFAALGYCYATGKIAGK-GVPRLVAILPVVGLFLVLPLGLHSIHLGGST  64

Query  918   AFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVA----------  769
             AFFI WL +FKL LFA  RGPL+S P + L  FI  ACLPIK+Q  ++            
Sbjct  65    AFFIAWLANFKLLLFAFGRGPLASDPSISLPRFIALACLPIKIQPARRTDPSPEDASRSQ  124

Query  768   --------GNFKFSGSLRKlvllgvvflvyyYK--------------EFLHPKVFLLFFV  655
                     G  K + + ++        + Y  K              + L  KV    ++
Sbjct  125   ENADPIQNGRDKQNPTPQRPQKGHKSAINYGIKILLLATILRIYDYSDRLPQKVVWFLYI  184

Query  654   IHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVY  475
             +H+YI LE +L  V+   RA    ELE  FDEP+LSTSLQDFWGRRWN+MVT ILRPTVY
Sbjct  185   LHIYICLEIILVAVAVAARATLGFELEPQFDEPYLSTSLQDFWGRRWNIMVTRILRPTVY  244

Query  474   DPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             +P+ + ++R +    A+LPAV+ +F VS +MHEL+FY +GRA P  E+  FFL +G C+ 
Sbjct  245   EPLLAWASRAVGRRYAALPAVLGTFAVSALMHELIFYYLGRARPNWEITWFFLFHGVCLM  304

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             +EI  K+ +    RLP  V+  L +  V +T+FW F PP  R + D +A  E  A
Sbjct  305   VEIAAKKELKLGLRLPRPVAAALTVGFVTVTAFWWFLPPLLRCRADERAFEEYAA  359



>ref|XP_004295309.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=345

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 192/300 (64%), Gaps = 10/300 (3%)
 Frame = -3

Query  990  IFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPF  811
            + PV  LF  LPL+LT+I L GTS+FF+ WL +FKL LFA  +GPLS  PPL    FIP 
Sbjct  34   VLPVVLLFFYLPLHLTTIFLGGTSSFFLCWLANFKLLLFAFGKGPLSFDPPLAH--FIPL  91

Query  810  ACLPIKVQ--RRKKVAGNFKFSGSLR----KlvllgvvflvyyYKEFLHPKVFLLFFVIH  649
            ACLPIK Q    KKV    K   S      K ++      VY+ KE +HPK+ +  + I+
Sbjct  92   ACLPIKFQTDSEKKVQNVKKGQKSTLNYTVKALIFSTSIQVYHNKESIHPKIVMFLYAIY  151

Query  648  LYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDP  469
            +Y  LEF++  V+   R    V+ E  FDEP+L+TSLQDFWGRRWN+MV  IL PTVY+P
Sbjct  152  MYTGLEFIMAFVAVAARVFLGVDFEPQFDEPYLATSLQDFWGRRWNIMVNRILHPTVYEP  211

Query  468  VRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALE  289
            VR +S R + +  A LPAV+ASF+V  +MHE VFY IGR  PT E+  FFL++  C+++E
Sbjct  212  VRDISIRLIGKEWAPLPAVLASFLVLALMHEFVFYYIGRTKPTWELTCFFLLHEVCLSVE  271

Query  288  IGVKRAVDG-KFRLPGIVSGPLALTLVILTSFWLFFPPYF-RNKGDTKACAESLAFIEFV  115
            I VK+A  G  +RLP  VSGPLA+T V++T  WLF P    R + D     E +AF+EF+
Sbjct  272  ITVKKAFRGSNWRLPAAVSGPLAMTFVVVTGSWLFLPSLMGRCQPDVMVYREYMAFLEFM  331



>gb|KGN58563.1| hypothetical protein Csa_3G684690 [Cucumis sativus]
Length=379

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 203/348 (58%), Gaps = 14/348 (4%)
 Frame = -3

Query  1119  KKKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTS  940
              ++ ME EI N   VW TV   L YCH    L   P   RF AI PV  +F +LPL LTS
Sbjct  24    DQQIMEAEIINLTKVWLTVFISLGYCHATAKLL-NPGPARFLAIAPVVLIFFLLPLQLTS  82

Query  939   IHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAG  766
             IH  G + FF+ WL +FKL L     GPLS+TPPLPL  FI  +CLPIK+     +K A 
Sbjct  83    IHFGGATCFFVTWLATFKLLLLTAGDGPLSTTPPLPLHRFIAISCLPIKILENPSEKSAP  142

Query  765   NFKFSGSLR-----------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLF  619
                 + +L            + +++ ++  +Y Y  F HPK+ L  +  H+Y++LE +L 
Sbjct  143   KNNRAETLNEKPKSFLNYSIRALIVVLMVKLYDYSHFFHPKLVLFIYSWHVYLLLEIILA  202

Query  618   MVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLP  439
             +     R +  +ELE  F +P+ STSLQDFWGRRWN+M TNIL+P VY P   ++AR + 
Sbjct  203   ITQFFGRNLLGIELEPQFRDPYYSTSLQDFWGRRWNLMATNILQPAVYKPTVKIAARVIG  262

Query  438   ESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK  259
                A LP VMA+F+VS +MHEL+FY +GR  P  E+  FF+++G  + +EI +K+ +  K
Sbjct  263   RMWAPLPGVMATFLVSAMMHELIFYYLGRMRPNWEITWFFVIHGIALTVEIMMKKMLPEK  322

Query  258   FRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              RLP  VS P+ L  +  T+ WLFFP + R + D +A  E  A   FV
Sbjct  323   RRLPAKVSVPVTLVFIFSTAIWLFFPQFVRLRLDVRAFEEYAALANFV  370



>gb|KHN11714.1| Acyl-CoA--sterol O-acyltransferase 1 [Glycine soja]
Length=350

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 204/330 (62%), Gaps = 8/330 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEG++ N I V  +V+  LCYC+ I  L P P   R   + P+ CL++ +PL+ +S+HL 
Sbjct  1     MEGDMMNLIKVCPSVVISLCYCYWIRKLVP-PGIKRLVFLLPIICLYIFIPLSFSSVHLT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ----RRKKVAGNF  760
             GT  FF+ WL +FKL LFA   GPLSS P + L  F+  AC PIK+Q    R+     + 
Sbjct  60    GTIGFFLAWLANFKLLLFAFDMGPLSSHPLISLPRFVAVACFPIKIQQNQPRQNGKTPHP  119

Query  759   KFSGSLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
               S  +R   K + LGV+  +Y Y + +HPKV +  +  H+Y +LE +L MV+ + R++ 
Sbjct  120   NPSSMIRYAIKGLSLGVLLKIYDYSDRIHPKVIMCMYCFHIYFLLEIILAMVAAMARSMM  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +ELE  F++P  STSLQDFWGRRWN+MVT+ILRPTVYDP    +   +    A LPAV 
Sbjct  180   GLELEPQFNDPLSSTSLQDFWGRRWNLMVTSILRPTVYDPTLKAAVNVVGPKWAPLPAVF  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
              +FVVSG+MHEL+ + +GR  PT  +  FF+++G  + +EI  KRA+  + RLP  VSGP
Sbjct  240   GTFVVSGLMHELILFYMGRLQPTFWMTWFFVLHGIFLTVEIAFKRALTARCRLPRFVSGP  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             L +  V+ T   LF P + R + D KA  E
Sbjct  300   LTVGFVLATGISLFLPEFIRCQIDVKAFQE  329



>ref|XP_004149740.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004166343.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Cucumis 
sativus]
Length=352

 Score =   246 bits (627),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 147/344 (43%), Positives = 201/344 (58%), Gaps = 14/344 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI N   VW TV   L YCH    L   P   RF AI PV  +F +LPL LTSIH  
Sbjct  1     MEAEIINLTKVWLTVFISLGYCHATAKLL-NPGPARFLAIAPVVLIFFLLPLQLTSIHFG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
             G + FF+ WL +FKL L     GPLS+TPPLPL  FI  +CLPIK+     +K A     
Sbjct  60    GATCFFVTWLATFKLLLLTAGDGPLSTTPPLPLHRFIAISCLPIKILENPSEKSAPKNNR  119

Query  753   SGSLR-----------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
             + +L            + +++ ++  +Y Y  F HPK+ L  +  H+Y++LE +L +   
Sbjct  120   AETLNEKPKSFLNYSIRALIVVLMVKLYDYSHFFHPKLVLFIYSWHVYLLLEIILAITQF  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
               R +  +ELE  F +P+ STSLQDFWGRRWN+M TNIL+P VY P   ++AR +    A
Sbjct  180   FGRNLLGIELEPQFRDPYYSTSLQDFWGRRWNLMATNILQPAVYKPTVKIAARVIGRMWA  239

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
              LP VMA+F+VS +MHEL+FY +GR  P  E+  FF+++G  + +EI +K+ +  K RLP
Sbjct  240   PLPGVMATFLVSAMMHELIFYYLGRMRPNWEITWFFVIHGIALTVEIMMKKMLPEKRRLP  299

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               VS P+ L  +  T+ WLFFP + R + D +A  E  A   FV
Sbjct  300   AKVSVPVTLVFIFSTAIWLFFPQFVRLRLDVRAFEEYAALANFV  343



>ref|XP_007213137.1| hypothetical protein PRUPE_ppa024118mg [Prunus persica]
 gb|EMJ14336.1| hypothetical protein PRUPE_ppa024118mg [Prunus persica]
Length=373

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/370 (41%), Positives = 202/370 (55%), Gaps = 41/370 (11%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEINNFI VW      LCYC+ I    PK    R  ++ P+  +F++ PLNL S HL 
Sbjct  1     MDGEINNFIKVWILTNTSLCYCYYIAAKIPK-DIIRLISLLPIFYIFIIFPLNLHSFHLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
             G + FF+ WLG FKL LF+   GPLS TPP  +  FI  ACLPIK+++   +K   N   
Sbjct  60    GPTTFFLVWLGIFKLLLFSFNLGPLSPTPPTLVQ-FISIACLPIKIKQNPPQKSPKNTDQ  118

Query  753   SGSLRKlvllgvvflvyyYKE-------------------------------------FL  685
             +    +             K+                                      L
Sbjct  119   NPLSHQNNKNPSHQSTPKPKKSVNPIDQTLTNVPNKSILLAIKALLLALVIRTYEYIPHL  178

Query  684   HPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVM  505
             HP + L  +  H+Y+ +E +L + +   RA+   ELE  F EP+LSTSLQDFWGRRWN+M
Sbjct  179   HPYIILAMYCCHMYLGIELVLALSAIPARAILGFELEPQFTEPYLSTSLQDFWGRRWNLM  238

Query  504   VTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMS  325
             VTNILRP VYDPVR +S R L    +   AVM++F VSG+MHE ++Y +   +PT EVM 
Sbjct  239   VTNILRPVVYDPVRCISMRILGPRWSLFLAVMSTFAVSGLMHEAIYYYLTCVSPTWEVMW  298

Query  324   FFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKAC  145
             FF+++G C+A+EI VK+A   ++RL  +VS PL +  + +T  WLFFP   RN  D KA 
Sbjct  299   FFVLHGVCMAVEIEVKKAATDRWRLHPVVSMPLTIVFLAVTGNWLFFPQLRRNGVDLKAI  358

Query  144   AESLAFIEFV  115
              E    I+FV
Sbjct  359   NEYGIMIDFV  368



>ref|XP_009335436.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Pyrus 
x bretschneideri]
Length=367

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 157/358 (44%), Positives = 209/358 (58%), Gaps = 25/358 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI NFI V       LCYC  I+   PK    R  ++ P+  LF++LPLNL S HL 
Sbjct  1     MEDEIYNFIKVCFLANISLCYCFYISSRIPK-GILRLISLLPILYLFILLPLNLHSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
               + FF+ WL +FKL LF+   GPLSS PPL L  FI  A LPIK+++   +K   N   
Sbjct  60    APTIFFLVWLATFKLLLFSFDHGPLSSPPPLTLFQFISLAILPIKIKQNPTQKSPPNQNP  119

Query  753   SGSLR----------------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYI  640
                +                       K +LL +V   Y+Y++ LHP V L     HLY+
Sbjct  120   DHKIPPNPTKPENPSYPIGKKSILFAVKALLLALVVGSYHYRQHLHPYVTLALCCCHLYL  179

Query  639   VLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRS  460
              LE +L + +   RAVF  ELE   +EP+LSTSLQDFWGRRWN+MVT ILRPT Y P+R+
Sbjct  180   GLEILLPLCATPARAVFGFELEPHSNEPYLSTSLQDFWGRRWNLMVTKILRPTTYYPIRN  239

Query  459   VSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV  280
             V  R +   LA   A+M++F VSG+MHE+++Y + R  PT EV  FF+++G CVA+E+ V
Sbjct  240   VFTRVVGPQLARFFAMMSTFAVSGLMHEVIYYYLARVPPTWEVTWFFVLHGVCVAIEVEV  299

Query  279   KRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             K+A   + RL  ++SGPL L  + +T+ WLFFP   RN  D KA  E  A + FV +H
Sbjct  300   KKAAADRCRLKPVISGPLTLLFLAVTANWLFFPQVLRNGVDVKALNEYSAMVAFVKSH  357



>ref|XP_006452483.1| hypothetical protein CICLE_v10008717mg [Citrus clementina]
 gb|ESR65723.1| hypothetical protein CICLE_v10008717mg [Citrus clementina]
Length=365

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 214/349 (61%), Gaps = 17/349 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE  N + VW     CL YC+ I    P  + +R  ++ P+  L  +LPL L +IHL 
Sbjct  1     MDGEFKNLLQVWILTTTCLTYCYYIPSKIPSGT-SRLLSLLPIFYLLTILPLKLHTIHLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ------RRKKVAG  766
               +AF + WL +FKL LFA  +GPLS  P      FI  ACLPIK++       RKK+  
Sbjct  60    VFTAFLLVWLTNFKLLLFAFDQGPLSPPPSKLSH-FISIACLPIKLKTNNTNPSRKKMQK  118

Query  765   NFK-----FSGSLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
               +     FS S     K+VL  V+   Y YK++LH K+ ++  ++++Y++LE +L + S
Sbjct  119   PLQKSFPIFSRSTLLAIKVVLFVVLLHAYKYKQYLHQKLIIIICMLYIYLLLETVLAVCS  178

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              L +A+  +ELE  F+EP+LSTSLQDFWGRRWN+MVT++L  TVYDPVR +S R + +  
Sbjct  179   ALAQAILGLELERQFNEPYLSTSLQDFWGRRWNLMVTSVLHSTVYDPVRRISTRLIDDKW  238

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFR  253
             A+LPAV+A+F VSG+MH++++  + RA PT E+ SFF+++G C+ +E+  KR + DG++R
Sbjct  239   AALPAVLATFAVSGVMHDIIYCYLTRAPPTWEMTSFFILHGTCLTMELAAKRELTDGRWR  298

Query  252   LPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             L   VS  L L  ++++  WLF PP  R   + K   E L F   + N 
Sbjct  299   LHPAVSCLLLLVFLLMSGLWLFSPPLLRGGVNEKMMREVLTFANLIKNE  347



>ref|XP_008366430.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Malus 
domestica]
Length=367

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 214/358 (60%), Gaps = 25/358 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NFI V       LCYC  I+   PK    R  ++ P+  LF++LPLNL S HL 
Sbjct  1     MEGEIYNFIKVCFLANISLCYCFYISSRIPK-GILRLLSLLPILYLFILLPLNLHSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             G + F + WL +FKL LF+   GPLSS PPLPL  FI  A LPIK+++            
Sbjct  60    GPTTFLLVWLATFKLLLFSFDHGPLSSPPPLPLFQFISLAILPIKIKQNPPQKSPSNQNP  119

Query  780   -KKVAGNFKFSGSLR------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYI  640
               K+  N   S +              K +LL +V   Y Y++ LHP V L  +  HLY+
Sbjct  120   DHKIPPNATKSDNTSYPIGKKSILFAVKALLLALVVGSYDYRQHLHPYVILALYCCHLYL  179

Query  639   VLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRS  460
              LE +L + +   RAVF  ELE   +EP+LSTSLQDFWGRRWN+MVT ILRPT Y PVR+
Sbjct  180   GLEILLPLFATPARAVFGFELEPHSNEPYLSTSLQDFWGRRWNLMVTKILRPTTYYPVRN  239

Query  459   VSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV  280
             V  R +   LA   A+M++FVVSG+MHE+++Y + R  PT EV  FF+++G CVA+E+ V
Sbjct  240   VFTRVVGPRLARFLAMMSTFVVSGLMHEVIYYYLARVPPTWEVTWFFVLHGVCVAIEVEV  299

Query  279   KRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             K+AV  ++RL  +VS PL L  + +T+ WLFFP   RN  D KA  E    ++FV +H
Sbjct  300   KKAVANRWRLKPVVSWPLTLLFLAVTANWLFFPQLLRNGVDVKAINEYPVMVDFVKSH  357



>emb|CAN76085.1| hypothetical protein VITISV_034778 [Vitis vinifera]
Length=347

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 142/338 (42%), Positives = 209/338 (62%), Gaps = 13/338 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEG+I + I V  +VL  LCY + I    PK    R  ++ P+  +F+ LP   +SI L+
Sbjct  1     MEGDIRSLITVCLSVLASLCYAYFIVSKIPKGKL-RLLSLLPIFSIFVTLPSLFSSILLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-------KVA  769
             G +A FI WL +FKL L +   GPL +  P  L  FI  ACLPIK+++ +       K+ 
Sbjct  60    GFTALFISWLATFKLALLSFDLGPLVTGRPKSLPIFIIIACLPIKIKQNQQHPYKPPKLP  119

Query  768   GNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
              NF       K++  G+   +Y YKE +HP +FL      +++ +E +  + + LV+++ 
Sbjct  120   LNFAV-----KVLGFGLFIGLYDYKELIHPNIFLGVLCCQVFLFIEIVFSLCNSLVKSMV  174

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +E+E P DEP+LSTSLQDFWGRRWN+MVTN+LR  VY P++S + + +   L+ LPAV+
Sbjct  175   GLEVEQPSDEPYLSTSLQDFWGRRWNLMVTNLLRQIVYKPMKSAAEKVVSRQLSPLPAVV  234

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+FVVSG++HEL+FY + RA+P+ E+  FF+++G CV +EIG+K    G++RL   VS P
Sbjct  235   ATFVVSGLVHELLFYYVIRASPSWEMTCFFVLHGLCVVVEIGLKSLFSGRWRLHWAVSAP  294

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             L +  V++TSFWLFFPP  R     +   E   F E V
Sbjct  295   LTVGFVVVTSFWLFFPPLIRAGVIDRVVGEIKFFFELV  332



>ref|XP_003534380.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Glycine 
max]
Length=350

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/330 (42%), Positives = 199/330 (60%), Gaps = 8/330 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEG++ N I V  +V+  LCYC+ I  L P P   R   + P+ CL++ +PL+ +S+HL 
Sbjct  1     MEGDMMNLIKVCPSVVISLCYCYWIRKLVP-PGIKRLVFLLPIICLYIFIPLSFSSVHLT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ----RRKKVAGNF  760
             GT  FF+ WL +FKL LFA   GPLSS P + L  F+  AC PIK+Q    R+     + 
Sbjct  60    GTIGFFLAWLANFKLLLFAFDMGPLSSHPLISLPRFVAVACFPIKIQQNQPRQNGKTPHP  119

Query  759   KFSGSLRKlvllgvvflvyyYKEF---LHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
               S  +R  +    + ++    ++   +HPK  +  +  H+Y +LE +L MV+ + R++ 
Sbjct  120   NPSSMIRYAIEGLALGVLLKIYDYSDRIHPKAIMCMYCFHIYFLLEIILAMVAAMARSMM  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +ELE  F++P  STSLQDFWGRRWN+MVT+ILRPTVYDP    +   +    A LPAV 
Sbjct  180   GLELEPQFNDPLSSTSLQDFWGRRWNLMVTSILRPTVYDPTLKAAVNVVGPKWAPLPAVF  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
              +FVVSG+MHEL+ + +GR  PT  +  FF+++G  + +EI  KRA+  + RLP  VSGP
Sbjct  240   GTFVVSGLMHELILFYMGRLQPTFWMTWFFVLHGIFLTVEIAFKRALTARCRLPRFVSGP  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             L +  V+ T   LF P + R + D KA  E
Sbjct  300   LTVGFVLATGISLFLPEFIRCQIDVKAFQE  329



>ref|XP_002276970.2| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Vitis vinifera]
 emb|CBI26713.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 142/338 (42%), Positives = 209/338 (62%), Gaps = 13/338 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEG+I + I V  +VL  LCY + I    PK    R  ++ P+  +F+ LP   +SI L+
Sbjct  1     MEGDIRSLITVCLSVLASLCYAYFIVSKIPKGKL-RLLSLLPIFSIFVTLPSLFSSILLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-------KVA  769
             G +A FI WL +FKL L +   GPL +  P  L  FI  ACLPIK+++ +       K+ 
Sbjct  60    GFTALFISWLATFKLALLSFDLGPLVTGRPKSLPIFIIIACLPIKIKQNQQHPYKPPKLP  119

Query  768   GNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
              NF       K++  G+   +Y YKE +HP +FL      +++ +E +  + + LV+++ 
Sbjct  120   LNFAV-----KVLGFGLFIGLYDYKELIHPNIFLGVLCCQVFLFIEIVFSLCNSLVKSMV  174

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +E+E P DEP+LSTSLQDFWGRRWN+MVTN+LR  VY P++S + + +   L+ LPAV+
Sbjct  175   GLEVEQPSDEPYLSTSLQDFWGRRWNLMVTNLLRQIVYKPMKSAAEKVVSRQLSPLPAVV  234

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+FVVSG++HEL+FY + RA+P+ E+  FF+++G CV +EIG+K    G++RL   VS P
Sbjct  235   ATFVVSGLVHELLFYYVIRASPSWEMTCFFVLHGLCVVVEIGLKSLFSGRWRLHWAVSAP  294

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             L +  V++TSFWLFFPP  R     +   E   F E V
Sbjct  295   LTVGFVMVTSFWLFFPPLIRAGVIDRVVGEIKFFFELV  332



>gb|KHN32969.1| Long-chain-alcohol O-fatty-acyltransferase [Glycine soja]
Length=331

 Score =   243 bits (619),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 144/297 (48%), Positives = 193/297 (65%), Gaps = 16/297 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI N IMVWT     +CYCH I  L P+ + +R  A+FP   + L+LPL L SIHL 
Sbjct  3     MEGEIKNLIMVWTIAPATMCYCHRIGKLIPEGT-SRLIALFPAIVILLLLPLRLISIHLG  61

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR-------RKKVA  769
             G S+FF+GWL +FKL LFA  +GPLSS P L LS F+P AC PIK Q        +KK  
Sbjct  62    GPSSFFLGWLSTFKLILFAFGKGPLSSNPSLSLSHFVPVACFPIKFQNDPKDQIPKKKHK  121

Query  768   GNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
                 ++ S   +++L  +  +Y  KE+ HPK  L  + +H+YI LEF+  M+S L   + 
Sbjct  122   SPLNYA-STSMVIILAALIPIYGKKEYFHPKFVLFLYGLHMYIGLEFIFAMISALTTKLI  180

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              V+LE  F+EP+L TSLQDFWG+RWN+MV  +L PTVY+PV ++SAR L    A LPA++
Sbjct  181   GVQLEPQFNEPYLCTSLQDFWGKRWNIMVNRVLHPTVYEPVMNLSARALGRKWAPLPAIL  240

Query  408   ASFVVSGIMHELVFYNIGRAT-------PTGEVMSFFLVNGACVALEIGVKRAVDGK  259
             ASF VSG+MHELVFY I R         P+ +   FFL++G CVA+E+G+K+++ GK
Sbjct  241   ASFAVSGLMHELVFYYIKREKRTWEAWEPSWDATCFFLIHGVCVAMEVGIKKSLRGK  297



>ref|XP_002876112.1| hypothetical protein ARALYDRAFT_485556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52371.1| hypothetical protein ARALYDRAFT_485556 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 200/326 (61%), Gaps = 8/326 (2%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFF  910
             +FI  W  V+  LCY   I  L PK    R   IFPV  +F ++P  ++SIH+ G +AFF
Sbjct  3     SFIKAWGLVIISLCYTFFIAKLVPK-GIKRLILIFPVVLIFFIVPFLISSIHILGITAFF  61

Query  909   IGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKKVAGNFKFSG-----  748
             I WL +FKL LFAL RGPLSS P       F+  +CLPIK+Q R K   +    G     
Sbjct  62    IAWLANFKLVLFALGRGPLSSNPKPLSLPIFLAVSCLPIKIQPRPKPPNSHSHGGFGPLI  121

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K V L ++  VY Y   L  KV L  + IH+YI LE +L   + +VRA+  +ELE  
Sbjct  122   YTIKAVFLVLLIKVYEYNNKLPEKVVLTLYAIHIYIALELILAATAAVVRAMSDLELEPQ  181

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F++P+L+TSLQDFWGRRWN+MVT ILRPTVY+P+  + +   P + +  PA   +FVVSG
Sbjct  182   FNKPYLATSLQDFWGRRWNLMVTGILRPTVYEPLLQLFSVLGP-NFSQFPAAFGTFVVSG  240

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVI  208
             IMHEL+F+ +GR  P  ++M FFL+NG C  +EI +K+ ++G++R+P ++S  L L  V+
Sbjct  241   IMHELIFFYMGRLRPDWKMMWFFLINGFCTTVEITIKKTINGRWRIPKVISRVLTLGFVM  300

Query  207   LTSFWLFFPPYFRNKGDTKACAESLA  130
             +T+ WLF P + R     +A  E  A
Sbjct  301   VTALWLFLPEFNRCNIIERALDEYAA  326



>ref|XP_004516471.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Cicer arietinum]
Length=369

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 208/365 (57%), Gaps = 33/365 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME  + N I V+  V+  L YC+ I   F +P   R     P+ CL L +PL  +S+HL 
Sbjct  1     MESNMLNLIKVYPLVIISLYYCYWIRT-FVQPGTKRLTCFLPIICLNLFIPLTFSSVHLT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK----------  778
             GT  FF  WL +FKL  FA  +GPLSS   + L  F+  ACLPIK+Q++K          
Sbjct  60    GTLGFFFAWLTNFKLLCFAFNKGPLSSDSSISLPLFLALACLPIKIQQKKYSHDQNGKTK  119

Query  777   ---------KVAGNFKFSGSLR-------------KlvllgvvflvyyYKEFLHPKVFLL  664
                        + NF+   S +             K +LLGV+  +Y Y +++HPK+   
Sbjct  120   TPSQDLLDSSKSSNFETKKSSKTLFKSTPFLQYAIKGILLGVLVKIYDYSDYIHPKIIWG  179

Query  663   FFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRP  484
              +  H+Y  LE ML  ++ L +    +ELE  F+ P +STSLQDFWGRRWN++VT+ILRP
Sbjct  180   MYCFHVYFTLEIMLATIALLAQKTLGLELEPQFNNPIISTSLQDFWGRRWNLIVTSILRP  239

Query  483   TVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGA  304
             TVY+P    +   +    A LPAV+ +FVVSG+MHEL+ + +GR  PT ++M FF+++G 
Sbjct  240   TVYEPTLKAAKNVIGPKWAPLPAVLGTFVVSGLMHELILFYLGRLEPTFKMMGFFVLHGV  299

Query  303   CVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFI  124
             C+ +EIG+K+ V  ++RLP +VS PL +  V  T FWLF P + R + D KA  E  A  
Sbjct  300   CLTVEIGLKKFVTDRWRLPKLVSRPLTVGFVFATCFWLFLPEFIRCRLDVKAFEEYAALG  359

Query  123   EFVIN  109
              +V N
Sbjct  360   AYVRN  364



>gb|KHM99510.1| Putative long-chain-alcohol O-fatty-acyltransferase 1 [Glycine 
soja]
Length=356

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/347 (41%), Positives = 217/347 (63%), Gaps = 9/347 (3%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
             +K +  EI  FI VW + + CLCYC+ I    PK  F R  ++ P+ C+F++LPL+L+S 
Sbjct  4     EKMLGDEIERFIRVWISAILCLCYCYYIASRIPK-GFLRLLSLLPIFCIFIILPLSLSSP  62

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK  757
             +L G ++FF+ WLG FKL LF+  +GPL+      +  FI  A LPI +++      N  
Sbjct  63    NLVGFTSFFLVWLGIFKLLLFSFNQGPLALISSPNIVHFIFIASLPINLKQHPTTNVNIN  122

Query  756   FSGSLRKl-------vllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
              + + +         +LLG++  V  YKE LHP+  L+ +  +LY+ LE +L +++ LV+
Sbjct  123   TNSTQKPKWLLALKVLLLGLIIRVSDYKENLHPRFMLVLYYCYLYLGLEIVLVLIAALVQ  182

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
              V   E++  F++P+L TSLQDFWGRRWN+++T ILRPT+YDPVR +S  F+    A+  
Sbjct  183   TVLGFEIQPLFNKPYLCTSLQDFWGRRWNLIITRILRPTIYDPVRRMSTCFVGPLCATSA  242

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGI  241
             A++ +F+VSG+MHEL++Y + R  PT EV  FF++ G C  +E+ VK+A+  + +RL   
Sbjct  243   AMLTTFLVSGLMHELMYYYLTRVPPTWEVTCFFVLQGMCTVVEVVVKKAMLHRGWRLHRA  302

Query  240   VSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
             VSGPL + ++ +  +WLFFP   RN  D KA  E    + FV++ RL
Sbjct  303   VSGPLMVVILAVPGWWLFFPQLLRNGVDRKATEEYEILVYFVVHSRL  349



>ref|XP_003530769.2| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1-like [Glycine max]
Length=356

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/347 (41%), Positives = 217/347 (63%), Gaps = 9/347 (3%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
             +K +  EI  FI VW + + CLCYC+ I    PK  F R  ++ P+ C+F++LPL+L+S 
Sbjct  4     EKMLGDEIERFIRVWISAILCLCYCYYIASRIPK-GFLRLLSLLPIFCIFIILPLSLSSP  62

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK  757
             +L G ++FF+ WLG FKL LF+  +GPL+      +  FI  A LPI +++      N  
Sbjct  63    NLVGFTSFFLVWLGIFKLLLFSFNQGPLALISSPNIVHFIFIASLPINLKQHPTTNVNIN  122

Query  756   FSGSLRKl-------vllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVR  598
              + + +         +LLG++  V  YKE LHP+  L+ +  +LY+ LE +L +++ LV+
Sbjct  123   TNSTQKPKWLLALKVLLLGLIIRVSDYKENLHPRFMLVLYYCYLYLGLEIVLVLIAALVQ  182

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
              V   E++  F++P+L TSLQDFWGRRWN+++T ILRPT+YDPVR +S  F+    A+  
Sbjct  183   TVLGFEIQPLFNKPYLCTSLQDFWGRRWNLIITRILRPTIYDPVRRMSTCFVGPLCATST  242

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGI  241
             A++ +F+VSG+MHEL++Y + R  PT EV  FF++ G C  +E+ VK+A+  + +RL   
Sbjct  243   AMLTTFLVSGLMHELMYYYLTRVPPTWEVTCFFVLQGMCTVVEVVVKKAMLHRGWRLHRA  302

Query  240   VSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
             VSGPL + ++ +  +WLFFP   RN  D KA  E    + FV++ RL
Sbjct  303   VSGPLMVVILAVPGWWLFFPQLLRNGVDRKATEEYEILVYFVVHSRL  349



>emb|CDP13765.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 215/347 (62%), Gaps = 17/347 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ EI +FI VW   +  L Y + +    P     R  ++ P+  LF+ LPL+LTS HL 
Sbjct  1     MDAEIQSFIKVWFVAITSLFYSYFLVQRIPT-GLPRLVSLLPIIYLFITLPLSLTSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ-----------RR  781
               +AF++ WLG+FKL LF+  + PL+S PPLPL  FI  A LPIK +            +
Sbjct  60    APTAFYLLWLGNFKLLLFSFNQCPLASNPPLPLLHFISIALLPIKTKTNLQPNSSSKNSK  119

Query  780   KKVAGNFKFSGSLR-----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFM  616
             ++ + +FK SG        K +LL  + ++Y Y++ LH  V    +  HLY+ ++  L +
Sbjct  120   EQDSPHFKISGRALLVFGIKFLLLAKIIVIYQYRDQLHQSVIFALYCCHLYLGVDLCLAI  179

Query  615   VSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPE  436
              +  VRA+  +  E  F++P+L+TSLQDFWGRRWN+MVT+ILRPTVY+P+R  S   +  
Sbjct  180   TAVPVRAILGLGTEPQFNQPYLATSLQDFWGRRWNLMVTSILRPTVYNPIRRSSTPIVGR  239

Query  435   SLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKF  256
               + +PAV+A+F+VSG+MHE+++Y   RA+PT EV  FF+++G CV  EI VK+A +G+ 
Sbjct  240   KWSLVPAVLATFLVSGLMHEVIYYYQSRASPTWEVTWFFVLHGVCVVAEIAVKKAFNGRR  299

Query  255   RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +LP +VSGPL +  V +T  WLFFP   R++ D KA  ES  ++  +
Sbjct  300   QLPRVVSGPLTIGFVAITGAWLFFPQVIRHRLDVKAIKESYIWLRLL  346



>ref|XP_011025481.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Populus euphratica]
Length=348

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/338 (42%), Positives = 199/338 (59%), Gaps = 9/338 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI N I    +VL  L YCH I+   PK    R  ++ P+   F+ LPL  + +   
Sbjct  1     MEGEIKNLIKASVSVLASLIYCHFISSKIPKGKL-RLVSLLPIFYHFITLPLYFSYLFPN  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               ++ FI WL +FKL LFA   GPLS      L  FI  A LPIK+++ +K   +     
Sbjct  60    AIASLFISWLANFKLALFAFDHGPLSCDQSNSLLQFISKALLPIKIKQNEKYPSSQTPQN  119

Query  747   SLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
             S +       K++L  +   V  YK+  H K+ L  +   +Y+ ++ +  + +  V A+ 
Sbjct  120   SPKLALNLATKVLLFTISVGVNDYKDRFHQKLVLALYCCMVYLSVDIIFGVFNATVHAIL  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +ELE P +EP+LSTSLQDFWGRRWN+MVTN+LR TVY PVRS     L +  A LPAV 
Sbjct  180   HMELEPPSNEPYLSTSLQDFWGRRWNLMVTNLLRHTVYKPVRSSLGSLLGQ-WAPLPAVA  238

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             ASF+VSG+MHEL+FY + RA+P+ EV  FF++ G C+ +E+ +KR   G+++L   VSGP
Sbjct  239   ASFLVSGLMHELLFYRVTRASPSWEVTLFFVLQGVCLVVELAMKRWFGGRWQLHWAVSGP  298

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             L +  V++T+ WLFFPP  R+  D  A  E   +  FV
Sbjct  299   LTVGFVMMTAMWLFFPPLVRSGADEHAIEECKMYFHFV  336



>ref|XP_002311581.1| hypothetical protein POPTR_0008s14500g [Populus trichocarpa]
 gb|EEE88948.1| hypothetical protein POPTR_0008s14500g [Populus trichocarpa]
Length=348

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 202/338 (60%), Gaps = 9/338 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI N I    +VL  L YCH I+   PK    R  ++ P+  LF+ LPL  + +   
Sbjct  1     MEGEIKNLIKASLSVLASLIYCHFISSKIPKGKL-RLVSLLPIFYLFITLPLFFSYLFPN  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNF----  760
               ++ FI WL +FKL LFA   GPLS      L  FI  A LPIK+++ +K   +     
Sbjct  60    TIASLFISWLANFKLALFAFDHGPLSCDQSNSLLQFISKALLPIKIKQNEKYPSSQTPQN  119

Query  759   --KFSGSL-RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
               K + +L  K++L  +   V  YK   H K+ L  +   +Y++++ +  + +  V A+ 
Sbjct  120   PPKLALNLATKVLLFTISVGVNDYKGRFHQKLVLALYCCMVYLLVDIIFGVFNATVHAML  179

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +ELE P +EP+LSTSLQDFWGRRWN+MVTN+LR TVY PVRS     L E  A LPAV 
Sbjct  180   HMELEPPSNEPYLSTSLQDFWGRRWNLMVTNLLRHTVYKPVRSSLGSLLGE-WAPLPAVA  238

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             ASF+VSG+MHEL+FY + RA+P+ EV  FF++ G C+ +E+ +KR   G+++L   VSGP
Sbjct  239   ASFLVSGLMHELLFYRVTRASPSWEVTMFFVLQGVCLVVELAMKRWFGGRWQLHWAVSGP  298

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             L +  V++T+ WLFFPP  R+  D  A  E   F  FV
Sbjct  299   LTVGFVMMTAMWLFFPPLIRSGADEHAIEECKMFFHFV  336



>ref|XP_008461834.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Cucumis 
melo]
Length=352

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 150/344 (44%), Positives = 205/344 (60%), Gaps = 14/344 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI N   VW TV   L YCH    L   P   RF AI P+  LF +LPL LTSIH  
Sbjct  1     MEGEIVNLTKVWLTVCISLSYCHATGKLL-NPGVARFLAIAPIVLLFFLLPLQLTSIHFG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
             G + FF+ WL +FKL LF+   GPLS+TPPL L  FI  +CLPIK+     +K A     
Sbjct  60    GATCFFVTWLATFKLLLFSAGDGPLSTTPPLSLRRFIAISCLPIKILEHPSEKSAPTNNR  119

Query  753   SGSLR-----------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSG  607
             + +L            + +++ ++  +Y Y EFLHPK+ L  +  H+Y++LE +L +   
Sbjct  120   AQTLHEKPKSLLNYSIRALIVVLMVKLYDYSEFLHPKLVLFIYSWHVYLLLEIILAITQF  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
               R +  +ELE  F +P+ STSLQDFWGRRWN+M TNIL+P VY P   ++A+ +    A
Sbjct  180   FGRNLLGIELEPQFRDPYYSTSLQDFWGRRWNLMATNILQPAVYKPTVKMAAKVIGRMWA  239

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
              LP VMA+F+VS +MHEL+FY +GR  P  E+  FF+++G  + +EI +K+ +  K RLP
Sbjct  240   PLPGVMATFLVSAMMHELIFYYLGRMRPDWEITWFFVIHGIALTVEIMMKKMLPEKRRLP  299

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               VS P+ L  +  T+ WLFFP + R K D +A  E  A   FV
Sbjct  300   AKVSVPVTLVFIFSTAIWLFFPQFVRLKLDVRAFEEYAALANFV  343



>ref|XP_011097128.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Sesamum 
indicum]
Length=402

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 153/385 (40%), Positives = 216/385 (56%), Gaps = 45/385 (12%)
 Frame = -3

Query  1134  QSINLKKKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLP  955
             Q I + +   EGEI NFI VW  V+  L YC       P P  +RF A+ PV  L L+LP
Sbjct  4     QIIKVLEYWAEGEITNFIKVWALVVASLSYCFFAAKHLP-PGLSRFLALLPVLLLNLILP  62

Query  954   LNLTSIHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ----  787
             L L ++HL G+SAFF+ WL +FKL LFA  +GPLS         F   ACLPIK      
Sbjct  63    LTLHTMHLGGSSAFFLAWLANFKLLLFAFGKGPLSDPSVSLPR-FAALACLPIKSAGCVP  121

Query  786   -----------------------RRKKVAGNFKFSGS----------------LRKlvll  724
                                    RRK   G                       + K +L+
Sbjct  122   ILVADEKLVSLKKTDKSSESKTVRRKGSGGEVPIESQAASKTSKQGLKSMWNYVTKGLLI  181

Query  723   gvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLST  544
              +   +Y Y + +HPK+  + + +H+Y  LE +L +  GL +A+  +ELE  FDEP+LS 
Sbjct  182   CLFLKLYDYTDMIHPKLTWVLYSLHIYFGLEIILAIFGGLAKALVGIELEPQFDEPYLSA  241

Query  543   SLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFY  364
             SLQ+FWGRRWN+MVT ILRPTVY+PV   S   +    A LPAVM SF+VS +MHEL+F+
Sbjct  242   SLQEFWGRRWNIMVTRILRPTVYEPVLYFSTLIIGRKWAPLPAVMGSFLVSALMHELIFF  301

Query  363   NIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFF  184
              +GR  P+GE+  FF+++G C+A+E+ +K+A++G++RLP +++ PL +  V++T+FWLFF
Sbjct  302   YLGRRKPSGEITLFFMLHGVCLAIEVAIKKAINGRWRLPKLMAAPLTVGFVMVTAFWLFF  361

Query  183   PPYFRNKGDTKACAESLAFIEFVIN  109
             P + R     +A  E  A   FV +
Sbjct  362   PEFLRCDSLPRAINEYAAIASFVKD  386



>gb|KDO62162.1| hypothetical protein CISIN_1g037704mg [Citrus sinensis]
Length=365

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 215/349 (62%), Gaps = 17/349 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE  N + VW     CL YC+ I    P  + +R  ++ P+  L  +LPL L +IHL 
Sbjct  1     MDGEFKNLLQVWILTTTCLTYCYYIPSKIPSGT-SRLLSLLPIFYLLTILPLKLHTIHLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ------RRKKVAG  766
               +AF + WL +FKL LFA  +GPLS  P      FI  ACLPIK++       RKK+  
Sbjct  60    VFTAFLLVWLTNFKLLLFAFDQGPLSPPPSKLSH-FISIACLPIKLKTNNTNPSRKKMQK  118

Query  765   NFK-----FSGSLR---KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVS  610
               +     FS S     K+VL  V+   Y YK++LH K+ ++  ++++Y++LE +L + S
Sbjct  119   PLQKSFPIFSRSTLLAIKVVLFVVLLHAYKYKQYLHQKLIIIICMLYIYLLLETVLAVCS  178

Query  609   GLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL  430
              L +A+  +ELE  F+EP+LSTSLQDFWGRRWN+MVT+IL  TVYDPVR +S R + +  
Sbjct  179   ALAQAILGLELEPQFNEPYLSTSLQDFWGRRWNLMVTSILHSTVYDPVRRISTRLIDDKW  238

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFR  253
             A+LPAV+A+F VSG+MH++++  + RA PT E+ SFF+++G C+ +E+  KR + DG++R
Sbjct  239   AALPAVLATFAVSGVMHDIIYCYLTRAPPTWEMTSFFVLHGTCLTMELAAKRELTDGRWR  298

Query  252   LPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             L   VS  L L  ++++S WLF PP  R   + K   E L F   + N 
Sbjct  299   LHPAVSCLLLLVFLLMSSLWLFSPPLLRGGVNEKMMREVLTFANLIKNE  347



>ref|XP_006373630.1| hypothetical protein POPTR_0016s01630g [Populus trichocarpa]
 gb|ERP51427.1| hypothetical protein POPTR_0016s01630g [Populus trichocarpa]
Length=351

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 193/329 (59%), Gaps = 30/329 (9%)
 Frame = -3

Query  1011  SFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplp  832
              FTR   + P+ CLFLVLPL LTSIH  G +AFF+ WL +FKL LFA  +GPL   P + 
Sbjct  8     GFTRLLCVLPIVCLFLVLPLELTSIHFGGMTAFFVAWLANFKLLLFAFGKGPLCLDPKIS  67

Query  831   lsTFIPFACLPIKV--------------------------QRRKKV---AGNFK-FSGSL  742
                F+  AC PIK+                          Q R+K+    G  K F    
Sbjct  68    FGRFVSVACFPIKILQIPPQKPNLNGHSHENQAQKSLLNGQDRQKLISRKGPHKSFLNYA  127

Query  741   RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFD  562
              K +LL ++   Y Y +++HPK+  L + +H+Y  LE  L M++ +VR +  +ELE  F+
Sbjct  128   TKGLLLAMLVATYDYSDYIHPKIMWLLYCLHIYFFLETFLAMLASVVRTLSGLELEPQFN  187

Query  561   EPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIM  382
             +P+LSTSLQDFWGRRWN+MVT+ILRP  YDP+      F+    A   A++ +F+VS +M
Sbjct  188   DPYLSTSLQDFWGRRWNLMVTSILRPIAYDPILYTCKNFIGRRWAQGIAILGTFLVSALM  247

Query  381   HELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILT  202
             HEL+FY +GR  PT E+  FFL++G C+ +EI +KRAV+G+++ P  +   L +  VI T
Sbjct  248   HELIFYYLGRGKPTWEITWFFLLHGVCLPVEIVLKRAVNGRWQFPRPMQTILTIGFVIAT  307

Query  201   SFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              FWLFFPP+   K   +A  E  A  E++
Sbjct  308   GFWLFFPPFLACKAGVRAIEEYAAVREYL  336



>ref|XP_007146545.1| hypothetical protein PHAVU_006G049700g [Phaseolus vulgaris]
 gb|ESW18539.1| hypothetical protein PHAVU_006G049700g [Phaseolus vulgaris]
Length=336

 Score =   241 bits (614),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 205/332 (62%), Gaps = 6/332 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ EI  FI VW T + CLCYC+ I    PK  F R  ++ P+  LFL+LP NL+S HL 
Sbjct  2     MDVEIERFIKVWLTTISCLCYCYFIASKIPK-GFLRLLSLLPILYLFLILPFNLSSFHLG  60

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G + FF+ WL +FKL LF+  +GPL+ +P +    FI  A LPI + + K        S 
Sbjct  61    GPTTFFLVWLATFKLLLFSFNQGPLAQSPNILH--FISLASLPINLNQNKTKPK--PKSL  116

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
              L KL++L ++   Y Y++  HP   L+ +  H+Y+ +E +L + +  VR +    L+  
Sbjct  117   LLLKLLILALIIHAYDYRQNFHPLFILVLYCCHMYLGIELVLALTAIPVRTLLGFNLQPQ  176

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+LSTSLQDFWGRRWN+MVT ILRP V+ PV S+S RF+  S A   AV A+FVVSG
Sbjct  177   FNEPYLSTSLQDFWGRRWNLMVTGILRPAVFHPVYSISTRFVGPSCAFSSAVFATFVVSG  236

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGIVSGPLALTLV  211
             +MHEL++Y + RA PT EV  FF+++G C A E+ VK+ +  + +RL G VSGPL L  +
Sbjct  237   LMHELIYYYLTRAPPTWEVTCFFVLHGVCTAAEVAVKKVLLRRGWRLHGAVSGPLVLAFL  296

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               T  WLFFP   RN  D KA  E    + F+
Sbjct  297   AATGSWLFFPQLLRNGVDRKAIEEYATLVNFI  328



>emb|CBI26714.3| unnamed protein product [Vitis vinifera]
Length=611

 Score =   248 bits (632),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 142/323 (44%), Positives = 200/323 (62%), Gaps = 8/323 (2%)
 Frame = -3

Query  1068  TVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSF  889
             +VL  LCY + I    PK  F R  ++ P+  LF+ LPL L++  L+G +AFFI WL +F
Sbjct  261   SVLASLCYSYFIVSKIPKGKF-RLLSLLPIFSLFVALPLFLSTAILSGITAFFITWLATF  319

Query  888   KLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGSLR-------Klv  730
             +L LF+   GPLS+  P  L  FI  ACLPIK++  ++     +     R       K++
Sbjct  320   RLALFSFDLGPLSTGSPKSLLVFIAIACLPIKIKPNQQHPSRQEPHKPPRLPLNFAVKVL  379

Query  729   llgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHL  550
               GV    Y YKE +HPK+FL      +++ LE +  + S LVR    +E+E P DEP+L
Sbjct  380   AFGVFIGFYQYKELVHPKIFLGLLCCQVFLFLEVLFSLCSALVRCTMGLEVEQPSDEPYL  439

Query  549   STSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELV  370
             STSLQDFWGRRWN+MVTN+LR TVY PV+S +   + E  + LPAV+A+F+VSG+MHEL+
Sbjct  440   STSLQDFWGRRWNLMVTNLLRHTVYKPVKSAAETVMSERWSPLPAVVATFLVSGLMHELL  499

Query  369   FYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWL  190
             FY + R +P+ E+ SFF+++G C+ +E+GVK    G++RL    S PL +  V+ TSFWL
Sbjct  500   FYYVNRVSPSWEMTSFFVLHGVCLVVEVGVKSVFSGRWRLHWAASVPLTVGFVVATSFWL  559

Query  189   FFPPYFRNKGDTKACAESLAFIE  121
             FFPP  R   D +   E    +E
Sbjct  560   FFPPLIRAGADMRVMEEVKVLLE  582


 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 115/298 (39%), Positives = 165/298 (55%), Gaps = 43/298 (14%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEI + I VW + +  +CYC+      P   F R   + P+  LF++LPLNL+S HL 
Sbjct  1     MDGEIKSLIKVWISAISSICYCYFFVVRLPVGLF-RLLFLLPMFYLFIILPLNLSSAHLV  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGpls--stpplplsTFIPFACLPIKVQRRKKVAGNFKF  754
             GT+AF++ WL +FK  LF+   GPLS  S PP  +  FI  ACLPIK++       + K 
Sbjct  60    GTTAFYLAWLANFKFILFSFGHGPLSFPSHPPKSVLRFISIACLPIKIKTVPSPKSHSKV  119

Query  753   SGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELE  574
             +  L K + L  +  VY Y++FLHP V L  +  H+Y+  E +L + +   RA+  +ELE
Sbjct  120   AF-LIKALALAALLKVYKYRQFLHPNVILALYCCHVYLAAELILALAAAPARAI-GLELE  177

Query  573   APFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVV  394
               F+EP+L+TSLQDFWGRRWN+MV++ILRPT+Y P+                        
Sbjct  178   PQFNEPYLATSLQDFWGRRWNLMVSSILRPTIYFPI------------------------  213

Query  393   SGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
                            TPT EV  FF++ G C A E+  K+A  G+++LP  V+ PL +
Sbjct  214   --------------LTPTWEVTWFFVLQGVCTAAEVAAKKAAAGRWQLPPAVTRPLTV  257



>emb|CAN61366.1| hypothetical protein VITISV_020586 [Vitis vinifera]
Length=2238

 Score =   257 bits (657),  Expect = 8e-72, Method: Composition-based stats.
 Identities = 142/323 (44%), Positives = 193/323 (60%), Gaps = 19/323 (6%)
 Frame = -3

Query  1002  RFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLFALCRGplsstp--plpl  829
             R   + P+  LF++LPLNL+S HL GT+AF++ WL +FK  LF+   GPLS        L
Sbjct  1909  RLLFLLPMFYLFIILPLNLSSAHLVGTTAFYLAWLANFKFILFSFGHGPLSFPSHPTKSL  1968

Query  828   sTFIPFACLPIKVQ-----RRKKVAGN---------FKFSGSLR---Klvllgvvflvyy  700
               FI  ACLPIK++     +   V+ N          K    L    K +L  ++  +Y 
Sbjct  1969  LRFISIACLPIKIKTVPSPKSHSVSENSTDPLSEIVMKLPRPLLLAIKALLFAILIRIYN  2028

Query  699   YKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGR  520
             YK  LHP V L  +  H+Y+ LE +  M +   RA+   ELE  F+EP+L+TSLQDFWGR
Sbjct  2029  YKRHLHPNVVLFLYCCHMYLALEIVQAMAAIPARAIPGFELEPQFNEPYLTTSLQDFWGR  2088

Query  519   RWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPT  340
             RWN+ VTNILRPTVYDPVRS+  R L +  A +P V+A+F+VSG+MHE ++Y I R +PT
Sbjct  2089  RWNLSVTNILRPTVYDPVRSICTRILGKEWAPVPGVLAAFLVSGLMHESLYYYITRVSPT  2148

Query  339   GEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKG  160
              EV  FF++ G C   E+ VK+A+ G++RL   VSGPL +  V +T+ WLFFP   RN  
Sbjct  2149  WEVTGFFVLQGLCTVSEVVVKKALGGRWRLHRAVSGPLTIGFVCVTADWLFFPQLLRNHI  2208

Query  159   DTKACAESLAFIEFVINHRLVSP  91
             D +A  E    ++FV    L  P
Sbjct  2209  DERAIREYSILVDFVKQKFLTLP  2231



>ref|XP_004500120.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Cicer 
arietinum]
Length=344

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 205/337 (61%), Gaps = 8/337 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEI  FI VW T   CLCYC+ I+   PK  F R  +I P+  LFL+LPLNL+S HL 
Sbjct  1     MDGEIERFIKVWITSTTCLCYCYYISSKIPK-GFLRLLSILPILYLFLILPLNLSSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               + FF+ WL +FKL LF+  + PL   P      FI  A LPI  Q   +     K+  
Sbjct  60    APTTFFLVWLSTFKLILFSFNQPPLFPLPNNIFH-FISIASLPIYPQPPNQNQNTKKYKK  118

Query  747   -----SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                  +  K+V+L  +   Y+Y+E +HP + L+ +  H+Y+ LE +L + +  VR VF  
Sbjct  119   PNLPFTCLKVVILATIICCYHYREHIHPNLILILYCCHMYLGLELVLALSAAPVRTVFGF  178

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             E+E  F+EP+LSTSLQDFWGRRWN+MVT +LRP VY+PVR VS  F+    A+  A +A+
Sbjct  179   EIEPQFNEPYLSTSLQDFWGRRWNLMVTRVLRPAVYNPVRHVSNFFVGPMFAASVATLAT  238

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGIVSGPL  226
             FVVSG+MHE+++Y + R  PT EV  FF+++G C ++E+ VK+ V  + ++L   VSG  
Sbjct  239   FVVSGLMHEVIYYYLARVPPTWEVTWFFVLHGVCTSVEVVVKKVVLRRGWKLHRAVSGLF  298

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              +  + +T  WLFFP   RN  D KA  E    ++FV
Sbjct  299   TVAFLAVTGNWLFFPQLVRNGVDKKAIQEYTIMVDFV  335



>gb|EYU33682.1| hypothetical protein MIMGU_mgv1a024355mg [Erythranthe guttata]
Length=337

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/326 (45%), Positives = 200/326 (61%), Gaps = 8/326 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI NFI +W T    L +CH I    P  +  R  ++ PV  +F  LPL L S+HL 
Sbjct  1     MEIEIQNFITIWLTATASLIFCHQIAARIPGGA-ARLLSVLPVIYIFTALPLRLNSVHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNF--KF  754
             G + F++ WLG+FKL LF+  +GPL S PPL L  F+     PIK ++   +  N   + 
Sbjct  60    GPTVFYLVWLGNFKLLLFSFNQGPLVSNPPLSLLHFVSIGLFPIKPKQTLTLTPNSERRI  119

Query  753   SGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELE  574
                L K VLL  V   Y Y+E +HP   L+ +  H+Y+ +E ML + +  VRAV  +E+E
Sbjct  120   FLLLVKCVLLAGVVYSYNYREIIHPYFILVLYCCHVYLGVELMLAVTAAPVRAVLGLEIE  179

Query  573   APFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVV  394
               FDEP+L+TSLQDFWGRRWN+MV+ ILR TVY PVR    R +    +   A+ A+F+V
Sbjct  180   PQFDEPYLATSLQDFWGRRWNLMVSAILRHTVYHPVR----RVVGGRWSQAAAIAATFLV  235

Query  393   SGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGIVSGPLALT  217
             SG+MHE+V+Y + RA PT EV  FF+++G CVA+E+G+K+A   + +RL   VSGPL + 
Sbjct  236   SGLMHEVVYYYLTRAVPTWEVTWFFVLHGVCVAVEVGMKKAALRRGWRLHRAVSGPLTVG  295

Query  216   LVILTSFWLFFPPYFRNKGDTKACAE  139
                +TS WLFFP   R+  D KA  E
Sbjct  296   FAAVTSGWLFFPQVIRSGLDLKAIDE  321



>ref|XP_008227051.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Prunus mume]
Length=357

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 147/344 (43%), Positives = 213/344 (62%), Gaps = 14/344 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI   I V  ++L  LCY + I    PK    RFF++ P+ CLF +LPL L++   A
Sbjct  3     MEDEIKRLIKVCLSILASLCYTYFIASKIPKGKL-RFFSLLPIFCLFTILPLFLSTALPA  61

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstp-plplsTFIPFACLPIKV----QRRKKVAGN  763
             G  A FI W+GSFKL LF+   GPLSS P    L  FI  ACLPIK     Q+  ++A N
Sbjct  62    GVIALFITWVGSFKLLLFSFGLGPLSSGPPLNSLLLFIFTACLPIKAKQDGQQHHQIAPN  121

Query  762   FKFSGSLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGL  604
              K   + +       K++L G++  +  + +++HP + L  +   LY+ ++ ++ + +  
Sbjct  122   HKTPQNPKFPLNLPTKVLLFGILVALTDFTKYVHPNILLGQYCCMLYLFVDIIVGLSNAT  181

Query  603   VRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLAS  424
             +RA+  V+LE+P +EP+LSTSLQDFWGRRWN+MVTN LR TV+ PV+     FL    A 
Sbjct  182   LRALLGVQLESPSNEPYLSTSLQDFWGRRWNLMVTNTLRHTVHKPVQLAMENFLGPKWAQ  241

Query  423   LPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVD-GKFRLP  247
             LPAV  +F+VSG+MHEL+F+ + R  PT EV  +F+++G C+ +E GVKRA+  G+++L 
Sbjct  242   LPAVFVAFLVSGLMHELIFFYMTRVPPTWEVTWYFVLHGMCLVVEFGVKRALSGGRWQLH  301

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              IVS PL +  V++T+ WLFFPP  RN  D +A  E    + F+
Sbjct  302   WIVSMPLTIGFVVVTASWLFFPPLVRNGVDARAIEECKELVVFM  345



>ref|XP_004241733.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Solanum 
lycopersicum]
Length=353

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 141/344 (41%), Positives = 204/344 (59%), Gaps = 12/344 (3%)
 Frame = -3

Query  1098  EINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTS  919
             E+ NFI VW   +  LCYC+      P     R   + P+   FL+LPL+L+S HL   +
Sbjct  6     ELQNFIRVWFAAIGALCYCYYCVTRIPS-GVLRLLFVLPIVYFFLILPLDLSSFHLGAPT  64

Query  918   AFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIK----VQRRKKVAGNFKFS  751
              F++ WL +FKL LF   RGPLSS   LPL  F+  A LP+K    ++   K++      
Sbjct  65    IFYLVWLANFKLLLFCFDRGPLSSYSSLPLLHFLSIALLPVKPTYIIRDGFKISSTQSVQ  124

Query  750   GSLR-------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
              + R       K++LL  +  VY Y+E LH  V L+ + +H+Y+ +E +L +    VRA+
Sbjct  125   STERAPGLFWGKIILLAAIIRVYNYRELLHSNVILVLYCLHIYLAVELILAITVIPVRAL  184

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
               +E+E  F++P+++TSLQDFWGRRWN+MV  ILRP VY PVR +    L + LASLPA+
Sbjct  185   LGLEIEPQFNDPYIATSLQDFWGRRWNLMVPGILRPAVYFPVRGILTSSLGKELASLPAI  244

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
              A+F+VSG+MHEL++Y + R  PT EV  FF+++G CV +E+ VK+   G +++  +VSG
Sbjct  245   FATFLVSGLMHELIYYYLSRVRPTWEVTWFFVLHGICVCIEVTVKKFFHGGWQMNRVVSG  304

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
              + L  V  T  WLFFP   RN  D KA  E    ++ V +  L
Sbjct  305   VVTLAFVAWTGDWLFFPQIIRNGLDQKAINEYYVMVDLVKDRLL  348



>ref|XP_006452482.1| hypothetical protein CICLE_v10008789mg [Citrus clementina]
 gb|ESR65722.1| hypothetical protein CICLE_v10008789mg [Citrus clementina]
Length=351

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 208/348 (60%), Gaps = 19/348 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M GE+ N I VW   + CL YC+ I   FPK    R  ++FPV  LF++LPLNL+SIH  
Sbjct  1     MGGELKNLIKVWILAISCLSYCYLIASKFPK-GLLRLISLFPVFYLFIILPLNLSSIHFC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ-----------RR  781
             G ++FF+ WL +FKL LFA  +GPLSS     L  FI  ACLPIK +            +
Sbjct  60    GVTSFFLVWLANFKLLLFAFDQGPLSSQLHHKLFHFILVACLPIKFKPNPPQGIVTKPHQ  119

Query  780   KKVAGNFK----FSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMV  613
             +    +++        + KL+LL  +F  Y Y++ LH  V L  +  H+Y+ LE +L + 
Sbjct  120   QSTQKSYRVPLKSLLLVTKLLLLLSIFHAYEYRQHLHQYVVLALYCCHIYLELELVLALC  179

Query  612   SGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARF-LPE  436
             S   R V    LE  F+EP+L+TSLQDFWGRRWN+MVT+ILRPTVYDPV+ +  R  +  
Sbjct  180   STPAR-VLGFALEPQFNEPYLATSLQDFWGRRWNLMVTSILRPTVYDPVQYICRRNKVGH  238

Query  435   SLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKF  256
                 L  V+A+F+VSG+MHE+++Y + R  P+ EV  FF+++G CVA+E+ +K+ +  + 
Sbjct  239   MWPQLLGVVATFIVSGLMHEVIYYYLTRVPPSWEVTWFFVLHGVCVAIEVWLKKKLIKRC  298

Query  255   -RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              RLP  VSG L L  V  T  WLFF   FRNK + K   E    ++FV
Sbjct  299   GRLPRAVSGALVLIFVAATGLWLFFAQIFRNKLEEKVITEVFFSLDFV  346



>ref|XP_006474976.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1-like [Citrus sinensis]
 gb|KDO62161.1| hypothetical protein CISIN_1g018738mg [Citrus sinensis]
Length=351

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 208/348 (60%), Gaps = 19/348 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M GE+ N I VW   + CL YC+ I   FPK    R  ++FPV  LF++LPLNL+SIH  
Sbjct  1     MGGELKNLIKVWILAISCLSYCYLIASKFPK-GLLRLISLFPVFYLFIILPLNLSSIHFC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ-----------RR  781
             G ++FF+ WL +FKL LFA  +GPLSS     L  FI  ACLPIK +            +
Sbjct  60    GVTSFFLVWLANFKLLLFAFDQGPLSSQLHHKLFHFILVACLPIKFKPNPPQGIVTKPHQ  119

Query  780   KKVAGNFK----FSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMV  613
             +    +++        + KL+LL  +F  Y Y++ LH  V L  +  H+Y+ LE +L + 
Sbjct  120   QSTQKSYQVPLKSLLLVTKLLLLLSIFYAYEYRQHLHQYVVLALYCCHVYLELELILALC  179

Query  612   SGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARF-LPE  436
             S   R V    LE  F+EP+L+TSLQDFWGRRWN+MVT+ILRPTVYDPV+ +  R  +  
Sbjct  180   STPAR-VLGFALEPQFNEPYLATSLQDFWGRRWNLMVTSILRPTVYDPVQYICRRNKVGH  238

Query  435   SLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKF  256
                 L  V+A+F+VSG+MHE+++Y + R  P+ EV  FF+++G CVA+E+ +K+ +  + 
Sbjct  239   MWPQLLGVVATFIVSGLMHEVIYYYLTRVPPSWEVTWFFVLHGVCVAIEVWLKKKLIKRC  298

Query  255   -RLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              RLP  VSG L L  V  T  WLFF   FRNK + K   E    ++FV
Sbjct  299   GRLPRAVSGALVLIFVAATGLWLFFAQIFRNKLEEKVITEVFFSLDFV  346



>gb|EPS66090.1| wax synthase isoform 2, partial [Genlisea aurea]
Length=334

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 206/330 (62%), Gaps = 13/330 (4%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
             + E  +FI VW T +  L YC  I G     +  R  A+ PV CLFL+LPL L+S+HL+G
Sbjct  1     DSEFESFIKVWLTAVASLIYCQQIAGRIHGGA-VRLIAVLPVVCLFLILPLRLSSVHLSG  59

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR------KKVAGN  763
              + F++ WL +FKL LFA   GPL+  PPLPL  F+    LPIK  ++      +K    
Sbjct  60    PTVFYLVWLANFKLLLFAFDAGPLAGDPPLPLIQFVSIGLLPIKPLQKSPSRFDQKSPTG  119

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
             F+F   L K + L  +  +Y Y+EFL+P + L+ +  ++Y+ ++ +L + +  VRA+   
Sbjct  120   FQF---LVKSLALVAIVWLYRYREFLNPFLILILYCGNVYLGVDLILAVTAAPVRAL-GF  175

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             E+E  FDEP+LSTSLQDFWGRRWN+MVT ILRP+VY PVR +++ ++ +      AV+A+
Sbjct  176   EIEPQFDEPYLSTSLQDFWGRRWNLMVTGILRPSVYFPVRRLTSPYVGKKWGQRAAVLAT  235

Query  402   FVVSGIMHELVFYNI-GRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFRLPGIVSGP  229
             F VSG+MHEL++Y +  RA PT EV  FFL++G C+A+E  VK AV DG  R+P   S  
Sbjct  236   FAVSGLMHELIYYYLTARARPTWEVTWFFLLHGVCLAVEGAVKTAVGDGGLRIPTAASRL  295

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             L +   ++T  WLFFP   RN  D +A  E
Sbjct  296   LTVGFAVVTCGWLFFPQLTRNGVDARAIEE  325



>ref|XP_009335432.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1 [Pyrus x bretschneideri]
Length=371

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 209/363 (58%), Gaps = 32/363 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI VW      LCYC  I    PK   TRF ++ P+   F++LPLNL S+ L 
Sbjct  1     MEGEIHNFIKVWILANVSLCYCFYIASRIPK-GITRFISLLPIFYQFIILPLNLHSVILC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             G + FF+ WLG+FKL LF++  GPLS  PP     FI   CLPI++++            
Sbjct  60    GLTTFFLVWLGNFKLLLFSVDLGPLSPPPPTLFQ-FISIGCLPIQIKQNPPQESPQNTNP  118

Query  780   ----------------KKVAGNFKFSGSLR-KlvllgvvflvyyYKEFLHPKVFLLFFVI  652
                             + V    K S +L  K +L  +V   + YK+ LHP V    +  
Sbjct  119   PQQTTQNPTRSENAVVQTVTNVPKNSLTLAIKALLFDLVIRSFEYKQHLHPYVISALYYC  178

Query  651   HLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYD  472
              +Y+ LE +L + +   RA FR ELE  F++PHLSTSLQDFW RRWN+MVT ILRP++Y 
Sbjct  179   LMYLALEIVLALGATPARAFFRFELEPQFNKPHLSTSLQDFWSRRWNIMVTKILRPSMYY  238

Query  471   PVRSVSARFL-PESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             PVR +    L P S  +L AVM++F VSG+MHE+++Y + R  PT EV  FF+++G  + 
Sbjct  239   PVRRICTPILGPRSARNL-AVMSTFTVSGLMHEVIYYYLTRVPPTWEVTWFFVLHGMSMV  297

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +E+ VK+A   ++RL  +VSGP  L  +++T+ WLFFP   RN    KA  E     +FV
Sbjct  298   IEVEVKKAAVNRWRLHRLVSGPSTLVFLVVTANWLFFPQQLRNGIYIKAANEHAIVQDFV  357

Query  114   INH  106
              +H
Sbjct  358   KSH  360



>gb|KEH17665.1| membrane-bound O-acyltransferase family MBOAT protein [Medicago 
truncatula]
Length=363

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 197/359 (55%), Gaps = 27/359 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME  + N I V   V+  L YC+ I+  F  P   R   + P+  L L +PL  TS+HL 
Sbjct  1     MESNMLNLIKVCPIVIISLSYCYLIHK-FVSPGTKRLICLLPIIFLNLFIPLTFTSVHLT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             GT  FF  WL +FKL LFA   GPLSS   + L+ FI  ACLPIK+Q+            
Sbjct  60    GTLGFFFAWLANFKLLLFAFNIGPLSSDSSISLTRFIALACLPIKIQQNPPKKHHQNLTN  119

Query  780   ---------------KKVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHL  646
                            K    N  F     K VLL ++  +Y Y + +HPK+ L  +  H+
Sbjct  120   GSKNSDFETETKPTSKTSNTNTPFLQYAIKFVLLAILVKIYDYSDQIHPKIILGMYCFHI  179

Query  645   YIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPV  466
             Y +LE +L +V+ L R +  +ELE  F+ P LSTSLQDFWGRRWN+MVT+ILRPTVY+P 
Sbjct  180   YFLLEIILAIVATLARTILGLELEPQFNNPILSTSLQDFWGRRWNLMVTSILRPTVYEPT  239

Query  465   RSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEI  286
                +   +    A LPAV  +FVVSG+MHEL+ Y +GR  PT  +  FF+ +G C+ +EI
Sbjct  240   LKAAKNIVGPKWAPLPAVFGTFVVSGLMHELILYYMGRLEPTLRMFGFFVFHGVCLTVEI  299

Query  285   GVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
              +KR    +++LP  VSG L    V  T FWLF P + R + D +A  E  A   FV N
Sbjct  300   ALKRCFTARWQLPRFVSGFLTAGFVFATCFWLFLPEFIRCRLDVRAFEEYAALGVFVKN  358



>emb|CDP02707.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 210/338 (62%), Gaps = 10/338 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI +FI VW  V+  L YC++++   PK   +R     PV  L L+LPLNL ++HL 
Sbjct  1     MEGEIKSFIKVWLLVIASLSYCYSVSRNVPKGP-SRLLTTLPVVFLNLLLPLNLHTLHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
              +SAFF+ WL +FKL +FA  +GPLS +           ACLPIK + +   +      G
Sbjct  60    VSSAFFLAWLCNFKLLMFAFGKGPLSDSSLSLSHFLA-LACLPIKARHQNNPSTKTTQKG  118

Query  747   --SLR----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
               SL     KL+L+ +    Y Y++ +HPK+ L+ + IH+Y+ LE +L +V GL RA   
Sbjct  119   LKSLWNYGIKLLLIPLFLKAYDYEDHIHPKLTLVVYAIHIYVGLETLLAIVGGLARASLG  178

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
             +ELE  FDEP+LSTSLQDFWGRRWN+MVT  LRP+VY P  ++S R      A LPA++A
Sbjct  179   IELEPQFDEPYLSTSLQDFWGRRWNIMVTRALRPSVYLPALNLSQRLTGRKWAPLPAILA  238

Query  405   SFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVK--RAVDGKFRLPGIVSG  232
             +F+ S +MHEL+F+ +GR  PT E+  FFL++G C+ +E+ +K  R + G+  LP I++ 
Sbjct  239   TFIASAVMHELIFFYMGRRWPTWEISCFFLLHGVCLVVEVALKKYRGLSGERGLPRIIAA  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             PL +  V++T FWLFFP + R+    +A  E  A   F
Sbjct  299   PLTVGFVMVTGFWLFFPEFLRSNAMVRASREYEAMGAF  336



>ref|XP_009364640.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009364641.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Pyrus 
x bretschneideri]
Length=367

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 208/358 (58%), Gaps = 25/358 (7%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI NFI V       LCYC  I+   PK    R  ++ P+  LF++LPLNL S HL 
Sbjct  1     MEDEIYNFIKVCFLANISLCYCFYISSRIPK-GILRLISLLPILYLFILLPLNLHSFHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR--KKVAGNFKF  754
               + F + WL +FKL LF+   GPLSS PPL L  FI  A LPIK+++   +K   N   
Sbjct  60    APTTFLLVWLATFKLLLFSFDHGPLSSPPPLTLFQFISLAILPIKIKQNPTQKSPPNQNP  119

Query  753   SGSLR----------------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYI  640
                +                       K +LL +V   Y+Y++ LHP V L     HLY+
Sbjct  120   DHKIPPNPTKPENPSYPIGKKSILFAVKALLLALVVGSYHYRQHLHPYVTLALCCCHLYL  179

Query  639   VLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRS  460
              LE +L +++   RAVF  ELE   +EP+LSTSLQDFWG RWN+MVT ILRPT Y P+R+
Sbjct  180   GLEILLPLLATPARAVFGFELEPHSNEPYLSTSLQDFWGHRWNLMVTKILRPTTYYPIRN  239

Query  459   VSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV  280
             V  R +   LA   A+M++F VSG+MHE+++Y + R  PT EV  FF+++G CVA+E+ V
Sbjct  240   VFTRVVGLQLARFLAMMSTFAVSGLMHEVIYYYLARVPPTWEVTWFFVLHGVCVAIEVEV  299

Query  279   KRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             K+A   + RL  ++SGPL L  + +T+ WLFFP   RN  D KA  E  A + FV +H
Sbjct  300   KKAAADRCRLKPVISGPLTLLFLAVTANWLFFPQLLRNGVDVKALNEYSAMVAFVKSH  357



>ref|NP_001240009.1| uncharacterized protein LOC100809798 [Glycine max]
 gb|ACU22750.1| unknown [Glycine max]
Length=351

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/354 (40%), Positives = 201/354 (57%), Gaps = 27/354 (8%)
 Frame = -3

Query  1119  KKKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTS  940
             K   MEGEI + + VW ++L  LCYC+ I+   PK    RF  + PV  LF +LPL LT+
Sbjct  5     KCMEMEGEIKSLMKVWISILASLCYCYFISSRVPK-GLLRFLTLSPVLYLFTILPLQLTT  63

Query  939   IHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGN-  763
             +   G +AFFI WL +FKL LF    GPL+      L  F+ FACLPI++      + + 
Sbjct  64    VLPTGVTAFFITWLTNFKLLLFTFDLGPLTPNSNSLLH-FLSFACLPIRLTPLNSKSKSK  122

Query  762   --------------FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFM  625
                           F FS SL  L            K+ LHP + L  +   LY++++ +
Sbjct  123   SKLKLHFIIFPIKVFLFSLSLMSLKDQY--------KQKLHPTIILGIYCTLLYLLMDVV  174

Query  624   LFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSV--SA  451
             L + + +V A F +EL+ P D+P+LSTSL+DFWGRRWN++VT  LR TVY PVRS+  S 
Sbjct  175   LGLCNIVVNAAFGIELQLPSDDPYLSTSLRDFWGRRWNLIVTYTLRHTVYKPVRSLLMSK  234

Query  450   RFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA  271
               L    AS+  VMA+F+VSG+MHEL+FY + R +PT EV  FFL++G C   E G  + 
Sbjct  235   TVLGPQWASVSGVMATFLVSGLMHELIFYYVTRVSPTWEVTCFFLLHGVCAVAEFGAVKW  294

Query  270   VDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             +  K+RL   + GP+ +  VI+T+ WLFFPP   +  D +   E    +E V+ 
Sbjct  295   LGAKWRLHWALCGPITVAFVIVTAAWLFFPPLMHDGTDERTIKEFNDVVECVMG  348



>emb|CDY19924.1| BnaC09g31900D [Brassica napus]
Length=339

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 205/332 (62%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ NFI VW +++  + YC+ ++    KP  +R  ++ PV  LFL+LPL  +S+H +
Sbjct  1     MEEELKNFIKVWVSIIISVSYCYYLSTRI-KPGVSRLLSVLPVCVLFLLLPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G++AFF  WL +FKL LF+  +GPL   P      FI F C PIK Q   K   +     
Sbjct  60    GSAAFFFTWLANFKLILFSFDKGPLYPLPQTLSR-FIYFTCFPIKSQHNPKSQDDIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+V+ GV+  +Y YK+ L P + L+ + +H+Y+ LE  L +V  LV      +LE  
Sbjct  119   FAIKVVVFGVLLRMYDYKQHLSPTMLLIIYSLHIYLELEIGLMLVKALVFISLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+L+TSLQDFWGRRWN+MVT ILRP VYDPV+ ++   +    A   AV+A+F+VSG
Sbjct  179   FNEPYLATSLQDFWGRRWNLMVTAILRPAVYDPVQRIAEWKMRTDHARFLAVLATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV-KRAVDGKFRLPGIVSGPLALTLV  211
              +HEL+F+ I    PTGEV  FF+++G C A E+ V KR    ++++  +VS PL +  V
Sbjct  239   AVHELIFFYITHEMPTGEVSWFFVLHGVCTAAEVAVKKRTFMRRWKMSHMVSRPLTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +LT+ WLFFPP  R+    K   E L FI+FV
Sbjct  299   VLTTGWLFFPPLIRSGMFEKLPNEVLLFIDFV  330



>gb|ABD33005.1| Membrane bound O-acyl transferase, MBOAT [Medicago truncatula]
 gb|AES64469.2| MBOAT (membrane bound O-acyl transferase) family protein, putative 
[Medicago truncatula]
Length=381

 Score =   234 bits (597),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 204/359 (57%), Gaps = 30/359 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEINNFIMVWT     + Y HTI  L  + + +R  A+ P   +  +LPL L SIHL 
Sbjct  1     MDGEINNFIMVWTIAASTMAYSHTIGKLISQGT-SRLIALIPAIIILFLLPLRLNSIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIK---------------  793
             G S+FFIGWL +FKL LFA  +GPLS+ P L L  FI  + LPIK               
Sbjct  60    GPSSFFIGWLSTFKLFLFAYNKGPLSTNPSLSLLHFISLSLLPIKFQNQPNINHNNNNPS  119

Query  792   ----VQRRKKVAGNFKFS---GSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVL  634
                  ++  +   N K +    S   +++L ++  +Y  KE  HPK  L  + +H+YI L
Sbjct  120   KTNIYKKDHESKSNSKSTLTYASATMIIILALLIPLYSKKENFHPKFVLFLYSLHMYIGL  179

Query  633   EFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVS  454
             EF   + S  +R +  ++LE  F++P+LSTSLQDFWG+RWN+ V  +L PT+Y+PV + S
Sbjct  180   EFFFALASTFIRKLLSIDLEPQFNKPYLSTSLQDFWGKRWNISVNRVLHPTIYEPVVNFS  239

Query  453   ARFLPESLASLPAVMASFVVSGIMHELVFYNIGRAT-------PTGEVMSFFLVNGACVA  295
              R++    A LP ++A+F +S +MHE+VFY I R         P+ + M FF+++G C+ 
Sbjct  240   TRWIGRKWAPLPGILATFTMSAMMHEVVFYYIKREKRSWEAWEPSWDAMCFFILHGVCLV  299

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             +++GVK+    K RLP +VS    +  V  T+ WLF P   R +   KA  E  A  EF
Sbjct  300   VQVGVKKMFGDKVRLPTVVSWLFTVVFVWCTALWLFVPALVRCRVYEKASRELNALTEF  358



>ref|XP_009364639.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1 [Pyrus x bretschneideri]
 ref|XP_009364642.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1 [Pyrus x bretschneideri]
Length=371

 Score =   233 bits (595),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 151/363 (42%), Positives = 209/363 (58%), Gaps = 32/363 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI+NFI VW      LCYC  I    PK   TRF ++ P+   F++LPLNL S+ L 
Sbjct  1     MEGEIHNFIKVWILANVSLCYCFYIASRIPK-GITRFISLLPIFYQFIILPLNLHSVILC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             G + FF+ WLG+FKL LF++  GPLS  PP     FI   CLPI++++            
Sbjct  60    GLTTFFLVWLGNFKLLLFSVDLGPLSRPPPTLFQ-FISIGCLPIQIKQNPPQESPQNTNP  118

Query  780   ----------------KKVAGNFKFSGSLR-KlvllgvvflvyyYKEFLHPKVFLLFFVI  652
                             + V    K S +L  K +LL +V   + YK+ LHP V    +  
Sbjct  119   PQQTTQNPTRSENAVVQTVTNVPKNSLTLAIKALLLDLVIRSFEYKQHLHPYVISALYYC  178

Query  651   HLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYD  472
              +Y+ LE +L + +   RA FR ELE  F++PHLSTSLQDFW RRWN+MV  ILRP++Y 
Sbjct  179   LMYLALEIVLALGATPARAFFRFELEPQFNKPHLSTSLQDFWSRRWNIMVPMILRPSMYY  238

Query  471   PVRSVSARFL-PESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVA  295
             PVR +    L P S  +L AVM++F VSG+MHE+++Y + R  PT EV  FF+++G  + 
Sbjct  239   PVRRICTPILGPRSARNL-AVMSTFTVSGLMHEVLYYYLTRVPPTWEVTWFFVLHGMSMV  297

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +E+ VK+A   ++RL  +VSGP  L  +++T+ WLFFP   RN    KA  E     +FV
Sbjct  298   IEVEVKKAAVNRWRLHRLVSGPSTLVFLVVTANWLFFPQQLRNGIYIKAANEHAIVQDFV  357

Query  114   INH  106
              +H
Sbjct  358   KSH  360



>gb|KFK27129.1| hypothetical protein AALP_AA8G338700 [Arabis alpina]
Length=339

 Score =   232 bits (592),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 139/332 (42%), Positives = 195/332 (59%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ NF+MVW   + C+ YC+ ++    KP   R F++ P+  LFLVLPL  +S+H +
Sbjct  1     MEEELKNFMMVWVLAIICISYCYYLSTRI-KPGLFRLFSVLPICVLFLVLPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G+ AFF+ WL +FKL LF+  +G L   P      FI F CLPIK Q   K   +     
Sbjct  60    GSIAFFLTWLTNFKLILFSFDQGSLFPLPSNLTR-FICFTCLPIKPQENPKPQNDIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y YK+ L P   L+ + +H+Y+ LE  L +V  LV      +LE  
Sbjct  119   FAIKVAIFGVLLQMYEYKQHLSPVGLLVLYSLHIYLELEIFLMVVKVLVSITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWGRRWN+MV  ILRP+VY PVR ++ R +    A    V ASF+VSG
Sbjct  179   SNEPYLATSLQDFWGRRWNLMVPAILRPSVYVPVRRITERKMNSDQALFLGVFASFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALE-IGVKRAVDGKFRLPGIVSGPLALTLV  211
              +HEL+F  + R  PTGEV  FF+++G C A E +  KR     +R+  +VS    +  V
Sbjct  239   AVHELIFLYLTRQLPTGEVTWFFVLHGVCTAAEVVAKKRTFVQGWRMSPMVSRLFTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             ++TS WLFFPP  R+        E+L  I+FV
Sbjct  299   VVTSGWLFFPPLIRSGMIESLANEALLSIDFV  330



>emb|CDP19938.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 196/332 (59%), Gaps = 17/332 (5%)
 Frame = -3

Query  1098  EINNF--IMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
             E  NF  I  W++V+  L YC+ I    PK  F R  ++ PV C F VLP+ + SI   G
Sbjct  2     EHGNFKSIYAWSSVVASLFYCYFIPARIPK-GFLRLVSLLPVFCHFTVLPMYMPSIFFRG  60

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGS  745
              S  FI WL + KL LFA  +GPL+      L  FI  A LPI+ +R    A +   S S
Sbjct  61    VSTLFITWLANSKLLLFAFGQGPLAWAQSQSLHIFIASAALPIRAKR----ADDSNPSSS  116

Query  744   LRKl----------vllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA  595
              +K+           L  ++ L   Y+E  HP V    +   ++++++ ++   S +VRA
Sbjct  117   KKKVPFLNLGTEILALSVLLALAAKYRETAHPLVLQADYCCVIFLLVDVLVAFSSSVVRA  176

Query  594   VFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPA  415
             +  +ELE P + P+ STSLQDFWG+RWN+ VTN LR +VY PVRSVSA  +    A+LPA
Sbjct  177   MVGLELEPPSNAPYASTSLQDFWGKRWNLTVTNTLRLSVYKPVRSVSAGVVGNRWAALPA  236

Query  414   VMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVS  235
               A+F+VSG+MHEL++Y + RA P+ EV  FF+++G CV +E+ +KR + GK  +P  +S
Sbjct  237   FFATFLVSGLMHELIYYYVSRAKPSWEVTWFFILHGICVMIELVIKRGLKGKREMPWFIS  296

Query  234   GPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             GPL +  VI+TSFWLFFPP  ++  D     E
Sbjct  297   GPLTMGFVIITSFWLFFPPLMKSGADEMVLEE  328



>ref|XP_002529022.1| acyltransferase, putative [Ricinus communis]
 gb|EEF33333.1| acyltransferase, putative [Ricinus communis]
Length=406

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/298 (44%), Positives = 180/298 (60%), Gaps = 14/298 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E  + + +W      LCYC+ I    PK    R  ++ PV  LF+VLP + TSIHL 
Sbjct  1     MEAEAKSLVKLWILATTSLCYCYYIPSKIPK-GLLRLLSLLPVFYLFIVLPFDFTSIHLR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKV--------  772
             G +AFF+ WL SFKL LF+L +G LS  P      FI  ACLPIK+++   V        
Sbjct  60    GLAAFFLTWLASFKLLLFSLDQGLLSPLPQKVTH-FISLACLPIKIKQNDSVVSVRVSQL  118

Query  771   AGNFKFSGSLRKlvllgvvfl----vyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGL  604
             + N   +   +         +     Y YK+ +HP   L+ + +H+Y+ LE  L + S  
Sbjct  119   SDNSDHTKDPQNPSPNANSSINFIPSYNYKQLMHPHAVLILYCLHVYLELEIALVISSTP  178

Query  603   VRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLAS  424
              R +   ELE PF+EP+L+TSLQDFWG RWN+MVTNILRPTVY P+R +S R +    A 
Sbjct  179   ARVLLGFELEPPFNEPYLATSLQDFWGHRWNLMVTNILRPTVYYPIRELSMRLIGPVWAP  238

Query  423   LPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRL  250
             LPAV+ +F VSGI+HE+++Y + R  PT EV  FF+++GACVA+E+ VK+ V G++RL
Sbjct  239   LPAVIGTFAVSGIVHEIIYYYLTRVNPTWEVTWFFILHGACVAMEMAVKKKVKGRWRL  296


 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 85/141 (60%), Gaps = 24/141 (17%)
 Frame = -3

Query  810  ACLPIKVQRRKKVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLE  631
            AC+ +++  +KKV G ++                       LHP    LF ++ L  + +
Sbjct  278  ACVAMEMAVKKKVKGRWR-----------------------LHPAGCGLFNLLMLKFIAD  314

Query  630  FMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSA  451
             +  + + LV A+ R+ELE+P D+P+ STSLQDFWGRRWN+MVTN+LR TV+ PV+S S 
Sbjct  315  IVFGVCNALVYAILRMELESPSDDPYFSTSLQDFWGRRWNLMVTNLLRYTVHKPVKSRSE  374

Query  450  RFLPESLASLPAVMASFVVSG  388
            + L E  A LPA++A+F VSG
Sbjct  375  KGLGE-WAPLPAILATFSVSG  394



>ref|XP_003594218.1| Annotation was added to scaffolds in November 2011~Long-chain-alcohol 
O-fatty-acyltransferase [Medicago truncatula]
Length=453

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/359 (40%), Positives = 204/359 (57%), Gaps = 30/359 (8%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GEINNFIMVWT     + Y HTI  L  + + +R  A+ P   +  +LPL L SIHL 
Sbjct  1     MDGEINNFIMVWTIAASTMAYSHTIGKLISQGT-SRLIALIPAIIILFLLPLRLNSIHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIK---------------  793
             G S+FFIGWL +FKL LFA  +GPLS+ P L L  FI  + LPIK               
Sbjct  60    GPSSFFIGWLSTFKLFLFAYNKGPLSTNPSLSLLHFISLSLLPIKFQNQPNINHNNNNPS  119

Query  792   ----VQRRKKVAGNFKFS---GSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVL  634
                  ++  +   N K +    S   +++L ++  +Y  KE  HPK  L  + +H+YI L
Sbjct  120   KTNIYKKDHESKSNSKSTLTYASATMIIILALLIPLYSKKENFHPKFVLFLYSLHMYIGL  179

Query  633   EFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVS  454
             EF   + S  +R +  ++LE  F++P+LSTSLQDFWG+RWN+ V  +L PT+Y+PV + S
Sbjct  180   EFFFALASTFIRKLLSIDLEPQFNKPYLSTSLQDFWGKRWNISVNRVLHPTIYEPVVNFS  239

Query  453   ARFLPESLASLPAVMASFVVSGIMHELVFYNIGRAT-------PTGEVMSFFLVNGACVA  295
              R++    A LP ++A+F +S +MHE+VFY I R         P+ + M FF+++G C+ 
Sbjct  240   TRWIGRKWAPLPGILATFTMSAMMHEVVFYYIKREKRSWEAWEPSWDAMCFFILHGVCLV  299

Query  294   LEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             +++GVK+    K RLP +VS    +  V  T+ WLF P   R +   KA  E  A  EF
Sbjct  300   VQVGVKKMFGDKVRLPTVVSWLFTVVFVWCTALWLFVPALVRCRVYEKASRELNALTEF  358



>gb|KCW77062.1| hypothetical protein EUGRSUZ_D01403 [Eucalyptus grandis]
Length=358

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 150/367 (41%), Positives = 211/367 (57%), Gaps = 53/367 (14%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF  V  T L  LCYC+++  + PK +  R   I PVA LFL LPLNL++    
Sbjct  1     MEGEIYNFFKVCITALISLCYCYSVGRIIPKGT-RRLLPILPVAALFLYLPLNLSA----  55

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
                           L LFA  +GPLSS PP+ L  F+  ACLPIK+Q+            
Sbjct  56    --------------LFLFAFGKGPLSSDPPISLPRFLAIACLPIKIQQTPLKKSPQRTQN  101

Query  783   -----RKKVAGNFKFS------GSLR-----------KlvllgvvflvyyYKEFLHPKVF  670
                  R    G+ K +       ++R           K +L  ++  VY Y +  HP + 
Sbjct  102   TKNHTRSPQNGHHKENPLPQNPENIRPKTILLLNYPTKALLFVMLLRVYDYGDHFHPNLI  161

Query  669   LLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNIL  490
             LL +  HLY+ L+ +L  +    RA F +ELE  F EP+LS+SLQDFWG+RWN+MVTNIL
Sbjct  162   LLIYCCHLYLALDLILSSIQATARAAFGMELEPQFGEPYLSSSLQDFWGKRWNLMVTNIL  221

Query  489   RPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVN  310
             R T+Y+P+   ++  +    A+LPAVMASF+VSG+MHEL+F+ +GR  PT EVM FF+++
Sbjct  222   RLTIYEPLHYAASAAIGRKWAALPAVMASFLVSGLMHELMFFYMGRVKPTWEVMWFFVLH  281

Query  309   GACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             GAC+ +E+ VKR    K+RL  +++G + +T V++T+ WLFFP   R+    KA  E  A
Sbjct  282   GACLVIEVVVKRKCGAKWRLQRVLTGLMTVTFVMVTASWLFFPQLLRDGVVKKALEEYAA  341

Query  129   FIEFVIN  109
               EF+ +
Sbjct  342   AGEFLKD  348



>emb|CDX76699.1| BnaC08g32850D [Brassica napus]
Length=346

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 201/338 (59%), Gaps = 10/338 (3%)
 Frame = -3

Query  1110  TMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
              +  E       W +V+  LCYC  +  L  K    R   + PV  LF ++PL+LT++H+
Sbjct  4     ALSHEAKRLTEAWGSVMVSLCYCFCVGKLVDK-GVKRLILMAPVMILFFLVPLHLTTVHM  62

Query  930   AGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFS  751
              GT+ FFI WL +FKL LFA  R    S+P L L  F+  +C PIK+Q+    +   + S
Sbjct  63    IGTTGFFISWLANFKLYLFAF-RNGPLSSPTLSLPIFLLVSCFPIKLQQLGNESKPKRHS  121

Query  750   ---GSL---RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
                GSL    K + L +V   + Y   L  K  LL +  ++Y  L+ ML + + LVRA  
Sbjct  122   VREGSLFYLVKALPLLLVIQSFRYTHLLPNKAVLLLYGFNMYFSLDLMLAVTASLVRAAS  181

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +ELE  F+EP+L+TSLQDFWG+RWN+MV+ ILRPTVY+PV  +S   LP   AS PA +
Sbjct  182   SLELEPQFNEPYLATSLQDFWGKRWNLMVSEILRPTVYEPVLRLSV--LPRKWASAPAAL  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+FVVSGIMHEL+F+ +GR  P+  +MSFFL++G C+  EI +K+A+  ++ LP  V+  
Sbjct  240   ATFVVSGIMHELIFFYLGRLRPSWGLMSFFLLHGVCIMAEIALKKAIRRRWSLPTPVART  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             L +  V  T  +LFFP +   K D KA AE  A   F+
Sbjct  300   LTILFVFATGIFLFFPEFQSCKIDQKAFAEYAAVGTFL  337



>ref|XP_007131434.1| hypothetical protein PHAVU_011G013200g [Phaseolus vulgaris]
 gb|ESW03428.1| hypothetical protein PHAVU_011G013200g [Phaseolus vulgaris]
Length=384

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 208/374 (56%), Gaps = 48/374 (13%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEG+I   + VW  V+  LCYC+ I  + P P   R   + P+  L++VLPL+ +S+HL+
Sbjct  1     MEGDIVTLMKVWPPVVISLCYCYWIRKVVP-PGTIRLLLLLPIIFLYIVLPLSFSSVHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             GT  FF+GWL +FKL LFA  +GPLSS   + L  F+  ACLPIK+Q+            
Sbjct  60    GTIGFFLGWLANFKLLLFAFDKGPLSSDQFISLPRFVAVACLPIKIQQTAPGSTHTQHSS  119

Query  780   ------------------------------------KKVAGNFKFSGSLRKlvllgvvfl  709
                                                   V G     G   K V LGV+  
Sbjct  120   TKNGKTPHPDPSKSSGFDTHPSSKKPNSASQPKQNLSSVNGGTPLVGYALKGVALGVLVK  179

Query  708   vyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDF  529
             +Y Y E ++PKV +  +  H+Y +LE +L +V+ + ++   +ELE  F +P  STSLQDF
Sbjct  180   IYDYSESINPKVIMCMYCFHIYFMLEIILAVVAAMAKSTLGIELEPQFKDPLCSTSLQDF  239

Query  528   WGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRA  349
             WGRRWN+MVT+ILRPTVY+P    +++ +    A LPAVM +FVVSG+MHEL+ + +GR 
Sbjct  240   WGRRWNLMVTSILRPTVYEPTLKGASKVVGSRWAPLPAVMGTFVVSGLMHELILFYLGRL  299

Query  348   TPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFR  169
              PT  +  FFL++G C+  EI +K  + G++RLP  VSGPL +  V+ TS  LF P + R
Sbjct  300   EPTFRMTCFFLLHGICLVAEIALKTTLTGRWRLPRFVSGPLTVVFVMGTSLSLFLPEFIR  359

Query  168   NKGDTKACAESLAF  127
              + D +A  E  A 
Sbjct  360   CRVDVRAFEEYAAL  373



>gb|EYU27396.1| hypothetical protein MIMGU_mgv1a026777mg [Erythranthe guttata]
Length=354

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 201/329 (61%), Gaps = 9/329 (3%)
 Frame = -3

Query  1101  GEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGT  922
             GEINN   VW  V+  LCYCH I+   PK    R F++ P+  +F +LPL+  S      
Sbjct  9     GEINNLSRVWLAVIASLCYCHFISATLPKGK-CRLFSLSPIFYIFSILPLHTNSAFFTAV  67

Query  921   SAFFIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQ------RRKKVAGN  763
             + FFI WL +FKL LFA  RGP+SS+        FI  A LP+K++        KK    
Sbjct  68    TVFFITWLANFKLLLFAFDRGPISSSGAPKSLPAFIATAALPLKIKPPQTDASPKKSKKV  127

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                + +    + + ++ ++Y  ++++HPK+ L+ +   +++ +E ++ + S LV A    
Sbjct  128   LPLNLATEIPISVVLISILYECRDYIHPKIVLVAYCCLVFLSVEILVEVSSLLVGAFLGF  187

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             ELE   DEP+LS+SL++FWGRRWN+ V++IL  TVY PV S +A  L    A+LPAV+A+
Sbjct  188   ELEPASDEPYLSSSLREFWGRRWNLTVSSILHQTVYRPVWSAAAAVLGGDWAALPAVLAA  247

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG-KFRLPGIVSGPL  226
             FVVSG+MHEL F+ I R +PT E+  FF+V G CV +E GVK A+ G K+RLP  VSGPL
Sbjct  248   FVVSGLMHELFFWYITRVSPTWEMTMFFVVQGVCVVVEFGVKVALAGRKWRLPWFVSGPL  307

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAE  139
              +  V+ TSFWLFFPP  RN  D +   E
Sbjct  308   TVGFVVATSFWLFFPPVMRNGADVRVIEE  336



>ref|XP_009116999.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Brassica 
rapa]
Length=346

 Score =   229 bits (585),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 141/338 (42%), Positives = 196/338 (58%), Gaps = 10/338 (3%)
 Frame = -3

Query  1110  TMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
              +  E       W +V+  LCYC  +  L  K    R   + PV  LF + PL+LT++H+
Sbjct  4     ALSHEAKRLTEAWGSVMVSLCYCFCVGKLVDK-GVKRLILMAPVMLLFFLAPLHLTTVHM  62

Query  930   AGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFS  751
              GT+ FFI WL +FKL LFA   GPLSS        F+  +C PIK+Q+ +  +   + S
Sbjct  63    IGTTGFFISWLANFKLYLFAFGNGPLSSPNLSLPI-FLLVSCFPIKLQQLENESKPKRHS  121

Query  750   GS------LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVF  589
                     L K +LL +V     Y   L  K  L  +   +Y  L+ +L + + LVRA  
Sbjct  122   AREGSLFYLVKALLLLLVIQSLRYTHLLPNKAVLFLYGFQMYFSLDLILAVTASLVRAAS  181

Query  588   RVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              +ELE  F+EP+L+TSLQDFWG+RWN+MV+ ILRPTVY+PV  +S   LP   AS PA +
Sbjct  182   SLELEPQFNEPYLATSLQDFWGKRWNLMVSEILRPTVYEPVLRLSV--LPRKWASAPAAL  239

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A+FVVSGIMHEL+F+ +GR  P+  +MSFFL++G C+  EI +K+A+  ++ LP  V+  
Sbjct  240   ATFVVSGIMHELIFFYMGRLRPSWGLMSFFLLHGVCIMAEIALKKAIRRRWSLPTPVART  299

Query  228   LALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             L +  V  T   LFFP + R K D KA AE  A   F+
Sbjct  300   LTILFVFATGVMLFFPEFQRCKIDQKAFAEYAAVGTFL  337



>ref|XP_004305991.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5-like [Fragaria vesca subsp. vesca]
Length=357

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 150/352 (43%), Positives = 212/352 (60%), Gaps = 12/352 (3%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
             + EI     +  +VL  L Y + I+   P+    RFF++ P+  LF +LPL+L++   AG
Sbjct  3     QDEIKTIFKIGLSVLASLSYTYFISSEIPQGKL-RFFSLLPILYLFFILPLSLSTALPAG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpp-lplsTFIPFACLPIKVQRR-----KKVAGN  763
               + F+ W+GSF L LF+   GPLSS PP   L  FI  ACLPIK Q        K +  
Sbjct  62    VISLFVTWIGSFNLLLFSFGSGPLSSQPPPKSLLLFILLACLPIKTQSSNHRIADKSSKP  121

Query  762   FKFSGSL-RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
              K   SL  K++L  ++  +  YK + HPKV L  +   LY+ ++ ++   + L+R    
Sbjct  122   KKLPLSLPTKVLLFAILVALTDYKHYFHPKVLLGQYGCMLYLFVDILVGSCNVLMRTALG  181

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
             +ELE+P DEP+LSTSLQDFWGRRWN+M+TNILR TVY PVRS     L    A  PAV+A
Sbjct  182   IELESPSDEPYLSTSLQDFWGRRWNLMITNILRNTVYKPVRSAVEASLGREWAPPPAVLA  241

Query  405   SFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPL  226
             +F+VSG+MHEL++Y + R TPT EV  FF+++G C+ +E+G+K+ +  K+R    VS P+
Sbjct  242   AFLVSGLMHELIYYYMTRVTPTWEVTLFFVLHGVCLVVEVGLKKVLSPKWRWHWAVSIPM  301

Query  225   ALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN----HRLVSPESM  82
              L  +I+T+ WLFFPP  RN  D +A  E    +EF+       RLVS  S+
Sbjct  302   TLGFIIVTATWLFFPPLMRNGVDERAIGECKELLEFINKKFELERLVSWTSL  353



>ref|XP_003530770.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1-like [Glycine max]
Length=343

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 212/336 (63%), Gaps = 7/336 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ EI  FI VW + + CLCYC+ I    PK  F R  ++ P+  LF+ LPL L+S  L 
Sbjct  1     MDDEIERFIKVWISAILCLCYCYYIASRIPK-GFLRLLSLLPILYLFITLPLKLSSPTLV  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR----KKVAGNF  760
             G ++FFI WLG+FKL LF+  +GPL+ +PP  +  FI  A LPI  ++     +K   N 
Sbjct  60    GYTSFFISWLGTFKLFLFSFNQGPLALSPPNIVQ-FISIASLPITPKQNPSTNEKNTTNK  118

Query  759   KFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
                    K+++  ++  VY YKE LHP   L+ +  H+Y+ LE ML +V   V+ +F  E
Sbjct  119   PKWLLFLKVLIFVMILGVYNYKETLHPDFLLVIYCCHVYLALELMLVLVGATVQTLFGFE  178

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             +E  F+EP+L TSLQDFWGRRWN+ VT+ILRPTVYDP+R +S  F+    A+  A++A+F
Sbjct  179   IEPQFNEPYLCTSLQDFWGRRWNLTVTHILRPTVYDPIRRMSTSFVGPLCATSAAMLATF  238

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGK-FRLPGIVSGPLA  223
             +VSG++HEL++Y + R  PT EV  FF+++G C+ +E+ VK+    + ++L   VSGPL 
Sbjct  239   LVSGLVHELLYYYLTRVPPTWEVTCFFVLHGVCMVVEVAVKKVALRRGWQLHRAVSGPLV  298

Query  222   LTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             + L+ +T+ WLFFP   RN  D K+  E    ++FV
Sbjct  299   VALLAVTANWLFFPQLLRNGLDRKSIEEYAILVDFV  334



>ref|XP_002299916.2| hypothetical protein POPTR_0001s26800g [Populus trichocarpa]
 gb|EEE84721.2| hypothetical protein POPTR_0001s26800g [Populus trichocarpa]
Length=362

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 212/346 (61%), Gaps = 17/346 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  EI NFI V  +V    CYC+ +  + PK + +R   + P+  LFL LPL+L +I+L+
Sbjct  1     MANEITNFIKVSFSVFASTCYCYAVGRIVPKGT-SRLLCLLPIVGLFLYLPLHLHTIYLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRR-----------  781
             G +AFFI WL +FK+ LFA   GPLSS P + L++F+  AC PI++Q++           
Sbjct  60    GLTAFFIAWLANFKILLFAFGEGPLSSDPSISLASFVFVACFPIRIQQKPSPRSRDSHLQ  119

Query  780   -KKVAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGL  604
              K+     K      K++L  ++  V  Y+E++HP++    + + LY+ LE +  + +  
Sbjct  120   DKEPKDGRKHMKYAIKVLLFAILANVPGYREYIHPQIVSFLYFLLLYVELETLFGVAAVA  179

Query  603   VRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLAS  424
              R +  +ELE PF+EP+LSTSLQDFWGRRWN++V++ILRP VY P R++++  +    A 
Sbjct  180   ARVLIGLELEPPFNEPYLSTSLQDFWGRRWNLIVSSILRPAVYKPTRNLASLVVGRKWAL  239

Query  423   LPAVMASFVVSGIMHELV-FYNI--GRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFR  253
             +PA M +F+VSG+MHEL+ FY +   + +P  E+  FFL++G C+  EI +K+   G+++
Sbjct  240   IPAFMGTFLVSGLMHELILFYYVECDQRSP-WELTCFFLLHGVCLLTEIALKKRFGGRWQ  298

Query  252   LPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             LP +VSGPL +  V+ T F LF P   R K   KA  E  A + F+
Sbjct  299   LPRLVSGPLTIGFVLFTGFQLFLPSLDRCKAFEKAYVELAALMAFL  344



>gb|KCW77061.1| hypothetical protein EUGRSUZ_D01403 [Eucalyptus grandis]
Length=354

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 148/360 (41%), Positives = 207/360 (58%), Gaps = 53/360 (15%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI NF  V  T L  LCYC+++  + PK +  R   I PVA LFL LPLNL++    
Sbjct  1     MEGEIYNFFKVCITALISLCYCYSVGRIIPKGT-RRLLPILPVAALFLYLPLNLSA----  55

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR------------  784
                           L LFA  +GPLSS PP+ L  F+  ACLPIK+Q+            
Sbjct  56    --------------LFLFAFGKGPLSSDPPISLPRFLAIACLPIKIQQTPLKKSPQRTQN  101

Query  783   -----RKKVAGNFKFS------GSLR-----------KlvllgvvflvyyYKEFLHPKVF  670
                  R    G+ K +       ++R           K +L  ++  VY Y +  HP + 
Sbjct  102   TKNHTRSPQNGHHKENPLPQNPENIRPKTILLLNYPTKALLFVMLLRVYDYGDHFHPNLI  161

Query  669   LLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNIL  490
             LL +  HLY+ L+ +L  +    RA F +ELE  F EP+LS+SLQDFWG+RWN+MVTNIL
Sbjct  162   LLIYCCHLYLALDLILSSIQATARAAFGMELEPQFGEPYLSSSLQDFWGKRWNLMVTNIL  221

Query  489   RPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVN  310
             R T+Y+P+   ++  +    A+LPAVMASF+VSG+MHEL+F+ +GR  PT EVM FF+++
Sbjct  222   RLTIYEPLHYAASAAIGRKWAALPAVMASFLVSGLMHELMFFYMGRVKPTWEVMWFFVLH  281

Query  309   GACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             GAC+ +E+ VKR    K+RL  +++G + +T V++T+ WLFFP   R+    KA  E  A
Sbjct  282   GACLVIEVVVKRKCGAKWRLQRVLTGLMTVTFVMVTASWLFFPQLLRDGVVKKALEEYAA  341



>ref|NP_190765.1| acyl-CoA sterol acyl transferase 1 [Arabidopsis thaliana]
 sp|Q9SV07.1|ASAT1_ARATH RecName: Full=Acyl-CoA--sterol O-acyltransferase 1; AltName: 
Full=Sterol O-acyltransferase 1 [Arabidopsis thaliana]
 emb|CAB41317.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAQ65159.1| At3g51970 [Arabidopsis thaliana]
 dbj|BAD42903.1| wax synthase-like protein [Arabidopsis thaliana]
 gb|AEE78870.1| acyl-CoA sterol acyl transferase 1 [Arabidopsis thaliana]
Length=345

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 142/337 (42%), Positives = 194/337 (58%), Gaps = 10/337 (3%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFF  910
             +FI  W  V+  LCY   I  L PK    R    FPV  +F ++P  + S+HL G +AFF
Sbjct  3     SFIKAWGLVIISLCYTFFIAKLVPK-GIKRLILFFPVFLIFFIVPFLIYSLHLLGITAFF  61

Query  909   IGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKKVAGNFKFSGSLR--  739
             I WL +FKL LFAL RGPLSS         F+  +CLPIK+Q   K        GS    
Sbjct  62    IAWLANFKLLLFALGRGPLSSNHKPLSLPIFLAVSCLPIKIQLSPKPTKTHSHEGSTEGP  121

Query  738   -----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELE  574
                  K V + ++   Y Y   L  KV L  + IH+Y  LE +L   +  VRA+  +ELE
Sbjct  122   LIYTIKAVFVVLIIKAYEYSTKLPEKVVLTLYAIHIYFALEIILAATAAAVRAMSDLELE  181

Query  573   APFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVV  394
               F++P+L+TSLQDFWGRRWN+MVT ILRPTVY+P   + +   P + + + A   +FVV
Sbjct  182   PQFNKPYLATSLQDFWGRRWNLMVTGILRPTVYEPSLQLFSVLGP-NYSQILAAFGTFVV  240

Query  393   SGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTL  214
             SGIMHEL+F+ +GR  P  ++M FFL+NG C  +EI +K+ ++G++R P  +S  L LT 
Sbjct  241   SGIMHELIFFYMGRLRPDWKMMWFFLINGFCTTVEIAIKKTINGRWRFPKAISQVLTLTF  300

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHR  103
             V++T+ WLF P + R     KA  E  A   F +  R
Sbjct  301   VMVTALWLFLPEFNRCNIVEKALDEYAAIGAFAVEVR  337



>emb|CDP13766.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 201/350 (57%), Gaps = 15/350 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  EI + I  + +VL  L YC+ I    PK  F R   + PV   F +LPL + S+   
Sbjct  1     MGDEIKSSIFAFASVLASLSYCYFIAARIPK-GFLRLICLLPVYYHFTILPLYVPSVFFR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G SA FI WLG+FKL LFA  RGPLSS   +PL  FI    LPI+  +   V  +   SG
Sbjct  60    GVSALFITWLGNFKLLLFAFGRGPLSSDQSMPLHIFIASGALPIRT-KLPNVNPSSTSSG  118

Query  747   SLRKl------------vllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGL  604
               +K              L  +  L   YKE +HP V  + + I ++ ++E ++ + S +
Sbjct  119   PSKKKLPFLNNLGTEILALSVIFGLAAKYKESVHPAVVQIAYSIAMFFLIEVLVALSSFV  178

Query  603   VRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLAS  424
             VRA+  +ELEAP DEP+LS SLQDFWG+RWN+   N LR T+Y PVRS+S   L    A 
Sbjct  179   VRALVGLELEAPSDEPYLSASLQDFWGKRWNLSAANALRHTIYKPVRSISEIVLGNRSAV  238

Query  423   LPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPG  244
             L A+ A+FVVSG+MHEL++Y +  A P+ EV  FF+++G CV +E+ +K AV GK+ +P 
Sbjct  239   LAAIFATFVVSGLMHELIYYYVSGAKPSWEVTWFFVLHGICVMIELVLKTAVGGKWEVPR  298

Query  243   IVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVS  94
             +++ PL +  V  T  WLFFPP  + + D     E     E+V N RLV+
Sbjct  299   LIAAPLTIGFVAATGMWLFFPPLTKMEIDRMIFEEFSQAGEYV-NGRLVA  347



>ref|XP_009120053.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
4 [Brassica rapa]
Length=339

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 195/332 (59%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ NFI VW   +  + YC+ ++    KP   R  ++ PV  LFL +PL  +S+H +
Sbjct  1     MEEELKNFIKVWFYAIISVAYCYYVSSRI-KPGVLRLLSVLPVIALFLFIPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G SAFF  WL +FKL LF+  +GPL   P      FI F C PIK Q+  K         
Sbjct  60    GASAFFFTWLANFKLILFSFDKGPLYPLPQNLPR-FIFFTCFPIKPQQNPKSQNQIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+++ GV+   Y YK+ L     L+ + +H+Y+ LE +L +V   V      +LE  
Sbjct  119   FAIKVLIFGVLLHTYDYKQHLSFTTLLVIYSLHIYLELEILLMLVKVWVFMFLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWGRRWN+MV  ILRP VY+PV+ ++   +    A   AV+A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGRRWNLMVPAILRPAVYNPVQRLAEWKMSSDHARFLAVLATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV-KRAVDGKFRLPGIVSGPLALTLV  211
              +HEL+FY I R  PTGE+  FF+++G C A E+ V KR   G++++  +VS  L +  V
Sbjct  239   AVHELIFYYINREMPTGEITWFFVLHGVCTAAEVVVKKRTFVGRWKVSPMVSRLLTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +LTS WLFFPP  R     +   E+L FI+ V
Sbjct  299   VLTSGWLFFPPLIRGGMFVRLPNEALLFIDSV  330



>emb|CDY17328.1| BnaA10g09620D [Brassica napus]
Length=339

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 195/332 (59%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ NFI VW   +  + YC+ ++    KP   R  ++ PV  LFL +PL  +S+H +
Sbjct  1     MEEELKNFIKVWFYAIISVSYCYYVSTRI-KPGALRLLSVLPVIALFLFIPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G SAFF  WL +FKL LF+  +GPL   P      FI F C PIK Q+  K         
Sbjct  60    GASAFFFTWLANFKLILFSYDKGPLYPLPQNLPR-FIFFTCFPIKPQQNPKSQNQIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+++ GV+   Y YK+ L     L+ + +H+Y+ LE +L +V   V      +LE  
Sbjct  119   FAIKVLIFGVLLHTYDYKQHLSFTTLLVIYSLHIYLELEILLMLVKVWVFMFLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWGRRWN+MV  ILRP VY+PV+ ++   +    A   AV+A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGRRWNLMVPAILRPAVYNPVQRLAEWKMSSDHARFLAVLATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV-KRAVDGKFRLPGIVSGPLALTLV  211
              +HEL+FY I R  PTGE+  FF+++G C A E+ V KR   G++++  +VS  L +  V
Sbjct  239   AVHELIFYYINREMPTGEITWFFVLHGVCTAAEVVVKKRTFVGRWKMSPMVSRLLTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +LTS WLFFPP  R     +   E+L FI+ V
Sbjct  299   VLTSGWLFFPPLIRGGMFVRLPNEALLFIDSV  330



>ref|XP_010449529.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
3 [Camelina sativa]
Length=341

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/343 (40%), Positives = 196/343 (57%), Gaps = 4/343 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ ++ NFI VW +    + YC+ I+    K    R  ++ PV  LFLV PL  +S+H +
Sbjct  1     MDEQLKNFIKVWISATISISYCYYISARI-KAGVFRLLSVLPVCVLFLVFPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G+ AFF+ WL +FKL LF+  +GPLS  P      FI F C PIK  +  K         
Sbjct  60    GSIAFFLSWLANFKLILFSFDQGPLSPLPLTLSR-FICFTCFPIKPLQNPKSQDQLPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + G +  +Y YK+++ P V L+ + +H+Y+ LEF L +V  LV      +LE  
Sbjct  119   FAIKVAMFGALLHMYEYKQYMSPSVLLVLYSLHIYLELEFALMLVKVLVLITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWG RWN+MV  ILRP VY PVR ++ R +    A    V A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGHRWNLMVPAILRPAVYTPVRRLAQRIMNSDQALFLGVFATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA--VDGKFRLPGIVSGPLALTL  214
              +HEL+F+ I R  PTGEV  FF+++G C A E+ VK+   V   +R+  +VS  L +  
Sbjct  239   AVHELIFFYITRDMPTGEVTWFFVLHGVCTAAEVAVKKQKFVRRWWRVSPMVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPES  85
             V+ TS WLFFPP  R+    +   E+L  I+F       + ES
Sbjct  299   VVGTSGWLFFPPLIRSGMVVRLANEALMPIDFFNRKLFYNAES  341



>ref|XP_003610513.1| hypothetical protein MTR_4g133020 [Medicago truncatula]
Length=444

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 202/347 (58%), Gaps = 15/347 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             +EGEINNFIMVW+      CY +TI  L PK    RF  + P   + L+LP+ LT +HL 
Sbjct  2     IEGEINNFIMVWSVATILFCYSYTIGKLIPKGK-VRFVTLIPPIIILLLLPMRLTIVHLV  60

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV-----QRRKKVAGN  763
             G S+F + WL +FKL LFA  +GPLSS PPL LS F+  A  PIK+     Q + KV   
Sbjct  61    GPSSFLLSWLSTFKLFLFAFSKGPLSSNPPLSLSHFLLIASFPIKLANHANQTKIKVVPI  120

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                S  +   +       +Y  KE  HP   ++ + +HLY  LE  L ++S L   +  V
Sbjct  121   NCPSKLVIIFLFSYFFIHLYDKKENFHPINLMILYTLHLYAGLEIFLVLISTLSSKLLHV  180

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             ELE PF++P+LSTS+QDFWGRRWN+MVT IL PTVY P+ + S+ F+    A LPAV+A+
Sbjct  181   ELEQPFNKPYLSTSVQDFWGRRWNIMVTRILHPTVYKPMVNASSHFIGRKWAPLPAVVAT  240

Query  402   FVVSGIMHELVFYNIGRAT--------PTGEVMSFFLVNGACVALEIGVKRAVDGKFR-L  250
             F VSG+MHEL+FY I R          P  + M FF ++G C+AL+I  K+  + K   L
Sbjct  241   FTVSGLMHELIFYYIKREKKDTWEAWEPCWDSMCFFFIHGVCLALQIAYKKVFEPKRELL  300

Query  249   PGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
             P +VS  L +  V+ T   LF P   R     KA  ES+ F++FV N
Sbjct  301   PRVVSCILTMVFVVSTGICLFVPALVRCGVFEKARTESIVFVQFVKN  347



>ref|XP_007142352.1| hypothetical protein PHAVU_008G273300g [Phaseolus vulgaris]
 gb|ESW14346.1| hypothetical protein PHAVU_008G273300g [Phaseolus vulgaris]
Length=341

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 195/332 (59%), Gaps = 5/332 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE+ + + VW +VL  LCYC+ I+   PK    RF ++ PV   F +LPL L+S+   
Sbjct  9     MEGEMKSLMKVWVSVLISLCYCYFISSKLPK-GMLRFVSLSPVLYQFSMLPLQLSSVLPT  67

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AFFI +L + KL LF    GPLSS     L  F   AC PI   +  K     KF  
Sbjct  68    GVTAFFITFLTNSKLLLFTFHLGPLSSNSITLLH-FFSSACFPIT--QTLKPHTKLKFHP  124

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                 + +L    L+    + LHP + L  +   +Y++L+ ++ + + LV A FRV+L+ P
Sbjct  125   IFLPIKVLLFALLLIPINQKLHPTLLLSLYCTLVYLLLDIIIGLCNILVNAAFRVQLQLP  184

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSV-SARFLPESLASLPAVMASFVVS  391
              DEP+LSTSL+DFW RRWN+ VT+ LR TVY+PVRS+ S   L    A +  VMA+F+VS
Sbjct  185   SDEPYLSTSLRDFWARRWNLTVTHTLRHTVYNPVRSLLSDSLLGPQWAWVCGVMATFLVS  244

Query  390   GIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLV  211
             G+MHEL+FY + R  PT EV  FFL++G CV  E G  + +  K RL   V+GP+ +  V
Sbjct  245   GLMHELIFYYVTRVGPTWEVTCFFLLHGVCVVAEFGATKWLGRKCRLHWAVTGPITVGFV  304

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             I T+ WLFFPP  R+  D ++  E    +E V
Sbjct  305   IATAGWLFFPPLMRSGADQRSITEFNNVVECV  336



>ref|XP_010449537.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
3 [Camelina sativa]
Length=339

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/338 (41%), Positives = 195/338 (58%), Gaps = 5/338 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E   FI VW + +  + YC+ I+    K    R   + PV  LFLVLPL  +S+H +
Sbjct  1     MEDEFRTFIKVWFSAIISISYCYYISTRI-KAGVFRLLTVLPVCVLFLVLPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF   +GPL   P      F+ F C PIK Q+            
Sbjct  60    ELTAFFLSWLANFKLILFCFDQGPLVPLPSNLPR-FVCFTCFPIKPQQNPNPQNQIPKWF  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + G +  +Y YK+++ P V L+ + +H+Y+ LEF L +V  LV      +LE  
Sbjct  119   FAIKVAIFGALLHMYEYKQYMSPSVLLVLYSLHIYLELEFALMLVKVLVFITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWG RWN+MV  ILRP VY PVR ++ R +    A    V+A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGHRWNLMVPAILRPAVYTPVRRLAKRIMNSDQALFLGVLATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA--VDGKFRLPGIVSGPLALTL  214
              +HEL+F+ + R  PTGEV  FF+++G C A E+ VKR   V   +R+  IVS  L +  
Sbjct  239   AVHELIFFYMTREMPTGEVTWFFVLHGVCTATEVAVKRTSLVQRWWRVSPIVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
             V++TS WLFFPP  R+    +   E+  FI+FV  H+L
Sbjct  299   VVVTSGWLFFPPLIRSCMIERLANEAFLFIDFV-KHKL  335



>ref|XP_010443158.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
3 [Camelina sativa]
Length=341

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 193/332 (58%), Gaps = 4/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+ NFI VW +    + YC+ I+    K    R  ++ PV  LFLV PL  +S+H +
Sbjct  1     MDEELKNFIKVWVSATILISYCYYISARI-KAGVFRLLSVLPVCVLFLVFPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G+ AFF+ WL +FKL LF+  +GPLS  P      FI F C PIK  +  K         
Sbjct  60    GSIAFFLSWLANFKLILFSFDQGPLSPLPLTISR-FICFTCFPIKPLQNPKSQDQLPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + G +  +Y YK+++ P V L+ + +H+Y+ LEF L +V  LV      +LE  
Sbjct  119   FAIKVAMFGALLHMYEYKQYMSPSVLLVLYSLHIYLELEFALMLVKVLVFITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWG RWN+MV  ILRP VY PV+ ++ R +    A    V A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGHRWNLMVPAILRPAVYTPVQRLAKRIMNSDQALFLGVFATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA--VDGKFRLPGIVSGPLALTL  214
              +HEL+F+ I R  PTGEV  FF+++G C A E+ VK+   V   +R+  +VS  L +  
Sbjct  239   AVHELIFFYIARDMPTGEVTWFFVLHGVCTAAEVAVKKQKFVRRWWRVSPMVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             V++TS WLF PP  R+    +   E+L  I+F
Sbjct  299   VVVTSGWLFLPPLIRSGMVVRLANEALMPIDF  330



>ref|XP_010060261.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Eucalyptus grandis]
 ref|XP_010060262.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Eucalyptus grandis]
Length=347

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 149/342 (44%), Positives = 207/342 (61%), Gaps = 14/342 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E  NFI VW T+L C+CYC+ ++   P P   R F++ PV  LF VLPL L+++   
Sbjct  1     MEEEARNFINVWLTILACVCYCYFVSSSLP-PGKLRLFSLLPVFSLFAVLPLRLSTVLPN  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstp------plplsTFIPFACLPIKVQRRKKV--  772
             G ++FF+ WL SFKL LF+  +GPLSS+P         L  FI F C PIK+++ +    
Sbjct  60    GVTSFFVTWLASFKLLLFSFGKGPLSSSPGSHPDPSKSLFLFILFTCFPIKIRQAQDYPS  119

Query  771   --AGNFKFSGSLRKlvllgvvflvyyYKEFL---HPKVFLLFFVIHLYIVLEFMLFMVSG  607
               A     +   + L+    + +  +  + L   HPK+ LL +   LY+ L+ ++ + + 
Sbjct  120   PQAPKLPLNLPSKLLLCGISILVYDHQDKLLLQGHPKLVLLLYSCMLYLYLDMIVGLSNA  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLA  427
               RAV  VEL+ P DEP+LSTSLQDFWGRRWN+ VTN LR TVY P++S     L  + A
Sbjct  180   AARAVLGVELQMPSDEPYLSTSLQDFWGRRWNLTVTNALRHTVYKPLKSFLEPRLRAAWA  239

Query  426   SLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLP  247
             +  AVMA+F+VSG+MHEL++Y + RA PT EV  FF++ GACV +E+  K AV  ++RL 
Sbjct  240   AAAAVMAAFLVSGLMHELLYYYVTRARPTWEVTGFFVLQGACVVVEVAAKAAVGERWRLS  299

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIE  121
               VS PL +  V  T+ WLFFP   RN  D +A  E  AF+E
Sbjct  300   RAVSTPLTVGFVAATAMWLFFPQLIRNGADARAIKECKAFVE  341



>ref|XP_004244080.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Solanum lycopersicum]
Length=344

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/322 (41%), Positives = 198/322 (61%), Gaps = 8/322 (2%)
 Frame = -3

Query  1083  IMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIG  904
             I +  +++  LCY + I+   PK    R  ++ P+  LF +LPL  +S  L   + FFI 
Sbjct  4     INICLSIILSLCYSYFISSKIPK-GIPRLISLLPIFYLFTILPLYFSSSFLIALTTFFIT  62

Query  903   WLGSFKLTLFALCRGplsstpplpls---TFIPFACLPIKV-QRRKKVAGNFKFSGSLRK  736
             WL +FKL LFA  +GPLSS      +    FI  A LP++  Q  K        +  L  
Sbjct  63    WLANFKLLLFAFNQGPLSSFTQKNATNLPIFIFMASLPLRSKQNMKNPTKKIPLNLGLEF  122

Query  735   lvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV---FRVELEAPF  565
             ++    + L +++K  LHPK+ L+ +   ++++++ ++ + S +V+ +   F +ELE+P 
Sbjct  123   VLFAIFLELTFHHKSQLHPKLILICYCFLVFLMIDILVALSSNIVKIILVGFELELESPS  182

Query  564   DEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGI  385
             +EP+LSTSLQDFWG RWN+ VTN LR TVY+PVRSV +  +    A   AV+A+FVVSG+
Sbjct  183   NEPYLSTSLQDFWGNRWNLTVTNTLRLTVYNPVRSVLSEVVGRMCALRVAVLATFVVSGL  242

Query  384   MHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVIL  205
             MHEL+FY + R +P+ E+  FF+++G CV +EIGVKRA+   +RLPG VSG L +  V++
Sbjct  243   MHELLFYYVNRVSPSWEMTGFFVLHGLCVMVEIGVKRALKDTWRLPGFVSGLLTVGFVVV  302

Query  204   TSFWLFFPPYFRNKGDTKACAE  139
             T+F LFFPP  RN  D +   E
Sbjct  303   TAFGLFFPPIIRNGADERVLQE  324



>ref|XP_009784173.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Nicotiana sylvestris]
Length=348

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 131/339 (39%), Positives = 202/339 (60%), Gaps = 17/339 (5%)
 Frame = -3

Query  1068  TVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSF  889
             +V+  LCYC+ ++   PK    R  ++ P+  LF +LPL  +S  L   + FFI WL +F
Sbjct  9     SVIISLCYCYFLSAKIPK-GIPRLISLLPIFYLFTILPLYFSSAFLIALTTFFITWLANF  67

Query  888   KLTLFALCRGplsstpplpls-----TFIPFACLPIKVQRR-------KKVAGNFKFSGS  745
             KL LFA  +GPLS +            FI  A LP++ +++       KK+  NF     
Sbjct  68    KLLLFAFNQGPLSLSTTNATKKLSLPVFISMAALPLRSKQKSNEPNPAKKIPLNFAAEFV  127

Query  744   LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPF  565
             L    L   + L +++K   HPK+ L+ +   ++++++ ++ + S + + +  +ELE P 
Sbjct  128   L----LAIFLGLTFHHKSQTHPKLVLICYCFMMFLMIDILIALSSSIAKILVGLELEPPS  183

Query  564   DEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGI  385
             +EP+LSTSLQDFWG+RWN+ VTN LR T+Y+PVRS  +  + +  A   AV+A+F+VSG+
Sbjct  184   NEPYLSTSLQDFWGKRWNLTVTNTLRLTIYNPVRSALSEVVGKKWALRFAVLATFIVSGL  243

Query  384   MHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVIL  205
             MHEL+FY +   +P+ E+  FF+++G CV +EIGVKRAV   +RLP  VSGPL +  V+ 
Sbjct  244   MHELIFYYVNGVSPSWEMTWFFVLHGLCVMVEIGVKRAVKDTWRLPWFVSGPLTVGFVVA  303

Query  204   TSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPE  88
             T+F LFFPP  RN  D +   E  +  +F+ +  L  P 
Sbjct  304   TAFGLFFPPIVRNGADERVLEEIGSCYDFLKDKMLQLPN  342



>ref|XP_003617668.1| hypothetical protein MTR_5g094140 [Medicago truncatula]
 gb|AET00627.1| MBOAT (membrane bound O-acyl transferase) family protein, putative 
[Medicago truncatula]
Length=454

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 207/335 (62%), Gaps = 7/335 (2%)
 Frame = -3

Query  1128  INLKKKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLN  949
             I+ K   +E EI N I VW  VL  L YC+ I+   PK    RF ++ P+  LF +LP  
Sbjct  2     ISPKCNELEVEIKNLIKVWLKVLASLSYCYFISSNIPK-GILRFLSLSPIFYLFTILPFQ  60

Query  948   LTSIHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVA  769
             L+ +   G ++FFI WL +FKL LF    GPLSS P + L  F+ FACLPI++ +++K  
Sbjct  61    LSLVLPIGITSFFITWLTNFKLLLFTFDLGPLSSNPKISLPLFLTFACLPIRITQKQKHP  120

Query  768   GNFKFSGSLRKlv--llgvvflvyyYKEFLHPKVFLL-FFVIHLYIVLEFMLFMVSGLVR  598
               F     ++ L   L  +       K+ +HP + ++  +   +Y++L+ +L   + L+ 
Sbjct  121   SKFNILLPIKALFFCLFLISLNDQKQKQKMHPSIIIMGLYCSLIYLLLDLVLGFFNILIY  180

Query  597   AVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFL--PESLAS  424
              VF +ELE P +EP+LS+SL DFWG+RWN+MVT ILR TVY PVR + ++ +  P+   S
Sbjct  181   LVFGIELELPSNEPYLSSSLGDFWGKRWNLMVTYILRHTVYIPVRKLMSKTILGPQCTQS  240

Query  423   LPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPG  244
             +  ++A+F+VSG+MHEL+FY++   TPT EV  FF+++G CV +EIGVK+ +D K+R+  
Sbjct  241   V-GIIATFLVSGLMHELLFYHVTHVTPTWEVTCFFMLHGVCVVVEIGVKKWLDHKWRVHW  299

Query  243   IVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
              +SGP  +  V+ T+ WLFFPP  R+  D +   E
Sbjct  300   AISGPTTVVFVVSTAAWLFFPPLLRDGADQRTIEE  334



>ref|XP_007147656.1| hypothetical protein PHAVU_006G143200g [Phaseolus vulgaris]
 gb|ESW19650.1| hypothetical protein PHAVU_006G143200g [Phaseolus vulgaris]
Length=359

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 147/344 (43%), Positives = 202/344 (59%), Gaps = 14/344 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE+ N +MVW+     +CYC+ I  L PK   +R  AI P   L L+LPL L SIH  
Sbjct  1     MEGELKNLMMVWSIAAATMCYCNRIGKLIPK-GVSRLIAIIPAIVLLLLLPLRLISIHFG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR-----RKKVAGN  763
             G S+FF+GWL +FKL LFA  +GPLS  PPL L  F+   CLP+K Q+     + +++ +
Sbjct  60    GPSSFFLGWLSTFKLLLFAFGKGPLSPNPPLSLPHFVSIGCLPVKFQQSTTPSKTQISKS  119

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
                  S   +V+  +    Y  K++LHPK  L  + +H+YI LEF+L  +S   R +  V
Sbjct  120   LFNYASTSIIVIFALFIPFYGIKQYLHPKFLLFLYGLHMYIGLEFILSTISTTTRKLLGV  179

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
              LE  FD+P+L TSLQDFWG+RWN+MV  +L PTVYDPV +++   +    A LPA++A+
Sbjct  180   HLEPQFDKPYLCTSLQDFWGKRWNIMVNRVLHPTVYDPVVTLARPLIGRKWAPLPAILAT  239

Query  402   FVVSGIMHELVFYNIGRAT-------PTGEVMSFFLVNGACVALEIG-VKRAVDGKFRLP  247
             F VSG+MHELVFY I R T       P+ +   FFL++G CVA E+   K     K++ P
Sbjct  240   FAVSGLMHELVFYYIKRETRTWEAWEPSWDATCFFLIHGLCVAAEVALKKGLKGKKWQFP  299

Query  246   GIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              + S  L+L  V+ T+  LF P   R     KA  E  A  +FV
Sbjct  300   RVASWLLSLVFVLYTAVLLFLPALVRCHVYEKATRELTALTQFV  343



>ref|XP_006401462.1| hypothetical protein EUTSA_v10014033mg [Eutrema salsugineum]
 gb|ESQ42915.1| hypothetical protein EUTSA_v10014033mg [Eutrema salsugineum]
Length=338

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 200/332 (60%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ N I VW + +  + YC+ ++    K    R  ++ PV  LFL+LPL  +S+HL+
Sbjct  1     MEEELKNLIKVWVSAIISVSYCYYLSTRI-KAGVFRLLSVLPVVALFLLLPLFFSSLHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AFF  WL +FKL LF+  +GPL   P      FI F C PIK Q+  K         
Sbjct  60    GAAAFFFTWLANFKLILFSFDKGPLFPLPQNLSR-FIYFTCFPIKPQQNPKSQNQIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y YK+ L P V L+ + +H+Y+ LE +L +V  LV      +LE  
Sbjct  119   FAIKVAVFGVLLHIYDYKQHLSPTVLLVLYSLHIYLELEILLMLVKVLVFISLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWGRRWN+MV  ILRP VY+PV+ ++ R L    A L AV+A+F VSG
Sbjct  179   SNEPYLATSLQDFWGRRWNLMVPAILRPAVYEPVQRIAKRKLSSDQARLLAVLATFFVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR-AVDGKFRLPGIVSGPLALTLV  211
              +HEL+F+   R  PTGEV  FF+++G C A E+ VK+     ++++  +VS P+ +  V
Sbjct  239   AVHELIFFYGTREMPTGEVTLFFVIHGVCTAAEVAVKKLTFVRRWKMSPLVSRPITVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             +LTS WLFFPP  RN    +   E+L  I+FV
Sbjct  299   VLTSGWLFFPPLVRNGLFERITNEALLSIDFV  330



>ref|XP_009115902.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Brassica 
rapa]
Length=342

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 136/326 (42%), Positives = 196/326 (60%), Gaps = 14/326 (4%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFF  910
             +FI  W  V+  LCY + +  L P     R     PV   F ++PL+L++IH  G +AFF
Sbjct  3     SFISAWCLVIISLCYTYVVARLVPN-GMRRMILFIPVFLYFFIVPLSLSNIHAVGITAFF  61

Query  909   IGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKKVAGNFKFSGSLRK-  736
             I WL +FKL LFAL RGPL+S   +     F+  +CLP+K+    K   ++   GS R+ 
Sbjct  62    ISWLANFKLFLFALGRGPLASDTKILPLPIFLAVSCLPVKIHLSPK---SYSHGGSSREG  118

Query  735   -------lvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
                      LL ++  VY Y   L  K  L  + IH+Y++LE +L   + +VRA+  +EL
Sbjct  119   LLYYTIMASLLVLMTKVYKYNSKLPNKAVLTLYAIHIYLLLELILAATATMVRAMSGLEL  178

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFV  397
             E  F++P+L+TSLQDFWGRRWN+ VT ILRPTVY+P+  + +   P + + + AV+A+FV
Sbjct  179   EPQFNKPYLATSLQDFWGRRWNLAVTGILRPTVYEPMIQLFSVLGP-NWSRVLAVLATFV  237

Query  396   VSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALT  217
             VSG+MHEL+F+ +G   P  +VM FFLV+G C  +EI VK+ V+G++RLP  VS  L   
Sbjct  238   VSGLMHELIFFYMGGLMPDWKVMWFFLVHGLCTTVEIAVKKKVNGRWRLPTGVSRVLTFG  297

Query  216   LVILTSFWLFFPPYFRNKGDTKACAE  139
              V++T  WLF P + R     +A  E
Sbjct  298   FVMVTGLWLFLPVFNRGNIFERALEE  323



>emb|CAN61367.1| hypothetical protein VITISV_020587 [Vitis vinifera]
Length=350

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 147/353 (42%), Positives = 210/353 (59%), Gaps = 14/353 (4%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
               E+ +F  VW   +   CYC+ I+   PK  F R  ++ P+  LF  LPL+L++ HL G
Sbjct  3     NSEMKSFGYVWILAIASFCYCYFISASIPKGLF-RLLSLLPIIFLFTTLPLHLSAFHLCG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-----KVAGNF  760
              +AF + WL +FKL LF+  RGPLS   PL    FI  A LPIK+ +       K+   +
Sbjct  62    LTAFLLVWLANFKLLLFSFGRGPLSPPQPLLH--FICTASLPIKISQNPYPNSYKITSPY  119

Query  759   KFSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
               +G     L K + L  +  VY Y++FLHP V L  +  H+Y+  E +L + +   RA+
Sbjct  120   SKTGQKVAFLIKALALAALLKVYKYRQFLHPNVILALYCCHVYLAAELILALAAAPARAI  179

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
               +ELE  F+EP+L+TSLQDFWGRRWN+MV++ILRPT+Y P+R  +A  L    + L A+
Sbjct  180   -GLELEPQFNEPYLATSLQDFWGRRWNLMVSSILRPTIYFPIRRFTASRLGPRCSHLLAM  238

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F VSG+MHE+++Y + R TPT EV  FF++ G C A E+  K+A  G+++ P  V+ 
Sbjct  239   LAAFTVSGLMHEVIYYYLTRVTPTWEVTWFFVLQGVCTAAEVAAKKAAAGRWQFPPAVTR  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQ  73
             PL +  V +TSFWLFFP   RN  D K   E    I+FV    L+ P S+  Q
Sbjct  299   PLTVVFVAVTSFWLFFPQLLRNHVDVKTIGEYSILIDFVKEKTLL-PLSLYLQ  350



>ref|XP_007146543.1| hypothetical protein PHAVU_006G049500g [Phaseolus vulgaris]
 gb|ESW18537.1| hypothetical protein PHAVU_006G049500g [Phaseolus vulgaris]
Length=347

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 204/335 (61%), Gaps = 7/335 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI  FI VW + +  LCYC+ I    PK  F R  ++ P+  + +  P  ++S +L 
Sbjct  1     MEGEIEKFIRVWISAILGLCYCYYIAARIPK-GFFRLLSLIPILYILITFPFKISSPNLV  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G ++FF+ WL +FKL LF+  +GPL+ +PP  L  FI  A LPI  ++      N   + 
Sbjct  60    GYTSFFLVWLATFKLILFSFNQGPLALSPPNILH-FISIASLPITPKQHPPTKQNTTTNK  118

Query  747   SL----RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
                    K ++  ++  +Y+  + LHP   LL +  HLY+ LE   F+V+  VR +F VE
Sbjct  119   PKWLLPLKALIFAIIAAIYHNNQHLHPYFMLLLYCCHLYLGLEIAFFIVATPVRIIFNVE  178

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             +E+ FDEP+LSTSLQ+FWG RWN++V+ ILRP++YDPVR +S  F+  S A L A+ A+F
Sbjct  179   IESQFDEPYLSTSLQEFWGHRWNLIVSRILRPSIYDPVRRISTSFMDPSYAMLVAMFATF  238

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFRLPGIVSGPLA  223
              VSG+MHEL++Y + R  PT EV  FF+++G C   E+  K+ V   ++RL  ++SG L 
Sbjct  239   FVSGLMHELIYYYVIRVPPTWEVTCFFVLHGVCTVAEVATKKMVLRRRWRLHRLMSGLLV  298

Query  222   LTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             +  +I+++ WLFFP   RN+ D K   E +  I F
Sbjct  299   MGFLIVSANWLFFPQLLRNEMDKKCSKEYVIMINF  333



>ref|NP_200346.1| putative long-chain-alcohol O-fatty-acyltransferase 4 [Arabidopsis 
thaliana]
 sp|Q9FJ75.1|WAXS4_ARATH RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 
4; AltName: Full=Wax synthase 4 [Arabidopsis thaliana]
 dbj|BAB08552.1| wax synthase-like protein [Arabidopsis thaliana]
 gb|AAY78866.1| membrane bound O-acyl transferase family protein [Arabidopsis 
thaliana]
 gb|AED96619.1| putative long-chain-alcohol O-fatty-acyltransferase 4 [Arabidopsis 
thaliana]
Length=345

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 133/332 (40%), Positives = 194/332 (58%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ + I VW   +  + YC+  +       F R  ++ PV  LFLVLPL ++S+H +
Sbjct  1     MEEELMSLIKVWVYAIISISYCYYTSTRIKSGVF-RLLSVLPVCVLFLVLPLFVSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G++AFF+ WL +FKL LF+  +GPL   P      F+ F C PIK+Q+  K        G
Sbjct  60    GSTAFFLSWLANFKLILFSFDQGPLFPVPSNLSR-FVCFTCFPIKLQQNPKPQNQMPKWG  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                KL   GV+  +Y YK+ + P V L+ + +H+Y+  E +L  +  L+      +LE  
Sbjct  119   FAVKLAFFGVLLHMYEYKQHMSPTVLLVLYSLHIYLEYEILLAPLKVLLSISLWCDLEPH  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+LSTSLQDFWGRRWN+MV  ILRP VY PVR ++ R +    A    V ASF+VSG
Sbjct  179   FNEPYLSTSLQDFWGRRWNLMVPAILRPAVYLPVRQMAGRKMNSDQALFLGVFASFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA-VDGKFRLPGIVSGPLALTLV  211
             ++HEL+F+   R +PTGEV  FF+++G C A E   KR  +  ++++  +VS  L +  V
Sbjct  239   VVHELIFFYFTRESPTGEVTLFFVLHGVCTAAECAAKRTRLVRRWKVSQMVSRLLTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             ++T  WLFFP   R+    +   E+  FI FV
Sbjct  299   VMTGGWLFFPHLARSGMIERLADEAFLFIGFV  330



>ref|XP_004507638.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Cicer arietinum]
Length=333

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 193/330 (58%), Gaps = 18/330 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             +EGEI+NFI VW+      CY + I  + PK    R  A+FP   +  +LP+NLTSIHL 
Sbjct  2     IEGEIHNFIKVWSIATTLFCYIYKIGKVIPKGK-VRVVALFPPIIIIFLLPVNLTSIHLG  60

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQR---------RKK  775
             G+ + F+ WL +FKL LF   +GPLSS PP  L  F+  A LPIK Q          + K
Sbjct  61    GSCSLFLAWLSTFKLLLFVFSKGPLSSNPPHNLLHFLLLASLPIKFQNDNNKKINLNKIK  120

Query  774   VAGNFKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA  595
             V     F   +  ++   V   +  YKE LHP +    + +HLY  +E  + M+  +VR 
Sbjct  121   VVPRNWFELLVMAILTYYVFIPLNKYKENLHPLILKSLYSLHLYTGIEMFISMIHIIVRY  180

Query  594   VFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPA  415
             + +VELE PF++P+LSTS+QDFWG+RWN+MV+ IL PTVY+P+   S++ +    A LPA
Sbjct  181   LIQVELEEPFNKPYLSTSVQDFWGKRWNIMVSRILHPTVYEPMVKASSKVIGRKWAPLPA  240

Query  414   VMASFVVSGIMHELVFYNIGRATPTGEV-------MSFFLVNGACVALEIGVKRAVDGKF  256
              +A+F+VSG+MHE++FY I R   T +V       M FFL++G CVALEI  K+    K 
Sbjct  241   AVATFLVSGLMHEMMFYYIKREKATWQVWEPCWDSMCFFLIHGVCVALEIAYKKIFKPKH  300

Query  255   R-LPGIVSGPLALTLVILTSFWLFFPPYFR  169
             R LP  VS  L  + V+ T   LF P   R
Sbjct  301   RLLPRFVSCILTTSFVVSTVLCLFAPALLR  330



>ref|XP_010482974.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Camelina sativa]
Length=348

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 135/333 (41%), Positives = 193/333 (58%), Gaps = 4/333 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E  N I VW + +  + YC+ I     K    R  ++ PV  LFLVLPL  +S+HL+
Sbjct  1     MDKEHKNLIKVWLSAIISISYCYYIPPRI-KSGVPRLLSVSPVLALFLVLPLFFSSLHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL   P   L  F  F C PIK Q+  K   +     
Sbjct  60    LITAFFLTWLANFKLILFSFDKGPLIPIPSNLLRFFC-FTCFPIKAQQNPKSQNHLPKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ +  V+  +Y YK+ LHP V L  + +HLY+ +E +L  V  LV      +LE  
Sbjct  119   FASKVAIFCVLLHLYGYKQNLHPIVMLGLYFVHLYLEIEIILTFVKVLVFITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +    A  P ++ +F+VSG
Sbjct  179   SNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERRMSSGWALFPGILVAFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++HEL+FY + R  PTGEV  FF+++G C A E+ VK+   V  ++RL  +VS  L +  
Sbjct  239   LVHELLFYYMTREMPTGEVTLFFVLHGVCTAAELAVKKKTTVMKRWRLSPVVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             V +T  WLF P   R+    +   E++  +EFV
Sbjct  299   VFVTGVWLFTPQLRRSSVMERFTYEAVLVVEFV  331



>gb|AAO18665.1| wax synthase isoform 2 [Vitis vinifera]
Length=350

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 147/353 (42%), Positives = 209/353 (59%), Gaps = 14/353 (4%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
               E+ +F  VW   +   CYC+ I+   PK  F R  ++ P+  LF  LPL+L++ H  G
Sbjct  3     NSEMKSFGYVWILAIASFCYCYFISASIPKGLF-RLLSLLPIIFLFTTLPLHLSAFHPCG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-----KVAGNF  760
              +AF + WL +FKL LF+  RGPLS   PL    FI  A LPIK+ +       K+   +
Sbjct  62    LTAFLLVWLANFKLLLFSFGRGPLSPPQPLLH--FICTASLPIKISQNPHPNSYKITSPY  119

Query  759   KFSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
               +G     L K + L  +  VY Y++FLHP V L  +  H+Y+  E +L + +   RA+
Sbjct  120   SKTGQKVAFLIKALALAALLKVYKYRQFLHPNVILALYCCHVYLAAELILALAAAPARAI  179

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
               +ELE  F+EP+L+TSLQDFWGRRWN+MV++ILRPT+Y P+R  +A  L    + L A+
Sbjct  180   -GLELEPQFNEPYLATSLQDFWGRRWNLMVSSILRPTIYFPIRGFTASGLGPRCSHLLAM  238

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F VSG+MHE+++Y + R TPT EV  FF++ G C A E+  K+A  G++R P  V+ 
Sbjct  239   LAAFTVSGLMHEVIYYYLTRVTPTWEVTWFFVLQGVCTAAEVAAKKAAAGRWRFPPAVTR  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQ  73
             PL +  V +TSFWLFFP   RN  D K   E    I+FV    L+ P S+  Q
Sbjct  299   PLTVVFVAVTSFWLFFPQLLRNHVDVKTIGEYSILIDFVKEKTLL-PLSLYLQ  350



>ref|XP_010443156.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Camelina sativa]
Length=348

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 135/333 (41%), Positives = 194/333 (58%), Gaps = 4/333 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+ N I VW + +  + YC+ I     K    R  ++ PV  LFLVLPL  +S+HL+
Sbjct  1     MDEELKNLIKVWLSAIISISYCYYIPPRI-KSGVPRLLSVSPVLALFLVLPLFFSSMHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL   P      F  F C PIK Q+  K   +     
Sbjct  60    LITAFFLTWLANFKLILFSFDKGPLIPIPSNLPRFFC-FTCFPIKFQQNPKSQNHLSKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  ++ Y++ LHP V L  + +HLY+ +E +L  V  LV      +LE  
Sbjct  119   FAIKVAIFGVLLHLHGYRQNLHPIVMLGLYFVHLYLEIEIILTFVKVLVFISLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +    A  P ++ +F+VSG
Sbjct  179   SNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERRMSSGWALFPGILVAFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++HEL+FY + R  PTGEV  FF+++G C A E+ VK+   V  ++RL  +VS  L +  
Sbjct  239   LVHELLFYYMTREMPTGEVTLFFVLHGVCTAAELAVKKKTTVMKRWRLSPVVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             V LT  WLF P   R+    K   E++  +EFV
Sbjct  299   VFLTGVWLFTPQLRRSGVMEKFTYEAVLVVEFV  331



>ref|XP_002276928.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase [Vitis 
vinifera]
 gb|AAO18664.1| wax synthase isoform 1 [Vitis vinifera]
Length=350

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 209/353 (59%), Gaps = 14/353 (4%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
               E+ +F  VW   +   CYC+ I+   PK  F R  ++ P+  LF  LPL+L++ HL G
Sbjct  3     NSEMKSFGYVWILAIASFCYCYFISASIPKGLF-RLLSLLPIIFLFTTLPLHLSAFHLCG  61

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-----KVAGNF  760
              +AF + WL +FKL LF+  RGPLS   PL    FI  A LPIK+ +       K+   +
Sbjct  62    LTAFLLVWLANFKLLLFSFGRGPLSPPQPLLH--FICTASLPIKISQNPYPNSYKITSPY  119

Query  759   KFSGS----LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
               +G     L K + L  +  VY Y++FLHP V L  +  H+Y+  E +L + +   RA+
Sbjct  120   SKTGQKVAFLIKALALAALLKVYKYRQFLHPNVILALYCCHVYLAAELILALAAAPARAI  179

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
               +ELE  F+EP+L+TSLQDFWGRRWN+MV++ILRPT+Y P+R  +A  L    + L A+
Sbjct  180   -GLELEPQFNEPYLATSLQDFWGRRWNLMVSSILRPTIYFPIRGFTASRLGPRCSHLLAM  238

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSG  232
             +A+F VSG+MHE+++Y + R TPT EV  FF++ G C A E+  K+A  G+++LP  V+ 
Sbjct  239   LAAFTVSGLMHEVIYYYLTRVTPTWEVTWFFVLQGVCTAAEVAAKKAAAGRWQLPPAVTR  298

Query  231   PLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPESMTCQ  73
             PL +  V  T FWLFFP   RN  D K   E    ++FV    L+ P S+  Q
Sbjct  299   PLTVVFVAATGFWLFFPQLLRNHVDVKTIGEYSILLDFVKEKTLL-PLSLYLQ  350



>gb|KCW75715.1| hypothetical protein EUGRSUZ_D00093 [Eucalyptus grandis]
Length=353

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 196/367 (53%), Gaps = 58/367 (16%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGEI N   V  T L  LCYC+ +  + PK +  R  AI PV  LFL LPLNL +++L 
Sbjct  1     MEGEIYNAFKVCITALMSLCYCYIVGRIIPKGT-QRLLAILPVVALFLYLPLNLCAVNLR  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK----------  778
               S+                        PP+ L  F+  AC PIK+Q+            
Sbjct  60    PLSS-----------------------DPPISLPCFLAIACFPIKIQQNPLQESPQRTHS  96

Query  777   -------------------KVAGNFKFSGSL-----RKlvllgvvflvyyYKEFLHPKVF  670
                                +   N +    L      K +L  ++  +Y Y +  HP + 
Sbjct  97    TKNHTHPPQEGHHKENPLPQNTENIRHKAILFLNYPTKALLFVMLLHLYNYGDHFHPNLM  156

Query  669   LLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNIL  490
             LL +  H+Y+ LE  L  +    RA   VELE  F EP+LS+SLQDFWG+RWN+MVTNIL
Sbjct  157   LLLYCCHIYLALEVTLASIQAAARAGLGVELEPQFREPYLSSSLQDFWGKRWNLMVTNIL  216

Query  489   RPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVN  310
             R TVY+PV + ++  +    ASL AVMA+F+VSG++HEL+F+ +GR  PT EVM FF+++
Sbjct  217   RLTVYEPVHNAASAVVGRKWASLLAVMAAFLVSGLLHELIFFYMGRMKPTWEVMWFFVIH  276

Query  309   GACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLA  130
             GAC+ +E+ VKR    K+RLP  ++G + +T V++T+ WLFFP   R+  D KA  E  A
Sbjct  277   GACLVVEVMVKRKCGTKWRLPRALTGLMTVTFVMVTASWLFFPQLLRDGVDKKALEEYAA  336

Query  129   FIEFVIN  109
                F+ +
Sbjct  337   AGAFIKD  343



>gb|KFK27125.1| hypothetical protein AALP_AA8G338100 [Arabis alpina]
Length=339

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 197/332 (59%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ NFI VW + +  + YC+ I+    K   +R  ++ PV  LFLV PL  +S+H +
Sbjct  1     MEEELKNFIKVWVSAIISISYCYYISTRI-KAGLSRLLSVLPVCALFLVFPLFFSSVHSS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G+ +FF+ WL +FKL LF+  +GPL   PP     FI F C PIK +             
Sbjct  60    GSLSFFLTWLANFKLILFSFDQGPLFPLPPNLTR-FICFTCFPIKPRENPTSQNEIPKWA  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+V+ G++  +Y YK+ L P V L+ + +H+Y+ LE +L +V  LV      +LE  
Sbjct  119   FAVKVVIFGILLHLYDYKQHLSPIVLLIIYSLHIYLELEMILMLVKLLVYTTLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWGRRWN+MV  ILRP VY PVR ++ R L    A    V ASF+VSG
Sbjct  179   SNEPYLATSLQDFWGRRWNLMVPAILRPAVYFPVRQITKRILNSDHALFLGVFASFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGV-KRAVDGKFRLPGIVSGPLALTLV  211
              +HEL+F+ I R  PTGEV  FF+++G C A E+ V KR +   +R+  +VS  L +  V
Sbjct  239   AVHELIFFYITRELPTGEVTWFFVIHGVCTAAEVAVKKRIIVRGWRMSPMVSRLLTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             + TS WLFFPP  R+    +   E+L  I+FV
Sbjct  299   VATSGWLFFPPLIRSGMIERLANEALLSIDFV  330



>ref|XP_002866092.1| hypothetical protein ARALYDRAFT_495620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42351.1| hypothetical protein ARALYDRAFT_495620 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/336 (40%), Positives = 197/336 (59%), Gaps = 4/336 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ + I VW      + YC+ I+    K    R  ++ PV  LFLVLPL ++S+H +
Sbjct  1     MEEELMSLIKVWVYATISISYCYYISTRI-KAGVFRLLSVLPVCVLFLVLPLFVSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G++AFF+ WL +FKL L +  +GPL   PP      I F C PIK+Q+  K         
Sbjct  60    GSTAFFLAWLANFKLILLSFDQGPLFPLPPNLSR-LICFTCFPIKLQQNPKPQNQLPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                KL + G++  +Y YK+++ P V L+ + +H+Y+  E +L  +  L+      +LE  
Sbjct  119   FAIKLAIFGLLLYMYAYKQYMSPTVLLVLYSLHIYLEYEILLAPLKVLLSISLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+L+TSLQDFWGRRWN+MV  ILRP VY PVR ++ R +    A    V A+F+VSG
Sbjct  179   FNEPYLATSLQDFWGRRWNLMVPAILRPAVYVPVRRMAGRKMNSDQALFLGVFATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR-AVDGKFRLPGIVSGPLALTLV  211
             ++HEL+F+   R +PTGEV  FF+V+G C A E   KR ++  + ++  +VS  L +  V
Sbjct  239   VVHELIFFYFTRESPTGEVTLFFVVHGVCTAAEGAAKRTSLVRRLKMSQMVSRLLTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHR  103
             +LT  WLFFP   R+    +   E+  FI+FV  H+
Sbjct  299   VLTGGWLFFPQLTRSGMIERLADEAFLFIDFV-KHK  333



>ref|XP_004491443.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
2-like [Cicer arietinum]
Length=354

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 198/332 (60%), Gaps = 13/332 (4%)
 Frame = -3

Query  1098  EINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTS  919
             EI + I VW  ++  LCY + I+   PK  F RF ++ P+  +F +LP  L+ +   G +
Sbjct  12    EIKSLIKVWLIIIASLCYSYFISSKIPKGIF-RFLSLSPIMYIFTILPFQLSFVLPIGIT  70

Query  918   AFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG--S  745
             +F I WL +FKL LF    GPLSS P   L  F+ FAC PI++ ++ K   N   S    
Sbjct  71    SFLITWLTNFKLLLFTFDLGPLSSNPSNSLPLFLTFACFPIRITQKLKHPLNQNPSKFHL  130

Query  744   LRKlvllgvvflvyyYKEFLHPK----VFLLFFVIHLYIVLEFMLF-MVSG----LVRAV  592
             L  +  + + FL+   K     K    ++  F ++ LY  L ++L  +V G    L+ A 
Sbjct  131   LLPMKAMLLFFLLMGLKNDPQKKQDMYIYSSFIIVCLYCSLIYLLLDLVWGLCNILINAS  190

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRS-VSARFLPESLASLPA  415
               +ELE PFDEP+LSTSL DFWG+RWN++VT ILR TVY PV++ +S   L    ASLP 
Sbjct  191   IGIELELPFDEPYLSTSLGDFWGKRWNLIVTYILRHTVYIPVKTLMSKTLLGPQWASLPG  250

Query  414   VMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVS  235
             ++ASF VSG+MHEL+FY + R TPT EV  FFL++G CV +EIGV + +  K R+   +S
Sbjct  251   IIASFWVSGLMHELIFYYVTRVTPTWEVTCFFLLHGVCVVVEIGVMKLLGFKRRVHWAIS  310

Query  234   GPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             GP+ +  V+ TS WLFFPP  R+  D +A  E
Sbjct  311   GPIIVGFVVSTSAWLFFPPIIRDGADQRAIEE  342



>ref|XP_010060257.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Eucalyptus grandis]
Length=348

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 206/343 (60%), Gaps = 15/343 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E  NFI VW TVL C+CYC+ ++   P P   R F++ PV  LF  LPL L+++   
Sbjct  1     MEEEARNFISVWLTVLACVCYCYFVSSSLP-PGKLRLFSLLPVFSLFAALPLRLSTVLPT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstp------plplsTFIPFACLPIKVQRRKKVAG  766
             G ++FF+ WL SFKL LF+  +GPLSS+P         L  FI F C PIK+++ +    
Sbjct  60    GVTSFFVTWLASFKLLLFSFGKGPLSSSPGSHPDPSKSLFLFILFTCFPIKIRQAQDYPS  119

Query  765   NFKFSGSLR---KlvllgvvflvyyYKEFL----HPKVFLLFFVIHLYIVLEFMLFMVSG  607
                    L    KL+L G+  LVY +++ L    H K+ LL +   LY+ ++ ++ + + 
Sbjct  120   PQTPKLPLNLPSKLLLFGISILVYDHQDKLLLQGHQKLVLLLYSCMLYLYVDMIMGLSNA  179

Query  606   LVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRS-VSARFLPESL  430
                AV  VEL+ P DEP+LSTSLQDFWGRRWN+ VTN LR TVY P++S +  R      
Sbjct  180   AAHAVLGVELQMPSDEPYLSTSLQDFWGRRWNLTVTNALRHTVYKPLKSFLERRLRAAWA  239

Query  429   ASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRL  250
             A+  AVMA+F+VSG+MHEL++Y + RA PT EV  FF++ G CV +E+  K AV  ++RL
Sbjct  240   AAAAAVMAAFLVSGLMHELLYYYMTRARPTWEVTEFFVLQGLCVVVEVAAKAAVGERWRL  299

Query  249   PGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIE  121
                VS PL +  V  T+ WLFFP   RN  D +A  E  A +E
Sbjct  300   SRAVSTPLTVGFVAATAMWLFFPQLIRNGADERAIKECKALVE  342



>gb|KGN58561.1| hypothetical protein Csa_3G684670 [Cucumis sativus]
Length=348

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 137/344 (40%), Positives = 199/344 (58%), Gaps = 6/344 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  EI  F+     V   L +C +I    P   F RF  I P   LFL +PL   +IHL 
Sbjct  1     MAAEIRIFLQTLLLVSSSLSFCFSIRNSIPN-GFLRFLLILPFFSLFLYIPLQFQTIHLQ  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGpl-sstpplplsTFIPFACLPIKV-QRRKKVAGNFKF  754
             G+  FFIGWL SFKL LFA  +GPL S+     L  F+    LPI++ Q   +   N   
Sbjct  60    GSIGFFIGWLASFKLLLFAFGKGPLCSAAASSSLRRFLAIGSLPIEIPQDTNRSHPNPIL  119

Query  753   SGS-LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
               +   KL+LL +  +  Y+K +LHP ++L+ F   +Y +LE ++   +  V+A   VEL
Sbjct  120   PPTYFIKLLLLILTLVAIYFKNYLHPTLYLIVFCFVIYFLLEILIGGAAAFVKATLGVEL  179

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFV  397
                FDEP+LS SLQDFWG+RWN++ + ILR  VYDP R ++   + +  +++ A+ A+F 
Sbjct  180   LPYFDEPYLSVSLQDFWGKRWNLLTSRILRLAVYDPCRKLTVGIVGKKASAMVALTATFA  239

Query  396   VSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALT  217
             VSG+MHEL+++ +GR  PT EV  FFL++G  ++ E+ +K AV G+ ++P I+S      
Sbjct  240   VSGLMHELIYFYMGRLAPTWEVTCFFLLHGVSLSAEMAMKSAVRGRLKVPRIISTGFTWW  299

Query  216   LVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN--HRLVSP  91
              V+ TS WLFFP +FR K D +   E  A   FV N   +L++P
Sbjct  300   FVMTTSSWLFFPQFFRLKPDVRMMEEHAALGAFVKNVTVQLITP  343



>ref|XP_002866091.1| long-chain-alcohol O-fatty-acyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42350.1| long-chain-alcohol O-fatty-acyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=335

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 135/338 (40%), Positives = 199/338 (59%), Gaps = 5/338 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+ N I VW + +  + YC+ +     K    RF ++ PV  LFLVLPL  +S+HL+
Sbjct  1     MDEELKNLIKVWVSAIISISYCYYLPPRI-KSGVPRFLSVSPVLALFLVLPLFFSSLHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL   P      F  F C PIKVQ+  K   +     
Sbjct  60    LITAFFLTWLANFKLILFSFDKGPLIPIPTNLSRFFC-FTCFPIKVQQNPKSQNHLPKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y Y++ L P V L  + +HLY+ +E +L  V  +V      +LE  
Sbjct  119   FAIKVAIFGVLLHLYGYRQNLSPTVLLGLYFVHLYLEIEIILTFVKVVVFISLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +    A  P ++A+F+VSG
Sbjct  179   SNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERKMSSGWALFPGILAAFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++HEL+F+ + R  PTGEV  FF+++G C A E+ VK+   V  ++RL   VS  + +  
Sbjct  239   LVHELLFFYMIREMPTGEVTLFFVLHGVCTAAELAVKKKTTVMQRWRLSPAVSRLITVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
             V +T  WLF P   R+    +   E++ F+EFV  H+L
Sbjct  299   VFVTGGWLFTPQLKRSGVVERFTYEAVLFVEFV-KHKL  335



>ref|XP_006281726.1| hypothetical protein CARUB_v10027883mg [Capsella rubella]
 gb|EOA14624.1| hypothetical protein CARUB_v10027883mg [Capsella rubella]
Length=339

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 142/340 (42%), Positives = 198/340 (58%), Gaps = 8/340 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE+ NFI VW +    + YC+ I+    K    R  ++ PV  LFL+LPL  +S+H +
Sbjct  1     MDGELKNFIKVWISATISIAYCYYISARI-KAGVFRLLSVLPVCALFLLLPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF   +GPL   P      FI F C PIK Q+            
Sbjct  60    ELTAFFLTWLANFKLILFCFDQGPLVPLPSNLSR-FICFTCFPIKPQQNPNSPTQISKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+V+ GV+  +Y YK+ L P V L+ + +H+Y+ LEF L +V  LV      +LE  
Sbjct  119   FAIKVVIFGVLLQMYEYKQHLSPTVLLVLYSLHIYLELEFALMLVKILVFITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWG RWN+MV  ILRP VY PVR ++ R +    A    V A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGHRWNLMVPAILRPAVYTPVRRLAKRIMNSDQALFSGVFAAFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGI----VSGPLAL  220
              +HEL+F+ I R  PTGEV  FF+++G C A E+ VKR    + R PG+    VS  L +
Sbjct  239   AVHELIFFYITREMPTGEVTWFFVLHGLCTATEVAVKRTSLVQ-RWPGVSSPTVSRLLTV  297

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
               V++TS WLFFPP  R++   +   E+   I+FV  H+L
Sbjct  298   GFVVVTSGWLFFPPLIRSRMIERLANEAFLSIDFV-KHKL  336



>ref|XP_010449487.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Camelina sativa]
Length=348

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 194/333 (58%), Gaps = 4/333 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+ N I +W + +  + YC+ I     K    R  ++ PV  LFLVLPL  +S+HL+
Sbjct  1     MDEELKNLIKLWFSAIISISYCYYIPPRI-KSGVPRLLSVSPVLALFLVLPLFFSSLHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL   P      F  F C PIK Q+  K   +     
Sbjct  60    LITAFFLTWLANFKLILFSFDKGPLIPIPSNLPRFFC-FTCFPIKAQQNPKSQNHLPKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y Y++ LHP V L  + +HLY+ +E +L  V  LV      +LE  
Sbjct  119   FAIKVTIFGVLLHLYGYRQNLHPIVMLGLYFVHLYLEIEIILTFVKVLVFISLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +    A  P ++ +F+VSG
Sbjct  179   SNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERRMSSGWALFPGILVAFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++HEL+F+ + R  PTGEV  FF+++G C A E+ VK+   V  ++RL  +VS  L +  
Sbjct  239   LVHELLFFYMTREMPTGEVTLFFVLHGVCTAAELAVKKKTTVTKRWRLSPVVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             V LT  WLF P   R+    K   E++  +EFV
Sbjct  299   VFLTGVWLFTPQLRRSGVMEKFTYEAVLVVEFV  331



>ref|XP_008448090.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Cucumis melo]
Length=355

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/320 (42%), Positives = 198/320 (62%), Gaps = 9/320 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ++GE+  F+ V  T++  L Y + I+   PK  F R  ++FPV  LF +LPL+L+S+ L 
Sbjct  4     VDGELKRFMKVSLTIMVSLLYSYFISSKLPKGKF-RLISLFPVFFLFALLPLSLSSVFLT  62

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             GT AFFI WL +FKL LF+   GPL S PPL    F   ACLPIK+ + K++  N+K+  
Sbjct  63    GTIAFFITWLTTFKLLLFSFNLGPLVSDPPLTFPLFASVACLPIKI-KPKEIDPNYKYPE  121

Query  747   SL------RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
                      K++L  ++     + + L P V + F+ + LY+ ++F+L + S +V + F 
Sbjct  122   KYVNPKLPTKILLFAILIAANDHIDQLRPNVKICFYCLTLYLFVDFLLGVSSAIVGSAFD  181

Query  585   -VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVM  409
              V LE P +EP+L+TSLQDFWGRRWN++V+N LR  +Y PVR+     + +  A+   VM
Sbjct  182   GVVLEPPSNEPYLATSLQDFWGRRWNLLVSNTLRYGIYRPVRAAVDGVVGKRWAAGTGVM  241

Query  408   ASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGP  229
             A FV SG+MHE + Y I R  PT EV  FF+++G CV LE  +KR V G+++ P +V+  
Sbjct  242   AVFVASGVMHEQLVYYISREVPTWEVTWFFVLHGVCVVLEFELKRVVGGRWQPPAVVAWL  301

Query  228   LALTLVILTSFWLFFPPYFR  169
             L L+ +++T+ WLFFP   R
Sbjct  302   LTLSFMVVTASWLFFPQLMR  321



>ref|XP_010482976.1| PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 
3 [Camelina sativa]
Length=336

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 195/333 (59%), Gaps = 4/333 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+ NFIMVW +    + YC+ I+       F R  ++ PV  LFLV PL   S+H +
Sbjct  1     MDEELKNFIMVWVSATISISYCYYISARIKSGVF-RLLSVLPVCALFLVFPLFFXSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G+ AFF+ WL +FKL LF+  +GPLS  P      FI F C PIK     K         
Sbjct  60    GSIAFFLSWLANFKLILFSFDQGPLSPLPLTLSR-FICFTCFPIKPLENPKSQEQIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y YK+++ P V L+ + +H+Y+ LEF L +V  LV      +LE  
Sbjct  119   FAIKVAMFGVLLHMYEYKQYISPSVLLVLYSLHIYLELEFALMLVKVLVFITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWG RWN+MV  ILRP VY PVR ++ R +    A    V A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGHRWNLMVPAILRPAVYTPVRRLAKRIMNSDQALFLGVFATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA--VDGKFRLPGIVSGPLALTL  214
              +HEL+F+ I R  PTGEV  FF+++G C A E+ VK+   V   +R+  +VS  L +  
Sbjct  239   AVHELIFFYITRDMPTGEVTWFFVLHGVCTAAEVAVKKQKIVRRWWRVSPMVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             V++TS WLFFPP  R+    +   E+L  ++FV
Sbjct  299   VVVTSGWLFFPPLIRSGMVVRLAKEALMPVDFV  331



>ref|NP_200345.1| putative long-chain-alcohol O-fatty-acyltransferase 5 [Arabidopsis 
thaliana]
 sp|Q9FJ76.1|WAXS5_ARATH RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 
5; AltName: Full=Wax synthase 5 [Arabidopsis thaliana]
 dbj|BAB08551.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61298.1| wax synthase-like protein [Arabidopsis thaliana]
 gb|AED96618.1| putative long-chain-alcohol O-fatty-acyltransferase 5 [Arabidopsis 
thaliana]
Length=333

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/333 (40%), Positives = 196/333 (59%), Gaps = 4/333 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+ N I VW + +  + YC+ I     K    RF ++ PV  LFLVLPL  +S+HL+
Sbjct  1     MDEELKNLIKVWVSAIISISYCYYIPPRI-KSGAPRFLSVSPVLALFLVLPLFFSSLHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL   P      F  F C PIKVQ+  K   +     
Sbjct  60    LITAFFLTWLANFKLILFSFDKGPLIPIPTNFPRFFC-FTCFPIKVQQNPKSQNHLPKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                KL +  V+  +Y Y++ L P + L  + +HLY+ +E +L  V  +V      +LE  
Sbjct  119   FAIKLAIFAVLLHLYSYRQNLSPTILLGLYFVHLYLEIEIILTFVKVVVFISLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +    A  P ++A+F+VSG
Sbjct  179   SNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERKMSSGWALFPGILAAFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++HEL+F+ + R  PTGEV  FF+++G C A+E+ VK+   V  ++RL   VS  L +  
Sbjct  239   LVHELLFFYLIREMPTGEVTLFFVLHGVCTAVELAVKKKTTVAQRWRLSPGVSRVLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             V +T  WLF P   R+    +  +E++  +EF+
Sbjct  299   VFVTGGWLFTPQLKRSGVMERFTSEAVLLVEFI  331



>ref|XP_006401463.1| hypothetical protein EUTSA_v10015854mg, partial [Eutrema salsugineum]
 gb|ESQ42916.1| hypothetical protein EUTSA_v10015854mg, partial [Eutrema salsugineum]
Length=332

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 133/331 (40%), Positives = 193/331 (58%), Gaps = 3/331 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ NFI VW + +  + YC+ ++    K    R  ++ PV  LFLVLPL  +S+H  
Sbjct  1     MEEELKNFIKVWVSAIISVSYCYYLSTRI-KVGVFRLLSVLPVCALFLVLPLFFSSVHFT  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AF + WL +FKL LF+  +GPL   PP     FI FAC PIK Q+  K         
Sbjct  60    GFTAFSLTWLANFKLILFSFDKGPLFPAPPNISH-FICFACFPIKRQQNPKSQNQLPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+   Y YK +L P V L    +H+Y+  E +L  +  L+      +LE  
Sbjct  119   FPIKVAIFGVLLHTYDYKHYLSPTVLLFLHCLHVYLEFEILLAPIKLLLSIALGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+L+TSLQDFWG RWN+MV  ILRP +Y PVR ++ R +    A    V+A+F+VSG
Sbjct  179   FNEPYLATSLQDFWGHRWNLMVPAILRPAIYLPVRRITERKVNSDQALFLGVLATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR-AVDGKFRLPGIVSGPLALTLV  211
              +HEL+F+   R +PTGEV  FF+++GAC A+E+  KR +   ++++  +VS  L L  V
Sbjct  239   AVHELIFFYFTRESPTGEVTWFFVLHGACTAVEVAAKRTSFVRRWKMNLMVSRLLTLVFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             ++T  WLFFP   R+    +   E+L  I+F
Sbjct  299   VVTGGWLFFPQLTRSGMIERLSNEALFSIDF  329



>gb|KHN43857.1| Putative long-chain-alcohol O-fatty-acyltransferase 5 [Glycine 
soja]
Length=325

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 187/324 (58%), Gaps = 27/324 (8%)
 Frame = -3

Query  1119  KKKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTS  940
             K   MEGEI + + VW ++L  LCYC+ I+   PK    RF  + PV  LF +LPL LT+
Sbjct  5     KCMEMEGEIKSLMKVWISILASLCYCYFISSRVPK-GLLRFLTLSPVLYLFTILPLQLTT  63

Query  939   IHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGN-  763
             +   G +AFFI WL +FKL LF    GPL+      L  F+ FACLPI++      + + 
Sbjct  64    VLPTGVTAFFITWLTNFKLLLFTFDLGPLTPNSNSLLH-FLSFACLPIRLTPLNSKSKSK  122

Query  762   --------------FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFM  625
                           F FS SL  L            K+ LHP + L  +   LY++++ +
Sbjct  123   SKLKLHFIIFPIKVFLFSLSLMSLKDQY--------KQKLHPTIILGIYCTLLYLLMDVV  174

Query  624   LFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSV--SA  451
             L + + +V A F +EL+ P D+P+LSTSL+DFWGRRWN++VT  LR TVY PVRS+  S 
Sbjct  175   LGLCNIVVNAAFGIELQLPSDDPYLSTSLRDFWGRRWNLIVTYTLRHTVYKPVRSLLMSK  234

Query  450   RFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA  271
               L    AS+  VMA+F+VSG+MHEL+FY + R +PT EV  FFL++G C   E G  + 
Sbjct  235   TVLGPQWASVSGVMATFLVSGLMHELIFYYVTRVSPTWEVTCFFLLHGVCAVAEFGAVKW  294

Query  270   VDGKFRLPGIVSGPLALTLVILTS  199
             +  K+RL   + GP+ +  VI+T+
Sbjct  295   LGAKWRLHWALCGPITVAFVIVTA  318



>ref|XP_010503909.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Camelina 
sativa]
Length=346

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 198/327 (61%), Gaps = 12/327 (4%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLT-SIHLAGTSAF  913
             +FI  W  V+  LCY   I  L PK    R   I PV  +F ++PL +  SIHL G +AF
Sbjct  3     SFIKAWGLVIISLCYTFFIARLVPK-GIQRLILIIPVLLIFFIVPLLMKPSIHLLGITAF  61

Query  912   FIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKKVAGNFKFSGSLR-  739
              IGWL +FK+ LFAL RGPLSS P       F+  +CLPIK+Q   K   +    G  R 
Sbjct  62    LIGWLANFKVFLFALGRGPLSSNPKPLSLPIFLAVSCLPIKIQLSTKSPKSGSHGGGSRE  121

Query  738   -------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
                    K  LL ++  VY Y   L  K  L  + IH+YI LE +L  ++ +VRA+  +E
Sbjct  122   GPLSYTIKAFLLVLLIKVYDYSSKLPDKALLTLYAIHIYITLELILAAMAAVVRAMSDLE  181

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             LE  F+EP+L+TSLQDFWGRRWN+MVT ILRPTVYDP+  + +  L  + + +PA+  +F
Sbjct  182   LEPQFNEPYLATSLQDFWGRRWNLMVTGILRPTVYDPMVQLFS-VLGRNWSRVPAIFGTF  240

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
             VVSGIMHEL+F+ +GR  P  +VM FFL++G C  +EI +K+ ++G+++L   +S  L L
Sbjct  241   VVSGIMHELIFFYMGRLRPDWKVMCFFLIHGFCTTVEIIIKKTINGRWKLQTAISQLLTL  300

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAE  139
               VI+T+ WLF P + R     +A  E
Sbjct  301   GFVIVTALWLFLPEFKRCNIADRAIEE  327



>ref|XP_010515642.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1 [Camelina sativa]
Length=346

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 198/327 (61%), Gaps = 12/327 (4%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLT-SIHLAGTSAF  913
             +FI  W  V+  LCY   I  L PK    R   I PV  LF ++PL +  SIHL G +AF
Sbjct  3     SFIKAWGLVIISLCYTFFIARLVPK-GIQRLILIIPVLLLFFIVPLLMKPSIHLLGITAF  61

Query  912   FIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKKVAGNFKFSGSLR-  739
              IGWL +FK+ LFAL RGPLSS P       F+  +CLPIK+Q   K   +    G  R 
Sbjct  62    LIGWLANFKVFLFALGRGPLSSDPKPLSLPIFLAVSCLPIKIQLSPKSPKSGSHGGGSRE  121

Query  738   -------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
                    K  LL ++  VY Y   L  K  L  + IH+YI LE +L  ++ +VRA+  +E
Sbjct  122   GPLSYTIKAFLLVLLIKVYDYSSKLPDKALLTLYAIHIYITLELILAAMAAVVRAMSDLE  181

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             LE  F+EP+L+TSLQDFWGRRWN+MVT ILRPTVYDP+  + +  L  + + +PA+  +F
Sbjct  182   LEPQFNEPYLATSLQDFWGRRWNLMVTGILRPTVYDPMVQLFS-VLGRNWSRVPAIFGTF  240

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
             VVSGIMHEL+F+ +GR  P  +VM FFL++G C  +EI +K+ ++G+++L   +S  L L
Sbjct  241   VVSGIMHELIFFYMGRLRPDWKVMCFFLIHGFCTTVEIIIKKTINGRWKLQTAISQLLTL  300

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAE  139
               VI+T+ WLF P + R     +A  E
Sbjct  301   GFVIVTALWLFLPEFKRCNIADRAIEE  327



>ref|XP_010059565.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Eucalyptus grandis]
Length=296

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 136/332 (41%), Positives = 187/332 (56%), Gaps = 53/332 (16%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ N I VW +V+  L YC  I+ L P     R F   PV  LFL+LPL LTS+ LA
Sbjct  1     METELQNLIFVWISVIAALTYCRYISVLVP-VGLKRLFFFLPVILLFLLLPLRLTSLTLA  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G ++FF+ WL +FKL L A  +G                   P++               
Sbjct  60    GLTSFFVAWLSNFKLLLLAYGKG-------------------PLR---------------  85

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                               +++H KV +L +++H+YIVLE  L +V      +  V +E  
Sbjct  86    -----------------SDYVHEKVMMLAYLVHVYIVLEVDLAVVGTAAARLIGVAVEPQ  128

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+L+TSLQDFWGRRWN+MVT+ILRP+VY+P+RS S   +    A LPAV+ +F VS 
Sbjct  129   FNEPYLATSLQDFWGRRWNLMVTSILRPSVYEPIRSASGHLVGRQWARLPAVLTTFAVSA  188

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG-KFRLPGIVSGPLALTLV  211
             +MHEL+FY IGR  PT  VM FFL++G  VA+EI VK+A+ G +++LP  VS  L +  V
Sbjct  189   LMHELIFYYIGRKEPTWVVMWFFLLHGVAVAVEITVKKALRGTRWQLPAEVSRLLTMGFV  248

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             + T FWLF P   R     K+  +++A IEFV
Sbjct  249   VATGFWLFLPSLLRYDTLAKSERKTIAIIEFV  280



>ref|XP_008448089.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Cucumis melo]
Length=353

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 139/335 (41%), Positives = 194/335 (58%), Gaps = 2/335 (1%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
              +  +GE      VWT  +  + Y +      PK    R  A+FPV  +FL+LPLNL S 
Sbjct  15    NQMNDGEFYRLAEVWTIAIPLIAYSYYFASKIPK-GIPRLLALFPVLFIFLLLPLNLRSF  73

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK-KVAGNF  760
             HL G +AFF+ WLG+FKL LFA   GPL S+P      F    CLPIK+   K ++  N 
Sbjct  74    HLCGPTAFFLSWLGNFKLLLFAFDLGPLFSSPLPSFLHFAATLCLPIKISSHKSEIRRNG  133

Query  759   KFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
                    K++LL +V  +Y Y+  + P +  + + +HLY  +E +L + S   +A+F   
Sbjct  134   NPIVLCLKVLLLAIVVRLYDYRNRMDPAIVSVLYFLHLYFGIEIVLAVCSLPGKAIFGAP  193

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
              E  FDEP+LSTSLQDFW RRWN+MV +ILRP VYDP R +++R      A    ++A+F
Sbjct  194   FEPQFDEPYLSTSLQDFWSRRWNLMVPSILRPAVYDPTRIITSRAFGRRWAQFLGMVATF  253

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
             VVSG+MHEL+FY   RA PT EV  FF+++G C+A E+  K AV G + +  +VSGP++L
Sbjct  254   VVSGLMHELIFYYFTRAPPTWEVTCFFVLHGFCMAAEVAAKAAVAGLWNIHPMVSGPISL  313

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               ++ T+ WL  P   RN    KA  E  A   F+
Sbjct  314   VFLMATARWLMLPQLIRNGVVDKAIGEYYAMAHFL  348



>ref|XP_004244342.2| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Solanum lycopersicum]
Length=350

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 193/316 (61%), Gaps = 9/316 (3%)
 Frame = -3

Query  1053  LCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLF  874
             LCYC+ I+   PK    R  ++ P+  LF +LPL  +S  L   + F I WL  FKL LF
Sbjct  14    LCYCYFISAKIPK-GIPRLISLLPIFYLFTILPLYFSSAFLTAITTFSITWLAIFKLVLF  72

Query  873   ALCRGplsstpp----lplsTFIPFACLPIKVQRRKKVAGNFKFSGSLRKlvllgvvflv  706
             A  +GPL         + L  FI  A LP++             S +++ ++   ++ +V
Sbjct  73    AFDQGPLIHNASNPKIISLPVFISIAALPLRTTFTPNPNRKNPMSSAVQLVIFAVLMEIV  132

Query  705   yyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA--VFRVELEAPFDEPHLSTSLQD  532
              ++K  +HPK+ L+F+ + ++++++ ++ + S +V+      +E+E+P DEP+ STSLQD
Sbjct  133   LHHKSVIHPKLVLIFYSVMIFLMIDILIALPSLIVKNFLCLDIEIESPSDEPYCSTSLQD  192

Query  531   FWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGR  352
             FWGRRWN+ VT+ LR TVY+PVR V    +    A   A +A+F+VSG+MHEL+FY +  
Sbjct  193   FWGRRWNLTVTHTLRFTVYNPVRLVLLNVIGRKWAQHSASLATFLVSGLMHELIFYYVNN  252

Query  351   AT-PTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPY  175
                P+GE+  FF+++G C+++EI VK+A+    RLPG+VSGPLA+  V++T+F LFFPP 
Sbjct  253   GVRPSGEITGFFMLHGLCLSVEIEVKKALKDTLRLPGLVSGPLAVGFVVVTAFGLFFPPI  312

Query  174   FRNKGDTKACAESLAF  127
              RN G  K+  E + F
Sbjct  313   IRN-GVEKSILEEVGF  327



>ref|XP_009591431.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Nicotiana tomentosiformis]
Length=351

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 130/342 (38%), Positives = 198/342 (58%), Gaps = 20/342 (6%)
 Frame = -3

Query  1068  TVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSF  889
             +V+  L YC+ ++   PK    R  ++ P+  LF +LPL  +S  L   + FFI WL +F
Sbjct  9     SVIISLYYCYFLSAKIPK-GIPRLISLLPIFYLFTILPLYFSSAFLIALTTFFITWLANF  67

Query  888   KLTLFALCRGplsstpplpls-----TFIPFACLPIKVQRR----------KKVAGNFKF  754
             KL LFA  +GPLS +            FI  A LP++ ++           KK+  N   
Sbjct  68    KLLLFAFNQGPLSLSTKNATKKLSLPIFISMAALPLRSKQHNLKSNEPNPTKKIPLNLAA  127

Query  753   SGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELE  574
                L    L   + L +++K  +HP + L+ +   ++++++ ++ + S + + +  +ELE
Sbjct  128   EFVL----LAIFLELTFHHKSQIHPNLVLICYCFMVFLMIDILVALSSSIAKILVGLELE  183

Query  573   APFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVV  394
              P +EP+LSTSLQDFWG+RWN+ VTN LR TVY+PVRS  +  + ++ A   AV+A+FVV
Sbjct  184   PPSNEPYLSTSLQDFWGKRWNLTVTNTLRLTVYNPVRSALSEVIGKNWALRVAVLATFVV  243

Query  393   SGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTL  214
             SG+MHEL+FY +   +P+ E+  FF+++G CV +EIGVKRAV   +RLP  VSGPL +  
Sbjct  244   SGLMHELIFYYVNGVSPSWEMTLFFVLHGLCVMVEIGVKRAVKDTWRLPWFVSGPLTVGF  303

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLVSPE  88
             V+ T+F LFFPP  RN  D +   E     +F+    L  P 
Sbjct  304   VVATAFGLFFPPIIRNGADERVLEEVGTCYDFIKTKMLQLPN  345



>ref|XP_010686732.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1 [Beta vulgaris 
subsp. vulgaris]
Length=388

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 145/385 (38%), Positives = 204/385 (53%), Gaps = 56/385 (15%)
 Frame = -3

Query  1104  EGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAG  925
             + E+ N   VW ++     Y + I G   +  FTR  AI PV  LFL+LPLNLTSIH  G
Sbjct  6     QDELKNLGKVWLSIFVSFSYSYVI-GKITQKGFTRLVAILPVISLFLILPLNLTSIHFCG  64

Query  924   TSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKV---------------  790
              +AFFI WL +FKL LFA  + PL   PP+    F+  ACLPIK+               
Sbjct  65    LTAFFISWLANFKLLLFAFGKPPLCFNPPISFPLFLLVACLPIKIQHHPPPKNSPNQENN  124

Query  789   -------------------------------QRRKKVAGNFKFSGSLRKlvllgvvflvy  703
                                            Q +   +        L K +LL ++  +Y
Sbjct  125   QNPDQKSQKNSYPHNKNSQLQQNNQNPDQKPQNKSHPSPQKSLWNYLIKFILLSLIIKIY  184

Query  702   yYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWG  523
              Y + +HPK+  L +  H+Y  LE +L +++        +ELE  F+EP LSTSLQDFWG
Sbjct  185   DYSDQIHPKILWLIYFFHIYFALEIVLAILAKSANFFLGLELEPQFNEPLLSTSLQDFWG  244

Query  522   RRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATP  343
             +RWN+MVT+ILRPTVY P   +  + +    ASL A++A+F+VS IMHEL+FY IGR  P
Sbjct  245   KRWNLMVTSILRPTVYLPTLDLFNKIVGRKTASLLAIIATFIVSAIMHELIFYYIGREFP  304

Query  342   TGEVMSFFLVNGACVALEIGVKRAVDGKFRL----PGIVSGPLALTLVILTSFWLFFPPY  175
             T EV  FFL++G C+ +EI +K+   G+ R     P  +SG    + VI+T FWLF PP 
Sbjct  305   TFEVTWFFLLHGFCLCVEISIKKY--GRERKWWVPPRWLSGFATASFVIVTGFWLFLPPL  362

Query  174   FRNKGDTKACAE---SLAFIEFVIN  109
              +   D++   E   + AF++ V++
Sbjct  363   LKAGLDSRGLGEYAVAGAFVKRVLD  387



>gb|AES63951.2| membrane bound O-acyl transferase family protein, putative [Medicago 
truncatula]
Length=335

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 190/328 (58%), Gaps = 15/328 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  EINNFIMVWT       Y + I  + PK    R  ++FP   + L+LP+ LTS+HL 
Sbjct  1     MIEEINNFIMVWTVATTLFWYSYRIGKVIPKGR-KRLVSLFPPILILLLLPVRLTSVHLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGN-----  763
               S+FF+ WL +FKL LFA  +GPL+S PPL L  F+  A LPIK Q       N     
Sbjct  60    SISSFFLAWLSAFKLLLFAFAKGPLASNPPLSLPHFVLLASLPIKFQHNNHTNKNQIKVA  119

Query  762   -FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFR  586
                +   +   +LL      Y  +E  HP + +  + +HLY  LE  L +++ + R V +
Sbjct  120   PLNWRELVVMSILLYFFIPSYEKRESFHPLILMSLYGLHLYTGLEIFLTVITKIARKVVQ  179

Query  585   VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMA  406
             VELE PF++P+LSTS+QDFWGRRWN+MVT IL P++Y+PV   ++  +    A +PAVM 
Sbjct  180   VELEQPFNKPYLSTSVQDFWGRRWNIMVTRILHPSIYEPVMKAASHVIGRKWAPIPAVMV  239

Query  405   SFVVSGIMHELVFYNIGRATPTGEV-------MSFFLVNGACVALEIGVKRAVDGKFR-L  250
             +F VSG+MH+L+FY++ R   T E        M FF ++G CVALEI  K+    K + L
Sbjct  240   TFTVSGLMHDLIFYHMKREKATWEAWEPCWDSMCFFFIHGVCVALEIAYKKIFKPKHQLL  299

Query  249   PGIVSGPLALTLVILTSFWLFFPPYFRN  166
             P +VS  L +  V+ T+ + F P   R+
Sbjct  300   PRVVSCTLTMAFVVSTALYFFVPALVRS  327



>ref|XP_010426792.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Camelina 
sativa]
Length=347

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 199/328 (61%), Gaps = 13/328 (4%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLT-SIHLAGTSAF  913
             +FI  W  V+  LCY   I  L PK    R   I PV  +F ++PL +  SIHL GT+AF
Sbjct  3     SFITAWGIVIISLCYTFFIARLVPK-GIQRLILIIPVLLIFFIVPLLMKPSIHLLGTTAF  61

Query  912   FIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKK------VAGNFKF  754
              IGWL +FK+ LFAL  GPLSS P       F+  +CLPIK+Q   K        G    
Sbjct  62    LIGWLANFKIFLFALGLGPLSSNPKPLSLPIFLAVSCLPIKIQLSTKPPPKSGSHGGGSR  121

Query  753   SGSLRKlvllgvvflvyyYKEF---LHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
              G L   +   ++ L+    ++   L  K  L  + IH+YI LE +L  ++ +VRA+  +
Sbjct  122   EGPLSYTIKAFLLVLLIKVYDYSSKLPDKALLTLYAIHIYITLELILAAMAAVVRAMSDL  181

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMAS  403
             ELE  F+EP+L+TSLQDFWGRRWN+MVT ILRPTVY+P+  + +  L  + + +PA+  +
Sbjct  182   ELEPQFNEPYLATSLQDFWGRRWNLMVTGILRPTVYEPMVQLFS-VLGRNWSRVPAIFGT  240

Query  402   FVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLA  223
             FVVSGIMHEL+F+ +GR  P  +VM FFL++G C  +EI +K+A++G+++L   +S  L 
Sbjct  241   FVVSGIMHELIFFYMGRLRPDWKVMWFFLIHGFCTTVEIIIKKAINGRWKLQTAISQLLT  300

Query  222   LTLVILTSFWLFFPPYFRNKGDTKACAE  139
             L  VI+T+ WLF P + R K   +A  E
Sbjct  301   LGFVIVTALWLFLPEFTRCKIADRAIEE  328



>ref|XP_010545118.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1 [Tarenaya hassleriana]
Length=376

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/376 (38%), Positives = 201/376 (53%), Gaps = 34/376 (9%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+G     + VW  V+  LCYC  +  L PK    R   + PV   F ++PL+++S+H  
Sbjct  1     MDGA-KKLVKVWALVIASLCYCFFVGKLVPK-GIKRLLLVAPVVFAFFLVPLHISSVHFG  58

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKKVAGNF---  760
             G +AFF+ WL +FKL LFA  RGPLS  P       F+  +CLPIK++      GN    
Sbjct  59    GITAFFVAWLANFKLLLFAFGRGPLSPDPIPHSLPIFLAVSCLPIKIRVDPDSTGNDHDP  118

Query  759   -----------------------KFSGSLR---KlvllgvvflvyyYKEFLHPKVFLLFF  658
                                       G L    K +LL +    Y Y E +  K  L  +
Sbjct  119   SRVSHLHTKPKSERGPDGTGKPKSREGPLNYTIKALLLVLFLKAYDYSERMPRKAVLALY  178

Query  657   VIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTV  478
              +H+Y +LE +L   +   RA   +ELE  F E +L+TSLQDFWGRRWN+MV++ILRPTV
Sbjct  179   ALHVYFILELILAAAAAGGRATLGLELEPQFKEAYLATSLQDFWGRRWNLMVSSILRPTV  238

Query  477   YDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACV  298
             Y+P   + +  L +  A LPAV ++FVVS +MHEL+FY +GR  P  E+  FFL++G C 
Sbjct  239   YEPSLRLFSSVLGKMRAPLPAVFSTFVVSALMHELIFYYMGRLRPAWELTWFFLIHGICT  298

Query  297   ALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE--SLAFI  124
              +EI VK+A+ G++R P  V+  L +  V+ T+ WLF P + R K   KA  E  +L  I
Sbjct  299   TVEIAVKKAIGGRWRFPTAVARMLTVGFVMATALWLFLPEFERCKIADKAFEEYKALGAI  358

Query  123   EFVINHRLVSPESMTC  76
               +I   L+   + T 
Sbjct  359   LDLITQGLLGSATATA  374



>ref|XP_004173371.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
4-like [Cucumis sativus]
Length=361

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 191/334 (57%), Gaps = 2/334 (1%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
              +   GE      VWT  +  + Y +      PK    R  A+FPV  +FL+LPLNL S 
Sbjct  20    NQMNHGEFYRLAKVWTIAIPLISYSYYFTSKIPK-GIPRLLALFPVLFIFLLLPLNLRSF  78

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFK  757
             HL G +AFF+ WLG+FKL LFA   GPL S+P      F    CLPIK+   K       
Sbjct  79    HLCGPTAFFLSWLGNFKLLLFAFDLGPLFSSPLPSFLHFAATLCLPIKINNNKSQIHRIG  138

Query  756   FSGSL-RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
                 L  K++LL +V  +Y Y+  +HP +  + + +HLY+ +E +L + S   +A+F   
Sbjct  139   NPMVLCLKVLLLAIVVRLYDYQNRMHPAIVSVLYFLHLYLGVEIVLALCSLPAKAIFGAP  198

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             +E  FDEP+LS+SLQDFW RRWN+MV +ILRP VYDP R +++R      A L  ++A+F
Sbjct  199   MEPQFDEPYLSSSLQDFWSRRWNLMVPSILRPAVYDPTRVITSRIFGRRRAQLVGMVATF  258

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
             VVSG MHEL+FY   RA PT EV SFF+++G C+A E+  K A+     +  ++S P  L
Sbjct  259   VVSGFMHELIFYYFTRAPPTWEVSSFFVLHGFCMAAEVAAKAALAWPSNIHPMLSRPTCL  318

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
               +++T+ WL  PP  RN    +A  E  A   F
Sbjct  319   FFLMVTARWLMLPPLIRNGVVDEAIGEYYATAHF  352



>ref|XP_007020660.1| Acyltransferase, putative [Theobroma cacao]
 gb|EOY12185.1| Acyltransferase, putative [Theobroma cacao]
Length=371

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/367 (37%), Positives = 195/367 (53%), Gaps = 38/367 (10%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE  NFI VW   +  LCYC+ I+   PK    R  +  P+  L  +LP +L+++HL 
Sbjct  1     MDGEFKNFIKVWILAITSLCYCYYISARVPK-GLPRLLSFLPIIYLLFILPFSLSTVHLC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AF + WL +FKL L +  +GPLS +PP     FI  ACLPIKV++          S 
Sbjct  60    GITAFCLAWLANFKLLLLSFGQGPLSPSPPKLFH-FISMACLPIKVKQDPPSQPPQTSSS  118

Query  747   SLRKlvllgvvflvyyYKEFLHPK---------------------VFLLF----------  661
             ++ K +          ++    P+                     VF L+          
Sbjct  119   AIGKTLNSKNSETPCRHQSIQTPQKAFPRTHKRILLFIKAVLLAVVFHLYEYRQHLPKNM  178

Query  660   ----FVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNI  493
                 +  H+Y+ LE  L + +   R +   ELE  F+EP+L+TSLQDFWGRRWN+MVT I
Sbjct  179   VLTLYCCHIYLELEIALALCATPARVLLGFELEPHFNEPYLATSLQDFWGRRWNLMVTRI  238

Query  492   LRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLV  313
             L   VY+P+R +S   L    A LPA++A+FVVSG++HEL++Y      PT EV  FF++
Sbjct  239   LHLAVYNPIRRISMPALGSKWAPLPAILAAFVVSGLIHELIYYYFTCMHPTWEVTWFFML  298

Query  312   NGACVALEIGVKRAV-DGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAES  136
             +G CVA+E+ +K+ V   ++RL   +S PL +  +++T FWLFF        D K   ES
Sbjct  299   HGVCVAMEVAMKKIVTTDRWRLHPAISVPLTVGFMVVTGFWLFFAQIVTYGIDEKLVQES  358

Query  135   LAFIEFV  115
             L  + FV
Sbjct  359   LISLNFV  365



>ref|XP_006282274.1| hypothetical protein CARUB_v10028555mg [Capsella rubella]
 gb|EOA15172.1| hypothetical protein CARUB_v10028555mg [Capsella rubella]
Length=344

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/335 (40%), Positives = 192/335 (57%), Gaps = 6/335 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+ NFI VW + +  + YC+ I+       F R   + PV  LFLV PL  +S+H +
Sbjct  1     MDEELKNFIKVWISAIISIAYCYYISARIKSGVF-RLLTVLPVCALFLVFPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G+ AFF+ WL +FKL LF+  +GPLS  P      FI F C PIK Q+            
Sbjct  60    GSIAFFLTWLANFKLILFSFDQGPLSPLPSTLSR-FICFTCFPIKPQQNPNPQNQIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y YK++L P + L+ + +H+Y+ LE  L +V GLV      +LE  
Sbjct  119   FAIKVAIFGVLLHMYEYKQYLSPSLLLVLYSLHIYLELEIALMLVRGLVFMTLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWG RWN+MV  I R  VY PVR ++ R +    A    V A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGHRWNLMVPAIFRVAVYTPVRRLAKRIMNSDQALFLGVFATFLVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA--VDGKFRLPGI--VSGPLAL  220
              +HEL+F+ I    PTGEV  FF+++G C A E+ VK+   V   +R+     VS  L +
Sbjct  239   AVHELIFFYITHDMPTGEVTWFFVLHGLCTAAEVAVKKQTVVKRWWRVSPTMSVSQLLTV  298

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               V++TS WLFFPP  R+    +   E+L  I+FV
Sbjct  299   AFVVVTSGWLFFPPLIRSGMIERLANEALMPIDFV  333



>ref|XP_009120051.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Brassica rapa]
Length=367

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 197/333 (59%), Gaps = 4/333 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ + I +W + +  + YC+ I     K    R  ++ PV  LFLVLPL  +S+HL+
Sbjct  1     MEEELTSLIKIWISAVISISYCYYIPPRI-KSGVPRLRSLCPVLALFLVLPLCFSSVHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL   PP     FI F C PIK Q+  K   +     
Sbjct  60    LITAFFLTWLANFKLILFSFDKGPLIPLPPSLPR-FICFTCFPIKAQQNSKSQNHLPKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y Y++ L P + L  + +HLY+ +E +L  V  +V      +LE  
Sbjct  119   FAIKVAIFGVLLHLYGYRKNLSPALLLALYFVHLYLEIEIILSFVKNVVCIFLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +    A  P ++A+F+VSG
Sbjct  179   SNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERRMSSDWALFPGILAAFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++HEL+F+ + R  PT EV  FF+++G C A+E+ VK+   V  +++L  +VS  L +  
Sbjct  239   LVHELLFFYLTREMPTWEVTMFFVLHGVCTAVELAVKKKTTVIQRWQLSPVVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             VI+T  WLF P   R+    +   E+L  ++F+
Sbjct  299   VIVTGGWLFTPQLIRSGVIERFTNEALLVVDFI  331



>ref|XP_004149741.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Cucumis 
sativus]
Length=354

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 192/324 (59%), Gaps = 6/324 (2%)
 Frame = -3

Query  1047  YCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLFAL  868
             +C +I    P   F RF  I P   LFL +PL   +IHL G+  FFIGWL SFK+ LFA 
Sbjct  27    FCFSIRNSIPN-GFLRFLLILPFFSLFLYIPLQFQTIHLQGSIGFFIGWLASFKILLFAF  85

Query  867   CRGpl-sstpplplsTFIPFACLPIKV-QRRKKVAGNFKFSGS-LRKlvllgvvflvyyY  697
              +GPL S+     L  F+    LPI++ Q   +   N     +   KL+LL +  +  Y+
Sbjct  86    GKGPLCSAAASSSLRRFLAIGSLPIEIPQDTNRSHPNPILPPTYFIKLLLLILTLVAIYF  145

Query  696   KEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRR  517
             K +LHP ++L+ F   +Y +LE ++   +  V+A   VEL   FDEP+LS SLQDFWG+R
Sbjct  146   KNYLHPTLYLIVFCFVIYFLLEILIGGAAAFVKATLGVELLPYFDEPYLSVSLQDFWGKR  205

Query  516   WNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTG  337
             WN++ + ILR  VYDP R ++   + +  +++ A+ A+F VSG+MHEL+++ +GR  PT 
Sbjct  206   WNLLTSRILRLAVYDPCRKLTVGIVGKKASAMVALTATFAVSGLMHELIYFYMGRLAPTW  265

Query  336   EVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGD  157
             EV  FFL++G  ++ E+ +K AV G+ ++P I+S       V+ TS WLFFP +FR K D
Sbjct  266   EVTCFFLLHGVSLSAEMAMKSAVRGRLKVPRIISTGFTWWFVMTTSSWLFFPQFFRLKPD  325

Query  156   TKACAESLAFIEFVIN--HRLVSP  91
              +   E  A   FV N   +L++P
Sbjct  326   VRMMEEHAALGAFVKNVTVQLITP  349



>ref|XP_010688612.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=359

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 139/352 (39%), Positives = 200/352 (57%), Gaps = 18/352 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFP-KPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
             ME EI NF+ +W   +C  CY  +++ +F  +    R   I P+  LF VLPL+L+S HL
Sbjct  1     MESEIKNFMKIWLFAICSACYSLSLSRIFHIRSGIPRLLFILPIIYLFTVLPLSLSSFHL  60

Query  930   AGTSAFFIGWLGSFKLTLFALCRG-------------plsstpplplsTFIPFACLPIKV  790
              G + FF+ WL +FKL L+A   G               ++   L LS FI  A LPIKV
Sbjct  61    GGPTIFFLVWLANFKLLLYAFDLGPLSTNPITNNNNNNNNNVNSLSLSHFISIALLPIKV  120

Query  789   -QRRKKVAGNFKFSGSLRKlvllgvvflvyyYKEFLH--PKVFLLF-FVIHLYIVLEFML  622
              Q++     N K+   L     L    LV    +F    PK  LL  +  HLY+ +E  L
Sbjct  121   NQQQPSKPTNNKWKSVLIIAFKLLAFALVIKIYDFTQHLPKFLLLINYCCHLYLGVEVTL  180

Query  621   FMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFL  442
              +V+ +VRA   + L+  F+EP+L+TSLQDFWGRRWN+MV++ILR +V++P+R V +  +
Sbjct  181   AVVAAIVRATLGLGLDPQFNEPYLATSLQDFWGRRWNLMVSDILRLSVFNPIRRVFSPLV  240

Query  441   PESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG  262
              +  A +  ++A+F VSG+MHEL+FY   R  PT EV  FF+++G C A+E+ VK AV G
Sbjct  241   GKRWALVVGMIAAFTVSGLMHELIFYYFTRVNPTWEVTWFFVLHGMCTAVEVVVKEAVGG  300

Query  261   KFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINH  106
             + +L  ++SG L +  V +T++WLF P   RN  D K   E      FV  H
Sbjct  301   RLQLHRLISGTLTIGFVAVTAWWLFLPQIIRNGVDVKVINEYPVMFSFVKQH  352



>ref|XP_006292828.1| hypothetical protein CARUB_v10019087mg [Capsella rubella]
 gb|EOA25726.1| hypothetical protein CARUB_v10019087mg [Capsella rubella]
Length=345

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 196/325 (60%), Gaps = 9/325 (3%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFF  910
             +F   W  V+  LCY   I  L PK        I      F++  L + S+HL G +AFF
Sbjct  3     SFFKAWGVVILSLCYTFLIGKLLPKGIKRLILIIPVFFIFFILPFLMIPSVHLLGVTAFF  62

Query  909   IGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKKVAGNFKFSGSLR--  739
             I WL +FKL LFAL RGPLSS P       F+  + LPIK+Q + K   +    GS    
Sbjct  63    IAWLANFKLFLFALGRGPLSSNPKPLSLPVFLAVSSLPIKIQLKSKPLKSRSHEGSREGP  122

Query  738   -----KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELE  574
                  K V+L ++  VY Y   L  KV L+ + IH+Y  LE +L  ++ +VRA+  +ELE
Sbjct  123   LIYTIKAVILVILIKVYDYSSKLPDKVLLILYAIHIYFTLELILAAMAAVVRAMSDLELE  182

Query  573   APFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVV  394
               F++P+L+TSLQDFWGRRWN+MVT ILRPTVY+P+  + +  L  + + +PA+  +FVV
Sbjct  183   PQFNKPYLATSLQDFWGRRWNLMVTGILRPTVYEPMVQLFS-ILGRNWSKVPAIFGTFVV  241

Query  393   SGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTL  214
             SGIMHEL+F+ +GR  P  +VM FFL+NG C  +EI +K+A++G+++L   VS  L L  
Sbjct  242   SGIMHELIFFYMGRLRPDWKVMWFFLINGFCTTVEIIIKKAINGRWKLQTAVSQFLTLGF  301

Query  213   VILTSFWLFFPPYFRNKGDTKACAE  139
             VI+T+ WLF P + R K   +A  E
Sbjct  302   VIVTALWLFLPEFERCKIADRALEE  326



>ref|XP_009115900.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Brassica 
rapa]
Length=346

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/310 (42%), Positives = 186/310 (60%), Gaps = 9/310 (3%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFF  910
             +FI  W  V+  LCY H +  L  K    R     PV   F V+PL+L++IH  G +AFF
Sbjct  3     SFISAWCLVIISLCYTHVVARLVSK-GMRRMILFIPVFLYFFVVPLSLSTIHSIGITAFF  61

Query  909   IGWLGSFKLTLFALCRGplsstp--plplsTFIPFACLPIKVQRRKKVAGNFKFSGSLRK  736
             I WL +FKL LFAL RGPL+S     L L  F+  +CLPIK+    K   ++     L  
Sbjct  62    ISWLANFKLFLFALGRGPLASDTKPLLSLPIFLAVSCLPIKIPLSPKPTTSYSSREGLLY  121

Query  735   lvllgvvflvyy----YKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
               ++  + ++      Y   L  K  L  + IH+Y+ LE +L   + +VRA+  +ELE  
Sbjct  122   YTIMVTLLVLMTKVYAYNNKLPDKAVLTLYAIHIYLSLELILSATATMVRAMSSLELEPQ  181

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F++P+L+TSLQ+FWGRRWN+ V+ ILRPTVY+P+  + +   P + +  PAV A+FVVSG
Sbjct  182   FNKPYLATSLQEFWGRRWNLAVSGILRPTVYEPMVQLFSVLGP-NWSQAPAVFATFVVSG  240

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFR-LPGIVSGPLALTLV  211
             +MHEL+F+ +G   P  +VM FFLV+G C  +EI VK+ V+G++R +P  +S  L    V
Sbjct  241   LMHELIFFYLGGLMPDWKVMWFFLVHGLCTTVEIAVKKKVNGRWRFIPTGISRVLTFGFV  300

Query  210   ILTSFWLFFP  181
             ++T  WLF P
Sbjct  301   MVTGLWLFLP  310



>ref|XP_010059563.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Eucalyptus 
grandis]
Length=366

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 212/343 (62%), Gaps = 13/343 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E++NF+ VW +V+  L YC  I+ L P     R F   PV  LFL+LPL LT++ LA
Sbjct  1     METELHNFVFVWISVVAALIYCRYISILLPVGP-KRLFFFLPVILLFLLLPLRLTTLSLA  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGpls---stpplplsTFIPFACLPIKVQ-------RRK  778
             G ++F I WL +FKL L A  +GPL    ++ PL L  F+  A LPIK+         + 
Sbjct  60    GLTSFSIAWLSNFKLLLLAYGKGPLVPPPTSSPLSLQLFVTTASLPIKISPSAESPTSKN  119

Query  777   KVAGNFKFSGS-LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLV  601
                G  K   + + K +LL  +F +Y   +++H KV +L + +H+YIVLE  L ++    
Sbjct  120   GGGGGLKSPANYVAKCLLLVSLFPLYQRNDYVHEKVMMLAYSVHVYIVLEVALAVIGVAA  179

Query  600   RAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASL  421
               +  V +E  FDEP+L+TSLQDFWGRRWN+M T+ILRP+VY+P+R  S R +    A+L
Sbjct  180   ARLIGVAVEPQFDEPYLATSLQDFWGRRWNLMATSILRPSVYEPIRLASGRLVGRQWAAL  239

Query  420   PAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG-KFRLPG  244
             PAV+A+F VS +MHEL+FY IGR  PT  V  FFL++G  VA E+  K+A+ G ++RLP 
Sbjct  240   PAVLATFAVSALMHELIFYYIGRKEPTWVVTWFFLLHGVAVAAEVAAKKALHGMRWRLPA  299

Query  243   IVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
              VS  L +  V++T FWLF PP  R     KA  E++A IEFV
Sbjct  300   EVSRVLTVGFVVVTGFWLFLPPLLRYDTVAKARRETIAVIEFV  342



>gb|KCW75187.1| hypothetical protein EUGRSUZ_E03938 [Eucalyptus grandis]
Length=318

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 186/316 (59%), Gaps = 16/316 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ N I VW +V+  L YC  I+ L P     R F   PV  LFL+LPL LTS+ LA
Sbjct  1     METELQNLIFVWISVIAALTYCRYISVLVPV-GLKRLFFFLPVILLFLLLPLRLTSLTLA  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G ++FF+ WL +FKL L A  +GPL   P     +    +    + + R  +    K   
Sbjct  60    GLTSFFVAWLSNFKLLLLAYGKGPLVPPPSSAPLSLSCSSSPLHRFRSRSTLPQKAKLPS  119

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
               R               +++H KV +L +++H+YIVLE  L +V      +  V +E  
Sbjct  120   MARS--------------DYVHEKVMMLAYLVHVYIVLEVDLAVVGTAAARLIGVAVEPQ  165

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+L+TSLQDFWGRRWN+MVT+ILRP+VY+P+RS S   +    A LPAV+ +F VS 
Sbjct  166   FNEPYLATSLQDFWGRRWNLMVTSILRPSVYEPIRSASGHLVGRQWARLPAVLTTFAVSA  225

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG-KFRLPGIVSGPLALTLV  211
             +MHEL+FY IGR  PT  VM FFL++G  VA+EI VK+A+ G +++LP  VS  L +  V
Sbjct  226   LMHELIFYYIGRKEPTWVVMWFFLLHGVAVAVEITVKKALRGTRWQLPAEVSRLLTMGFV  285

Query  210   ILTSFWLFFPPYFRNK  163
             + T FWLF P   R +
Sbjct  286   VATGFWLFLPSLLRGE  301



>ref|XP_009107348.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Brassica 
rapa]
 emb|CDY41824.1| BnaA08g03190D [Brassica napus]
Length=343

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 188/312 (60%), Gaps = 14/312 (4%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFF  910
             +F+ VW  V+  LCY   +  L  +    R   IFPV  +FL++PL ++SIHL   ++FF
Sbjct  5     SFMYVWGLVMVSLCYTFYVGKLVGR-GIMRQILIFPVLLIFLIVPLLVSSIHLICITSFF  63

Query  909   IGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGSL----  742
             I WL +FK+ LF L RG       L L  F+  A LPIK+Q   K   + +  G+L    
Sbjct  64    IAWLANFKIILFTLGRG---PLYSLSLPVFLAVASLPIKIQLIPKPHESRE--GTLLNYA  118

Query  741   RKlvllgvvflvyyYKEFLHPK-VFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPF  565
             +K   L ++  V  Y   L  K VF L+ +I  Y  L+ +L  VS +VRA   +ELE  F
Sbjct  119   KKFATLVLIIKVIEYSSKLPDKAVFTLYLMIQNYFSLKVILSTVSVVVRATSNLELEPQF  178

Query  564   DEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGI  385
             DEPHL+TSLQ+FWGRRWN+MVT ILRPTVY+P   + +  L  + +   AV  +F VSG+
Sbjct  179   DEPHLATSLQNFWGRRWNLMVTGILRPTVYEPTMELLSG-LGRNRSRYLAVFITFAVSGL  237

Query  384   MHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVIL  205
             MH L+F+ IGR  P  ++M FFL+NG C ++EI +K+ V G+F  P  +S  L +  V++
Sbjct  238   MHVLIFFYIGRLRPDWKIMWFFLINGFCTSVEIAIKKNVKGRF--PTTISRVLTMGFVVV  295

Query  204   TSFWLFFPPYFR  169
             TS+WLFFP + R
Sbjct  296   TSWWLFFPEFKR  307



>ref|XP_004151617.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5-like [Cucumis sativus]
 ref|XP_004171368.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5-like [Cucumis sativus]
Length=356

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 195/323 (60%), Gaps = 11/323 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE+ +F  V  T++  L Y + I+   PK  F R  ++FP   LF +LPL+L+S+ L+
Sbjct  1     MDGELKSFTKVSLTIMVSLLYSYFISSKLPKGKF-RLISLFPTFSLFALLPLSLSSVFLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK--------KV  772
             GT AFFI WL +FKL LF+   GPL S PPL    F+  ACLPIK++ R+        + 
Sbjct  60    GTVAFFITWLTTFKLLLFSFNLGPLVSDPPLTFPLFVTVACLPIKIKPREIDPDYKYLEK  119

Query  771   AGNFKFSGSL-RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA  595
               N K   +L  K++L  ++     + +   P V +  + + LY+ +EF+L + S +VR+
Sbjct  120   YANPKLGLNLPAKILLFAILIAAGDHIDQFRPNVKICVYCVTLYLFVEFLLGVSSAIVRS  179

Query  594   VFR-VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
              F  V LE   +EP+L+TSLQDFWGRRWN++V+N LR  +Y PVR+     + +  A+  
Sbjct  180   SFDGVVLEPSSNEPYLATSLQDFWGRRWNLLVSNTLRYGIYRPVRAAVGGVVGKRWAAGT  239

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
              VMA FVVSG+MHE + Y I R  PT EV  FF++ G CV LE  +K  V  +++ P  V
Sbjct  240   GVMAVFVVSGVMHEQLVYYITREVPTWEVTWFFVLQGVCVVLEFELKTVVGRRWQPPAAV  299

Query  237   SGPLALTLVILTSFWLFFPPYFR  169
             +  L L+ +++T+ WLFFPP  R
Sbjct  300   AWLLTLSFLVVTASWLFFPPLMR  322



>gb|KGN44084.1| hypothetical protein Csa_7G179120 [Cucumis sativus]
Length=359

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 195/323 (60%), Gaps = 11/323 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE+ +F  V  T++  L Y + I+   PK  F R  ++FP   LF +LPL+L+S+ L+
Sbjct  4     MDGELKSFTKVSLTIMVSLLYSYFISSKLPKGKF-RLISLFPTFSLFALLPLSLSSVFLS  62

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRK--------KV  772
             GT AFFI WL +FKL LF+   GPL S PPL    F+  ACLPIK++ R+        + 
Sbjct  63    GTVAFFITWLTTFKLLLFSFNLGPLVSDPPLTFPLFVTVACLPIKIKPREIDPDYKYLEK  122

Query  771   AGNFKFSGSL-RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA  595
               N K   +L  K++L  ++     + +   P V +  + + LY+ +EF+L + S +VR+
Sbjct  123   YANPKLGLNLPAKILLFAILIAAGDHIDQFRPNVKICVYCVTLYLFVEFLLGVSSAIVRS  182

Query  594   VFR-VELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLP  418
              F  V LE   +EP+L+TSLQDFWGRRWN++V+N LR  +Y PVR+     + +  A+  
Sbjct  183   SFDGVVLEPSSNEPYLATSLQDFWGRRWNLLVSNTLRYGIYRPVRAAVGGVVGKRWAAGT  242

Query  417   AVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIV  238
              VMA FVVSG+MHE + Y I R  PT EV  FF++ G CV LE  +K  V  +++ P  V
Sbjct  243   GVMAVFVVSGVMHEQLVYYITREVPTWEVTWFFVLQGVCVVLEFELKTVVGRRWQPPAAV  302

Query  237   SGPLALTLVILTSFWLFFPPYFR  169
             +  L L+ +++T+ WLFFPP  R
Sbjct  303   AWLLTLSFLVVTASWLFFPPLMR  325



>ref|XP_006401460.1| hypothetical protein EUTSA_v10015320mg [Eutrema salsugineum]
 gb|ESQ42913.1| hypothetical protein EUTSA_v10015320mg [Eutrema salsugineum]
Length=346

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 135/340 (40%), Positives = 192/340 (56%), Gaps = 14/340 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  E+ N   VW + L  +CYC+ I+    K    R  +I PV  LFLVLPL L+++H  
Sbjct  1     MGEELRNLTQVWISALISICYCYFISSRIAK-GVLRLLSILPVCILFLVLPLFLSTVHFC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKK---VAGNFK  757
             G SA F  WL + KL LFA  +GPL          FI FAC PIK+ + +    +    +
Sbjct  60    GISALFFSWLANSKLLLFAFDQGPLCQLSSNLSR-FICFACFPIKISQNRSPNAIKNLHR  118

Query  756   FSGSLRKlvllgvvfl------vyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA  595
              +  L K VL   V +      VY Y + L   V L  + +H+Y+ +E  L +V  ++  
Sbjct  119   KNEPLPKWVLALKVLVFGGLLRVYEYSDGLPRFVVLALYCLHIYLEVELFLVLVGAVLST  178

Query  594   VFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPA  415
             +   ++E  F+EP+L+TSLQDFW RRWN+MV+ +LR TV+ PV+  ++RFL    A L  
Sbjct  179   LLGCDIEPVFNEPYLATSLQDFWSRRWNLMVSAVLRSTVHKPVQRFASRFLGPDAAVLVG  238

Query  414   VMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPG-IV  238
             VMASF+VSG+MHEL+++ + R  PT EV  FF+++G   A EI VK+ +  ++R P   V
Sbjct  239   VMASFLVSGLMHELIYFYVIRVPPTWEVTCFFVLHGVATATEIAVKKIL--RWRPPHRAV  296

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             SG   L  V +T  WLF P   RN    +A +E L  I+F
Sbjct  297   SGLAVLVFVSVTGVWLFLPQLLRNNVHERAISECLLVIDF  336



>ref|XP_002529021.1| acyltransferase, putative [Ricinus communis]
 gb|EEF33332.1| acyltransferase, putative [Ricinus communis]
Length=343

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 192/341 (56%), Gaps = 14/341 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI N I V  ++L  L YC+ I+   PK  F R  ++ P+  LF  LP  L  I   
Sbjct  1     MESEIKNLIKVNLSILASLIYCYLISSKIPKGRF-RLVSLLPIIILFTQLPFLLLYIFPK  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGN-----  763
               ++ FI W  SFKL LFA  + PLSS+    L  FI    LPIK  + K          
Sbjct  60    AITSSFISWFASFKLVLFAFDQPPLSSSNYKSLFHFISLVLLPIKFHKNKNYPSPQKPKL  119

Query  762   FKFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRV  583
             F      + L    +V ++   K   H  + LL F I  Y++++    + + L  A+  V
Sbjct  120   FTLVFPAKVLFFALLVTVLDDNKYRAHQSLLLLIFCIMAYLLIDIFSGVSNALAYAILHV  179

Query  582   ELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESL---ASLPAV  412
             E E+  D P+LSTSLQDFWGRRWN+MV+++LR TVY P++S   RF   +L   A+LPA 
Sbjct  180   EPESTSDNPYLSTSLQDFWGRRWNLMVSDLLRYTVYRPLKS---RFATTALVGRATLPAS  236

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIV  238
             +A F+VSG+MHEL+FY+I  A+PT EV  FFL+ G C+A+E+ VKR   ++G ++L   V
Sbjct  237   LAVFLVSGLMHELLFYHITCASPTWEVTCFFLLQGLCMAVEMRVKRWLKMNGGWQLHWAV  296

Query  237   SGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             SGPL +  +++T+ WLFFPP  R      A  E    I ++
Sbjct  297   SGPLTVGFLVVTARWLFFPPLIRTGAIDAAIGECKMVISYL  337



>ref|XP_010693141.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=350

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/341 (40%), Positives = 197/341 (58%), Gaps = 18/341 (5%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFP-KPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
             ME EI NF+ +W   +C  CY  +++ +F  +    R   I P+  LF VLPL+L+S HL
Sbjct  1     MESEIKNFMKIWLFAICSACYSLSLSRIFHIRSGIPRLLFILPIIYLFTVLPLSLSSFHL  60

Query  930   AGTSAFFIGWLGSFKLTLFALCRG-------------plsstpplplsTFIPFACLPIKV  790
              G + FF+ WL +FKL L+A   G               ++   L LS FI  A LPIKV
Sbjct  61    GGPTIFFLVWLANFKLLLYAFDLGPLSTNPITNNNNNNNNNVNSLSLSHFISIALLPIKV  120

Query  789   -QRRKKVAGNFKFSGSLRKlvllgvvflvyyYKEFLH--PKVFLLF-FVIHLYIVLEFML  622
              Q++     N K+   L     L    LV    +F    PK  LL  +  HLY+ +E  L
Sbjct  121   NQQQPSKPTNNKWKSVLIIAFKLLAFALVIKIYDFTQHLPKFLLLINYCCHLYLGVEVTL  180

Query  621   FMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFL  442
              +V+ +VRA   + L+  F+EP+L+TSLQDFWGRRWN+MV++ILR +V++P+R V +  +
Sbjct  181   AVVAAIVRATLGLGLDPQFNEPYLATSLQDFWGRRWNLMVSDILRLSVFNPIRRVFSPLV  240

Query  441   PESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG  262
              +  A +  ++A+F VSG+MHEL+FY   R  PT EV  FF+++G C A+E+ VK AV G
Sbjct  241   GKRWALVVGMIAAFTVSGLMHELIFYYFTRVNPTWEVTWFFVLHGMCTAVEVVVKEAVGG  300

Query  261   KFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
             + +L  ++SG L +  V +T++WLF P   RN  D K   E
Sbjct  301   RLQLHRLISGTLTIGFVAVTAWWLFLPQIIRNGVDVKVINE  341



>gb|EPS68808.1| hypothetical protein M569_05960, partial [Genlisea aurea]
Length=335

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 138/338 (41%), Positives = 190/338 (56%), Gaps = 5/338 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+ E+  F+ VW T +  L YC  I G  P     R  A+ P   LF+ LP  L+ + L 
Sbjct  1     MDPELELFVKVWLTAVGSLVYCRQIAGRIPGGP-ARLLAVLPAVYLFIALPFQLSVVVLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               + F++GWL +FKL LFA   G L++ PPL L  F+    LP++  +  + +   +F  
Sbjct  60    APTVFYLGWLANFKLLLFAFGAGRLAAEPPLSLVEFVAVGLLPVQKSKGAESSPGNRFRL  119

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
              L + V L  +  +  Y+EF+HP V L+ +   + + L+ M  + S  VRA   +ELE  
Sbjct  120   VL-ESVALAAILWLSSYREFIHPNVMLILYGGTIGLCLDLMFAVTSVAVRAAVGMELEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             FD P+L+TSLQDFWGRRWN++VT ILRP+VY PVR  +A +  E LA   A++A+F VSG
Sbjct  179   FDRPYLATSLQDFWGRRWNLIVTGILRPSVYLPVRRFTAPYAGEKLALAAAILATFAVSG  238

Query  387   IMHELV-FYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLV  211
             +MHE + FY   RATPT EV  FFL++G CV LE  +KR   G  RLP   S    L  V
Sbjct  239   LMHEFIFFYLTSRATPTWEVTCFFLLHGFCVVLEDQMKRG--GVRRLPVGASRISTLGFV  296

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLV  97
              +T  WLFFP         K   E L  I +V +  +V
Sbjct  297   GMTGAWLFFPQLINYGVALKGIEECLTAIAYVRDRMMV  334



>ref|XP_009127005.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
1 [Brassica rapa]
Length=346

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 189/342 (55%), Gaps = 20/342 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ N   VW + L  +CYC+ I+    K    R   I PV+ LFLVLPL+ +S+H  
Sbjct  1     MEQELRNLSKVWISALVSICYCYFISCRISK-GVLRLITILPVSVLFLVLPLSFSSVHFC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               SA F+ WL +FKL LFA  +GPL   P      FI +AC PIK+++    +G    + 
Sbjct  60    VISALFLSWLANFKLMLFAFDQGPLYPLPANLYR-FICYACFPIKIRQNPSPSG---IAN  115

Query  747   SLRKlvllgvvflvyyYKEF---LH--------PKVFLL-FFVIHLYIVLEFMLFMVSGL  604
              LRK   +           F   LH        P+  +L  + +H+Y+ LE +L +V  +
Sbjct  116   RLRKNKPIPKFVFAVKILIFGVLLHIYEYSDSLPRFAVLSIYCLHIYLELELVLVIVGAV  175

Query  603   VRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLAS  424
             +  +   ++E  F+EP+L+TSLQDFW RRWN+MV+ +LR TV+ PV+    RFL    A 
Sbjct  176   ISTLLGCDIEPVFNEPYLATSLQDFWSRRWNLMVSAVLRSTVHIPVQRFCTRFLGPDAAV  235

Query  423   LPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPG  244
             L  VMASF+VSG+MHEL+++   R  PT EV  FF+++G    +EI VKR V  ++  P 
Sbjct  236   LVGVMASFLVSGLMHELIYFYAIRLPPTWEVTCFFVLHGVATTVEIAVKRTV--RWSPPH  293

Query  243   -IVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIE  121
               VSG   L  V +T  WLF P   RN    +A +E L  I+
Sbjct  294   RAVSGLGVLVFVSVTGVWLFLPQLLRNNVHERAISECLLVID  335



>ref|XP_007020662.1| MBOAT family protein [Theobroma cacao]
 gb|EOY12187.1| MBOAT family protein [Theobroma cacao]
Length=337

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 194/335 (58%), Gaps = 8/335 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE+ NFI V       + YC+ I    P+    R  ++ PV  LF VLPLN+ S H+ 
Sbjct  1     MEGELKNFISVIIMGFISMYYCYYIAAKIPQ-GLPRLISLLPVITLFSVLPLNIHSFHIG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ----RRKKVAGNF  760
                 F + W+ +FKL L A  +GPLS  PP     FI  AC P +++    + K+  G  
Sbjct  60    TPVVFILTWITNFKLLLLAFEQGPLSPPPPGAHL-FILTACSPFRIKQSQPKTKRTTGPN  118

Query  759   KFSGSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
               S +  K  LL ++F  Y Y++    +V L+ +  H Y+ ++  L + +     +  VE
Sbjct  119   VVSEAANKAALLALLFHCYNYRQCFPRQVLLILYFFHTYLTIQLFLALAAIPALILLGVE  178

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             LE  F+ P L+TSLQDFWGRRWN+ V++ LRPTVY P+RSVS R +    ASLPAV A+F
Sbjct  179   LEPQFNAPLLATSLQDFWGRRWNLRVSDTLRPTVYSPIRSVSTRIIGPRWASLPAVFATF  238

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
             + SG+MHEL++Y+I R  PT EV  FF++ G  V +EI +K+ +   FRL   VSGPLAL
Sbjct  239   LTSGLMHELIYYHITREFPTWEVTWFFVLQGIFVDIEIVMKKKL--LFRLHRSVSGPLAL  296

Query  219   TLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               + +T+ WL +    RN  D K   E  AF+EF+
Sbjct  297   ANLAVTAGWLSYRQLLRNGVDEKVINEFNAFLEFL  331



>ref|XP_002532420.1| acyltransferase, putative [Ricinus communis]
 gb|EEF29961.1| acyltransferase, putative [Ricinus communis]
Length=354

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -3

Query  693  EFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRW  514
            E +HPKV LL + +H+Y  +E  L MV+ L RA+  +ELE  F+EP+LSTSLQDFWGRRW
Sbjct  151  ELMHPKVILLLYSLHIYFAIELTLAMVAALARAILGLELEPQFNEPYLSTSLQDFWGRRW  210

Query  513  NVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGE  334
            N+MVT+ILRPTVY P+    +  +    A +PA+M +F VS IMHEL+FY +GR  PT E
Sbjct  211  NIMVTSILRPTVYGPLLKTCSPIIGRKWAPVPAIMGTFTVSAIMHELIFYYLGRVNPTWE  270

Query  333  VMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDT  154
            +  FF+++G C+ +EI +K+ V  +++LP ++S PL +  V++T FWLF P   R + DT
Sbjct  271  ITRFFVLHGVCLVIEIALKKVVSRRWQLPRLISTPLTIGFVVVTGFWLFVPQILRCRADT  330

Query  153  KACAESLAFIEFVIN  109
            KA  E  A   F+ N
Sbjct  331  KAFQEYSAVSIFLKN  345



>gb|KCW75181.1| hypothetical protein EUGRSUZ_E03931 [Eucalyptus grandis]
Length=354

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 212/348 (61%), Gaps = 13/348 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E++NF+ VW +V+  L YC  I+ L P     R F   PV  LFL+LPL LT++ LA
Sbjct  1     METELHNFVFVWISVVAALIYCRYISILLPVGP-KRLFFFLPVILLFLLLPLRLTTLSLA  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGpls---stpplplsTFIPFACLPIKVQ-------RRK  778
             G ++F I WL +FKL L A  +GPL    ++ PL L  F+  A LPIK+         + 
Sbjct  60    GLTSFSIAWLSNFKLLLLAYGKGPLVPPPTSSPLSLQLFVTTASLPIKISPSAESPTSKN  119

Query  777   KVAGNFKFSGS-LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLV  601
                G  K   + + K +LL  +F +Y   +++H KV +L + +H+YIVLE  L ++    
Sbjct  120   GGGGGLKSPANYVAKCLLLVSLFPLYQRNDYVHEKVMMLAYSVHVYIVLEVALAVIGVAA  179

Query  600   RAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASL  421
               +  V +E  FDEP+L+TSLQDFWGRRWN+M T+ILRP+VY+P+R  S R +    A+L
Sbjct  180   ARLIGVAVEPQFDEPYLATSLQDFWGRRWNLMATSILRPSVYEPIRLASGRLVGRQWAAL  239

Query  420   PAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG-KFRLPG  244
             PAV+A+F VS +MHEL+FY IGR  PT  V  FFL++G  VA E+  K+A+ G ++RLP 
Sbjct  240   PAVLATFAVSALMHELIFYYIGRKEPTWVVTWFFLLHGVAVAAEVAAKKALHGMRWRLPA  299

Query  243   IVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
              VS  L +  V++T FWLF PP  R     KA  E++A    +I+  +
Sbjct  300   EVSRVLTVGFVVVTGFWLFLPPLLRYDTVAKARRETIAISRLLISREI  347



>ref|NP_200347.1| putative long-chain-alcohol O-fatty-acyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9FJ74.1|WAXS3_ARATH RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 
3; AltName: Full=Wax synthase 3 [Arabidopsis thaliana]
 dbj|BAB08553.1| wax synthase-like protein [Arabidopsis thaliana]
 gb|AED96620.1| MBOAT (membrane bound O-acyl transferase) family protein [Arabidopsis 
thaliana]
Length=342

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 200/340 (59%), Gaps = 11/340 (3%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTIN-GLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHL  931
             ME E+ NFI +W + +  + YC+ ++ G+  K    R  ++ PV  LFLV PL  + +H 
Sbjct  1     MEEELKNFIKLWISAIISISYCYYLSTGI--KAGVFRLLSVLPVCALFLVFPLFFSYVHF  58

Query  930   AGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFS  751
             +G  AFF+ WL +FKL LF+  +GPLS  P      FI   C PIK Q+   +  N+K  
Sbjct  59    SGCMAFFLSWLANFKLILFSFDQGPLSPLPRTLSR-FICITCFPIKPQQNPNIQ-NYKIP  116

Query  750   GSL--RKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVEL  577
               L   K+V+  V+  +Y YK++L P + L+F  +H+++ LE +  +V  LV      +L
Sbjct  117   IWLFAIKVVIFVVLLQMYEYKQYLSPALLLVFNSLHIFLELEIVFMLVKALVFITLGCDL  176

Query  576   EAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFV  397
             E   +EP+L+TSLQDFWGRRWN+MV  ILRP VY P R ++ R +    A    V A+F+
Sbjct  177   EPQSNEPYLATSLQDFWGRRWNLMVPAILRPAVYLPARRMACRKVNSDQAMFLGVFAAFL  236

Query  396   VSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA--VDGKFRLPGIVSGPLA  223
             VSG +HE++F+ + R  PTGEV  FFL++G C   E+ VK++  V   +R+   VS  L 
Sbjct  237   VSGAVHEMLFFYLTREVPTGEVTWFFLLHGVCTVAEVAVKKSTFVRRWWRVSPTVSRLLT  296

Query  222   LTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHR  103
             +  V++TS W FF P  R+    +  +E+L  I+FV  H+
Sbjct  297   VGFVVVTSGWFFF-PLIRSGIIERLASEALMCIDFV-KHK  334



>ref|XP_010675843.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Beta vulgaris subsp. vulgaris]
Length=348

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 132/342 (39%), Positives = 195/342 (57%), Gaps = 10/342 (3%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
             ++  EG I   I VW  VL  L Y + I   FPK    R F++ P+  LF  LP +L++ 
Sbjct  2     EEQEEGIIKALIKVWLKVLISLIYTYFIVSKFPKGKL-RIFSLLPIFSLFTFLPNSLSTP  60

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpp--lplsTFIPFACLPIKVQRRKKV--A  769
               AG + FF  WL +FKL LF    GPLS+          FI  A  PIK+++ +     
Sbjct  61    TTAGLTGFFFTWLANFKLLLFCFNLGPLSNDNLPKKSFLNFILIASFPIKIKQNENYPFT  120

Query  768   GNFKFSGSLRKlvllgvvflv----yyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLV  601
              N K   +L    L+  + ++      Y + +HP + +  +   +Y+ LE ++ + + +V
Sbjct  121   QNQKLPLNLWSKCLIYSIIVICGFLSNYNKNVHPNILMGIYCCVVYLNLEVIMGICNKIV  180

Query  600   RAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASL  421
              ++ R+EL  PFDEP+LSTSLQDFWGRRWN+MV+++LR T+Y P+R+     + +  A L
Sbjct  181   GSILRMELSPPFDEPYLSTSLQDFWGRRWNLMVSDVLRHTLYFPIRAFWEIRIGKRWAQL  240

Query  420   PAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGI  241
              A M +FVVSG+MHEL+F+ I R  PT EV  FFL++G C+ +EIG+KR + G   L   
Sbjct  241   VATMVAFVVSGLMHELLFFYITRVGPTWEVTCFFLLHGVCLVVEIGLKRVL-GLRELHWA  299

Query  240   VSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             ++GPL +  V+ T  WLF P   RN+ D ++  E  A   FV
Sbjct  300   LAGPLTVGFVMGTGVWLFLPQLVRNQVDVRSLEEVKAVSRFV  341



>ref|XP_010063067.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Eucalyptus 
grandis]
Length=356

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/344 (39%), Positives = 192/344 (56%), Gaps = 11/344 (3%)
 Frame = -3

Query  1116  KKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSI  937
              +  E E+ NF+ VW   L  L Y +  +   P+ +  R  ++ P   L  +LPL L+S 
Sbjct  2     NEAAEEELKNFVQVWIAALAALTYSYFASSAVPRGA-PRLLSLLPAVVLLSLLPLRLSSF  60

Query  936   HLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ---RRKKVAG  766
             HL G +AFF+ WL + KL L +   GPL+  P L    F+  A LP+KV+     ++V+ 
Sbjct  61    HLGGPTAFFLVWLANSKLLLLSFHLGPLADAPNLLH--FLSLASLPVKVKPPREDERVSR  118

Query  765   NFKFSG--SLRKlvllgvvflvyyYKEF---LHPKVFLLFFVIHLYIVLEFMLFMVSGLV  601
                 S   S+R  + + V+  V +  E+   LH    L  + +H+Y+ LE +L + +   
Sbjct  119   ESSRSALASVRLAIKVLVLVSVLHAYEYRPRLHEYAILALYCVHMYLELELVLAICAVPA  178

Query  600   RAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASL  421
              A   ++LE  FDEP+L+TSLQDFWGRRWN+MV++ILR TVY PVR   A  +    ASL
Sbjct  179   SAALGLDLERQFDEPYLATSLQDFWGRRWNLMVSSILRSTVYGPVRRRLAPLVGARRASL  238

Query  420   PAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGI  241
             PA +A+F VSG MHE ++Y + RA PTGEV  FF+++G CVA E+  KR   G++R+   
Sbjct  239   PATIAAFAVSGAMHEAIYYYLTRARPTGEVTWFFVLHGICVAAEVAAKRWAGGRWRMHRA  298

Query  240   VSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFVIN  109
              SG L L  +  T    FFP   RN  D K   E  A  +F  +
Sbjct  299   ASGVLTLAFLAATGVRWFFPQLTRNGVDEKVIGECYAIFDFAKD  342



>gb|KFK27009.1| hypothetical protein AALP_AA8G322600 [Arabis alpina]
Length=350

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/333 (41%), Positives = 191/333 (57%), Gaps = 18/333 (5%)
 Frame = -3

Query  1089  NFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFF  910
             +FI  W+ V+  LCY   I  L PK    R   I PV  +F ++P  L+SIH  G +AFF
Sbjct  3     SFIEAWSLVMVSLCYTFYIAKLVPK-GINRLILIIPVLFIFFIVPFLLSSIHFIGITAFF  61

Query  909   IGWLGSFKLTLFALCRGplsstpplpls-TFIPFACLPIKVQRRKK------VAGNFKFS  751
             I WL +FK+ LFAL  GPLSS P       F+  +CLPIK+QR  +        G     
Sbjct  62    ITWLANFKIILFALGLGPLSSNPRPLSLPIFLAVSCLPIKIQRSPRPPPTSHSHGVRSRE  121

Query  750   GSLRKlvllgvvflvyyYKEF---LHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVE  580
             G L+  +++ +V L     ++   L  K  L  + IH +  LE +L   + LVR +  +E
Sbjct  122   GLLKYTIMVALVVLFIKVYDYKTNLPDKALLTLYAIHTWFTLELVLAAAAALVRTMSGLE  181

Query  579   LEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASF  400
             LE  F++P+L+TSLQDFWGRRWN+MVT ILRPTVY+P+  V + FL    + +PAV  +F
Sbjct  182   LEPQFNKPYLATSLQDFWGRRWNLMVTGILRPTVYEPIVHVFS-FLGPDRSWVPAVYVTF  240

Query  399   VVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLAL  220
             +VSG+MHEL+F+ +GR  P  +VM FFLV   C  +E+ +K+ V+ ++  P  +S  L +
Sbjct  241   IVSGLMHELMFFYMGRLRPDWKVMWFFLVQAFCTTVEVMIKKTVNNRWTFPTWISRVLTI  300

Query  219   TLVILTSFWLFFPPYF------RNKGDTKACAE  139
               VI T+ WLF P +       R  G+  A  E
Sbjct  301   GFVIGTAKWLFLPAFIQCNIFERGIGEYAAIGE  333



>ref|XP_010467019.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Camelina sativa]
Length=344

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/339 (38%), Positives = 197/339 (58%), Gaps = 5/339 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ + I V    +  + YC+ +     K    RF ++ P+  LFLVLPL  +S+HL+
Sbjct  1     MEEELKSLIKVLVIAIMSISYCYYLPPKI-KSGIPRFLSVLPIVALFLVLPLFYSSVHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AF + WL +FKL LF+  +GPL   P   L  F+ F C PIK Q+  K   +     
Sbjct  60    FITAFSLTWLTNFKLILFSFDKGPLIPIPKNLLW-FLFFTCFPIKAQQNPKPNTHLPKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y YK+ + P + +  + +HLY+ +E +  ++   +      ELE  
Sbjct  119   FAIKVAIFGVLLHLYGYKQSMPPILLMGLYFVHLYLEIEIIFTLLKVFISISLGCELEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +  S A  P ++A+F+VSG
Sbjct  179   SNKPYLATSLQDFWGRRWNIMVPAILRPAVYTPMRRVSERRMSSSWALFPGILATFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++H+L+F+ + R  PTG+V  FF++ G C+A E+ VK+   V  ++RL   VS  L +  
Sbjct  239   LVHDLLFFYLTREMPTGKVTLFFVLQGVCIAAELAVKKKTTVMQRWRLSPTVSRILTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRLV  97
             V +T FWL  P   R+    K   E+L  ++FV  H+L+
Sbjct  299   VFVTGFWLMTPQLTRSGVMEKYTNEALYCVDFV-KHKLL  336



>emb|CDY12003.1| BnaC03g14290D [Brassica napus]
Length=335

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/333 (38%), Positives = 193/333 (58%), Gaps = 5/333 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+  F+ VW + +  + YC+ ++    KP   R   I PV   F+ LP+  +S+H  
Sbjct  1     MEEELKIFMKVWVSAIISISYCYYLSTRI-KPGVFRLLFILPVCVQFIFLPMCFSSLHFI  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNF-KFS  751
             G++AF + WL +FKL LF+   GPL   PP     FI F C PIK+Q+  K   +  K+ 
Sbjct  60    GSTAFSLTWLANFKLILFSFDNGPLYPVPPNISQ-FICFTCFPIKLQQNAKHQIHLPKWV  118

Query  750   GSLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEA  571
              ++R + +  V+  +Y YK+ +   V L+ + +H+Y+  E +L  +  L+      +LE 
Sbjct  119   FAIR-VAIFSVLLKLYDYKQHMSSNVLLVLYSLHIYLEFEILLAPLKVLLIMALGCDLEP  177

Query  570   PFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVS  391
              F+EP+L+TSLQDFWGRRWN+MV  ILR  VY PVR ++ R +    A    V+A+F VS
Sbjct  178   QFNEPYLATSLQDFWGRRWNLMVPAILRQAVYVPVRRITERKMKSEQAKFLGVLATFHVS  237

Query  390   GIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR-AVDGKFRLPGIVSGPLALTL  214
             G++HEL+F+   R  PTGEV  FF+++G C A E+  KR ++  ++ +  +VS  L +  
Sbjct  238   GVVHELIFFYFTREPPTGEVTLFFILHGVCTAAEVAAKRTSLLNRWNMSMMVSRLLTVGF  297

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             V++T  WLFFPP  R+    +   E    I+F+
Sbjct  298   VVVTGGWLFFPPLLRSGMIERLSHEVFLSIDFI  330



>ref|XP_010488707.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
5 [Camelina sativa]
Length=344

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/338 (38%), Positives = 195/338 (58%), Gaps = 5/338 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ + I V    +  + YC+ +     K    RF ++ P+  LFLVLPL  +S+HL+
Sbjct  1     MEEELKSLIKVLVIAIISISYCYYLPPKI-KSGIPRFLSVLPIVALFLVLPLFFSSVHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL   P      F+ F C PIK Q+  K   +     
Sbjct  60    FFTAFFLTWLANFKLILFSFDKGPLIPVPTNLSG-FLFFTCFPIKAQQNPKPNIHLPKLV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GV+  +Y YK+ + P + +  + +HLY+ LE +  ++  L+      E E  
Sbjct  119   FAIKVAIFGVLLHLYGYKQNMPPILLMGLYFVHLYLELEIIFTLLKVLISISLGCEFEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+T LQDFWGRRWN+MV  ILRP VY P+R VS R +  S A  P ++A+F+VSG
Sbjct  179   SNKPYLATYLQDFWGRRWNIMVPAILRPAVYTPMRRVSERRMSSSWALFPGILATFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++H+L+F+ + R  PTG+V  FFL+ G C++ E+ VK+   V  ++RL   VS  L +  
Sbjct  239   LVHDLLFFYLTREMPTGDVTLFFLLQGVCISAELAVKKKTTVMQRWRLSPTVSRILTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFVINHRL  100
             V +TS WL      R+    K   E+L + +F +NH+L
Sbjct  299   VFVTSSWLMTSQLVRSGVMEKYTNEALYYADF-LNHKL  335



>ref|XP_007146544.1| hypothetical protein PHAVU_006G049600g [Phaseolus vulgaris]
 gb|ESW18538.1| hypothetical protein PHAVU_006G049600g [Phaseolus vulgaris]
Length=341

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 137/331 (41%), Positives = 203/331 (61%), Gaps = 5/331 (2%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME EI  FI VW + +  L YC+ I    PK  F R  ++ P+  + +  P  ++S +LA
Sbjct  1     MEAEIQKFIKVWISAILGLSYCYYIAAKIPK-GFFRLLSLLPILYILITFPFKISSPNLA  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G ++FF+ WL +FKL LF+  +GPL+ +PP  L  FI  A LPI   +        K+  
Sbjct  60    GYTSFFLVWLATFKLILFSFNQGPLALSPPNVLH-FISIASLPI-TPKPNTTTNKPKWLL  117

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
              L K ++  V+  +++  + LHP + LL +  HLY+ LE +L +V+  VR +F VE+E+ 
Sbjct  118   PL-KALIFAVIVAIHHNNQHLHPYLLLLLYCCHLYLGLEVVLAIVATPVRVIFGVEIESQ  176

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             FDEP+LS+SLQ+FWG RWN+MV+ ILRP++YDPVR +S  F+  S A L A+ A+F VSG
Sbjct  177   FDEPYLSSSLQEFWGHRWNLMVSRILRPSIYDPVRRISTSFMDPSYAMLVAMFATFFVSG  236

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFRLPGIVSGPLALTLV  211
             +MHEL++Y + R  PT EV  FF+++G C   E+  K+ V   ++RL  ++SG L +  +
Sbjct  237   LMHELIYYYVIRVPPTWEVTCFFVLHGVCTVAEVATKKMVLRRRWRLHRLMSGLLVVAFL  296

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             I+T+ WLFFP   RN  + K   E    I F
Sbjct  297   IVTANWLFFPQLLRNDMEKKCTEEYAIMINF  327



>ref|XP_004250264.2| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like, partial 
[Solanum lycopersicum]
Length=420

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  693  EFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRW  514
            +++HP + ++ +  H+Y+ L+ +L +VSGL R +  ++LE  F+EP+LSTSLQDFWGRRW
Sbjct  215  DYIHPYIIMVIYCFHIYLSLDIILAIVSGLARGLLGLQLEPQFNEPYLSTSLQDFWGRRW  274

Query  513  NVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGE  334
            N++VT ILRPT+Y PV S+SA  L    A +PAVMA+FVVSG+MHEL+FY +GR  PT E
Sbjct  275  NLIVTRILRPTIYKPVLSLSANILGRKWAPIPAVMATFVVSGLMHELIFYYLGRVKPTWE  334

Query  333  VMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDT  154
            +  FFL++G C+ LEI  K+ ++G+F+LP I+   L +  V++T  WLFFP   R   D 
Sbjct  335  ITWFFLLHGVCLNLEIYAKKVINGRFKLPRIIGTILTVGFVMITGLWLFFPQLLRCNSDV  394

Query  153  KACAESLA  130
            +A AE  A
Sbjct  395  RALAEYEA  402


 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = -3

Query  1065  VLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSFK  886
             +   LCYC+  + + PK  F R  +  PV   FL +PL + S+HL G + FFI WL +FK
Sbjct  3     IYVSLCYCYLSSKILPKGLF-RLSSFLPVILFFLYVPLKINSVHLCGNTGFFISWLCNFK  61

Query  885   LTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKV  772
             L L A  +G   S   L +  F+  ACLPIK+Q++ ++
Sbjct  62    LILLAFDQG-PLSDSSLSIIKFVFLACLPIKIQQKSQI  98



>ref|XP_002866093.1| hypothetical protein ARALYDRAFT_495621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42352.1| hypothetical protein ARALYDRAFT_495621 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 143/344 (42%), Positives = 192/344 (56%), Gaps = 19/344 (6%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME +  N I VW + L  L YC+ I+    K    R  +I P+  LF VLPL L+ +H  
Sbjct  1     MEEKFRNLIEVWISALISLSYCYYISSKLSK-GVLRLLSILPICILFFVLPLFLSCVHCC  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               SA F+ WL +FKL LFA   G      P  LS FI FACLPIK+  R   + N   + 
Sbjct  60    AISALFLSWLANFKLLLFAFDEG-PLFPLPPKLSRFICFACLPIKI--RHNPSPNAITNL  116

Query  747   SLR------------KlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGL  604
              LR            K+++LGV+  VY Y++ L   V L  + +H+Y+ +E +L  V  +
Sbjct  117   HLRKHEPMPKWVLAVKILVLGVLLHVYEYRDGLPRFVVLALYCLHIYLEVELVLVFVGAV  176

Query  603   VRAVFRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLAS  424
             V  +    +E  F+EP+L+TSLQDFW RRWN+MV+ +LR TV+ PV+    R L  + A 
Sbjct  177   VSTLLGCNIEPVFNEPYLATSLQDFWSRRWNLMVSAVLRSTVHIPVQRFFKRLLSPNGAM  236

Query  423   LPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPG  244
                VMASF VSG+MHEL+++ + R  PT EV  FF+++GA  A EIGVKR     +R P 
Sbjct  237   FAGVMASFFVSGLMHELLYFYMIRKPPTWEVTCFFVLHGAATATEIGVKR--TQWWRPPH  294

Query  243   -IVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
               VSG  ALT V +T  WLF P   RN    KA +E L  +  V
Sbjct  295   RAVSGLAALTFVSVTGVWLFLPQVLRNNVHEKAISECLLVLHLV  338



>ref|XP_010057846.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW75180.1| hypothetical protein EUGRSUZ_E03930 [Eucalyptus grandis]
Length=355

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 197/339 (58%), Gaps = 12/339 (4%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M  E+ N + VWT+V+  L YC  +  L       R     PV  LFL+LPL LT+I L 
Sbjct  1     MATELQNLVFVWTSVVAALVYCRHVAKLVAAGP-RRLLLFLPVILLFLLLPLRLTTISLG  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
             G +AFF+ WL +FKL L A  +GPL+    LPL  F+  A LPIK+      AG     G
Sbjct  60    GLTAFFVAWLSNFKLLLLACGKGPLAPPLSLPL--FVAVASLPIKIGPSTGSAGAKNGGG  117

Query  747   S--------LRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAV  592
                      + K + +  +F +Y   +++H KV ++ + IH+YI LE  L  V      +
Sbjct  118   DGLKSPANYVTKCLFVAALFPLYQRSDYVHEKVMMMAYSIHMYIGLEVALAAVGAAAGRL  177

Query  591   FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAV  412
                 +E  FDEP+LSTSLQDFWGRRWN+MVT+ILRP+VYDPVRS S R +    A LPA+
Sbjct  178   IGAAVEPQFDEPYLSTSLQDFWGRRWNLMVTSILRPSVYDPVRSASGRLVGRRWAPLPAM  237

Query  411   MASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAVDG-KFRLPGIVS  235
             +A+F VS +MHEL+FY IGR  P   V  FFL++G  VA E+  K+ + G +++LP   S
Sbjct  238   LATFAVSALMHELIFYYIGRKEPAWVVTWFFLLHGVAVAAEVAAKKVLRGTRWQLPAEAS  297

Query  234   GPLALTLVILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
               L +  V++T FWLF PP  R     KA  E +A IEF
Sbjct  298   RLLTVGFVVVTGFWLFLPPLLRCDAVAKARREIIAVIEF  336



>emb|CDY06589.1| BnaC02g13130D [Brassica napus]
Length=339

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/332 (38%), Positives = 184/332 (55%), Gaps = 3/332 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             M+GE+  F++VW   +  + YC+ I+    K    R  ++ PV   F VLPL  TS+HL+
Sbjct  1     MDGEVIGFVIVWVLAVISVSYCYYISSRI-KAGVLRLISVVPVCAFFQVLPLFFTSLHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
                A F+  L S KL LF+  +G L   P      F  F CLPIK Q+            
Sbjct  60    SCLAVFLSCLASAKLVLFSFDKGSLFPLPSNIFR-FSCFTCLPIKAQQNPNPKNQIPKWL  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ +  VV  +Y YK+++ P V L+ + +H+Y+ L+  L +V  LV      +LE  
Sbjct  119   FPIKVAIFAVVLHMYDYKQYMSPVVLLVLYTLHVYLELDIALMLVKLLVLITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              DEP+L+TSLQDFWGRRWN+MV  ILRP +Y PVR      +    A+  AV+A+FV SG
Sbjct  179   ADEPYLATSLQDFWGRRWNLMVPAILRPAIYIPVRQFCRGLMSSDWATFLAVLATFVASG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA-VDGKFRLPGIVSGPLALTLV  211
             + HE+ F+ +    PTGEV  FF+++G C  +E+ +KR  +  ++R+   VS  L +  V
Sbjct  239   VAHEVFFFALTFEIPTGEVACFFVLHGVCTTVEVAMKRTELVRRWRVSPTVSRLLTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             ++TS WL FP   R+    K   E+L  I+FV
Sbjct  299   VVTSGWLLFPTLARSDMLEKLANEALLSIDFV  330



>ref|XP_009631229.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=410

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 133/192 (69%), Gaps = 0/192 (0%)
 Frame = -3

Query  693  EFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRW  514
            +++HP + ++ +  H+Y+ LE +L +VSGL   +  +ELE  F+EP+LSTSLQDFWGRRW
Sbjct  201  DYMHPHIIMVIYCFHIYLSLEIILAIVSGLAHGLLGLELEPQFNEPYLSTSLQDFWGRRW  260

Query  513  NVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGE  334
            N++VT ILRPTVY+P  S+S   L    A LPAVM +FVVSG+MHEL+FY +GR  PT E
Sbjct  261  NLIVTRILRPTVYNPTLSLSTNILGRKWAPLPAVMGTFVVSGLMHELIFYYLGRVKPTWE  320

Query  333  VMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDT  154
            +  FFL++G C+ +EI +K+A++G+F+LP I+     +  V++T FWLFFP   R   D 
Sbjct  321  ITWFFLLHGVCLNIEICIKKAINGEFKLPRIIGTIWTVGFVMITGFWLFFPQLLRCNSDV  380

Query  153  KACAESLAFIEF  118
            +A  E  A   F
Sbjct  381  RAFEEYEAIGAF  392


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = -3

Query  975  CLFLVLPLNLTSIHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPI  796
            C FL LPL + S+HL G +AFFI WL +FKL L A   G   S   L +  F+  ACLPI
Sbjct  3    CFFLYLPLKINSVHLCGNTAFFISWLCNFKLLLLAFDHG-PLSDSSLSIPKFLILACLPI  61

Query  795  KVQRR  781
            K+Q++
Sbjct  62   KIQQK  66



>ref|XP_006352458.1| PREDICTED: acyl-CoA--sterol O-acyltransferase 1-like [Solanum 
tuberosum]
Length=450

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  693  EFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDEPHLSTSLQDFWGRRW  514
            +++HP + ++ +  H+Y+ L+ +L +VSGL R +  ++LE  F+EP+LSTSLQDFWG+RW
Sbjct  245  DYIHPYIIMVIYCFHIYLSLDIILAIVSGLARGILGLQLEPQFNEPYLSTSLQDFWGQRW  304

Query  513  NVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGE  334
            N++VT ILRPT+Y PV S+SA  L    A +PAVMA+F VSG+MHEL+FY +GR  PT E
Sbjct  305  NLIVTRILRPTIYKPVLSLSANILGRKWAPIPAVMATFAVSGLMHELIFYYLGRVKPTWE  364

Query  333  VMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDT  154
            +  FFL++G C+ +EI  K+ ++G+F+LP I+   L +  V++T FWLFFP   R   D 
Sbjct  365  ITWFFLLHGVCLNVEIYAKKVINGRFKLPRIIGTILTIGFVMITGFWLFFPQLLRCNSDV  424

Query  153  KACAESLA  130
            +A AE  A
Sbjct  425  RAFAEYEA  432


 Score = 91.7 bits (226),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 76/125 (61%), Gaps = 3/125 (2%)
 Frame = -3

Query  1146  LKGNQSINLKKKTMEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLF  967
             ++GN   ++ K  +EGEI +F+ VW  +   LCYC+  + + PK SF R F+  PV   F
Sbjct  1     MEGNIK-DVIKYWIEGEIESFVKVWLLIYVSLCYCYLSSKILPKGSF-RLFSFLPVIFFF  58

Query  966   LVLPLNLTSIHLAGTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQ  787
             L +PL + S+HL G + FFI WL +FKL L A  +G   S   L +  F+  ACLPIK+Q
Sbjct  59    LYVPLKINSVHLCGNTGFFISWLCNFKLILLAFDQG-PLSDSSLSIIKFVFLACLPIKIQ  117

Query  786   RRKKV  772
             ++ ++
Sbjct  118   QKSQL  122



>emb|CDY06586.1| BnaC02g13100D [Brassica napus]
Length=353

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 189/315 (60%), Gaps = 3/315 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ N I VW + +  + YC+ I+    K    R  ++ PV  LFL+LPL  +S+H +
Sbjct  1     MEQELENLIKVWFSAIISVSYCYYISTRI-KAGVFRLLSVLPVCVLFLLLPLFFSSVHFS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
              ++AFF+ WL +FKL LF+  +GPL   P      FI F C PIK Q+  K         
Sbjct  60    ESTAFFLTWLANFKLILFSFDKGPLYPLPQTLSR-FIYFTCFPIKPQQSPKSHDQIPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+V+ GV+  +Y YK+ L P + L+ + +H+Y+ LE +L +V  LV      +LE  
Sbjct  119   FAIKVVVFGVLLRMYDYKQHLSPTMLLVMYSLHIYLELEIVLMLVKVLVLITLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              +EP+L+TSLQDFWGRRWN+MV  ILRP VY+PV+ ++ R +    A   AV A+F+VSG
Sbjct  179   SNEPYLATSLQDFWGRRWNLMVPAILRPAVYNPVQRIAERTMSSDQARFLAVFATFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRAV-DGKFRLPGIVSGPLALTLV  211
              +HEL+F+ +    PTGEV  FFL++G C A E+ VK+     ++ L  + S  L +  V
Sbjct  239   AVHELIFFYVTHEMPTGEVTWFFLLHGVCTAAEVAVKKMTFVRRWTLGPMASRLLTVGFV  298

Query  210   ILTSFWLFFPPYFRN  166
             +LTS WLFFPP  RN
Sbjct  299   VLTSGWLFFPPLIRN  313



>ref|XP_003593700.1| Annotation was added to scaffolds in November 2011~Long-chain-alcohol 
O-fatty-acyltransferase [Medicago truncatula]
Length=326

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 183/319 (57%), Gaps = 15/319 (5%)
 Frame = -3

Query  1080  MVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGW  901
             MVWT       Y + I  + PK    R  ++FP   + L+LP+ LTS+HL   S+FF+ W
Sbjct  1     MVWTVATTLFWYSYRIGKVIPKGR-KRLVSLFPPILILLLLPVRLTSVHLGSISSFFLAW  59

Query  900   LGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSGSLRKlvllg  721
             L +FKL LFA  +GPL+S PPL L  F+  A LPIK Q       N      L    L+ 
Sbjct  60    LSAFKLLLFAFAKGPLASNPPLSLPHFVLLASLPIKFQHNNHTNKNQIKVAPLNWRELVV  119

Query  720   vvfl------vyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAPFDE  559
             +  L       Y  +E  HP + +  + +HLY  LE  L +++ + R V +VELE PF++
Sbjct  120   MSILLYFFIPSYEKRESFHPLILMSLYGLHLYTGLEIFLTVITKIARKVVQVELEQPFNK  179

Query  558   PHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIMH  379
             P+LSTS+QDFWGRRWN+MVT IL P++Y+PV   ++  +    A +PAVM +F VSG+MH
Sbjct  180   PYLSTSVQDFWGRRWNIMVTRILHPSIYEPVMKAASHVIGRKWAPIPAVMVTFTVSGLMH  239

Query  378   ELVFYNIGRATPTGEV-------MSFFLVNGACVALEIGVKRAVDGKFR-LPGIVSGPLA  223
             +L+FY++ R   T E        M FF ++G CVALEI  K+    K + LP +VS  L 
Sbjct  240   DLIFYHMKREKATWEAWEPCWDSMCFFFIHGVCVALEIAYKKIFKPKHQLLPRVVSCTLT  299

Query  222   LTLVILTSFWLFFPPYFRN  166
             +  V+ T+ + F P   R+
Sbjct  300   MAFVVSTALYFFVPALVRS  318



>ref|XP_009127057.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
4 [Brassica rapa]
Length=337

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 189/331 (57%), Gaps = 3/331 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             MEGE  + ++V  + +    YC+ I+    K    R   + PV  LF + P+  +++H++
Sbjct  1     MEGETKSLVIVCVSAIIYTSYCYYISTRI-KAGVFRLICVLPVCALFHIFPMFFSTLHIS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
              + +  + WL  FKL LF+  +GPL   PP     FI FACLPIK Q+       F    
Sbjct  60    CSLSVILSWLAGFKLILFSFDQGPLFPLPPNIFR-FICFACLPIKAQQNPNSKTQFPKWV  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+ + GVV  +Y YK+++ P V L  + +H+Y+ LE +L +V  LV  +   +LE  
Sbjct  119   FPIKVAIFGVVLHMYDYKQYMSPVVLLAIYPLHIYLELEIVLMLVKLLVFIILGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
             F+EP+L+TSLQDFWGRRWN+MVT +L+P +Y PVR +    +    A   AVMA+F+VSG
Sbjct  179   FNEPYLATSLQDFWGRRWNLMVTQLLKPAIYIPVRRLCNGRMSSDHARFLAVMATFIVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKRA-VDGKFRLPGIVSGPLALTLV  211
             + HE+ F+ +    PTGEV  FF+++G C A EI  KR     ++R+   VS    +  V
Sbjct  239   VAHEVFFFTLTFEMPTGEVACFFVLHGVCTAAEIAAKRTEFVRRWRVSPTVSPLFTVGFV  298

Query  210   ILTSFWLFFPPYFRNKGDTKACAESLAFIEF  118
             ++TS WL FP   R+    +A  E+L  I+F
Sbjct  299   VMTSGWLLFPTAARSNMLERAANEALLSIDF  329



>ref|XP_006401465.1| hypothetical protein EUTSA_v10015572mg, partial [Eutrema salsugineum]
 gb|ESQ42918.1| hypothetical protein EUTSA_v10015572mg, partial [Eutrema salsugineum]
Length=333

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 135/333 (41%), Positives = 193/333 (58%), Gaps = 4/333 (1%)
 Frame = -3

Query  1107  MEGEINNFIMVWTTVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLA  928
             ME E+ + I VW   +  + YC+ +     K    R  ++FPV  LFLVLPL  +S+HL+
Sbjct  1     MEEELKSLIKVWFCAIISISYCYYLPPRI-KSGVPRLLSVFPVLALFLVLPLLFSSVHLS  59

Query  927   GTSAFFIGWLGSFKLTLFALCRGplsstpplplsTFIPFACLPIKVQRRKKVAGNFKFSG  748
               +AFF+ WL +FKL LF+  +GPL+  P      F  F C PIK Q+  K   +     
Sbjct  60    LITAFFLAWLANFKLILFSFDKGPLTPLPTNLSRFFC-FTCFPIKAQQNPKSHSHLPKLS  118

Query  747   SLRKlvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRAVFRVELEAP  568
                K+V+ GV+  +Y Y+  L P + L  +  HLY+ +E +L  V  +V      +LE  
Sbjct  119   FAIKVVIFGVLLHLYGYRRNLSPTLLLALYFAHLYLEIEIILTFVKVVVFIFLGCDLEPQ  178

Query  567   FDEPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSG  388
              ++P+L+TSLQDFWGRRWN+MV  ILRP VY P+R VS R +    A  P ++A+FVVSG
Sbjct  179   SNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERRMSSGWALFPGILAAFVVSG  238

Query  387   IMHELVFYNIGRATPTGEVMSFFLVNGACVALEIGVKR--AVDGKFRLPGIVSGPLALTL  214
             ++HEL+F+ + R TPTGEV  FF+V G C A E+ VK+   V  +++L   VS  L +  
Sbjct  239   LVHELLFFYLTRETPTGEVTLFFVVQGVCTAAELAVKKKTTVMKRWQLSPAVSRLLTVGF  298

Query  213   VILTSFWLFFPPYFRNKGDTKACAESLAFIEFV  115
             V +T  WLF P   R+    +   E+L F+ FV
Sbjct  299   VFVTGGWLFTPQLIRSGVIERYTNEALLFVNFV  331



>ref|XP_006346258.1| PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 
3-like [Solanum tuberosum]
Length=529

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 191/322 (59%), Gaps = 18/322 (6%)
 Frame = -3

Query  1068  TVLCCLCYCHTINGLFPKPSFTRFFAIFPVACLFLVLPLNLTSIHLAGTSAFFIGWLGSF  889
             +V+  LCYC+  +   PK    R  ++ P+  LF +LPL  +S  L   + F I WL  F
Sbjct  9     SVIPSLCYCYFFSAKIPK-GIPRLISLLPIFYLFTILPLYFSSAFLTAITTFSITWLAIF  67

Query  888   KLTLFALCRGplsstp----plplsTFIPFACLPIKV-----QRRKKVAGNFKFSGSLRK  736
             KL LFA  +GPL         + L  FI  A LP++      Q RKK       + +++ 
Sbjct  68    KLVLFAFDQGPLIINAPNPKIISLPVFISIAALPLRTTFTPNQNRKK-----PMNSAVQV  122

Query  735   lvllgvvflvyyYKEFLHPKVFLLFFVIHLYIVLEFMLFMVSGLVRA--VFRVELEAPFD  562
             ++   ++ ++ ++K  +HPK+ L+F+ + ++++++ ++ + S +V+      +E+E+P +
Sbjct  123   VLFAVIMEIILHHKSEIHPKLVLIFYCVMIFLMIDILIALSSLIVKHFLCLDIEIESPSN  182

Query  561   EPHLSTSLQDFWGRRWNVMVTNILRPTVYDPVRSVSARFLPESLASLPAVMASFVVSGIM  382
             EP+ STSLQDFWGRRWN+ VT+ LR TVY+PVR V    +    A   A +A+F+VSG+M
Sbjct  183   EPYFSTSLQDFWGRRWNLTVTHTLRCTVYNPVRLVLLNVIGRKWAQHSASLATFLVSGLM  242

Query  381   HELVFYNIGRAT-PTGEVMSFFLVNGACVALEIGVKRAVDGKFRLPGIVSGPLALTLVIL  205
             HEL+FY +     P+GE+  FF+++G C+ +EI VK+ +   +R PG+V GPL +  V++
Sbjct  243   HELIFYYVNNGVRPSGEITGFFVLHGLCLVVEIEVKKVLKDTWRFPGLVLGPLTVGFVVV  302

Query  204   TSFWLFFPPYFRNKGDTKACAE  139
             T+F LFFPP  RN  D     E
Sbjct  303   TAFGLFFPPIIRNGVDESILEE  324


 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 121/174 (70%), Gaps = 7/174 (4%)
 Frame = -3

Query  639  VLEFMLF----MVSGLVRAV---FRVELEAPFDEPHLSTSLQDFWGRRWNVMVTNILRPT  481
            +L+F++F    + S +V+ +   F +ELE P +EP+LSTSLQDFWG RWN+ VTN LR T
Sbjct  336  MLQFVIFDKISLSSNIVKIILVGFELELEPPSNEPYLSTSLQDFWGNRWNLTVTNTLRLT  395

Query  480  VYDPVRSVSARFLPESLASLPAVMASFVVSGIMHELVFYNIGRATPTGEVMSFFLVNGAC  301
            +Y+PVRS  +  +  + A   A++A+FVVSG+MHEL+FY + R +P+ E+  FF+++G C
Sbjct  396  IYNPVRSALSEVVGRTWALRVAMLATFVVSGLMHELLFYYVNRVSPSWEMTGFFVLHGLC  455

Query  300  VALEIGVKRAVDGKFRLPGIVSGPLALTLVILTSFWLFFPPYFRNKGDTKACAE  139
            V +EIGVKR +   +RLPG VSG L +  V++T+F LFFPP  RN  D +   E
Sbjct  456  VMVEIGVKRCLKDTWRLPGFVSGLLTVGFVVVTAFGLFFPPIIRNGADERVLEE  509



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3001124733500