BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77742_g1_i1 len=737 path=[1:0-736]

Length=737
                                                                      Score     E

dbj|BAF46299.1|  extensin like protein                                  151   3e-42   Ipomoea nil [qian niu]
gb|ABP35529.1|  proline-rich protein                                    139   3e-37   Ipomoea batatas [batate]
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    125   4e-32   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor            125   4e-32   
gb|ABQ88334.1|  lipid transfer protein                                  125   6e-32   Capsicum annuum
emb|CAI51313.1|  arachidonic acid-induced DEA1                          125   7e-32   Capsicum chinense [bonnet pepper]
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    122   5e-31   
gb|ABG91752.1|  HyPRP2                                                  117   7e-29   Gossypium hirsutum [American cotton]
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                    112   3e-27   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg             111   9e-27   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    111   1e-26   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg             110   3e-26   
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative       110   4e-26   
emb|CDP09932.1|  unnamed protein product                                109   5e-26   
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   7e-26   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   8e-26   
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg                108   1e-25   
ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...    108   1e-25   
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...    108   1e-25   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like     108   2e-25   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg             108   2e-25   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   2e-25   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like     107   2e-25   
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   2e-25   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   2e-25   
emb|CDY32208.1|  BnaA03g54590D                                          107   2e-25   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like     107   2e-25   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like     107   2e-25   
ref|XP_009601879.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   4e-25   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   4e-25   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   4e-25   
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    106   5e-25   
ref|XP_006369032.1|  HyPRP family protein                               106   5e-25   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    106   7e-25   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1          106   7e-25   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15      106   7e-25   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...    106   7e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAC60566.1|  proline-rich SAC51                                      106   1e-24   Brassica napus [oilseed rape]
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...    105   1e-24   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like     105   1e-24   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg                105   1e-24   
emb|CDY08680.1|  BnaC04g19890D                                          105   1e-24   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    105   2e-24   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    104   3e-24   
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    105   3e-24   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    104   3e-24   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg             105   3e-24   
gb|AIX10944.1|  PRP2-like protein                                       105   3e-24   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    104   3e-24   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652             104   4e-24   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    104   4e-24   
ref|XP_004245750.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    103   4e-24   
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15      103   5e-24   Vitis vinifera
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...    103   5e-24   
dbj|BAA99575.1|  DC2.15 like protein                                    103   6e-24   Daucus carota [carrots]
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg                103   8e-24   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    103   1e-23   
gb|AAD01800.1|  HyPRP                                                   103   1e-23   Fragaria x ananassa
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like     103   1e-23   
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    103   1e-23   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg             102   2e-23   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    102   2e-23   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    102   3e-23   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...    102   3e-23   Daucus carota [carrots]
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    101   4e-23   
ref|XP_009787417.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    101   5e-23   
ref|XP_010676150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    101   5e-23   
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15                 101   6e-23   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg             101   6e-23   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg             100   6e-23   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651             100   6e-23   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg             101   6e-23   
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   7e-23   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   8e-23   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...    100   8e-23   
emb|CDY31241.1|  BnaC08g15360D                                          100   1e-22   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor     100   1e-22   
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   1e-22   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                      100   1e-22   
gb|ACE82175.1|  extensin-like protein                                   100   1e-22   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor     100   1e-22   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   1e-22   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   2e-22   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  99.8    2e-22   
emb|CDY21275.1|  BnaC03g29590D                                        99.8    2e-22   
gb|AFK41425.1|  unknown                                               99.8    2e-22   
ref|XP_009612116.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  99.8    2e-22   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  99.4    3e-22   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  99.4    3e-22   Ricinus communis
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   3e-22   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    99.0    4e-22   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.6    4e-22   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 99.0    4e-22   
emb|CDY61290.1|  BnaCnng37610D                                        98.6    5e-22   
emb|CAA81526.1|  14 kDa polypeptide                                   98.6    6e-22   Catharanthus roseus [chatas]
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.2    6e-22   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           98.6    7e-22   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    98.6    7e-22   Vitis vinifera
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               98.2    7e-22   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.6    7e-22   
emb|CAA59472.1|  hybrid proline-rich protein                          98.6    7e-22   Catharanthus roseus [chatas]
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           98.2    7e-22   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    98.2    8e-22   Vitis vinifera
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.2    8e-22   
ref|XP_002271792.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    98.2    9e-22   Vitis vinifera
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    97.8    9e-22   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   98.2    9e-22   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   97.8    1e-21   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.8    1e-21   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    97.1    2e-21   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.1    2e-21   
emb|CDY21034.1|  BnaA08g24910D                                        96.7    3e-21   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.1    3e-21   
ref|XP_008448871.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.7    3e-21   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   96.7    3e-21   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    96.3    4e-21   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    4e-21   
emb|CBI31906.3|  unnamed protein product                              95.5    4e-21   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   96.7    5e-21   
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    5e-21   
ref|XP_008437107.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    5e-21   
emb|CDX90834.1|  BnaA03g25140D                                        95.9    5e-21   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.9    5e-21   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   95.9    6e-21   
gb|AEX33654.1|  lipid transfer protein                                95.9    6e-21   
gb|AAM47507.1|  extensin-like protein                                 95.9    6e-21   Citrus junos [kuzu]
ref|XP_004150818.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.9    6e-21   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    7e-21   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    7e-21   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.1    1e-20   
ref|NP_001053511.1|  Os04g0554500                                     95.1    1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|KHN04345.1|  14 kDa proline-rich protein DC2.15                    95.9    1e-20   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   95.1    1e-20   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  95.1    1e-20   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    1e-20   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    1e-20   
gb|EAY95110.1|  hypothetical protein OsI_16927                        94.7    1e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAK05563.1|  predicted protein                                    96.3    1e-20   
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       94.7    2e-20   
ref|XP_006357014.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    2e-20   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  94.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001053512.1|  Os04g0554600                                     94.4    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    2e-20   
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    2e-20   
ref|XP_006368194.1|  HyPRP family protein                             94.4    2e-20   
ref|XP_003559027.1|  PREDICTED: putative glycine-rich cell wall s...  95.5    3e-20   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    3e-20   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           94.0    3e-20   
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           94.0    3e-20   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    93.6    3e-20   Vitis vinifera
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.0    3e-20   
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.6    3e-20   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.0    3e-20   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.6    4e-20   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.0    4e-20   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           93.6    4e-20   
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   93.6    4e-20   
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    5e-20   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    5e-20   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  93.2    5e-20   Ricinus communis
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
dbj|BAA11854.1|  extensin like protein                                93.2    6e-20   Populus nigra [black poplar]
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
ref|XP_010093705.1|  hypothetical protein L484_019046                 92.4    6e-20   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.8    7e-20   
ref|XP_007155637.1|  hypothetical protein PHAVU_003G218600g           92.8    7e-20   
emb|CDP09930.1|  unnamed protein product                              92.4    9e-20   
emb|CDP09931.1|  unnamed protein product                              92.4    9e-20   
ref|XP_010041938.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    9e-20   
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        92.4    9e-20   Sorghum bicolor [broomcorn]
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  92.8    9e-20   
emb|CDX79156.1|  BnaA01g12230D                                        92.4    9e-20   
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.4    1e-19   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    1e-19   
ref|XP_004516837.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    1e-19   
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    2e-19   
gb|ACV74341.1|  proline-rich protein                                  92.0    2e-19   Jatropha curcas
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   91.7    2e-19   
ref|NP_001152587.1|  cortical cell-delineating protein precursor      91.7    2e-19   Zea mays [maize]
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_010933688.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  91.7    2e-19   Ricinus communis
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  92.4    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289  92.8    3e-19   
gb|EAY88189.1|  hypothetical protein OsI_09636                        92.4    3e-19   Oryza sativa Indica Group [Indian rice]
emb|CDP05328.1|  unnamed protein product                              90.9    3e-19   
dbj|BAG50511.1|  qLTG-3-1                                             92.4    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    3e-19   
ref|NP_001048668.1|  Os03g0103300                                     92.4    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  91.3    3e-19   Ricinus communis
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           90.9    3e-19   
dbj|BAJ08379.1|  qLTG3-1                                              92.4    3e-19   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           91.3    3e-19   
ref|XP_002874777.1|  hypothetical protein ARALYDRAFT_911650           91.3    4e-19   
dbj|BAJ08384.1|  qLTG3-1                                              92.4    4e-19   
dbj|BAJ08383.1|  qLTG3-1                                              92.4    4e-19   
dbj|BAJ08381.1|  qLTG3-1                                              92.4    4e-19   
ref|XP_010053449.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    90.5    4e-19   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   90.5    4e-19   
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.3    4e-19   
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    4e-19   
dbj|BAJ08382.1|  qLTG3-1                                              92.4    4e-19   
dbj|BAJ08386.1|  qLTG3-1                                              92.4    4e-19   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            90.9    4e-19   
ref|XP_006289530.1|  hypothetical protein CARUB_v10003073mg           91.3    4e-19   
dbj|BAJ08385.1|  qLTG3-1                                              92.4    4e-19   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    5e-19   
gb|KCW77747.1|  hypothetical protein EUGRSUZ_D02041                   90.1    5e-19   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           90.5    5e-19   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           91.3    5e-19   
ref|XP_010422218.1|  PREDICTED: lipid transfer protein EARLI 1-like   90.9    6e-19   
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              89.7    7e-19   
ref|XP_010553781.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    8e-19   
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...  90.1    8e-19   Ricinus communis
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        90.5    8e-19   
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   89.7    8e-19   
gb|EPS71802.1|  hypothetical protein M569_02964                       90.1    9e-19   
ref|NP_001152564.1|  cortical cell-delineating protein precursor      89.7    9e-19   Zea mays [maize]
ref|XP_010519362.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        89.4    1e-18   Sorghum bicolor [broomcorn]
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           90.1    1e-18   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  89.7    1e-18   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   88.2    1e-18   
gb|ADA67933.1|  putative 14 kDa proline-rich protein DC2.15           89.4    1e-18   Wolffia arrhiza
ref|XP_010533776.1|  PREDICTED: lipid transfer protein EARLI 1        89.4    1e-18   
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
gb|EMS52512.1|  14 kDa proline-rich protein DC2.15                    89.4    2e-18   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  89.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134277.1|  PREDICTED: putative lipid-binding protein AIR1   88.6    2e-18   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    2e-18   
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
ref|XP_004986077.1|  PREDICTED: putative glycine-rich cell wall s...  90.5    2e-18   
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   89.0    2e-18   
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    2e-18   
ref|NP_199500.1|  bifunctional inhibitor/lipid-transfer protein/s...  88.6    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        89.0    2e-18   
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           89.7    2e-18   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   89.4    2e-18   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   89.4    2e-18   
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            90.1    2e-18   
ref|XP_010088890.1|  hypothetical protein L484_020878                 88.6    3e-18   
ref|NP_192985.1|  putative lipid transfer protein                     89.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    88.6    3e-18   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           89.4    3e-18   
ref|XP_010433390.1|  PREDICTED: lipid transfer protein EARLI 1-like   89.0    3e-18   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    88.6    3e-18   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           89.4    3e-18   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    3e-18   
ref|XP_002867769.1|  hypothetical protein ARALYDRAFT_914370           88.6    3e-18   
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...  89.0    3e-18   
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        88.2    3e-18   Sorghum bicolor [broomcorn]
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        87.8    3e-18   Sorghum bicolor [broomcorn]
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.2    3e-18   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       88.2    3e-18   
gb|EPS73889.1|  hypothetical protein M569_00868                       88.2    3e-18   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  89.0    3e-18   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           88.2    4e-18   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.2    4e-18   
gb|AAM62750.1|  extA                                                  87.8    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    4e-18   
gb|KFK31980.1|  hypothetical protein AALP_AA6G184800                  89.0    4e-18   
emb|CBI31904.3|  unnamed protein product                              87.4    4e-18   
gb|EYU31726.1|  hypothetical protein MIMGU_mgv1a019851mg              87.4    4e-18   
ref|NP_199501.1|  Bifunctional inhibitor/lipid-transfer protein/s...  87.8    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001047650.1|  Os02g0662000                                     87.8    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  90.9    5e-18   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           88.2    5e-18   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    5e-18   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    6e-18   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    6e-18   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    6e-18   
dbj|BAA05471.1|  tumor-related protein                                85.9    7e-18   
emb|CDY31240.1|  BnaC08g15350D                                        87.4    7e-18   
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   87.0    8e-18   
gb|KHN04347.1|  14 kDa proline-rich protein DC2.15                    87.0    9e-18   
ref|XP_002533291.1|  lipid binding protein, putative                  86.3    1e-17   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    1e-17   
gb|KHG02760.1|  14 kDa proline-rich DC2                               87.0    1e-17   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    1e-17   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    1e-17   
ref|XP_010455697.1|  PREDICTED: lipid transfer protein EARLI 1-like   87.0    1e-17   
emb|CDY21277.1|  BnaC03g29610D                                        86.3    1e-17   
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       86.7    1e-17   
ref|XP_010695115.1|  PREDICTED: putative lipid-binding protein AIR1B  86.3    1e-17   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    1e-17   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        86.3    1e-17   
ref|XP_004147199.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    1e-17   
gb|AFK47889.1|  unknown                                               86.3    1e-17   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  86.7    1e-17   
ref|XP_010422216.1|  PREDICTED: pEARLI1-like lipid transfer prote...  87.4    1e-17   
ref|XP_011039660.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.3    1e-17   
ref|XP_003525814.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    1e-17   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.0    1e-17   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           86.7    1e-17   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           86.7    1e-17   
dbj|BAA13155.1|  glycine-rich polypeptide                             85.5    1e-17   
ref|NP_001235008.1|  uncharacterized protein LOC100499716 precursor   87.4    2e-17   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    2e-17   
ref|XP_008448867.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    2e-17   
ref|XP_006396752.1|  hypothetical protein EUTSA_v10029040mg           86.7    2e-17   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    2e-17   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    86.3    2e-17   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    2e-17   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   86.3    2e-17   
gb|AFK37038.1|  unknown                                               85.9    2e-17   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    2e-17   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    2e-17   
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           85.9    2e-17   
ref|XP_008796819.1|  PREDICTED: lipid transfer protein EARLI 1-like   85.9    2e-17   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  85.9    2e-17   
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    2e-17   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        85.5    2e-17   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   85.9    3e-17   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.3    3e-17   
gb|ADD11814.1|  hybrid proline-rich protein                           85.5    3e-17   
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.5    3e-17   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.3    3e-17   
ref|XP_006398385.1|  hypothetical protein EUTSA_v10001072mg           85.5    3e-17   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        85.5    3e-17   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.5    3e-17   
ref|XP_006398386.1|  hypothetical protein EUTSA_v10001071mg           85.1    4e-17   
ref|NP_192984.1|  azelaic acid induced 1                              85.9    4e-17   
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   85.5    4e-17   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        85.1    4e-17   
ref|XP_003525810.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.3    4e-17   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  85.1    4e-17   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.1    4e-17   
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.5    4e-17   
gb|ACU21436.1|  unknown                                               86.3    4e-17   
ref|XP_010093706.1|  hypothetical protein L484_019047                 85.1    5e-17   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  84.7    5e-17   
ref|XP_007155640.1|  hypothetical protein PHAVU_003G218800g           86.7    5e-17   
ref|XP_007155639.1|  hypothetical protein PHAVU_003G218800g           86.7    5e-17   
gb|AAM75351.1|AF520576_1  extensin-like protein                       86.3    5e-17   
ref|XP_010456924.1|  PREDICTED: putative lipid-binding protein AIR1   84.3    5e-17   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    5e-17   
dbj|BAA13150.1|  NT16 polypeptide                                     85.9    5e-17   
emb|CDP12555.1|  unnamed protein product                              84.7    5e-17   
ref|XP_003608748.1|  14 kDa proline-rich protein DC2.15               85.9    5e-17   
gb|KFK43475.1|  hypothetical protein AALP_AA1G129800                  84.7    5e-17   
ref|XP_010676152.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.1    5e-17   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       84.7    6e-17   
ref|XP_010422379.1|  PREDICTED: putative lipid-binding protein AIR1   84.0    6e-17   
ref|XP_010455695.1|  PREDICTED: pEARLI1-like lipid transfer prote...  85.5    6e-17   
ref|NP_172674.2|  Bifunctional inhibitor/lipid-transfer protein/s...  84.7    6e-17   
ref|XP_002304421.2|  hypothetical protein POPTR_0003s11070g           84.3    6e-17   
ref|XP_002874776.1|  hypothetical protein ARALYDRAFT_911648           85.9    6e-17   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.7    7e-17   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  85.5    7e-17   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       84.7    7e-17   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        84.7    7e-17   
ref|XP_010455696.1|  PREDICTED: lipid transfer protein EARLI 1-like   85.1    7e-17   
ref|XP_010434049.1|  PREDICTED: putative lipid-binding protein AIR1   84.7    7e-17   
ref|XP_008232632.1|  PREDICTED: lipid transfer protein EARLI 1-like   85.5    8e-17   
ref|XP_010431835.1|  PREDICTED: putative lipid-binding protein AIR1   83.6    8e-17   
gb|KDP25658.1|  hypothetical protein JCGZ_20814                       83.6    8e-17   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    8e-17   
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.7    8e-17   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.7    8e-17   
ref|XP_010431799.1|  PREDICTED: putative lipid-binding protein AIR1   83.6    9e-17   
emb|CDY21274.1|  BnaC03g29580D                                        85.1    9e-17   
ref|NP_001152585.1|  LOC100286225 precursor                           84.0    1e-16   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      84.0    1e-16   
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.0    1e-16   
ref|XP_006289038.1|  hypothetical protein CARUB_v10002422mg           84.7    1e-16   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    1e-16   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.7    1e-16   
gb|AFK43955.1|  unknown                                               83.6    1e-16   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              84.0    1e-16   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.0    1e-16   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           83.6    1e-16   
ref|XP_008238565.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    1e-16   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.0    1e-16   
gb|AFW63295.1|  cortical cell-delineating protein                     83.6    1e-16   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           84.3    1e-16   
gb|AAX20042.1|  proline-rich protein                                  83.6    1e-16   
ref|XP_010657904.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    85.5    1e-16   
ref|NP_192987.1|  bifunctional inhibitor/lipid-transfer protein/s...  84.7    2e-16   
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        84.3    2e-16   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    2e-16   
emb|CDX90837.1|  BnaA03g25170D                                        82.8    2e-16   
ref|XP_002309638.1|  hypothetical protein POPTR_0006s27220g           83.2    2e-16   
gb|KDP25654.1|  hypothetical protein JCGZ_20810                       82.8    2e-16   
emb|CDX90833.1|  BnaA03g25130D                                        84.3    2e-16   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.3    2e-16   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.6    2e-16   
ref|XP_006290087.1|  hypothetical protein CARUB_v10003726mg           82.8    2e-16   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   83.2    2e-16   
ref|XP_006286641.1|  hypothetical protein CARUB_v10002511mg           82.8    2e-16   
ref|XP_010431811.1|  PREDICTED: putative lipid-binding protein AIR1   82.8    2e-16   
ref|XP_010441523.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    2e-16   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  83.2    2e-16   
emb|CAI48077.1|  extensin-like protein                                83.6    2e-16   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           83.2    2e-16   
ref|XP_010099842.1|  hypothetical protein L484_008499                 83.2    2e-16   
ref|XP_004244453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    2e-16   
ref|XP_004152413.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    2e-16   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       85.5    2e-16   
ref|XP_004245729.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    2e-16   
ref|XP_010494895.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    2e-16   
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           83.2    2e-16   
gb|KGN50238.1|  hypothetical protein Csa_5G161870                     83.2    2e-16   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    2e-16   
emb|CDY64848.1|  BnaC05g49400D                                        83.2    2e-16   
ref|XP_002892674.1|  hypothetical protein ARALYDRAFT_471359           83.2    2e-16   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.0    2e-16   
gb|EYU30298.1|  hypothetical protein MIMGU_mgv1a017316mg              81.6    2e-16   
ref|XP_008232631.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.6    2e-16   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.0    2e-16   
ref|NP_001151721.1|  LOC100285357 precursor                           83.2    2e-16   
ref|XP_008648736.1|  PREDICTED: pEARLI1-like lipid transfer prote...  82.8    3e-16   
ref|XP_006396749.1|  hypothetical protein EUTSA_v10029497mg           82.4    3e-16   
gb|ACN26094.1|  unknown                                               82.8    3e-16   
gb|KDP34267.1|  hypothetical protein JCGZ_12836                       82.4    3e-16   
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       85.1    3e-16   
ref|NP_192986.1|  Bifunctional inhibitor/lipid-transfer protein/s...  84.0    3e-16   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   82.8    3e-16   
ref|XP_007155638.1|  hypothetical protein PHAVU_003G218700g           84.0    3e-16   
ref|XP_006289359.1|  hypothetical protein CARUB_v10002845mg           82.4    3e-16   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    82.8    3e-16   
ref|XP_004516836.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    3e-16   
ref|XP_006847372.1|  hypothetical protein AMTR_s01045p00008470        82.8    3e-16   
ref|XP_009595495.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    3e-16   
ref|XP_010433325.1|  PREDICTED: putative lipid-binding protein AIR1B  82.0    3e-16   
ref|XP_006282240.1|  hypothetical protein CARUB_v10028513mg           82.4    3e-16   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.0    3e-16   
ref|XP_010433312.1|  PREDICTED: putative lipid-binding protein AIR1   82.4    4e-16   
ref|XP_010422227.1|  PREDICTED: putative lipid-binding protein AIR1B  82.0    4e-16   
ref|NP_001275620.1|  uncharacterized protein LOC102590907 precursor   82.4    4e-16   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  82.4    4e-16   
ref|XP_006367623.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.4    4e-16   
ref|XP_010494894.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.4    4e-16   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  84.3    4e-16   
ref|XP_010093708.1|  hypothetical protein L484_019049                 82.0    4e-16   
ref|XP_004246067.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    5e-16   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    81.6    5e-16   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    5e-16   
ref|XP_007039884.1|  Bifunctional inhibitor/lipid-transfer protei...  82.0    5e-16   
emb|CDY16710.1|  BnaA09g20880D                                        81.3    5e-16   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.4    5e-16   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    5e-16   
ref|XP_010439335.1|  PREDICTED: putative lipid-binding protein AIR1   82.0    5e-16   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   82.0    5e-16   
ref|XP_006289684.1|  hypothetical protein CARUB_v10003241mg           82.0    6e-16   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    6e-16   
ref|XP_008437105.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    6e-16   
ref|XP_004171279.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    6e-16   
ref|XP_006282236.1|  hypothetical protein CARUB_v10028509mg           81.3    6e-16   
emb|CDX94514.1|  BnaC09g23220D                                        82.8    6e-16   
ref|XP_006282307.1|  hypothetical protein CARUB_v10028597mg           81.6    7e-16   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    7e-16   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    7e-16   
ref|XP_010456925.1|  PREDICTED: putative lipid-binding protein AIR1   80.9    7e-16   
ref|XP_006289945.1|  hypothetical protein CARUB_v10003571mg           82.0    7e-16   
ref|XP_010264239.1|  PREDICTED: putative lipid-binding protein At...  81.6    7e-16   
ref|XP_010455703.1|  PREDICTED: putative lipid-binding protein AIR1B  81.3    7e-16   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    7e-16   
ref|NP_172673.1|  extensin-like protein                               81.6    7e-16   
ref|XP_010455705.1|  PREDICTED: pEARLI1-like lipid transfer prote...  82.4    7e-16   
ref|XP_006281886.1|  hypothetical protein CARUB_v10028084mg           81.3    8e-16   
ref|XP_003603362.1|  Proline-rich protein                             81.6    8e-16   
ref|XP_006396746.1|  hypothetical protein EUTSA_v10029045mg           82.0    8e-16   
ref|XP_010422228.1|  PREDICTED: putative lipid-binding protein AIR1   81.6    8e-16   
ref|XP_002515493.1|  14 kDa proline-rich protein DC2.15 precursor...  81.6    8e-16   
emb|CDX82944.1|  BnaC01g13940D                                        81.6    8e-16   
ref|XP_008448870.1|  PREDICTED: lipid transfer protein EARLI 1-like   83.2    9e-16   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   81.6    9e-16   
ref|XP_006281689.1|  hypothetical protein CARUB_v10027837mg           80.9    9e-16   
ref|XP_006355499.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    9e-16   
ref|XP_002466039.1|  hypothetical protein SORBIDRAFT_01g050420        81.6    9e-16   
gb|AFK47547.1|  unknown                                               81.6    9e-16   
ref|NP_001065334.1|  Os10g0552800                                     81.3    9e-16   
ref|XP_010692176.1|  PREDICTED: putative lipid-binding protein At...  81.3    1e-15   
ref|XP_010456901.1|  PREDICTED: putative lipid-binding protein AIR1B  80.9    1e-15   
ref|XP_010441524.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    1e-15   
ref|XP_004152415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    1e-15   
gb|AAK30571.1|AF346659_1  extensin-like protein                       81.3    1e-15   
ref|XP_003580295.1|  PREDICTED: ctenidin-3-like                       82.4    1e-15   
ref|XP_010458633.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    1e-15   
ref|XP_003608741.1|  Cortical cell-delineating protein                80.9    1e-15   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   82.8    1e-15   
ref|XP_009798523.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    1e-15   
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    1e-15   
ref|XP_010433356.1|  PREDICTED: putative lipid-binding protein AIR1B  80.5    1e-15   
ref|XP_004501349.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    1e-15   
ref|XP_008437103.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    1e-15   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    2e-15   
ref|XP_006279552.1|  hypothetical protein CARUB_v10028669mg           80.1    2e-15   
ref|XP_002863385.1|  hypothetical protein ARALYDRAFT_494287           80.5    2e-15   
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    2e-15   
ref|NP_001065332.1|  Os10g0552600                                     80.9    2e-15   
ref|XP_008437111.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    2e-15   



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 133/133 (100%), Positives = 133/133 (100%), Gaps = 0/133 (0%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASKKTSVLALFIVFNILFCTMVSACGTCPSPKPKPKPKPTPSPSNKGKCPKDALKLGVC
Sbjct  1    MASKKTSVLALFIVFNILFCTMVSACGTCPSPKPKPKPKPTPSPSNKGKCPKDALKLGVC  60

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLGNLLGLVVGNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGINLNVPLSLSLLLN
Sbjct  61   ANVLGNLLGLVVGNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGINLNVPLSLSLLLN  120

Query  287  VCGKKVPSGFQCP  249
            VCGKKVPSGFQCP
Sbjct  121  VCGKKVPSGFQCP  133



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 123/133 (92%), Gaps = 1/133 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASKKTSVLALFIVFNI FC MVSACGTCPSPKPKPKPKPTPSP     CPKDALKLGVC
Sbjct  1    MASKKTSVLALFIVFNIFFCPMVSACGTCPSPKPKPKPKPTPSPFKGK-CPKDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLGNLLGLVVGNPPKKPCCS IEGLVDLEAAVCLCTAIKAN+LGINLNVPLSLSL LN
Sbjct  60   ANVLGNLLGLVVGNPPKKPCCSFIEGLVDLEAAVCLCTAIKANVLGINLNVPLSLSLFLN  119

Query  287  VCGKKVPSGFQCP  249
            VCGKKVP GFQCP
Sbjct  120  VCGKKVPFGFQCP  132



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 120/137 (88%), Gaps = 4/137 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgK----CPKDALK  480
            MASK+T+ LALF++ N+LF T+VSACGTCPSPKPKPKPKP P P+        CP D LK
Sbjct  1    MASKRTTSLALFVLVNLLFFTLVSACGTCPSPKPKPKPKPKPKPTPSPSSKGKCPIDTLK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVLGN+LG+V+GNPPKKPCCSLIEGLVDLEAA+CLCTAIKANILGINLNVPLSLS
Sbjct  61   LGVCANVLGNVLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGINLNVPLSLS  120

Query  299  lllnVCGKKVPSGFQCP  249
            LLLN CGKK PSGFQCP
Sbjct  121  LLLNACGKKAPSGFQCP  137



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 120/137 (88%), Gaps = 4/137 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgK----CPKDALK  480
            MASK+T+ LALF++ N+LF T+VSACGTCP PKPKPKPKP P P+        CP D LK
Sbjct  1    MASKRTTSLALFVLVNLLFFTLVSACGTCPGPKPKPKPKPKPKPTPSPSSKGKCPIDTLK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVLGNLLG+V+GNPPKKPCCSLIEGLVDLEAA+CLCTAIKANILGINLNVPLSLS
Sbjct  61   LGVCANVLGNLLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGINLNVPLSLS  120

Query  299  lllnVCGKKVPSGFQCP  249
            LLLNVCGKK PSGFQCP
Sbjct  121  LLLNVCGKKAPSGFQCP  137



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 8/141 (6%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsps--------nkgKCPK  492
            MASKKT+ LALFI+ N+LF ++VSACGTCPSPKPKPKPKP P+P+        +KGKCP 
Sbjct  1    MASKKTTTLALFILVNLLFFSLVSACGTCPSPKPKPKPKPKPTPTPKPTPSPGSKGKCPV  60

Query  491  DALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvp  312
            DALKLG+CANVLGNLLG+V+GNPPKKPCCSLI+GLVDLEAA+CLCTA+KANILGINLNVP
Sbjct  61   DALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGINLNVP  120

Query  311  lslslllnVCGKKVPSGFQCP  249
            +SLSLLLNVCGKKVPSGFQCP
Sbjct  121  ISLSLLLNVCGKKVPSGFQCP  141



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 8/141 (6%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsps--------nkgKCPK  492
            MASKKT+ LALFI+ N+LF ++VSACGTCPSPKPKPKPKP P+P+        +KGKCP 
Sbjct  1    MASKKTTTLALFILVNLLFFSLVSACGTCPSPKPKPKPKPKPTPTPKPTPSPGSKGKCPI  60

Query  491  DALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvp  312
            DALKLG+CANVLGNLLG+V+GNPPKKPCCSLI+GLVDLEAA+CLCTA+KANILGINLNVP
Sbjct  61   DALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGINLNVP  120

Query  311  lslslllnVCGKKVPSGFQCP  249
            +SLSLLLNVCGKKVPSGFQCP
Sbjct  121  ISLSLLLNVCGKKVPSGFQCP  141



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASKKT+ LALFI+ N+LF ++VSACGTCPSPKPKPKPKP+PSPS    CP D LKLGVC
Sbjct  1    MASKKTTSLALFILVNLLFFSLVSACGTCPSPKPKPKPKPSPSPSKGK-CPIDTLKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLGNLLGLV+GNPPKKPCC+LI+G+ DLEAAVCLCTAIKANILGINLNVPLSLSLLLN
Sbjct  60   ANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAVCLCTAIKANILGINLNVPLSLSLLLN  119

Query  287  VCGKKVPSGFQC  252
            VCGKKVPSGFQC
Sbjct  120  VCGKKVPSGFQC  131



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 4/136 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgK----CPKDALK  480
            M SK+T+ LALF   NILF ++VSACG+CPSP PKPKPKP P+P+        CP+DALK
Sbjct  1    MGSKRTASLALFFALNILFFSLVSACGSCPSPNPKPKPKPKPNPTPSPSSSGKCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCA++LG LL + +G PP +PCCSLI+GL DLEAAVCLCTAIKANILGINLNVPLSLS
Sbjct  61   LGVCADLLGGLLNVTIGTPPVQPCCSLIQGLADLEAAVCLCTAIKANILGINLNVPLSLS  120

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVC KKVPSGFQC
Sbjct  121  LLLNVCSKKVPSGFQC  136



>gb|KFK31985.1| hypothetical protein AALP_AA6G185200 [Arabis alpina]
Length=133

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++ L LF+ FNILF T+ SAC +  +P  KPKPKPTP+PS+ GKCPKD ++LGVC
Sbjct  1    MASKISASLTLFLTFNILFFTLTSACSSGCNPISKPKPKPTPNPSSSGKCPKDTIRLGVC  60

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL +LL + +G PP KPCCSLI+GLVDLEAA CLCTA+KAN+LGI LN+P+SL+LLLN
Sbjct  61   ANVLKDLLKIKLGTPPVKPCCSLIDGLVDLEAAACLCTALKANVLGIKLNIPISLNLLLN  120

Query  287  VCGKKVPSGFQC  252
            VCGKKVPSGF+C
Sbjct  121  VCGKKVPSGFKC  132



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L +F+ FNILF T+ +ACG    P PKPKPKPKPTPS S+ G CPKD LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPKDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSLI+GLVDLEAA CLCTAIKAN+LGINLNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGINLNVPVSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKKVPSGF+C
Sbjct  121  LNVCGKKVPSGFKC  134



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK T+ LALF+  N+LF ++V+A  +   P P           + GKCPKDALKLGVC
Sbjct  1    MASKSTTSLALFLAVNLLFFSLVTAK-SSSCPPPPKPKPTPTPSPSGGKCPKDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +LG+LL + VG PP +PCCS+I+GL+DLEAAVCLCTAIKANILGINLN+P+SLSLLLN
Sbjct  60   AGLLGSLLNVTVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKANILGINLNIPVSLSLLLN  119

Query  287  VCGKKVPSGFQCP  249
            VCGKKVP GFQCP
Sbjct  120  VCGKKVPKGFQCP  132



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L LF+ FNILF T+ +ACG    P PKPKPKPKPTPS S+ G CPKD LKLG
Sbjct  1    MASKISAPLVLFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPKDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSLI+GLVDLEAA CLCTAIKAN+LGINLNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGINLNVPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKKVPSGF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
 gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
Length=140

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 114/139 (82%), Gaps = 7/139 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsn-------kgKCPKD  489
            MASK+++ LALF   NILF ++VSACG+CPSPKPKPKP P  SPS         GKCP+D
Sbjct  1    MASKRSASLALFFALNILFFSLVSACGSCPSPKPKPKPTPCSSPSTPCPTPSGGGKCPRD  60

Query  488  ALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpl  309
            ALKLG+CA++LG LL + VG PP +PCCSLI+GL DLEAAVCLCTAIKANILGINLN+P+
Sbjct  61   ALKLGICADLLGGLLNVTVGKPPVQPCCSLIQGLADLEAAVCLCTAIKANILGINLNIPV  120

Query  308  slslllnVCGKKVPSGFQC  252
            SLSLLLNVC K VPSGFQC
Sbjct  121  SLSLLLNVCSKNVPSGFQC  139



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 101/147 (69%), Gaps = 16/147 (11%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsn--------------  510
            M SK T+ LALF+ FN++F T+VSACG CP PKP         P                
Sbjct  1    MGSKATTTLALFLAFNLIFFTLVSACGDCPKPKPPKPKPKPSPPPTVPCPPPPYSPTPNP  60

Query  509  -kgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANIL  333
             +  CP+DALKLGVCAN+L  +   +   PP +PCCSL++GL DLEAA+CLCTAIKANIL
Sbjct  61   PQKSCPRDALKLGVCANLLNIIGISIGS-PPTEPCCSLLQGLADLEAALCLCTAIKANIL  119

Query  332  GInlnvplslslllnVCGKKVPSGFQC  252
            GINLNVP+SLS++LN CGKKVP+GFQC
Sbjct  120  GINLNVPVSLSVILNDCGKKVPNGFQC  146



>ref|XP_008808739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 96/132 (73%), Gaps = 7/132 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK TS  ALF++FN L  T  SACG+CP          +        CP DALKLGVC
Sbjct  1    MASK-TSAFALFLIFNSLLFTFASACGSCPPKPSTTPSPSSGK------CPIDALKLGVC  53

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A+VLG LL + +G PPK+PCCSL+ GLVDLE AVCLC AIKA+ILGINLN+P+ LSLL+N
Sbjct  54   ADVLGGLLNITIGTPPKEPCCSLLSGLVDLEVAVCLCIAIKASILGINLNIPVDLSLLVN  113

Query  287  VCGKKVPSGFQC  252
             CGKKVPSGFQC
Sbjct  114  YCGKKVPSGFQC  125



>ref|XP_009376589.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009376590.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptps---psnkgKCPKDALKL  477
            M SK+ S LALF+  N+LFC + S C TC     +    P P+    ++   CP+D+LKL
Sbjct  1    MNSKRYSTLALFLSINLLFCVLASGCYTCSQQPHQQIRNPRPNPIPSASPKSCPRDSLKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCA +L   +G VVGNPP  PCC+L+EGLVDLE AVCLCTAIKANILGINLN+P++LSL
Sbjct  61   GVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  296  llnVCGKKVPSGFQC  252
            +++ C K VP GF+C
Sbjct  121  VIDGCAKNVPEGFKC  135



>gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Erythranthe guttata]
Length=146

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 101/145 (70%), Gaps = 13/145 (9%)
 Frame = -1

Query  647  MASKKT-SVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk------------  507
            MAS KT S++A+F+V N+LF T  SACG+CP                             
Sbjct  1    MASNKTTSIIAIFLVLNLLFFTFSSACGSCPDTPKPKPKPKPKPKPKPSCPPPPAGPGDK  60

Query  506  gKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGI  327
              CP+DALKLGVCA++LG L+GL +G+PPK PCCSLIEGL DLEAAVCLCTAIKAN+LGI
Sbjct  61   TTCPRDALKLGVCADLLGGLIGLTIGSPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGI  120

Query  326  nlnvplslslllnVCGKKVPSGFQC  252
            NLNVP+SLSLLLNVC K +P GFQC
Sbjct  121  NLNVPISLSLLLNVCSKNIPPGFQC  145



>ref|XP_009591583.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Nicotiana tomentosiformis]
Length=135

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 105/131 (80%), Gaps = 6/131 (5%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGTCpspkpkpkpkptps------psnkgKCPKDALKLGVCAn  462
            LALF+VFNILF T+VSAC TCP PKPKPKPKP P        S  GKCP DALKLGVCAN
Sbjct  5    LALFLVFNILFFTVVSACSTCPGPKPKPKPKPKPKPCPPPPSSQGGKCPTDALKLGVCAN  64

Query  461  vlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVC  282
            VL  LL + +G PP KPCCSLIE LVDLEAAVCLCTA+KANILGINLN+P+SL+LLLNVC
Sbjct  65   VLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKANILGINLNLPISLNLLLNVC  124

Query  281  GKKVPSGFQCP  249
             KK P GF CP
Sbjct  125  SKKAPKGFTCP  135



>ref|XP_011081227.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Sesamum indicum]
Length=139

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 6/138 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk------gKCPKDA  486
            MA+KK + +ALF+V N++F T+ SACGTCP+PKPKPKPKP P+            CP+DA
Sbjct  1    MATKKQTSIALFLVLNLVFFTLSSACGTCPTPKPKPKPKPKPNCPPPPASPGKATCPRDA  60

Query  485  LKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpls  306
            LKLGVCAN+LG L+ L +G PPK PCC+LIEGL D+EAAVCLCTAIKAN+LGINLNVPLS
Sbjct  61   LKLGVCANLLGGLIDLTIGTPPKTPCCTLIEGLADVEAAVCLCTAIKANVLGINLNVPLS  120

Query  305  lslllnVCGKKVPSGFQC  252
            LSLLLNVC KKVP GFQC
Sbjct  121  LSLLLNVCSKKVPPGFQC  138



>ref|XP_010422224.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L +F+ FNILF T+ +ACG    P PKPKP PKPTPS S+ G CP+D LKLG
Sbjct  1    MASKMSASLVIFLTFNILFFTLTTACGGGCSPVPKPKPNPKPTPSHSSTGSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN+LGINLNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKKVPSGF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis]
Length=132

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK ++ LALF+  NILF  +V+ACG+                 +   CP+DALKLGVC
Sbjct  1    MGSKTSASLALFLAVNILFFALVTACGS-CPSPKPKPKPKPTPSPSGASCPRDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL  LL + +G PP +PCC+LI+GL DLEAAVCLCTAIKANILGINLN+PLSLSLLLN
Sbjct  60   ANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLN  119

Query  287  VCGKKVPSGFQC  252
            VC K VP GFQC
Sbjct  120  VCSKSVPRGFQC  131



>ref|XP_008381149.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008365739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptps---psnkgKCPKDALKL  477
            M SK +S LALF+  N+LFC + S C TC     +P   P P+    ++   CP+D+LKL
Sbjct  1    MNSKTSSTLALFLSINLLFCVLASGCYTCSQQPHQPIRNPRPNPIPSASPKSCPRDSLKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCA +L   +G VVGNPP  PCC+L+EGLVDLE AVCLCTAIKANILGINLN+P++LSL
Sbjct  61   GVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  296  llnVCGKKVPSGFQC  252
            +++ C K VP GF+C
Sbjct  121  VIDGCAKNVPEGFKC  135



>ref|XP_010433369.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK +S L +F+ FNILF T+ +ACG    P PKPKPKPKPTPS S+ G CP+D LKLG
Sbjct  1    MASKISSSLIIFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSSGSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN+LGI LNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGKPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIKLNVPVSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKKVPSGF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_004299470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=144

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 111/143 (78%), Gaps = 11/143 (8%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMV-SACGTCpspkpkpkpkpt----------pspsnkgK  501
            MAS+ T+ LALF+V N+LF TMV +AC TCP PKPKP+P+P            +PS    
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPRPTPSPGTPSTPSGTAT  60

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLG+CANVL NLL + +G PP +PCC+LI+GL DLEAAVCLCTAI+A+ILGINL
Sbjct  61   CPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINL  120

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLLLN CG +VP GFQC
Sbjct  121  NIPIALSLLLNACGNQVPRGFQC  143



>ref|XP_009123402.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brassica 
rapa]
Length=137

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC-----pspkpkpkpkptpspsnkgKCPKDAL  483
            M+S+ TS LA+F++ NILF T +SACG C                        KCP+DAL
Sbjct  1    MSSRTTSSLAIFLILNILFFTTISACGNCGCPFPKPKPNPEPKPTPSPSPATAKCPRDAL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+KANILG NLN+P+SL
Sbjct  61   KLGVCANVLNGLLNVTLGQPPVEPCCTLIKGLADLEAAACLCTALKANILGNNLNIPISL  120

Query  302  slllnVCGKKVPSGFQC  252
            SLLLNVC KKVP GFQC
Sbjct  121  SLLLNVCSKKVPPGFQC  137



>emb|CDY32208.1| BnaA03g54590D [Brassica napus]
Length=137

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC-----pspkpkpkpkptpspsnkgKCPKDAL  483
            M+S+ TS LA+F++ NILF T +SACG C                        KCP+DAL
Sbjct  1    MSSRTTSSLAIFLILNILFFTTISACGNCGCPSPKPKPNPEPKPTPSPSPATAKCPRDAL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+KANILG NLN+P+SL
Sbjct  61   KLGVCANVLNGLLNVTLGQPPVEPCCTLIKGLADLEAAACLCTALKANILGNNLNIPISL  120

Query  302  slllnVCGKKVPSGFQC  252
            SLLLNVC KKVP GFQC
Sbjct  121  SLLLNVCSKKVPPGFQC  137



>ref|XP_010455699.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
 ref|XP_010455700.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L +F+ FNILF T+ +ACG    P PKPKPKPKPTPS S+ G CP+D LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN+LGINLNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKKVPSGF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_010455698.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L +F+ FNILF T+ +ACG    P PKPKP PKPTPS S+ G CP+D LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACGGGCSPVPKPKPNPKPTPSHSSTGSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN+LGINLNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKKVPSGF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_009601879.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnll  444
            LALF+VFNILF T+VSAC TCPSPKP PKP P PSPS    CP DALKLGVCANVL  LL
Sbjct  5    LALFLVFNILFFTVVSACNTCPSPKPTPKPTPNPSPSEGK-CPTDALKLGVCANVLNGLL  63

Query  443  glvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPS  264
             + +G PP KPCCSLI  LVDLEAAVCLCTA+KANILGINLN+P+SLSLLLNVC K +P 
Sbjct  64   NVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIPISLSLLLNVCSKDIPK  123

Query  263  GFQCP  249
            GF CP
Sbjct  124  GFACP  128



>ref|XP_008392579.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpk---ptpspsnkgKCPKDALKL  477
            M SK +S LALF+  N+LFC + S C TCP    +P           +    CP+D+LKL
Sbjct  1    MDSKSSSTLALFLSVNLLFCVLASGCYTCPQXPHQPMTNPKPNPIPSAAPKSCPRDSLKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCA +L   +G VVGNPP  PCC+L+EGLV+LE AVCLCTAIKANILGINLN+P++LSL
Sbjct  61   GVCAKLLNRAVGAVVGNPPDHPCCALLEGLVELEVAVCLCTAIKANILGINLNIPIALSL  120

Query  296  llnVCGKKVPSGFQC  252
            +++ C K VPSGF+C
Sbjct  121  IIDGCAKNVPSGFKC  135



>ref|XP_009333598.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpk---ptpspsnkgKCPKDALKL  477
            M SK +S LALF+  N LFC + S C TCP    +P           +    CP+D+LKL
Sbjct  1    MDSKSSSTLALFLSVNFLFCVLASGCYTCPQQPHQPITNPKPNPIPSAASKSCPRDSLKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCA +L  ++G VVGNPP  PCC+L+EGLVDLE AVCLCTAIKANILGINLN+P++LSL
Sbjct  61   GVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  296  llnVCGKKVPSGFQC  252
            +++ C K VP+GF+C
Sbjct  121  VIDGCAKNVPAGFKC  135



>ref|XP_006355478.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=132

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 105/128 (82%), Gaps = 3/128 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGTC---pspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlg  453
            LALF+VFN+LF TMVSAC TC     P PKP P P+PSP+++ KCPKDALKLG+CANVL 
Sbjct  5    LALFLVFNVLFFTMVSACYTCPGPIKPNPKPTPTPSPSPNSQTKCPKDALKLGICANVLN  64

Query  452  nllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKK  273
             LL + +G PP KPCCSLI  LVDLEAAVCLCTA+KANILGINLN+P+SLSLLLNVC K+
Sbjct  65   GLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIPISLSLLLNVCSKE  124

Query  272  VPSGFQCP  249
             P GF CP
Sbjct  125  APKGFICP  132



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK T+ LALF+  N+LF ++V+A      P P           + GKCPKDALKLGVC
Sbjct  1    MASKSTTSLALFLAVNLLFFSLVTA-KRSSCPPPPKPKPTPTPSPSGGKCPKDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A++LG+LL + VG PP +PCCSLI+GL+DLEAAVCLCTAIKANILGINLN+P+SLSLLLN
Sbjct  60   ADLLGSLLNVTVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKANILGINLNIPVSLSLLLN  119

Query  287  VCGKKVPSGFQC  252
            VCGKKVP  FQC
Sbjct  120  VCGKKVPKDFQC  131



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = -1

Query  641  SKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg-KCPKDALKLGVCA  465
            SK ++ LA+F+  N+LF  +VS+CGTCP PKPKP PKP+PS       CP+DALKLGVCA
Sbjct  4    SKSSASLAIFLTLNLLFFALVSSCGTCPGPKPKPTPKPSPSSGPSTGACPRDALKLGVCA  63

Query  464  nvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnV  285
            +VLGNLL + VG PP  PCCSL+ GLVDLEAAVCLCTAIKANILGINLN+P+SLSLLLNV
Sbjct  64   DVLGNLLNVTVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILGINLNIPISLSLLLNV  123

Query  284  CGKKVPSGFQC  252
            C K+VP GF+C
Sbjct  124  CSKQVPPGFKC  134



>ref|XP_009113072.1| PREDICTED: lipid transfer protein EARLI 1 [Brassica rapa]
 emb|CDY19562.1| BnaC09g13410D [Brassica napus]
 emb|CDY12952.1| BnaA09g13220D [Brassica napus]
Length=147

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 96/147 (65%), Gaps = 15/147 (10%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC---------------pspkpkpkpkptpsps  513
            MAS+  S LA+F++ NILFCT +SA G C                               
Sbjct  1    MASRTKSFLAIFLILNILFCTTISAYGNCGCPSPKPKPHPSHKPKPNPKPRPTPTPTPSP  60

Query  512  nkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANIL  333
               KCP+DALKLGVCANVL  LL + +G PP KPCC+LI+GL DLEAA CLCTA+KANIL
Sbjct  61   VTAKCPRDALKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANIL  120

Query  332  GInlnvplslslllnVCGKKVPSGFQC  252
            GINLN+P+SLSLLLNVC KKVP GFQC
Sbjct  121  GINLNIPISLSLLLNVCSKKVPPGFQC  147



>ref|XP_010553464.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Tarenaya hassleriana]
Length=128

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 5/132 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M  K++ +LALFI FN+LF T VS+C TC  PKP P P PT        CP+DALKLGVC
Sbjct  1    MDPKRSFLLALFISFNLLFFTHVSSCNTCVQPKPIPNPNPTKRS-----CPRDALKLGVC  55

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G VVG PP  PCCS+++GLVDLEAAVCLCTAIKANILGI++N+P+SLSLL+N
Sbjct  56   AKILDGAVGTVVGGPPDMPCCSVLQGLVDLEAAVCLCTAIKANILGIDINIPISLSLLIN  115

Query  287  VCGKKVPSGFQC  252
             CGK +P  F C
Sbjct  116  TCGKSLPPDFVC  127



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++ L +F+ FNILF T+ +ACG          PKP P P + G CPKD LKLGVC
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACG----GGCSSTPKPKPKPKSTGSCPKDTLKLGVC  56

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KA +LGINLNVP+SLSLLLN
Sbjct  57   ANVLKDLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLGINLNVPVSLSLLLN  116

Query  287  VCGKKVPSGFQC  252
            VCGKKVPSGF C
Sbjct  117  VCGKKVPSGFVC  128



>gb|AAC60566.1| proline-rich SAC51 [Brassica napus]
Length=147

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 96/147 (65%), Gaps = 15/147 (10%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC---------------pspkpkpkpkptpsps  513
            MAS+  S LA+F++ NILFCT +SA G C                               
Sbjct  1    MASRTKSFLAIFLILNILFCTTISAYGNCGCPSPKPKPDPSHKPKPNPKPKPTPTPTPSP  60

Query  512  nkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANIL  333
               KCP+DALKLGVCANVL  LL + +G PP KPCC+LI+GL DLEAA CLCTA+KANIL
Sbjct  61   VTAKCPRDALKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANIL  120

Query  332  GInlnvplslslllnVCGKKVPSGFQC  252
            GINLN+P+SLSLLLNVC KKVP GFQC
Sbjct  121  GINLNIPISLSLLLNVCSKKVPPGFQC  147



>ref|XP_010422222.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X1 [Camelina 
sativa]
Length=135

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 111/134 (83%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L +F+ F+ILF T+ +ACG    P PKPKPKPKPTPS S+ G CP+D LKLG
Sbjct  1    MASKMSASLVIFLTFSILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN+LGINLNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKKVPSGF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L +F+ FNILF T+ +ACG    P PKPKPKPKPTPS S+ G CP+D LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTNACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCAN+L +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN++GI LNVP+SLSLL
Sbjct  61   VCANLLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVIGIKLNVPVSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCG+KVPSGF C
Sbjct  121  LNVCGRKVPSGFVC  134



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MAS+  +   L ++FN++F TMVS+    P P P            K  CPKD LKLGVC
Sbjct  1    MASRVATSTILLVMFNLVFFTMVSSTYV-PCPPPPSHEHKHHHHHPKATCPKDTLKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            AN+L +L+ LVVG+PPK PCCSLI GLVDLEAAVCLCTA+KAN+LGINLNVP+SLSLLLN
Sbjct  60   ANLLNDLVHLVVGSPPKTPCCSLIGGLVDLEAAVCLCTAVKANVLGINLNVPVSLSLLLN  119

Query  287  VCGKKVPSGFQC  252
             CGKKVPSGFQC
Sbjct  120  YCGKKVPSGFQC  131



>emb|CDY08680.1| BnaC04g19890D [Brassica napus]
Length=137

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 94/137 (69%), Gaps = 5/137 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC-----pspkpkpkpkptpspsnkgKCPKDAL  483
            M S+ TS L +F++ NILF T +SACG C                        KCP+DAL
Sbjct  1    MDSRTTSALDIFLILNILFFTTISACGNCGCPSPKPKPNPEPKPTPSPSPATAKCPRDAL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+KANILG NLN+P+SL
Sbjct  61   KLGVCANVLNGLLNVTLGQPPVEPCCTLIKGLADLEAAACLCTALKANILGNNLNIPISL  120

Query  302  slllnVCGKKVPSGFQC  252
            SLLLNVC KKVP GFQC
Sbjct  121  SLLLNVCSKKVPPGFQC  137



>ref|XP_010264241.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=134

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg--KCPKDALKLG  474
            M SK+++ LALF+  N++F  + SACGTCPSPKPKPKP PTPSP+      CP+DALKLG
Sbjct  1    MVSKQSASLALFLSLNLVFFALTSACGTCPSPKPKPKPNPTPSPTPAAKGTCPRDALKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL  +  +V   PP  PCCSLI+GL +LEAAVCLCTAIKANILGINLN+PLSLSL+
Sbjct  61   VCANVLNLVNVVVGT-PPYLPCCSLIQGLANLEAAVCLCTAIKANILGINLNIPLSLSLV  119

Query  293  lnVCGKKVPSGFQC  252
            LN CGKK P+GFQC
Sbjct  120  LNNCGKKFPTGFQC  133



>ref|XP_008238566.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=136

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptps---psnkgKCPKDALKL  477
            M SK+ S LALF+  N+LFC + + C TC     +P   P  +         CP+DALKL
Sbjct  1    MDSKRCSTLALFLSINLLFCVLANGCYTCSWQPHQPITAPKTNPIPSVATKSCPRDALKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCAN+L   +G ++GNPP  PCC+L+EGL+DLE AVCLCTAIKANILGINLN+P++LSL
Sbjct  61   GVCANLLKGAVGAIIGNPPDTPCCALLEGLLDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  296  llnVCGKKVPSGFQC  252
            +++ C K  P GFQC
Sbjct  121  VIDGCAKTFPPGFQC  135



>ref|XP_004299469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=152

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 19/151 (13%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMV-SACGTCps------------------pkpkpkpkpt  525
            MAS+ T+ LALF+V N+LF TMV +AC TCP                       P P   
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPRPTPSPGTPSTPSPGTP  60

Query  524  pspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIK  345
             +PS    CP+DALKLG+CANVL NLL + +G PP +PCC+LI+GL DLEAAVCLCTAI+
Sbjct  61   STPSGTATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIR  120

Query  344  ANILGInlnvplslslllnVCGKKVPSGFQC  252
            A+ILGINLN+P++LSLLLN CG +VP GFQC
Sbjct  121  ASILGINLNIPIALSLLLNACGNQVPRGFQC  151



>ref|XP_009798258.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=135

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 101/131 (77%), Gaps = 6/131 (5%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgK------CPKDALKLGVCAn  462
            LALF++FNILF T+VSAC TCP P PKPKPKP P P           CP DALKLGVCAN
Sbjct  5    LALFVIFNILFFTVVSACSTCPGPSPKPKPKPKPKPCPPPPSSQGGKCPTDALKLGVCAN  64

Query  461  vlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVC  282
            VL  LL + +G PP KPCCSLIE LVDLEAAVCLCTA+KA ILG+NLN+P+SL+LLLNVC
Sbjct  65   VLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKAKILGVNLNLPISLNLLLNVC  124

Query  281  GKKVPSGFQCP  249
             KK P GF CP
Sbjct  125  SKKAPKGFTCP  135



>ref|XP_006391856.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
 gb|ESQ29142.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
Length=147

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 96/147 (65%), Gaps = 15/147 (10%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC---------------pspkpkpkpkptpsps  513
            MAS+ T+ LALF++ NILF T +SACG C                               
Sbjct  1    MASRTTTSLALFLILNILFFTTISACGNCGCPSPKPKHKPSHKPKPNPKPKPTPSPSPTP  60

Query  512  nkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANIL  333
               KCP+DALKLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+K NIL
Sbjct  61   TTEKCPRDALKLGVCANVLNGLLNITLGKPPVEPCCNLIKGLADLEAAACLCTALKGNIL  120

Query  332  GInlnvplslslllnVCGKKVPSGFQC  252
            GINLN+PLSLSLLLNVC KKVP GFQC
Sbjct  121  GINLNIPLSLSLLLNVCSKKVPPGFQC  147



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 97/147 (66%), Gaps = 16/147 (11%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg------------  504
            M SK T+ LALF+ FN++F T VSACG CP P+P         P                
Sbjct  1    MGSKATTTLALFLAFNLIFFTRVSACGDCPKPRPPKPKPKPSPPPPVPCRPPPYSPTPTP  60

Query  503  ---KCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANIL  333
                CP DALKLGVCA++LG +   +   PP KPCCSL+EGL DLEAAVCLCTAIKANIL
Sbjct  61   SKKTCPGDALKLGVCADLLGLIGISIGS-PPTKPCCSLLEGLADLEAAVCLCTAIKANIL  119

Query  332  GInlnvplslslllnVCGKKVPSGFQC  252
            GINLNVP+SLSL+LN CGK VP GFQC
Sbjct  120  GINLNVPISLSLILNNCGKSVPKGFQC  146



>ref|XP_009783170.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=126

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnll  444
            LALF+VFNILF T VSAC TCPSPK KP P P+PS      CP DALKLGVCANVL  LL
Sbjct  5    LALFLVFNILFFTAVSACYTCPSPKAKPTPTPSPSEGK---CPTDALKLGVCANVLNGLL  61

Query  443  glvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPS  264
             + +G PP KPCCSL+  LVDLEAAVCLCTA+KANILGINLN+P+SLSLLLNVC K +P 
Sbjct  62   NVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGINLNIPISLSLLLNVCSKDIPK  121

Query  263  GFQCP  249
            GF CP
Sbjct  122  GFTCP  126



>ref|XP_002874779.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51038.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++ L +F+ FNILF T+ +ACG        P PKP P P + G CP+D LKLGVC
Sbjct  1    MASKTSASLVIFLTFNILFFTLTTACG----GGCSPTPKPKPKPKSTGSCPRDTLKLGVC  56

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL +LL + +G PP KPCCSL++GLVDLEAA CLCTA+KAN+LG  LNVP+SLSLLLN
Sbjct  57   ANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGNKLNVPVSLSLLLN  116

Query  287  VCGKKVPSGFQC  252
            VCG+KVPSGF C
Sbjct  117  VCGRKVPSGFVC  128



>ref|XP_009333674.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpk---ptpspsnkgKCPKDALKL  477
            M SK +S LALF+  N LFC + S   TCP    +P           +    CP+D+LKL
Sbjct  1    MDSKSSSTLALFLSVNFLFCVLASGWYTCPQQPHQPITNPKPNPIPSAASKSCPRDSLKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCA +L  ++G VVGNPP  PCC+L+EGLVDLE AVCLCTAIKANILGINLN+P++LSL
Sbjct  61   GVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  296  llnVCGKKVPSGFQC  252
            +++ C K VP+GF+C
Sbjct  121  VIDGCAKNVPAGFKC  135



>ref|XP_004245750.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=131

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = -1

Query  629  SVLALFIVFNILFCTMVSACGTCp-spkpkpkpkptpspsnkgKCPKDALKLGVCAnvlg  453
            S LALF+VFN+LF TMVSAC TCP   KP PKP P+PSP+++ KCP+DALKLGVCANVL 
Sbjct  4    SSLALFLVFNVLFFTMVSACYTCPGPIKPNPKPTPSPSPNSQTKCPRDALKLGVCANVLN  63

Query  452  nllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKK  273
             LL + +G PP KPCCSL+  LVDLEAAVCLCTA+KANILGINL++P+SLSLLLNVC K+
Sbjct  64   GLLNVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGINLDIPISLSLLLNVCTKE  123

Query  272  VPSGFQC  252
             P GF C
Sbjct  124  APKGFIC  130



>ref|XP_002271619.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=133

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK TS  ALF+  N++   +VS C TCP PK KP P PTP+  N G CP DALKLGVC
Sbjct  1    MDSKSTSSAALFLSINLVLFALVSGCDTCPQPKSKPTPTPTPANPNSGSCPIDALKLGVC  60

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL  L+G+V+G PP  PCC+L++GL+DLEAA+CLCTAIKANILGINL++ LSLSLL+N
Sbjct  61   ANVLSGLVGVVIGTPPDTPCCALLDGLLDLEAAICLCTAIKANILGINLDIHLSLSLLIN  120

Query  287  VCGKKVPSGFQC  252
             CGK +P  FQC
Sbjct  121  TCGKTLPKDFQC  132



>ref|XP_010422223.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X2 [Camelina 
sativa]
Length=135

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ L +F+ F+ILF T+ +ACG    P PKPKPKPKPTPS S+ G CP+D LKLG
Sbjct  1    MASKMSASLVIFLTFSILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN+LGINLNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCGKK PSGF C
Sbjct  121  LNVCGKKFPSGFVC  134



>dbj|BAA99575.1| DC2.15 like protein [Daucus carota]
Length=127

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 6/132 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MAS +   LALF+  N+LF ++VS+C TC    P     PT        CP+D LKLGVC
Sbjct  1    MASPENVSLALFLTLNVLFFSLVSSCKTCTGSLPVIPEVPTGK------CPRDQLKLGVC  54

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A+VL  +  +VVG PP  PCC+L+EGLV+LEAA+CLCTAIKANILGINLN+P++LSL+LN
Sbjct  55   ADVLNLVKNVVVGAPPTLPCCALLEGLVNLEAALCLCTAIKANILGINLNLPVALSLVLN  114

Query  287  VCGKKVPSGFQC  252
             CGK +P+GF+C
Sbjct  115  NCGKTLPNGFEC  126



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MAS+  +   L ++FN++F TMVS+    P P P            K  CPKD LKLGVC
Sbjct  1    MASRAATSTILLVMFNLVFFTMVSST-YVPCPPPPSHEHKHHHYHPKATCPKDTLKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            AN+L +L+ LVVG+PPK PCCSLI GL DLEAAVCLCTA+KAN+LGINLNVP+SLSLLLN
Sbjct  60   ANLLNDLVHLVVGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVLGINLNVPVSLSLLLN  119

Query  287  VCGKKVPSGFQC  252
             CGKKVPSGFQC
Sbjct  120  YCGKKVPSGFQC  131



>ref|XP_009384469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=138

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 101/139 (73%), Gaps = 7/139 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgK------CPKDA  486
            MASK TS +ALF++FN+LF  + SACG CP+P PKPKPKP P P           CP D 
Sbjct  1    MASKTTSSIALFLLFNVLFWVLTSACGYCPTPTPKPKPKPKPKPKPTPSPAPSGKCPVDT  60

Query  485  LKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpls  306
            LK   C++VL  +   +   PPKKPCCSL+EGL D EAA+CLCTA+KAN+LG NLN+P+S
Sbjct  61   LKFAACSDVLKLINVEIGK-PPKKPCCSLVEGLADDEAALCLCTALKANVLGANLNIPIS  119

Query  305  lslllnVCGKKVPSGFQCP  249
            LSLL+N CGKKVP GFQCP
Sbjct  120  LSLLVNYCGKKVPEGFQCP  138



>gb|AAD01800.1| HyPRP [Fragaria x ananassa]
 gb|AAS76505.1| HyPRP [Fragaria x ananassa]
Length=156

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 105/155 (68%), Gaps = 23/155 (15%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMV-SACGTCpspk----------------------pkpk  537
            MAS+ T+ LALF+V N+LF TMV +AC TCP PK                          
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPTPSPGTPSTPSPGTPST  60

Query  536  pkptpspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLC  357
            P    +PS    CP+DALKLG+CANVL NLL + +G PP +PCC+LI+GL DLEAAVCLC
Sbjct  61   PGTPSTPSGTATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLC  120

Query  356  TAIKANILGInlnvplslslllnVCGKKVPSGFQC  252
            TAI+A+ILGINLN+P++LSLLLN CG +VP GFQC
Sbjct  121  TAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  155



>ref|XP_009134275.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
 emb|CDX90835.1| BnaA03g25150D [Brassica napus]
Length=133

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++ L +F+ FNILF T+ +ACG      PKPKPKPTP+PS+ G CP+  LKLGVC
Sbjct  1    MASKISASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPTPTPSSSGSCPRKTLKLGVC  60

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL +LL + +G PP KPCCSL+ GLVDLEAA CLCTA+KAN+LGI LNVP+SLSLLLN
Sbjct  61   ANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIKLNVPVSLSLLLN  120

Query  287  VCGKKVPSGFQC  252
             CG+K P GF C
Sbjct  121  ACGRKTPRGFIC  132



>ref|XP_004516838.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=166

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 96/166 (58%), Gaps = 33/166 (20%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC-------------------------------  561
            M SK  S LALF+ FNILF T+VS+CGTC                               
Sbjct  1    MTSKTVSSLALFLTFNILFFTLVSSCGTCGPNYPSPNPKHKPKHKPSPNPSGGSSPSGGS  60

Query  560  --pspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGL  387
                                  CP+DALKLGVCANVL  LL + +G PP  PCCSL++GL
Sbjct  61   SPSGGSSPYGGSSPSGGGTVTTCPRDALKLGVCANVLNGLLNVTLGQPPVTPCCSLLQGL  120

Query  386  VDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPSGFQCP  249
            VDLEAAVCLCTA+KANILGINLN+P+SLSLLLNVC ++ P  FQCP
Sbjct  121  VDLEAAVCLCTALKANILGINLNLPISLSLLLNVCSRQAPRDFQCP  166



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = -1

Query  620  ALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnllg  441
            AL +  N++F T+VS+  T     P P       P+ K  CP+D LKLGVCANVL +L+ 
Sbjct  10   ALLLSLNLIFFTLVSS--TYVPCPPPPPKSHKHPPAPKPTCPRDTLKLGVCANVLNDLVH  67

Query  440  lvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPSG  261
            LVVG PPK PCCSLI+GLVDLEAAVCLCTAIKANILGINLNVP+SLSLLLN CGKKVPSG
Sbjct  68   LVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINLNVPVSLSLLLNFCGKKVPSG  127

Query  260  FQC  252
            FQC
Sbjct  128  FQC  130



>ref|XP_010493743.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M S ++   ALF+ FN++    VS C TC   KP P P P  +P+    CPKDALKLGVC
Sbjct  1    MESHRSFSAALFLSFNLMLFAYVSGCNTCLPTKPIPNPNPISNPTKHS-CPKDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G V+GNPP  PCCS+++GLVDLEAAVCLCTAIKANILGIN+++P+SLSLL+N
Sbjct  60   AKILDGAVGTVIGNPPDAPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPISLSLLIN  119

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  120  TCGKKLPSDFIC  131



>ref|XP_004298650.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsps--nkgKCPKDALKLG  474
            M SK+ S +ALF+  N+L   + S C TC  P P   PKP  +P       CP+D LKLG
Sbjct  1    MDSKRCSTIALFLSINLLLSALTSGCYTCSQPHPITTPKPITNPIPGAAKSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCA +L   +G VVG+PP  PCC+++EGLVDLE AVCLCTAIKANILGINLN+P+SLSLL
Sbjct  61   VCAKLLNGAVGAVVGSPPDTPCCAVLEGLVDLEVAVCLCTAIKANILGINLNIPVSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            L+ C KK PSGFQC
Sbjct  121  LDGCAKKFPSGFQC  134



>sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor 
[Daucus carota]
 emb|CAA33476.1| unnamed protein product [Daucus carota]
Length=137

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC----pspkpkpkpkptpspsnkgKCPKDALK  480
            M SK ++ +ALF   NILF  +VS+   C                    + GKCP+DALK
Sbjct  1    MGSKNSASVALFFTLNILFFALVSSTEKCPDPYKPKPKPTPKPTPTPYPSAGKCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCA+VL  +  +V+G+PP  PCCSL+EGLV+LEAAVCLCTAIKANILG NLN+P++LS
Sbjct  61   LGVCADVLNLVHNVVIGSPPTLPCCSLLEGLVNLEAAVCLCTAIKANILGKNLNLPIALS  120

Query  299  lllnVCGKKVPSGFQC  252
            L+LN CGK+VP+GF+C
Sbjct  121  LVLNNCGKQVPNGFEC  136



>ref|XP_004306948.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -1

Query  644  ASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCA  465
            +SK  + +AL +  NI+F T VSA    P P P   PK  P+P     CPKD LKLGVCA
Sbjct  4    SSKAVATIALLLSLNIVFFTTVSANHYVPCPPPPKTPKHPPTPPAAATCPKDTLKLGVCA  63

Query  464  nvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnV  285
            N+L +L+ LVVG PPK PCCSLIEGLVDLEAAVCLCTA+KAN+LGINLNVP+SLSLLLN 
Sbjct  64   NLLNDLVHLVVGTPPKTPCCSLIEGLVDLEAAVCLCTALKANVLGINLNVPISLSLLLNY  123

Query  284  CGKKVPSGFQC  252
            CGK VP+GFQC
Sbjct  124  CGKGVPAGFQC  134



>ref|XP_009787417.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=138

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 105/138 (76%), Gaps = 6/138 (4%)
 Frame = -1

Query  647  MASKKT-SVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk----gKCPKDAL  483
            MAS +  S LALF+ FN++F T VS CGTCP PKP PKPKP+  P         CP D L
Sbjct  1    MASNQVCSTLALFLTFNLIFFTFVSGCGTCPKPKPPPKPKPSCPPPPYVPKKETCPIDTL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCANVLG +  +V   PP KPCCSLI GL D+EAA+CLCTAIKAN+LGINLNVP+SL
Sbjct  61   KLGVCANVLGLVNVVVGS-PPVKPCCSLISGLADVEAALCLCTAIKANVLGINLNVPVSL  119

Query  302  slllnVCGKKVPSGFQCP  249
            SLLLNVC KKVPSGFQCP
Sbjct  120  SLLLNVCSKKVPSGFQCP  137



>ref|XP_010676150.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 93/150 (62%), Gaps = 17/150 (11%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgK-----------  501
            MASK    LALF+V N+ F ++VSACG C S                             
Sbjct  1    MASKLFKSLALFLVLNLFFVSLVSACGECGSGTSPNPKPKPKPKPRPTPGYSGSPSTGGS  60

Query  500  ------CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKAN  339
                  CP DALKLGVCANVL  LL L +G PPK PCC LI+GL+D EAAVCLCTAIKAN
Sbjct  61   TSSSGTCPIDALKLGVCANVLNGLLDLTIGTPPKSPCCPLIQGLIDAEAAVCLCTAIKAN  120

Query  338  ILGInlnvplslslllnVCGKKVPSGFQCP  249
            +LGINL +PLS+SLL+N CG ++P GFQCP
Sbjct  121  VLGINLEIPLSISLLVNYCGCQLPHGFQCP  150



>ref|XP_003608743.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90940.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK42391.1| unknown [Medicago truncatula]
Length=143

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT----------CpspkpkpkpkptpspsnkgKC  498
            MASK  S LA+F+  N+LF ++VSACG+                           + G C
Sbjct  1    MASKTCSSLAIFLTINLLFFSLVSACGSYSCNPTPNPTPKPKPRPNPNPNPNPTPSSGTC  60

Query  497  PKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInln  318
            P+DALKLGVCANVL  LL L +G PP  PCCSL+ GLVDLEAA CLCTA+KANILGINLN
Sbjct  61   PRDALKLGVCANVLSGLLNLTLGKPPVTPCCSLLNGLVDLEAAACLCTALKANILGINLN  120

Query  317  vplslslllnVCGKKVPSGFQC  252
            +P+SLSLLLNVC +KVP  FQC
Sbjct  121  LPISLSLLLNVCSRKVPHDFQC  142



>ref|XP_006306558.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
 gb|EOA39456.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
Length=132

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M S ++   ALF+ FN++F   VS C TC   KP P P P  +P+    CPKDAL+LGVC
Sbjct  1    MESHRSFSAALFLSFNLMFLAYVSGCNTCLPTKPIPNPNPISNPTKHS-CPKDALQLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G V+GNPP  PCCS+++GLVDLEAAVCLCTAIKAN+LGIN+++P+SLSLL+N
Sbjct  60   AKILDGAVGTVIGNPPDTPCCSVLKGLVDLEAAVCLCTAIKANVLGINIDIPISLSLLIN  119

Query  287  VCGKKVPSGFQC  252
             CGK +PS F C
Sbjct  120  TCGKTLPSNFIC  131



>ref|XP_006440346.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
 gb|ESR53586.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
Length=130

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK++  + +F   N++F  +VS C TC  P+P P P P P+      CP+DALKLGVC
Sbjct  1    MDSKRSIWITVFFSINVIFFALVSGCNTCVQPRPIPNPNPNPTSRR---CPRDALKLGVC  57

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A VL   +G VVGNPP  PCCS+++GL+DLEAAVCLCTAIKANILGIN+N+P+SLSLL+N
Sbjct  58   AKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGININIPISLSLLIN  117

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  118  TCGKKLPSDFIC  129



>ref|XP_002874778.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51037.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++ L +F+ F+ILF T+ +ACG        P PKP P P + G CP+D LKLGVC
Sbjct  1    MASKTSASLVIFLTFSILFFTLTTACG----GGCSPTPKPKPKPQSTGSCPRDTLKLGVC  56

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL +LL + +G PP KPCCSL++GLVDLEAA CLCTA+KAN+LG  LNVP+SLSLLLN
Sbjct  57   ANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGTKLNVPVSLSLLLN  116

Query  287  VCGKKVPSGFQC  252
            VCG+KVPS F C
Sbjct  117  VCGRKVPSKFVC  128



>ref|XP_006396750.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
 gb|ESQ38203.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
Length=135

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MAS+ ++ L +F+ FNILF T+ +ACG    P PKPKPKPKPTP PS+   CP+D LKLG
Sbjct  1    MASRISASLIIFLTFNILFFTLTTACGGGCSPIPKPKPKPKPTPKPSSSISCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + VG PP KPCCS+++GLVDLEAA CLCTA+KAN+LGI LNVP+SLSLL
Sbjct  61   VCANVLKDLLKIDVGKPPVKPCCSVLKGLVDLEAAACLCTALKANVLGIKLNVPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCG+K PSGF C
Sbjct  121  LNVCGRKTPSGFIC  134



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 3/133 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASKKT+ LALF++ N+LF ++VSACGTCPSPKPKPKP P+PS      CP D LKLGVC
Sbjct  1    MASKKTTSLALFLLVNLLFFSLVSACGTCPSPKPKPKPSPSPSKGK---CPIDTLKLGVC  57

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLGNLLGLV+GNPPKKPCC+LI+G+ DLEAA+CLCTAIKANILGINLNVPLSLSLLLN
Sbjct  58   ANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAICLCTAIKANILGINLNVPLSLSLLLN  117

Query  287  VCGKKVPSGFQCP  249
            VCGK+VPSGFQCP
Sbjct  118  VCGKQVPSGFQCP  130



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = -1

Query  620  ALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg-KCPKDALKLGVCAnvlgnll  444
            AL +  N++F T+VS+      P P         P      CP+D LKLGVCANVL +L+
Sbjct  10   ALLLSLNLIFFTLVSSTYVPCPPPPPKSHNHHKHPPAPKPTCPRDTLKLGVCANVLNDLV  69

Query  443  glvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPS  264
             LVVG PPK PCCSLI+GLVDLEAAVCLCTAIKANILGINLNVP+SLSLLLN CGKKVPS
Sbjct  70   HLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINLNVPVSLSLLLNFCGKKVPS  129

Query  263  GFQC  252
            GFQC
Sbjct  130  GFQC  133



>ref|XP_007039887.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24388.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=132

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK+ S   L +  N+LF T+VS C TC  P+P P P+PTPSP  K  CP+DALKLGVC
Sbjct  1    MDSKRCSSTILLLAINLLFFTLVSGCNTCVQPRPNPNPRPTPSPPTKS-CPRDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G VVGNPP  PCCS++ GLVDLEAAVCLCTAIKAN+LGIN+N+P+SLSLL+N
Sbjct  60   AKLLNGTIGGVVGNPPDTPCCSVLSGLVDLEAAVCLCTAIKANVLGININIPISLSLLIN  119

Query  287  VCGKKVPSGFQC  252
             CGK++PS F C
Sbjct  120  TCGKQLPSDFIC  131



>emb|CDY31241.1| BnaC08g15360D [Brassica napus]
Length=132

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M S ++   ALF+  N++F   VS C TC  PKP P P P  +P+    CP+DALKLGVC
Sbjct  1    MESNRSFSAALFLSLNLMFFACVSGCNTCLPPKPIPNPNPISNPTKHS-CPRDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G V+GNPP  PCCS ++GLVDLEAAVCLCTAIKANILGI++N+P+SLSLL+N
Sbjct  60   AKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDINIPISLSLLIN  119

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  120  TCGKKLPSDFIC  131



>ref|NP_001238293.1| uncharacterized protein LOC100527330 precursor [Glycine max]
 gb|ACU16403.1| unknown [Glycine max]
Length=136

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG----TCpspkpkpkpkptpspsnkgKCPKDALK  480
            MASK  S LALF+  N++F ++VSACG      P+P+P+P P P P+PS  G CP+DALK
Sbjct  1    MASKICSSLALFLTLNLVFFSLVSACGYTPCPGPNPRPRPNPNPNPNPSRSGSCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  +   +   PP  PCC+L++GLVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLNLVNATLGQ-PPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVC +KVP  FQC
Sbjct  120  LLLNVCSRKVPRNFQC  135



>ref|XP_009782252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgK----CPKDALKLGVCAnvl  456
            LALF+VFNI+F T+VSAC TCP P PKPKPKP P P         CP DALKLGVCANVL
Sbjct  5    LALFLVFNIVFFTVVSACSTCPGPGPKPKPKPKPCPPPPSSQGGKCPTDALKLGVCANVL  64

Query  455  gnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGK  276
              LL + +G PP KPCCSLI  LVDLEAAVCLCTA+KANIL INLN+P+SL+LLLNVC K
Sbjct  65   NGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILSINLNLPISLNLLLNVCSK  124

Query  275  KVPSGFQCP  249
            K P GF CP
Sbjct  125  KAPKGFTCP  133



>gb|KHN04346.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG----TCpspkpkpkpkptpspsnkgKCPKDALK  480
            MASK  S LALF+  N++F ++VSACG      P+PKP+P P P P+PS  G CP+DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  +   +   PP  PCC+L++GLVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLNLVNATLGQ-PPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVC +KVP  FQC
Sbjct  120  LLLNVCSRKVPRNFQC  135



>gb|ACE82175.1| extensin-like protein [Glycine max]
 gb|KHN04348.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG----TCpspkpkpkpkptpspsnkgKCPKDALK  480
            MASK  S LALF+  N++F ++VSACG      P+PKP+P P P P+PS  G CP+DALK
Sbjct  1    MASKTCSSLALFLTLNLIFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  +   +   PP  PCC+L++GLVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLNLVNVTLGQ-PPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVC +KVP  FQC
Sbjct  120  LLLNVCSRKVPRDFQC  135



>ref|NP_001237154.1| uncharacterized protein LOC100500124 precursor [Glycine max]
 gb|ACU15034.1| unknown [Glycine max]
Length=136

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG----TCpspkpkpkpkptpspsnkgKCPKDALK  480
            MASK  S LALF+  N++F ++VSACG      P+PKP+P P P P+PS  G CP+DALK
Sbjct  1    MASKTCSSLALFLTLNLIFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  +   +   PP  PCC+L++GLVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLNLVNVTLGQ-PPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  299  lllnVCGKKVPSGFQC  252
            LLL+VC +KVP  FQC
Sbjct  120  LLLDVCSRKVPRDFQC  135



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+D LKLGVCAN+L +L+ LVVG PPK PCCSLIEGL DLEAAVCLCTAIKANILGI+L
Sbjct  54   CPRDTLKLGVCANLLNDLVHLVVGTPPKYPCCSLIEGLADLEAAVCLCTAIKANILGIHL  113

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVPSGFQC
Sbjct  114  NVPVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_010264242.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=133

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+D LKLGVCAN+L +L+ LV+G PPK PCC+LIEGL DLEAAVCLCTAIKANILGI+L
Sbjct  50   CPRDTLKLGVCANLLNDLVHLVIGTPPKYPCCTLIEGLADLEAAVCLCTAIKANILGIHL  109

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVPSGFQC
Sbjct  110  NVPVSLSLLLNYCGKKVPSGFQC  132



>ref|XP_010041843.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 ref|XP_010042382.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 12/132 (9%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK    LAL +  NI+F ++ +A              P P+P+    CP++ALKLGVC
Sbjct  1    MASKNYPSLALVLSLNIIFASLATA------------WTPKPTPTAAASCPENALKLGVC  48

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             ++LG+L+ + VG PPK+PCCSLI+GLVDLEAAVCLCTAI+AN+LG++L+VPLSLSLLLN
Sbjct  49   LDLLGSLVNVTVGTPPKEPCCSLIQGLVDLEAAVCLCTAIRANVLGLHLDVPLSLSLLLN  108

Query  287  VCGKKVPSGFQC  252
            VC KKVP GFQC
Sbjct  109  VCSKKVPPGFQC  120



>emb|CDY21275.1| BnaC03g29590D [Brassica napus]
Length=135

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC--pspkpkpkpkptpspsnkgKCPKDALKLG  474
            MA+K ++ L +F+ FNILF T+ +ACG      PKPKPKPKPTP+PS+ G CP+  LKLG
Sbjct  1    MAAKNSASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPKPTPTPSSSGSCPRKTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G+PP KPCCSL++GLVDLEAA CLCTA+KAN+LGI LNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLGIKLNVPVSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LN CG+K P GF C
Sbjct  121  LNACGRKTPRGFIC  134



>gb|AFK41425.1| unknown [Lotus japonicus]
Length=142

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 9/141 (6%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT---------CpspkpkpkpkptpspsnkgKCP  495
            MASK  S LA+F+  N++F ++VSAC +          PSP PKPKP P PSPS+ G CP
Sbjct  1    MASKTCSSLAVFLTLNLIFFSLVSACNSGCPGPNPKPKPSPSPKPKPNPNPSPSSGGSCP  60

Query  494  KDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnv  315
            +DALKLGVCANVL  LL + +G PP  PCC+L++GLVDLEAAVCLCTA+KANILGINLN+
Sbjct  61   RDALKLGVCANVLNGLLNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNL  120

Query  314  plslslllnVCGKKVPSGFQC  252
            P+SLSLLLNVC KKVP  FQC
Sbjct  121  PISLSLLLNVCSKKVPRDFQC  141



>ref|XP_009612116.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=138

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 105/138 (76%), Gaps = 6/138 (4%)
 Frame = -1

Query  647  MASKKT-SVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg----KCPKDAL  483
            MAS K  S LALF+ FN++F T VS CGTCP PKP PKPKP+  P+        CP D L
Sbjct  1    MASNKVFSTLALFLTFNLIFFTFVSGCGTCPKPKPPPKPKPSCPPTPYVPKKETCPIDTL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCANVLG +  +V   PP KPCCSLI GL D+EAA+CLCTAIKAN+LGINLNVP+SL
Sbjct  61   KLGVCANVLGLVNVVVGS-PPVKPCCSLISGLADVEAALCLCTAIKANVLGINLNVPISL  119

Query  302  slllnVCGKKVPSGFQCP  249
            SLLLNVC K VPSGFQCP
Sbjct  120  SLLLNVCSKNVPSGFQCP  137



>ref|XP_006600137.1| PREDICTED: uncharacterized protein LOC100500016 isoform X1 [Glycine 
max]
 gb|KHN09802.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=137

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG----TCpspkpkpkpkptpspsnkgKCPKDALK  480
            MASK  S LALF+  N++F ++VSACG      P+PKP+P P P P+PS  G CP+DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  +   +   PP  PCCSL++GLVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLNLVNATLGQ-PPVTPCCSLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVC +K P  FQC
Sbjct  120  LLLNVCSRKAPRDFQC  135



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK+TS LALF+V N+LF ++VSACG                  + GKCP+DALKLGVC
Sbjct  1    MESKRTSSLALFLVLNLLFFSLVSACGGGCPSPKPNPNPKPTPSPSSGKCPRDALKLGVC  60

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLG+LL L +G PP +PCCSLI+GLVDLEAAVCLCTAIKANILGINLN+PLSLSLLLN
Sbjct  61   ANVLGSLLNLNIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGINLNIPLSLSLLLN  120

Query  287  VCGKKVPSGFQC  252
            VCGKK PSGFQC
Sbjct  121  VCGKKTPSGFQC  132



>ref|XP_004299468.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=166

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 105/165 (64%), Gaps = 33/165 (20%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMV-SACGTCp-----------------------------  558
            MAS+ T+ LALF+V N+LF TMV +AC TCP                             
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPRPTPSPGTPSTPSPGTP  60

Query  557  ---spkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGL  387
               SP     P    +PS    CP+DALKLG+CANVL NLL + +G PP +PCC+LI+GL
Sbjct  61   STPSPGTPSTPGTPSTPSGTATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGL  120

Query  386  VDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPSGFQC  252
             DLEAAVCLCTAI+A+ILGINLN+P++LSLLLN CG +VP GFQC
Sbjct  121  ADLEAAVCLCTAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  165



>ref|XP_009110670.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
Length=134

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk-gKCPKDALKLGV  471
            M S ++   ALF+  N++F   V+ C TC  PKP P P P P  +     CP+DALKLGV
Sbjct  1    MESNRSFSAALFLSLNLMFFACVNGCNTCLPPKPIPNPNPNPISNPTKHSCPRDALKLGV  60

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CA +L   +G V+GNPP  PCCS ++GLVDLEAAVCLCTAIKANILGI++++P+SLSLL+
Sbjct  61   CAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDIDIPISLSLLI  120

Query  290  nVCGKKVPSGFQC  252
            N CGKK+PS F C
Sbjct  121  NTCGKKLPSDFIC  133



>ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=124

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 99/133 (74%), Gaps = 9/133 (7%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++  ALF+  N+LF T+ SACGTCPSP P               CP DALKLGVC
Sbjct  1    MASKPSASAALFLALNLLFFTLTSACGTCPSPSPPSGGGK---------CPMDALKLGVC  51

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL  L+ L +G PPKKPCCSL+EGLVDLEAAVCLCTA++ANILGI LN+P+ LSLLLN
Sbjct  52   ANVLKGLINLNLGKPPKKPCCSLLEGLVDLEAAVCLCTALRANILGIKLNLPIHLSLLLN  111

Query  287  VCGKKVPSGFQCP  249
             CGKK P GFQCP
Sbjct  112  YCGKKTPKGFQCP  124



>gb|KDO61485.1| hypothetical protein CISIN_1g047179mg [Citrus sinensis]
Length=130

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK++  + +F+  NI+   +VS C TC  P+P P P P P+      CP+DALKLGVC
Sbjct  1    MDSKRSIWITVFLSINIISFALVSGCNTCVQPRPIPNPNPNPTSRR---CPRDALKLGVC  57

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A VL   +G VVGNPP  PCCS+++GL+DLEAAVCLCTAIKANILGIN+N+P+SLSLL+N
Sbjct  58   AKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGININIPISLSLLIN  117

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  118  TCGKKLPSDFIC  129



>emb|CDY61290.1| BnaCnng37610D [Brassica napus]
Length=135

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC--pspkpkpkpkptpspsnkgKCPKDALKLG  474
            MA+K ++ L +F+ FNILF T+ +ACG      PKPKPKPKPTP+PS+ G CP+  LKLG
Sbjct  1    MAAKNSASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPKPTPTPSSSGSCPRKTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL +LL + +G+PP KPCCSL++GLVD+EAA CLCTA+KAN+LGI LNVP+SLSLL
Sbjct  61   VCANVLKDLLKIELGSPPVKPCCSLLKGLVDIEAAACLCTALKANVLGIKLNVPVSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LN CG+K P GF C
Sbjct  121  LNACGRKTPRGFIC  134



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 109/137 (80%), Gaps = 5/137 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk-----gKCPKDAL  483
            MASK TS LALF+  N++F T+VSACG CP PKPKPKPKP PS           CP+DAL
Sbjct  1    MASKSTSALALFLALNLIFFTLVSACGDCPKPKPKPKPKPKPSCPPPPYVPKATCPRDAL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCA++LG L+  V+G PPK PCCSLIEGL DLEAAVCLCTAIKAN+LGINLNVP+SL
Sbjct  61   KLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINLNVPVSL  120

Query  302  slllnVCGKKVPSGFQC  252
            +LLLNVC KKVP GF C
Sbjct  121  TLLLNVCSKKVPEGFIC  137



>ref|XP_006477231.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=130

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK++  + +F+  NI+   +VS C TC  P+P P P P P+      CP+DALKLG+C
Sbjct  1    MDSKRSIWITVFLSINIISFALVSGCNTCVQPRPIPNPNPNPTSRR---CPRDALKLGIC  57

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A VL   +G VVGNPP  PCCS+++GL+DLEAAVCLCTAIKANILGIN+N+P+SLSLL+N
Sbjct  58   AKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGININIPISLSLLIN  117

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  118  TCGKKLPSDFIC  129



>ref|XP_006417265.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
 gb|ESQ35618.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
Length=134

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk-gKCPKDALKLGV  471
            M S ++     F+  N++F   VS C TC  PKP P P P P  +     CP+DALKLGV
Sbjct  1    MESYRSFHAVFFLSLNLMFFAYVSGCNTCLPPKPIPNPNPNPISNPTKHSCPRDALKLGV  60

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CA +L   +G V+GNPP  PCCS+++GLVDLEAAVCLCTAIKANILGIN+++P+SLSLL+
Sbjct  61   CAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPISLSLLI  120

Query  290  nVCGKKVPSGFQC  252
            N CGKK+PS F C
Sbjct  121  NTCGKKLPSDFIC  133



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsps--nkgKCPKDALKLG  474
            MASK ++ +A F++ N+LF  +VSACGTCP+P                K  CPKD LKLG
Sbjct  1    MASKSSASVAFFLLVNLLFFAIVSACGTCPNPPKSKNKPKPTPSPSPAKATCPKDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCAN+LG L+G VVG PPK PCCSLI+GL DLEAAVCLCTAIKAN+LGINLN+PLSLSLL
Sbjct  61   VCANLLGGLIGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVLGINLNIPLSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVC KKVP GFQC
Sbjct  121  LNVCSKKVPPGFQC  134



>ref|XP_003608746.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90943.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
 gb|AFK36641.1| unknown [Medicago truncatula]
Length=134

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg-KCPKDALKLGV  471
            M S K+S L LF + N+LF  M + C  CP P P P P P P+PS     CP+DALKLGV
Sbjct  1    MNSSKSSTLVLFSIINMLFFAMANGCFFCPKPNPNPNPFPYPNPSPSTKSCPRDALKLGV  60

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CAN+L   +G V+G+PP+ PCCS++EGLVDLE AVCLCTAIKANILGI++N+P+SLSL+L
Sbjct  61   CANLLNGPIGAVIGSPPEHPCCSILEGLVDLEVAVCLCTAIKANILGIDINIPISLSLIL  120

Query  290  nVCGKKVPSGFQC  252
            N C K  P+ FQC
Sbjct  121  NACEKTPPTDFQC  133



>ref|XP_003549906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
 gb|KHN09800.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG----TCpspkpkpkpkptpspsnkgKCPKDALK  480
            MASK  S LALF+  N++F ++VSACG      P+PKP+P P P P+PS  G CP+DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  +   +   PP  PCC+L++GLVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLNLVNATLGQ-PPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVC +K P  FQC
Sbjct  120  LLLNVCSRKAPRDFQC  135



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 109/137 (80%), Gaps = 5/137 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk-----gKCPKDAL  483
            MASK TS LALF+  N++F T+VSACG CP PKPKPKPKP PS           CP+DAL
Sbjct  1    MASKSTSALALFLALNLIFFTLVSACGDCPKPKPKPKPKPKPSCPPPPYVPKATCPRDAL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCA++LG L+  V+G PPK PCCSLIEGL DLEAAVCLCTAIKAN+LGINLNVP+SL
Sbjct  61   KLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINLNVPVSL  120

Query  302  slllnVCGKKVPSGFQC  252
            SLLLNVC KKVP GF C
Sbjct  121  SLLLNVCSKKVPEGFIC  137



>ref|XP_006289270.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
 gb|EOA22168.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
Length=131

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGT-CpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnl  447
            LA+F+ FNILF  +  A  + CP      KPKPTPS      CPKDALKLGVC   L  +
Sbjct  7    LAIFLAFNILFFALTEAARSGCPPSSSYNKPKPTPSAPAIETCPKDALKLGVCVQALNLV  66

Query  446  lglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVP  267
               +   PP KPCCSLI+GLVDLEAAVCLCTAIKA+ILGIN+N+P++LSLLLNVC +K P
Sbjct  67   NVTLGA-PPVKPCCSLIDGLVDLEAAVCLCTAIKASILGININLPINLSLLLNVCSRKAP  125

Query  266  SGFQCP  249
             GFQCP
Sbjct  126  RGFQCP  131



>ref|XP_002271593.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80709.1| hypothetical protein VITISV_033376 [Vitis vinifera]
 emb|CBI31903.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK +S  ALF+  N+LF  +VSA     SP        TPS  + G CP+DALKLGVC
Sbjct  1    MDSKGSSSAALFLSINLLFFALVSA-NKPCSPPKPTPTPSTPSTPSNGSCPRDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G VVG PP  PCCSL+EGL+DLE A CLCTAIKANILGI+L++P+SLSLL+N
Sbjct  60   AKLLNGTVGAVVGTPPVTPCCSLLEGLLDLEVAACLCTAIKANILGIHLDIPVSLSLLVN  119

Query  287  VCGKKVPSGFQC  252
            +CGKK+P  FQC
Sbjct  120  ICGKKLPKDFQC  131



>ref|XP_011070108.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCAN+L +L+ LVVG PPK PCCSLI GL DLEAAVCLCTAIKAN+LGINL
Sbjct  54   CPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGINL  113

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVPSGFQC
Sbjct  114  NVPVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_002271792.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80710.1| hypothetical protein VITISV_033377 [Vitis vinifera]
Length=135

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpsp--kpkpkpkptpspsnkgKCPKDALKLG  474
            MASK ++ LA F++ N+LF  +VSACGTCPSP                +  CPKD LKLG
Sbjct  1    MASKSSASLAFFLLVNLLFFAIVSACGTCPSPPKSKTNPRPTPSPSPARATCPKDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VC ++LG LLG+VVGNPPK PCCSLI+GL DLEAAVCLCTAIKAN+LGINLN+PLSLSLL
Sbjct  61   VCVDLLGGLLGVVVGNPPKTPCCSLIQGLADLEAAVCLCTAIKANVLGINLNIPLSLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVC KKVPSGFQC
Sbjct  121  LNVCSKKVPSGFQC  134



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsps-nkgKCPKDALKLGV  471
            MASK  +  A+ ++ N+LF TMVS+      P     PK    PS     CP+D LKLGV
Sbjct  1    MASKTVATGAILLI-NLLFFTMVSSTHVPCPPPHPKIPKHPSLPSPAAATCPRDTLKLGV  59

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CAN+L +LL LVVG PPK PCCSLIEGL DLEAAVCLCTAIKANILG NLN+P+SLSLLL
Sbjct  60   CANLLNDLLHLVVGTPPKTPCCSLIEGLADLEAAVCLCTAIKANILGNNLNIPISLSLLL  119

Query  290  nVCGKKVPSGFQC  252
            N CG+ VP GFQC
Sbjct  120  NYCGQGVPKGFQC  132



>ref|NP_001237899.1| uncharacterized protein LOC100527818 precursor [Glycine max]
 gb|ACU17007.1| unknown [Glycine max]
 gb|KHN09797.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=135

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = -1

Query  644  ASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkp-kptpspsnkgKCPKDALKLGVC  468
            +S+ ++ LALF+  N+LF  M S C TC  PKP P P            CP+DALKLGVC
Sbjct  3    SSRTSTTLALFLTINLLFFVMASGCYTCTQPKPNPIPFPYPNPSPAAKSCPRDALKLGVC  62

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL   +G +VG+PP  PCCS++EGL+DLE AVCLCTAIKANILGINLN+P+SLSL+LN
Sbjct  63   ANVLNGPIGAIVGSPPDHPCCSVLEGLLDLEVAVCLCTAIKANILGINLNIPISLSLILN  122

Query  287  VCGKKVPSGFQC  252
             C K  PS F C
Sbjct  123  ACEKSPPSDFLC  134



>ref|NP_001235642.1| uncharacterized protein LOC100500016 precursor [Glycine max]
 gb|ACU14605.1| unknown [Glycine max]
Length=137

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 103/136 (76%), Gaps = 5/136 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG----TCpspkpkpkpkptpspsnkgKCPKDALK  480
            MASK  S LALF+  N++F ++VSACG      P+PKP+P P P P+PS  G CP+DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  +   +   PP  PCCSL++GL DLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLNLVNATLGQ-PPVTPCCSLLDGLADLEAAVCLCTALKANILGINLNLPISLS  119

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVC +K P  FQC
Sbjct  120  LLLNVCSRKAPRDFQC  135



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCAN+L +L+ LVVG PPK PCC+LIEGL DLEAAVCLCTAIKAN+LGINL
Sbjct  50   CPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIEGLADLEAAVCLCTAIKANVLGINL  109

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKK PSGFQC
Sbjct  110  NVPVSLSLLLNYCGKKAPSGFQC  132



>ref|XP_010053450.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77748.1| hypothetical protein EUGRSUZ_D02042 [Eucalyptus grandis]
Length=121

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 97/132 (73%), Gaps = 12/132 (9%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK    LAL +  NI+F ++ +A              P P+P+    CP++ALKLGVC
Sbjct  1    MASKNYPTLALVLSLNIIFASLATA------------WTPKPTPTAAASCPENALKLGVC  48

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             ++LG+L+ + VG PPK+PCCSLI+GL DLEAAVCLCTAI+A++LG++L+VPLSLSLLLN
Sbjct  49   LDLLGSLVNVTVGTPPKEPCCSLIQGLADLEAAVCLCTAIRADVLGLHLDVPLSLSLLLN  108

Query  287  VCGKKVPSGFQC  252
            VC KKVP GFQC
Sbjct  109  VCSKKVPPGFQC  120



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCA+VL  LL + +G PPK+PCCSL+ GLVDLEAAVCLCTAIKANILGINL
Sbjct  46   CPIDALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEAAVCLCTAIKANILGINL  105

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+ LSLLLN CGKKVPSGFQC
Sbjct  106  NIPVDLSLLLNYCGKKVPSGFQC  128



>emb|CDY21034.1| BnaA08g24910D [Brassica napus]
Length=134

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk-gKCPKDALKLGV  471
            M S ++   ALF+  +++F   V+ C TC  PKP P P P P  +     CP+DALKLGV
Sbjct  1    MESNRSFSAALFLSLSLMFFACVNGCNTCLPPKPIPNPNPNPISNPTKHSCPRDALKLGV  60

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CA +L   +G V+GNPP  PCCS ++GLVDLEAAVCLCTAIKANILGI++++P+SLSLL+
Sbjct  61   CAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDIDIPISLSLLI  120

Query  290  nVCGKKVPSGFQC  252
            N CGKK+PS F C
Sbjct  121  NTCGKKLPSDFIC  133



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 93/139 (67%), Gaps = 8/139 (6%)
 Frame = -1

Query  644  ASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg--------KCPKD  489
            +SK  + +AL I  NI+F T VSA        P P PK    P             CPKD
Sbjct  3    SSKAVATIALLISLNIVFFTTVSAHHHASKCPPPPPPKTPKCPPTASPLNPPAKASCPKD  62

Query  488  ALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpl  309
             LKLGVC ++L +L+ +VVG PPK PCCSLI GL DLEAAVCLCTAIKAN+LGINL+VP+
Sbjct  63   TLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVLGINLDVPV  122

Query  308  slslllnVCGKKVPSGFQC  252
            SLSLLLN CGK VP GFQC
Sbjct  123  SLSLLLNYCGKSVPKGFQC  141



>ref|XP_008448871.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=134

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg-KCPKDALKLGV  471
            M SK+ S   +F+V N++F   V+ C  C  PKPKP PKP P+P+     CP+DALKLGV
Sbjct  1    MDSKRISNATIFLVLNLVFFAFVNVCHACNDPKPKPTPKPYPNPTPVVKSCPRDALKLGV  60

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            C  +L   +  +VG+ P   CCSL++GL+DLEAAVCLCTAIKAN+LGIN+N+P+SLSLL+
Sbjct  61   CTKLLNGPVSALVGSLPNTQCCSLLDGLIDLEAAVCLCTAIKANVLGININIPISLSLLV  120

Query  290  nVCGKKVPSGFQC  252
            NVCGKKVPS FQC
Sbjct  121  NVCGKKVPSEFQC  133



>ref|XP_009134274.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
Length=133

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++ L +F+ FNILF T+ +ACG      PKPKPKPTPSPS+ G CP+  LKLGVC
Sbjct  1    MASKISASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPTPSPSSSGSCPRKTLKLGVC  60

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL +LL + +G PP KPCCSL++GLVDLEAA CLCTA+KAN+LGI LNVP+SLSLLLN
Sbjct  61   ANVLKDLLKIELGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGIKLNVPVSLSLLLN  120

Query  287  VCGKKVPSGFQC  252
             CG+K P GF C
Sbjct  121  ACGRKTPRGFIC  132



>ref|XP_010258987.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Nelumbo nucifera]
Length=135

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsp---snkgKCPKDALKL  477
            M SK ++ +ALF+  N++F    SACG+C SP      KPTP+    + KG CP+DALKL
Sbjct  1    MDSKSSASIALFLSINLVFFAFASACGSCSSPSKPQPIKPTPTSPIPAAKGTCPRDALKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCANVL  +   V   PP  PCCSLI+ L DLEAA CLCTAIKA +LGINLNVP+SLSL
Sbjct  61   GVCANVLKLVSVSVGT-PPYLPCCSLIKDLADLEAAACLCTAIKAKVLGINLNVPVSLSL  119

Query  296  llnVCGKKVPSGFQC  252
            +LN CGKKVP+GF+C
Sbjct  120  ILNNCGKKVPTGFKC  134



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+D +KLGVCANVL NLL LVVG PPK PCCSLI GL DLEAAVCLCTAIKAN+LG+NL
Sbjct  48   CPRDTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNL  107

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVPSGFQC
Sbjct  108  NVPVSLSLLLNYCGKKVPSGFQC  130



>emb|CBI31906.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCA++L +LL  VVG PPK PCCSLI GL DLEAAVCLCTAIKAN+LGI L
Sbjct  30   CPKDTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLGIKL  89

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVP+G+QC
Sbjct  90   NVPVSLSLLLNYCGKKVPTGYQC  112



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+D +KLGVCANVL NLL LVVG PPK PCCSLI GL DLEAAVCLCTAIKAN+LG+NL
Sbjct  64   CPRDTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNL  123

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVPSGFQC
Sbjct  124  NVPVSLSLLLNYCGKKVPSGFQC  146



>ref|XP_010919520.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=140

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALK GVCANVL  L+ + +GNPPKKPCCSL+EGL DLEAAVCLCTAIKANILG NL
Sbjct  57   CPRDALKFGVCANVLQGLINVQLGNPPKKPCCSLLEGLADLEAAVCLCTAIKANILGTNL  116

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+ LSLLLN CGKKVP+G++C
Sbjct  117  NVPVDLSLLLNYCGKKVPAGYKC  139



>ref|XP_008437107.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=138

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 95/138 (69%), Gaps = 6/138 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsp------snkgKCPKDA  486
            MASK T+ LA+ +  N+LF T VSAC  C  P P         P      SN GKCPKDA
Sbjct  1    MASKATASLAIILSLNLLFFTFVSACDNCYVPAPPKPKPKPCPPTKPNPPSNHGKCPKDA  60

Query  485  LKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpls  306
            LK+GVCA +LG L+ L +G PP  PCC+L+EGL DLEAA CLCTAIKA++LG  + +PL 
Sbjct  61   LKIGVCAKLLGGLVDLTIGKPPVTPCCTLVEGLADLEAAACLCTAIKASVLGNKIKIPLH  120

Query  305  lslllnVCGKKVPSGFQC  252
            LSLLLNVC K +P+GFQC
Sbjct  121  LSLLLNVCKKNLPNGFQC  138



>emb|CDX90834.1| BnaA03g25140D [Brassica napus]
Length=133

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK ++ L +F+ FNILF T+ +ACG      PKPKPKPTPSPS+   CP+  LKLGVC
Sbjct  1    MASKISASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPTPSPSSSASCPRKTLKLGVC  60

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL +LL + +G+PP KPCCSL++GLVDLEAA CLCTA+KAN+LG+ LNVP+SLSLLLN
Sbjct  61   ANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLGVKLNVPVSLSLLLN  120

Query  287  VCGKKVPSGFQC  252
             CG+K P GF C
Sbjct  121  ACGRKTPRGFIC  132



>ref|XP_008786988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=136

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DAL+LGVCANVL  L+ L +GNPPKKPCCSL+E LVDLEAAVCLCTAIKANILGINL
Sbjct  53   CPRDALELGVCANVLQGLINLQLGNPPKKPCCSLLEDLVDLEAAVCLCTAIKANILGINL  112

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+ LSLLLN CGKKVP+G+ C
Sbjct  113  NVPVDLSLLLNYCGKKVPAGYAC  135



>ref|XP_010433333.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGT-CpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnl  447
            LA+F+V NILF  +  A  + CP            SP     CPKDALKLGVC   L  +
Sbjct  7    LAIFLVLNILFFALTEATRSGCPPSFSNKPKPTPSSPPAIETCPKDALKLGVCVQALNLV  66

Query  446  lglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVP  267
               +   PP KPCCSLI+GLVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVC +K P
Sbjct  67   NVTLGA-PPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKAP  125

Query  266  SGFQCP  249
             GFQCP
Sbjct  126  RGFQCP  131



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCAN+L +L+ LVVG PPK PCC+L++GL DLEAA+CLCTAIKAN+LGINL
Sbjct  51   CPKDTLKLGVCANLLNDLVHLVVGAPPKTPCCTLLKGLADLEAALCLCTAIKANVLGINL  110

Query  320  nvplslslllnVCGKKVPSGFQCP*R  243
            NVP+SLSLLLN CGKKVP+GFQCP R
Sbjct  111  NVPVSLSLLLNYCGKKVPTGFQCPSR  136



>gb|AAM47507.1| extensin-like protein [Citrus junos]
Length=143

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK ++ LALF+  NILF  +V+ACG+                 +   CP+DALKLGVC
Sbjct  1    MGSKTSASLALFLAVNILFFALVTACGS-CPSPKPKPKPKPTPSPSGASCPRDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL  LL + +G PP +PCC+LI+GL DLEAAVCLCTAIKANILGINLN+PLSLSLLLN
Sbjct  60   ANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLN  119

Query  287  VCGKKVP  267
            VC K  P
Sbjct  120  VCSKGCP  126



>ref|XP_004150818.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004163648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN55887.1| hypothetical protein Csa_3G027210 [Cucumis sativus]
Length=136

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsps---nkgKCPKDALKL  477
            M SK+ S   +F+V N++F   V+ C  C  PKPKP PKP P+P+       CP+DALKL
Sbjct  1    MDSKRISNATIFLVLNLVFFAFVNVCHACNDPKPKPTPKPYPNPNPTPVVKSCPRDALKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVC  +L   +  +VG+ P   CCSL++GL+DLEAAVCLCTAIKAN+LGIN+N+P+SLSL
Sbjct  61   GVCTKLLNGPVSALVGSLPNTQCCSLLDGLIDLEAAVCLCTAIKANVLGININIPISLSL  120

Query  296  llnVCGKKVPSGFQC  252
            L+NVCGKKVPS FQC
Sbjct  121  LVNVCGKKVPSEFQC  135



>ref|XP_010493734.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M S  +   ALF+  N++    VS C TC   KP P P P  +P+    CPKDALKLGVC
Sbjct  1    MESHISFSAALFLSSNLILFACVSGCNTCLPTKPIPNPNPISNPTTHS-CPKDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G V+GNPP  PCCS+++GLVDLEAAVCLCTAIKANILGIN+++P+SLSLL++
Sbjct  60   AKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPISLSLLIS  119

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  120  TCGKKLPSDFIC  131



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 109/136 (80%), Gaps = 4/136 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsp----snkgKCPKDALK  480
            MASK TS LALF+  N+ F  +VS+CGTCP+P PKP+PKP P+P    S    CP+D LK
Sbjct  1    MASKTTSSLALFLALNLFFFALVSSCGTCPNPNPKPRPKPNPTPKPSPSTGTSCPRDTLK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVCANVL  LL + +G PP +PCCSLI+GL DLEAAVCLCTAIKANILGINLN+P+SLS
Sbjct  61   LGVCANVLNGLLNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILGINLNIPISLS  120

Query  299  lllnVCGKKVPSGFQC  252
            LLLNVCG KVP GFQC
Sbjct  121  LLLNVCGNKVPKGFQC  136



>ref|XP_010264240.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=132

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = -1

Query  584  MVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCC  405
            +VS CGTC +PKP P    TP+      CP+DALKLGVCA +L   +G  VGNPP  PCC
Sbjct  23   VVSGCGTCYNPKPTPTTPTTPASKGS--CPRDALKLGVCAKLLNGAVGAEVGNPPDHPCC  80

Query  404  SLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPSGFQC  252
            +L+EGLVDLE A CLCTAIKANILGINLN+P+SLSLL+N CGKK+PSGFQC
Sbjct  81   TLLEGLVDLEVAACLCTAIKANILGINLNIPVSLSLLVNTCGKKLPSGFQC  131



>ref|NP_001053511.1| Os04g0554500 [Oryza sativa Japonica Group]
 emb|CAE01698.2| OSJNBa0010H02.22 [Oryza sativa Japonica Group]
 gb|AAR30140.1| lipid transfer protein-like protein [Oryza sativa Japonica Group]
 dbj|BAF15425.1| Os04g0554500 [Oryza sativa Japonica Group]
 gb|EAY95109.1| hypothetical protein OsI_16926 [Oryza sativa Indica Group]
Length=130

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 4/133 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG-TCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MA K +  +ALF+  N++  ++ SACG  CP+P P     PTP+P+  GKCP+DALKLGV
Sbjct  1    MAGKAS--IALFLAVNLVVFSLASACGGRCPTPTPSTPSTPTPTPAAFGKCPRDALKLGV  58

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CANVLG +   V   PP +PCC L+EGLVDLEAAVCLCTAI+ NILGINLN+P+ LSL+L
Sbjct  59   CANVLGLIKAKVGV-PPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGINLNLPVDLSLIL  117

Query  290  nVCGKKVPSGFQC  252
            N CGK+VP+GF+C
Sbjct  118  NYCGKRVPTGFKC  130



>gb|KHN04345.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=166

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 96/165 (58%), Gaps = 33/165 (20%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspk---------------------------  549
            M SK  S LALF+  NILF  +VSACGTCPSP                            
Sbjct  1    MGSKTRSSLALFLTVNILFFALVSACGTCPSPTPRHKHKPVKPSPSGGSGGSGGSGGSGG  60

Query  548  ------pkpkpkptpspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGL  387
                           S  +   CP+DALKLGVCANVL  LL + +G PP  PCCSL+ GL
Sbjct  61   SGGSGGSGGSGGSGGSGGSGASCPRDALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGL  120

Query  386  VDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPSGFQC  252
            VDLEAAVCLCTA+KANILGINLN+P+SLSLLLNVC +  P  FQC
Sbjct  121  VDLEAAVCLCTALKANILGINLNLPISLSLLLNVCSRNAPRDFQC  165



>ref|XP_010422226.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGT-CpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnl  447
            LA+F+  NILF  +  A  + CP            S      CPKDALKLGVC   L  +
Sbjct  7    LAIFLALNILFFALTEAARSGCPPSSSNKPKPTPSSAPAIETCPKDALKLGVCVQALNLV  66

Query  446  lglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVP  267
               +   PP KPCCSLI+GLVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVC +K P
Sbjct  67   NVTLGA-PPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKAP  125

Query  266  SGFQCP  249
             GFQCP
Sbjct  126  RGFQCP  131



>gb|KFK28807.1| hypothetical protein AALP_AA7G051200 [Arabis alpina]
Length=133

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgn  450
            LA F++FNILF T+ SA  +  CP P  K        P+  G CP D +KLGVC N L  
Sbjct  7    LARFLLFNILFFTLTSATRSTNCPPPPRKHNKHKPSPPTTTGTCPLDTIKLGVCVNALNL  66

Query  449  llglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKV  270
            L  + +G PP  PCCSLI+GLVDLEAAVCLCTA+KA++LGINLN+P++LSLLLNVC +K 
Sbjct  67   LNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPINLSLLLNVCSRKA  126

Query  269  PSGFQCP  249
            P GFQCP
Sbjct  127  PRGFQCP  133



>ref|XP_010055513.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=132

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCA VL   +  ++G PP  PCCS++EGL+DLEAAVCLCTAIKANILGINL
Sbjct  49   CPRDALKLGVCAKVLDGPVNAIIGTPPDMPCCSVLEGLLDLEAAVCLCTAIKANILGINL  108

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLL+N CGK VPSGFQC
Sbjct  109  NIPISLSLLINTCGKNVPSGFQC  131



>ref|XP_010933689.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=134

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCANVL  L+ + +G PPKKPCCSL++GLVDLEAAVCLCTA+KAN+LGI L
Sbjct  51   CPMDALKLGVCANVLNGLINVHLGRPPKKPCCSLLDGLVDLEAAVCLCTALKANVLGIKL  110

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+ LSLLLN CGK  P GFQCP
Sbjct  111  NLPIHLSLLLNYCGKNTPKGFQCP  134



>gb|EAY95110.1| hypothetical protein OsI_16927 [Oryza sativa Indica Group]
Length=131

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 4/133 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG-TCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MA K +  +ALF+  N++  ++ SACG  CP+P P     PTP+P+  GKCP+DALKLGV
Sbjct  1    MAGKAS--IALFLAVNLVVFSLASACGGHCPTPTPSTPSTPTPTPAAFGKCPRDALKLGV  58

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CANVLG +   V   PP +PCC L+EGLVDLEAAVCLCTAI+ NILGINLN+P+ LSL+L
Sbjct  59   CANVLGLIKAKVGV-PPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGINLNLPVDLSLIL  117

Query  290  nVCGKKVPSGFQC  252
            N CGK+VP+GF+C
Sbjct  118  NYCGKRVPTGFKC  130



>dbj|BAK05563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCANVL  L+ L +G PPKKPCC+LI+GL DLEAAVCLCTA+KANILGINL
Sbjct  109  CPIDALKLGVCANVLNGLINLQLGTPPKKPCCTLIQGLADLEAAVCLCTALKANILGINL  168

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            NVP+ LSLL+N CGK VP+GFQCP
Sbjct  169  NVPIDLSLLVNYCGKNVPAGFQCP  192



>ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=127

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ L +G PPKKPCCSLI+GL DLEAAVCLCTA+KANILGI L
Sbjct  44   CPIDTLKLGVCANVLNGLINLNLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGIKL  103

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+ LSLL+N CGKKVP+GFQCP
Sbjct  104  NIPVDLSLLINYCGKKVPTGFQCP  127



>gb|KDP25645.1| hypothetical protein JCGZ_20801 [Jatropha curcas]
Length=138

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCA VLG+LL + +G+PP KPCCSL+EGLVDLEAAVCLCTAIKANILGINL
Sbjct  55   CPRDALKLGVCAKVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGINL  114

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVPLSLSLLLNVC KKVPS FQC
Sbjct  115  NVPLSLSLLLNVCSKKVPSDFQC  137



>ref|XP_006357014.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 104/138 (75%), Gaps = 6/138 (4%)
 Frame = -1

Query  647  MASKKT-SVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg----KCPKDAL  483
            MASKK  S LALF+  N++F T VS+C TCP PKPKPKPKP+  P         CP D L
Sbjct  1    MASKKFFSTLALFLSLNLIFFTFVSSCNTCPKPKPKPKPKPSCPPPPYVPKYKTCPIDTL  60

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCA+VLG +  +V   PP  PCCSLI GL D+EAA+CLCTA+KAN+LGINLNVP+SL
Sbjct  61   KLGVCADVLGLVNVVVGS-PPVTPCCSLISGLADVEAALCLCTALKANVLGINLNVPISL  119

Query  302  slllnVCGKKVPSGFQCP  249
            SLLLNVC KKVP GFQCP
Sbjct  120  SLLLNVCSKKVPYGFQCP  137



>ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAL11562.1|AF424568_1 At2g45180/T14P1.1 [Arabidopsis thaliana]
 gb|AAB82643.1| expressed protein [Arabidopsis thaliana]
 gb|AAM62919.1| unknown [Arabidopsis thaliana]
 gb|AAV84511.1| At2g45180 [Arabidopsis thaliana]
 dbj|BAF01874.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAF02133.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAE99283.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|ABI93898.1| At2g45180 [Arabidopsis thaliana]
 gb|AEC10522.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=134

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg--KCPKDALKLG  474
            MASK  +V AL I  N+LF T V++    P+    PK   +P  +      CP D LKLG
Sbjct  1    MASKALAVTALLITLNLLFFTFVTSTKCPPTTPKPPKTPKSPKKAPAVKPTCPTDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCA++LG +  +V   PPK PCC+L++GL +LEAAVCLCTA+KAN+LGINLNVP+ L+LL
Sbjct  61   VCADLLGLVNVVVGS-PPKTPCCTLLQGLANLEAAVCLCTALKANVLGINLNVPIDLTLL  119

Query  293  lnVCGKKVPSGFQC  252
            LN CGKKVP GFQC
Sbjct  120  LNYCGKKVPHGFQC  133



>ref|NP_001053512.1| Os04g0554600 [Oryza sativa Japonica Group]
 emb|CAD41235.2| OSJNBa0010H02.23 [Oryza sativa Japonica Group]
 dbj|BAF15426.1| Os04g0554600 [Oryza sativa Japonica Group]
 gb|EAZ31583.1| hypothetical protein OsJ_15725 [Oryza sativa Japonica Group]
Length=131

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 4/133 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG-TCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MA K +  +ALF+  N++  ++ SACG  CP+P P     PTP+P+  GKCP+DALKLGV
Sbjct  1    MAGKAS--IALFLAVNLVVFSLGSACGGHCPTPTPPTPSTPTPTPAAFGKCPRDALKLGV  58

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CANVLG +   V   PP +PCC L+EGLVDLEAAVCLCTAIK NILGINLN+P+ LSL+L
Sbjct  59   CANVLGLIKAKVGV-PPAEPCCPLLEGLVDLEAAVCLCTAIKGNILGINLNLPVDLSLIL  117

Query  290  nVCGKKVPSGFQC  252
            N CGK+VP+GF+C
Sbjct  118  NYCGKRVPTGFKC  130



>ref|XP_009333597.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=145

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+D LKLGVCANVL  LL + VGNPP +PCCSLI+GLVDLEAAVCLCTAI+ANILGINL
Sbjct  62   CPRDTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGINL  121

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+PLSLSLLLNVCG KVP GFQC
Sbjct  122  NIPLSLSLLLNVCGNKVPKGFQC  144



>ref|XP_008232588.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = -1

Query  644  ASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnk-----gKCPKDALK  480
            +SK  + +AL +  N++F T VS+    P+  P PK    P PS         CPKD LK
Sbjct  3    SSKAIATIALLLSLNLVFFTTVSSNHHVPNCPPPPKTPKHPPPSTSIPPAKASCPKDTLK  62

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVC ++L  L+ LV+G PPK PCCSLI GL D+EAAVCLCTAIKAN+LGINLNVP+SLS
Sbjct  63   LGVCGDLLNGLVHLVMGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGINLNVPVSLS  122

Query  299  lllnVCGKKVPSGFQC  252
            LLLN CGK VP+GFQC
Sbjct  123  LLLNYCGKSVPTGFQC  138



>ref|XP_009333675.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=153

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+D LKLGVCANVL  LL + VGNPP +PCCSLI+GLVDLEAAVCLCTAI+ANILGINL
Sbjct  70   CPRDTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGINL  129

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+PLSLSLLLNVCG KVP GFQC
Sbjct  130  NIPLSLSLLLNVCGNKVPRGFQC  152



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVCA++LG+LL + +G+PP KPCCS+I+GL+DLEAA+CLCTAIKANILGINL
Sbjct  57   CPKDALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANILGINL  116

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+SLSLL+NVCGKKVP  FQCP
Sbjct  117  NIPISLSLLINVCGKKVPKDFQCP  140



>ref|XP_003559027.1| PREDICTED: putative glycine-rich cell wall structural protein 
1 [Brachypodium distachyon]
 gb|ACF22748.1| proline-rich protein [Brachypodium distachyon]
Length=186

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCANVL  L+ L +G PPKKPCC+LI+GL DLEAAVCLCTA++ANILGINL
Sbjct  103  CPIDALKLGVCANVLNGLINLELGTPPKKPCCTLIQGLADLEAAVCLCTALRANILGINL  162

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            NVP+ LSLL+N CGK+VP+GFQCP
Sbjct  163  NVPIDLSLLVNYCGKRVPTGFQCP  186



>ref|XP_008362163.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=145

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVC ++L +L+ +VVG PPK PCCSLI GL DLEAAVCLCTAIKAN+LGINL
Sbjct  62   CPKDTLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGINL  121

Query  320  nvplslslllnVCGKKVPSGFQC  252
            +VP+SLSLLLN CGK VP+GFQC
Sbjct  122  DVPVSLSLLLNYCGKSVPNGFQC  144



>ref|XP_007218576.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
Length=139

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVC  +L  L+ LVVG PPK PCCSLI GL D+EAAVCLCTAIKAN+LGINL
Sbjct  56   CPKDTLKLGVCGALLNGLVHLVVGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGINL  115

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGK VP+GFQC
Sbjct  116  NVPVSLSLLLNYCGKSVPTGFQC  138



>ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
 gb|EOA28114.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
Length=134

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 93/134 (69%), Gaps = 3/134 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg--KCPKDALKLG  474
            MASK  +V AL I  N+LF T V++    P+    PK   +P         CP D LKLG
Sbjct  1    MASKALAVTALLITLNLLFFTFVTSTKCPPTTPKPPKTPKSPKKEPAVKPTCPTDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCA++LG +  L+   PPK PCCSL++GL +LEAAVCLCTA+KAN+LGINLNVP+ LSLL
Sbjct  61   VCADLLGLVNVLIGS-PPKTPCCSLLQGLANLEAAVCLCTALKANVLGINLNVPVDLSLL  119

Query  293  lnVCGKKVPSGFQC  252
            LN CGKK+P GFQC
Sbjct  120  LNYCGKKLPYGFQC  133



>ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=132

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCA++L +LL  VVG PPK PCCSLI GL DLEAAVCLCTAIKAN+LGI L
Sbjct  49   CPKDTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLGIKL  108

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVP+G+QC
Sbjct  109  NVPVSLSLLLNYCGKKVPTGYQC  131



>ref|XP_009333630.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=135

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC--pspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK TS LALF+  N+ F  +VS+CGTC  P PKPKPKP P PSPS    CP+D LKLG
Sbjct  1    MASKTTSSLALFLALNLFFFALVSSCGTCPGPKPKPKPKPTPKPSPSTGTSCPRDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL  LL + VG PP +PCCSLI+GL D+EAAVCLCTA+KANILGINLN+P+SLSLL
Sbjct  61   VCANVLNGLLNISVGKPPVEPCCSLIQGLADIEAAVCLCTALKANILGINLNIPISLSLL  120

Query  293  lnVCGKKVPSGFQC  252
            LNVCG KVP GFQC
Sbjct  121  LNVCGNKVPKGFQC  134



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLG+CANVL  LL + +G PPK+PCCSL+EGLVDLEAAVCLCTA+K N+LG+ L
Sbjct  46   CPRDALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKL  105

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLL+N CGKKVP GF C
Sbjct  106  NIPVSLSLLINYCGKKVPKGFLC  128



>ref|XP_009333632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptps---psnkgKCPKDALKL  477
            M SK++S LAL +  N+LFC + S C TC     +P   P P+    ++   CP+D+LKL
Sbjct  1    MNSKRSSTLALLLSINLLFCVLASGCYTCSQQPHQPIRNPRPNPIPSASPKSCPRDSLKL  60

Query  476  GVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsl  297
            GVCA +L   +G VVGNPP  PCC+L+EGLVDLE AVCLCTAIKANILGINLN+P++LSL
Sbjct  61   GVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  296  llnVCGKKVPSGFQC  252
            +++ C K VP GF+C
Sbjct  121  VIDGCAKNVPEGFKC  135



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCA++L  L+ +VVG PPK PCCSL+EGL DLEAAVCLCTAIKA++LGINL
Sbjct  51   CPRDALKLGVCADLLNGLVNIVVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLGINL  110

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGK VP GFQC
Sbjct  111  NVPVSLSLLLNYCGKDVPYGFQC  133



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLG+CANVL  LL + +G PPK+PCCSL+EGLVDLEAAVCLCTA+K N+LG+ L
Sbjct  60   CPRDALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKL  119

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLL+N CGKKVP GF C
Sbjct  120  NIPVSLSLLINYCGKKVPKGFLC  142



>ref|XP_006396747.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
 gb|ESQ38200.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
Length=129

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnll  444
            LA+F+  NILF  +  A G    P    KPKPTPS      CPKDALKLGVC N L  L 
Sbjct  7    LAIFLALNILFFALTEA-GRSGYPPSPYKPKPTPSAPAIETCPKDALKLGVCVNALNLLN  65

Query  443  glvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVPS  264
              +   PP +PCCSLI+GLVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVC +K P 
Sbjct  66   VTLGA-PPVQPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKAPR  124

Query  263  GFQCP  249
            GFQCP
Sbjct  125  GFQCP  129



>ref|NP_001237995.1| uncharacterized protein LOC100305616 precursor [Glycine max]
 gb|ACU13392.1| unknown [Glycine max]
Length=137

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 92/134 (69%), Gaps = 3/134 (2%)
 Frame = -1

Query  644  ASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpk---ptpspsnkgKCPKDALKLG  474
            +S  ++ LALF+  N+L   M S C TC  PKP P P              CP+DALKLG
Sbjct  3    SSGPSTTLALFLTINLLVFVMASGCYTCTQPKPNPSPNPFPYPNPSPTAKSCPRDALKLG  62

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL   +G +VG+PP  PCCS++EGL+DLE AVCLCTAIKANILGINLN+P+SLSL+
Sbjct  63   VCANVLNGPIGAIVGSPPDHPCCSVLEGLLDLEVAVCLCTAIKANILGINLNIPISLSLI  122

Query  293  lnVCGKKVPSGFQC  252
            LN C K  PS F C
Sbjct  123  LNACEKSPPSDFLC  136



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 108/132 (82%), Gaps = 6/132 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK  ++++LF+V N+LF  + SACGTCPSPKPKPKPKP         CPKD LKLGVC
Sbjct  1    MASKTNTLISLFLVLNLLFFPLSSACGTCPSPKPKPKPKPKGY------CPKDTLKLGVC  54

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A++LG LLG+ +G PPK PCC+LIEGL DLEAAVCLCTAIKANILGINLNVPLSLSLLLN
Sbjct  55   ADLLGGLLGITIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANILGINLNVPLSLSLLLN  114

Query  287  VCGKKVPSGFQC  252
            VC KKVP GF C
Sbjct  115  VCSKKVPKGFVC  126



>ref|XP_011081229.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCAN+L +L+ LVVG PPK PCC+LI+GL DLEAAVCLCTAIKAN+LG +L
Sbjct  50   CPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIKGLADLEAAVCLCTAIKANVLGNDL  109

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+PLSLSLLLN CGKKVP+GFQC
Sbjct  110  NIPLSLSLLLNYCGKKVPTGFQC  132



>ref|XP_002511665.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF50334.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPK+ALKLGVCA++L +L+ LVVG PPK+PCC LI+GL DLEAAVCLCTA+KANILGINL
Sbjct  56   CPKNALKLGVCADLLNDLVHLVVGTPPKEPCCPLIQGLADLEAAVCLCTALKANILGINL  115

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGK VP+GFQC
Sbjct  116  NVPVSLSLLLNYCGKGVPAGFQC  138



>ref|XP_004291444.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=133

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 2/133 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVS-ACGTCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MAS      AL I+  +L+ +  S ACGTC        P P  +P    KCPKD LKLGV
Sbjct  1    MASSNKLSAALLIISVLLYSSTFSIACGTCKPHPKPTPPTPAATPPAAEKCPKDTLKLGV  60

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CA++LG +   +   PP  PCCSL++GL DLEAA+CLCTA+KAN+LGINLNVP+SLS+L+
Sbjct  61   CADLLGLVNLQIGS-PPTTPCCSLLKGLTDLEAALCLCTALKANVLGINLNVPISLSVLV  119

Query  290  nVCGKKVPSGFQC  252
            + C K VPSGFQC
Sbjct  120  SACQKSVPSGFQC  132



>ref|XP_008338137.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008389722.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=139

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 108/138 (78%), Gaps = 6/138 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC------pspkpkpkpkptpspsnkgKCPKDA  486
            MASK TS LALF+  N+ F  +VS+CGTC      P PKPKPKP P PSPS    CP+D 
Sbjct  1    MASKTTSSLALFLALNLFFFALVSSCGTCPGPKPKPKPKPKPKPTPKPSPSTGTSCPRDT  60

Query  485  LKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpls  306
            LKLGVCANVL  LL + VG PP +PCCSLI+GL DLEAAVCLCTA+KANILGINLN+P+S
Sbjct  61   LKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADLEAAVCLCTALKANILGINLNIPVS  120

Query  305  lslllnVCGKKVPSGFQC  252
            LSLLLNVCG KVP GFQC
Sbjct  121  LSLLLNVCGNKVPKGFQC  138



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVCA++LG+LL + VG PP KPCCS+I+GL+DLEAAVCLCTAIKANILGINL
Sbjct  58   CPKDALKLGVCADLLGSLLNVTVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGINL  117

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+PLSLSLLLNVCGKKVP  FQC
Sbjct  118  NIPLSLSLLLNVCGKKVPKDFQC  140



>ref|XP_009623719.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=135

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 122/135 (90%), Gaps = 2/135 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpsps--nkgKCPKDALKLG  474
            MASK+T+ LALF++ N+LF ++VSACGTCPSPKPKPKPKP P+ S   KGKCPK+ LKLG
Sbjct  1    MASKRTTSLALFLLVNLLFFSLVSACGTCPSPKPKPKPKPKPTRSPNYKGKCPKNTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVLGNLLGL +GN PKKPCC+LI+GL D+EAA+CLCTAIKAN+LGINLNVPLSLSLL
Sbjct  61   VCANVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLGINLNVPLSLSLL  120

Query  293  lnVCGKKVPSGFQCP  249
            LNVCGKKVPSGF CP
Sbjct  121  LNVCGKKVPSGFICP  135



>ref|XP_010093705.1| hypothetical protein L484_019046 [Morus notabilis]
 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis]
Length=114

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCA+VL   +G+VVG+PP  PCCSL+EGL+DLEAAVCLCTAIKANILGINL
Sbjct  31   CPRDALKLGVCADVLKGPVGVVVGSPPDVPCCSLLEGLIDLEAAVCLCTAIKANILGINL  90

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLL++ C K +PSGFQC
Sbjct  91   NIPISLSLLISTCRKDIPSGFQC  113



>ref|XP_008808738.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=131

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP +ALKLGVCANVL  L+ + +G PPKKPCC+L+EGLVDLEAAVCLCTA+KANILGI L
Sbjct  48   CPMNALKLGVCANVLNGLINVSLGKPPKKPCCTLLEGLVDLEAAVCLCTALKANILGIKL  107

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+ LSLLLN CGKKVP+G++C
Sbjct  108  NLPVDLSLLLNYCGKKVPAGWKC  130



>ref|XP_007155637.1| hypothetical protein PHAVU_003G218600g [Phaseolus vulgaris]
 gb|ESW27631.1| hypothetical protein PHAVU_003G218600g [Phaseolus vulgaris]
Length=132

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M   ++S L LF   N+LF  + S C TC  PKP P P P P+P+ K  CP+DALKLGVC
Sbjct  1    MKPSRSSTLVLFFTINLLFFAIASGCYTCTQPKPNPLPYPNPTPAPKS-CPRDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             NVL   +G VVG+P   PCCS++EGL+DLE AVCLCTAIKANILGIN+N+P+SLSL+LN
Sbjct  60   TNVLNGPIGAVVGSPLDHPCCSVLEGLLDLEVAVCLCTAIKANILGININIPISLSLILN  119

Query  287  VCGKKVPSGFQC  252
             C K  PS FQC
Sbjct  120  ACEKSPPSDFQC  131



>emb|CDP09930.1| unnamed protein product [Coffea canephora]
Length=130

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M SK++    +F+  NI F  +VSAC T PSP              KG CP+DALKLGVC
Sbjct  1    MDSKRSKSTVIFLSINIFFFVLVSACNT-PSPPMPKPIPNPTPTPAKGSCPRDALKLGVC  59

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L     +    PP  PCCS++ GL+DLEAA+CLCTA++ANILGINLN+P+SLSLL+N
Sbjct  60   AKLLSIGTVIGN--PPDTPCCSILGGLLDLEAAICLCTALRANILGINLNIPISLSLLVN  117

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  118  TCGKKLPSDFIC  129



>emb|CDP09931.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 95/133 (71%), Gaps = 6/133 (5%)
 Frame = -1

Query  647  MASKKTS-VLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MAS  T+  +ALF+ FN+LF T  SA          P           GKCPKDALKLGV
Sbjct  1    MASMNTTRAIALFLCFNVLFFTFASA-----CGGGCPPKPKPKPKPKPGKCPKDALKLGV  55

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CANVL  LL + +GNPPKKPCC+LI+GL DLEAAVCLCTAIKANILGINLN+PLSLSLLL
Sbjct  56   CANVLSGLLNITIGNPPKKPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLL  115

Query  290  nVCGKKVPSGFQC  252
            NVC K VP GF C
Sbjct  116  NVCSKNVPKGFVC  128



>ref|XP_010041938.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 12/133 (9%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK    LAL +  NI+F ++ +A              P P+P+    CP++ALKLGVC
Sbjct  1    MASKNYPTLALVLSLNIIFASLATA------------WTPKPTPTAAASCPENALKLGVC  48

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             ++LG+LL + VG PPK+PCCSLI GL+D+EAA CLC AI A+ILG+ ++V LSLSLLL+
Sbjct  49   LDLLGSLLNVTVGTPPKEPCCSLIGGLLDVEAAACLCIAIDADILGLQIDVELSLSLLLD  108

Query  287  VCGKKVPSGFQCP  249
             C KKVP GFQCP
Sbjct  109  ACSKKVPPGFQCP  121



>ref|XP_002446915.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
 gb|EES11243.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
Length=132

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = -1

Query  644  ASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCA  465
             + K S +ALF+  N+    M SACG    P P     PTP+P++ GKCP+DALKLGVCA
Sbjct  3    GNNKASSVALFLAVNLAVFAMASACGG-NCPTPSTPSTPTPTPASFGKCPRDALKLGVCA  61

Query  464  nvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnV  285
            NVLG +   V   PP +PCC L+EGLVDLEAA+CLCTAIK NILGINLN+P+ LSL+LN 
Sbjct  62   NVLGLIKAKVGV-PPTEPCCPLLEGLVDLEAALCLCTAIKGNILGINLNLPIDLSLILNH  120

Query  284  CGKKVPSGFQC  252
            CGK VP+GF+C
Sbjct  121  CGKSVPTGFKC  131



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+D LKLGVCANVL +L+ LVVG PPK PCC LI+GL DLEAAVCLCTAIKANILGINL
Sbjct  56   CPRDTLKLGVCANVLNDLIHLVVGTPPKTPCCPLIQGLADLEAAVCLCTAIKANILGINL  115

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGK VP GFQC
Sbjct  116  NVPVSLSLLLNYCGKNVPKGFQC  138



>emb|CDX79156.1| BnaA01g12230D [Brassica napus]
Length=135

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 97/137 (71%), Gaps = 6/137 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGT--CpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MA K +  LALF++FN++F T+ +A  +  CP P  K        P+  G CPKD LKLG
Sbjct  1    MAVKDS--LALFLLFNVIFFTLTTATRSTNCPPPPRKHNKHKPSPPTTTGTCPKDTLKLG  58

Query  473  VC--AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            VC  A  L N  G  +G PP  PCCSLI+GLVDLEAAVCLCTA+KA++LGIN+N+P++LS
Sbjct  59   VCVNALNLLNDDGPALGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGININLPINLS  118

Query  299  lllnVCGKKVPSGFQCP  249
            LLLNVC +K P GFQCP
Sbjct  119  LLLNVCKRKSPPGFQCP  135



>ref|XP_011033953.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=137

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVCA++LG+LL + VGNPP KPCCS+I+GL+DLE+AVCLCTAIKANILGINL
Sbjct  54   CPKDALKLGVCADLLGSLLNVTVGNPPVKPCCSVIQGLLDLESAVCLCTAIKANILGINL  113

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+PLSLSLLLNVCGKKVP  FQC
Sbjct  114  NIPLSLSLLLNVCGKKVPKDFQC  136



>ref|XP_010906607.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCA+VL  LL + +G PPK+PCCSL+ GLVDLE AVCLCT IKA+ILGINL
Sbjct  46   CPIDALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEVAVCLCTVIKASILGINL  105

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+ LSLL+N CGKKVPSGFQC
Sbjct  106  NIPVDLSLLVNYCGKKVPSGFQC  128



>ref|XP_004516837.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=135

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNI-LFCTMVSACGTCpspkpkpkpkp-tpspsnkgKCPKDALKLG  474
            M S ++S +ALF + N+ LF  M + C  CP P P P   P   +  +   CP+DAL+LG
Sbjct  1    MNSSRSSNVALFSIINVMLFFVMANGCFFCPKPNPNPNQFPFPNTSPSTKSCPRDALQLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCAN+L   +G V+G+PP+ PCCS++EGL+DLE AVCLCTAIKANILGIN+N+P+SLSL+
Sbjct  61   VCANLLNGPIGAVIGSPPEHPCCSVLEGLLDLEVAVCLCTAIKANILGININIPISLSLI  120

Query  293  lnVCGKKVPSGFQC  252
            LN C K  PS +QC
Sbjct  121  LNACEKTPPSNYQC  134



>ref|XP_009373377.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009373378.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009346904.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=140

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 9/140 (6%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC--------pspkpkpkpkptpspsnkgKCPK  492
            MASK  +  AL +  N+LF T+V++              PK      P P+PS    CP+
Sbjct  1    MASKALASTALLVSLNLLFFTLVTSTNVVCPPPAKKGHQPKHASPALPNPNPSKPATCPR  60

Query  491  DALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvp  312
            D LKLG CA+VL  L+ LVVG PPK PCCSLIEGLVDL+AAVCLCTAIKAN++GINLN+P
Sbjct  61   DTLKLGACADVLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVMGINLNIP  119

Query  311  lslslllnVCGKKVPSGFQC  252
            +SLSLLLN CGK+VP+G++C
Sbjct  120  ISLSLLLNYCGKQVPTGYEC  139



>gb|ACV74341.1| proline-rich protein [Jatropha curcas]
Length=138

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCA VLG+LL + +G+PP KPCCSL+EGLVDLEAAVCLCTAIKANILGI L
Sbjct  55   CPRDALKLGVCAKVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGITL  114

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVPLSLSLLLNVC KKVP  FQC
Sbjct  115  NVPLSLSLLLNVCSKKVPFDFQC  137



>ref|XP_010455702.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = -1

Query  623  LALFIVFNILFCTMVSACGT-CpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgnl  447
            LA+F+  NILF     A  + CP            SP     CPKDALKLGVC   L  +
Sbjct  7    LAIFLALNILFFAFTEAGRSGCPPSSSNKPKPTPSSPPAIDTCPKDALKLGVCVQALNLV  66

Query  446  lglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKVP  267
               +   PP KPCCSLI+GLVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVC +K P
Sbjct  67   NVTLGA-PPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKPP  125

Query  266  SGFQCP  249
             GFQCP
Sbjct  126  RGFQCP  131



>ref|NP_001152587.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48385.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW59241.1| cortical cell-delineating protein [Zea mays]
Length=134

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNI-LFCTMVSACG-TCpspkpkpkpkptpspsnkgKCPKDALKLG  474
            MA    + +ALF+  N+ +F  M SACG  CP+P P     PTP+P++ GKCP+DALKLG
Sbjct  1    MALAGKASVALFLAVNLAVFIAMASACGGNCPTPTPSTPSTPTPTPASFGKCPRDALKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVLG +   V   PP +PCC L+EGLVDLEAAVCLCTAIK  +LGI LN+P+ LSL+
Sbjct  61   VCANVLGLIKAKVGV-PPTEPCCRLLEGLVDLEAAVCLCTAIKGEVLGIKLNLPVDLSLI  119

Query  293  lnVCGKKVPSGFQC  252
            LN CGK VP+GF+C
Sbjct  120  LNHCGKTVPTGFKC  133



>ref|XP_004976453.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=131

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG-TCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MA K +  +ALF+  N++   M SACG  CP   P     PTP+P++ GKCP+DALKLGV
Sbjct  1    MAGKAS--VALFLAVNMVVFAMASACGGHCPPSTPSTPSTPTPTPASFGKCPRDALKLGV  58

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            C NVLG +   V   PP +PCC L+EGLVDL+AAVCLCTAIK NILGINLN+P+ +SL+L
Sbjct  59   CTNVLGLIKAKVGV-PPTEPCCPLLEGLVDLQAAVCLCTAIKGNILGINLNLPIDVSLIL  117

Query  290  nVCGKKVPSGFQC  252
            N CGK VP+GF+C
Sbjct  118  NHCGKTVPTGFKC  130



>ref|XP_010933688.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=131

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP +ALKLGVCANVL  L+ L +GNPPKKPCC+L++GL DLE AVCLCTA+KANILGI+L
Sbjct  48   CPMNALKLGVCANVLNGLINLNLGNPPKKPCCTLLQGLADLEVAVCLCTALKANILGISL  107

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            NVP+ LSLL+N CGK  P+GFQCP
Sbjct  108  NVPIDLSLLINYCGKNAPTGFQCP  131



>ref|XP_002529775.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF32589.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCA+VLG+LL + +G PP +PCCSLI+GLVDLEAAVCLCTAIKANILGINL
Sbjct  56   CPRDALKLGVCADVLGSLLNITIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGINL  115

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+PLSLSLLLNVC KK PS FQC
Sbjct  116  NIPLSLSLLLNVCSKKTPSDFQC  138



>gb|ABF93505.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=179

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  95   CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  154

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  155  NLPINLSLLVNYCGRSVPSGFQC  177



>ref|XP_008669243.1| PREDICTED: uncharacterized protein LOC103646289 [Zea mays]
Length=201

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCAN+L  L+   +G PP+ PCC+LI+GL DLEAAVCLCT ++AN+LGINL
Sbjct  118  CPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINL  177

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG++VPSGFQC
Sbjct  178  NLPINLSLLVNYCGRRVPSGFQC  200



>gb|EAY88189.1| hypothetical protein OsI_09636 [Oryza sativa Indica Group]
 dbj|BAJ08376.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08377.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08378.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08380.1| qLTG3-1 [Oryza sativa Indica Group]
Length=178

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  94   CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  153

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  154  NLPINLSLLVNYCGRSVPSGFQC  176



>emb|CDP05328.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 14/138 (10%)
 Frame = -1

Query  647  MASKKT--SVLALFIVFNILFCTMVSA---CGTCpspkpkpkpkptpspsnkgKCPKDAL  483
            MASK    S  A F + N+LF T+++A   CGTC +P P               CP+DAL
Sbjct  1    MASKTPTFSSSATFFLINLLFFTLLTASHSCGTCRNPGPGTGSGAR--------CPRDAL  52

Query  482  KLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsl  303
            KLGVCANVLG +   +   PP  PCCSL++GL DLEAA+CLCTAI+ANILGINLN+P++L
Sbjct  53   KLGVCANVLGLIRVSIGA-PPTLPCCSLLQGLADLEAALCLCTAIRANILGINLNLPVTL  111

Query  302  slllnVCGKKVPSGFQCP  249
            SL+LN CG+  P+GF CP
Sbjct  112  SLVLNNCGRNPPNGFICP  129



>dbj|BAG50511.1| qLTG-3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08371.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08372.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08373.1| qLTG3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08374.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAN84541.1| QTL for low-temperature germinability 3-1 [Oryza sativa Japonica 
Group]
Length=184

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  100  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  159

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  160  NLPINLSLLVNYCGRSVPSGFQC  182



>ref|XP_010258988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=126

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 92/132 (70%), Gaps = 7/132 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            M S+ +S  ALF+  N++   +VS CG+C  P P P             CPKDALKLGVC
Sbjct  1    MDSRSSSSAALFLSLNLVLFAVVSGCGSCVKPTPTPPTPTGS-------CPKDALKLGVC  53

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A +L   +G  VGNPP  PCC+L+EGLVDLE A CLCTAIKANILGINL++P+SLSLL+N
Sbjct  54   AKLLNGAIGAEVGNPPDHPCCALLEGLVDLEVAACLCTAIKANILGINLDIPISLSLLVN  113

Query  287  VCGKKVPSGFQC  252
             CGKK+PS F C
Sbjct  114  TCGKKLPSDFLC  125



>ref|NP_001048668.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|ABF93504.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10582.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|EAZ25261.1| hypothetical protein OsJ_09069 [Oryza sativa Japonica Group]
 dbj|BAI60003.1| Low-temperature germinability 3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08375.1| qLTG3-1 [Oryza sativa Japonica Group]
Length=184

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  100  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  159

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  160  NLPINLSLLVNYCGRSVPSGFQC  182



>ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29088.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=140

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVC ++L +LL + +G PPK PCCSLI  LVDLEAAVCLCT+IKA++LGINL
Sbjct  57   CPKDTLKLGVCVDLLKDLLSVTIGKPPKTPCCSLIGDLVDLEAAVCLCTSIKASLLGINL  116

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+ LSL+LN CGKKVP GFQCP
Sbjct  117  NLPVDLSLVLNYCGKKVPEGFQCP  140



>ref|XP_002880164.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56423.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkg--KCPKDALKLG  474
            MASK  +V AL I  N+LF T V++    P+    PK   +P         CP D LKLG
Sbjct  1    MASKALAVTALLITLNLLFFTFVTSTKCPPTTPKPPKVPKSPKKDPAVKPTCPTDTLKLG  60

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCA +LG +  +V   PPK PCC+L++GL +LEAAVCLCTA+KAN+LGINLNVP+ LSLL
Sbjct  61   VCAELLGLVNLVVGS-PPKTPCCTLLQGLANLEAAVCLCTALKANVLGINLNVPVDLSLL  119

Query  293  lnVCGKKVPSGFQ  255
            LN CGKK+P GFQ
Sbjct  120  LNYCGKKLPYGFQ  132



>dbj|BAJ08379.1| qLTG3-1 [Oryza sativa Indica Group]
Length=190

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  106  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  165

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  166  NLPINLSLLVNYCGRSVPSGFQC  188



>ref|XP_006304906.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
 gb|EOA37804.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
Length=138

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 97/138 (70%), Gaps = 6/138 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCp------spkpkpkpkptpspsnkgKCPKDA  486
            MAS+ TS +ALF+  N+L  T +SACG+C                         KCPKD 
Sbjct  1    MASRTTSSIALFLALNLLLFTTISACGSCSPCGGGCPSPKPKPKPTPKPKPTSNKCPKDT  60

Query  485  LKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpls  306
            LKLGVCANVL  LL L +G PP +PCCSLI+GL D+EAAVCLCTA+KAN+LGINLNVP+S
Sbjct  61   LKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNVPIS  120

Query  305  lslllnVCGKKVPSGFQC  252
            LSLLLNVC K++PSGFQC
Sbjct  121  LSLLLNVCSKQLPSGFQC  138



>ref|XP_002874777.1| hypothetical protein ARALYDRAFT_911650 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51036.1| hypothetical protein ARALYDRAFT_911650 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 96/149 (64%), Gaps = 17/149 (11%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG-----------------TCpspkpkpkpkptps  519
            MASK ++ LALF   NILF T+  A                         P P      +
Sbjct  1    MASKNSASLALFFALNILFFTLTVATDCKCNPSPKHSPRVPTPRVPIPSVPTPSVPTPST  60

Query  518  psnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKAN  339
            P +   CP DAL+LGVCANVL  LL + +G P  +PCCSLI+GLVDL+AA+CLCTA++AN
Sbjct  61   PGSSRNCPIDALRLGVCANVLSGLLNVQLGQPSAQPCCSLIQGLVDLDAAICLCTALRAN  120

Query  338  ILGInlnvplslslllnVCGKKVPSGFQC  252
            +LGINLNVP+SLS+LLNVC +++PSGFQC
Sbjct  121  VLGINLNVPISLSVLLNVCNRRLPSGFQC  149



>dbj|BAJ08384.1| qLTG3-1 [Oryza longistaminata]
Length=194

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  110  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  169

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  170  NLPINLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08383.1| qLTG3-1 [Oryza glumipatula]
Length=194

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  110  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  169

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  170  NLPINLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08381.1| qLTG3-1 [Oryza rufipogon]
Length=194

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  110  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  169

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  170  NLPINLSLLVNYCGRSVPSGFQC  192



>ref|XP_010053449.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77745.1| hypothetical protein EUGRSUZ_D02039 [Eucalyptus grandis]
Length=121

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 12/133 (9%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK    LAL +  NI+F ++ +A              P P+P+    CP++ALKLGVC
Sbjct  1    MASKNYPTLALVLSLNIIFASLATA------------WTPKPTPTAAASCPENALKLGVC  48

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             ++LG+LL + VG PPK+PCCSLI GL DLEAA CLC  I A++LG+ ++VPLSLSLLL+
Sbjct  49   LDLLGSLLNVTVGTPPKEPCCSLIGGLADLEAAACLCIVIDADVLGLQIDVPLSLSLLLD  108

Query  287  VCGKKVPSGFQCP  249
             C KKVP GFQCP
Sbjct  109  ACSKKVPPGFQCP  121



>ref|XP_009134276.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=127

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MAS+ +  LA+F+V NILF  +  A  +     P    KP P+P     CPKD +KLGVC
Sbjct  1    MASRNS--LAIFLVLNILFFALTEAARS---GCPPGPYKPKPTPPAIQTCPKDTVKLGVC  55

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             N L  L   +   PP KPCCSLI+GLVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLN
Sbjct  56   VNALNLLNVTLGA-PPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLN  114

Query  287  VCGKKVPSGFQCP  249
            VC +K P GFQCP
Sbjct  115  VCSRKAPRGFQCP  127



>ref|XP_010919517.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=157

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCANVL  L+ L  G PPK PCCSL++GLVDLEAAVCLCT +KANILGI L
Sbjct  74   CPVDALKLGVCANVLNGLINLKAGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIKL  133

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+ LSLLLN CGK  P GFQCP
Sbjct  134  NLPIHLSLLLNYCGKNTPRGFQCP  157



>ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP + LKLGVCA+VL  L+  +   PPKKPCC+L+EGLVDLEAAVCLCTA+KANILGI L
Sbjct  44   CPMNTLKLGVCADVLKALIVNIGK-PPKKPCCTLLEGLVDLEAAVCLCTALKANILGIKL  102

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+ LSLLLN CGKKVP GFQCP
Sbjct  103  NIPVDLSLLLNYCGKKVPKGFQCP  126



>dbj|BAJ08382.1| qLTG3-1 [Oryza barthii]
Length=198

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  114  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  173

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  174  NLPINLSLLVNYCGRSVPSGFQC  196



>dbj|BAJ08386.1| qLTG3-1 [Oryza meridionalis]
Length=199

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  115  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  174

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  175  NLPINLSLLVNYCGRSVPSGFQC  197



>tpg|DAA37198.1| TPA: hypothetical protein ZEAMMB73_187029 [Zea mays]
 tpg|DAA42811.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=142

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCAN+L  L+   +G PP+ PCC+LI+GL DLEAAVCLCT ++AN+LGINL
Sbjct  59   CPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINL  118

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG++VPSGFQC
Sbjct  119  NLPINLSLLVNYCGRRVPSGFQC  141



>ref|XP_006289530.1| hypothetical protein CARUB_v10003073mg [Capsella rubella]
 gb|EOA22428.1| hypothetical protein CARUB_v10003073mg [Capsella rubella]
Length=159

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 95/158 (60%), Gaps = 26/158 (16%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSA--CGTCpspkpkpkpkptpsps-------------  513
            MASK ++ LALF   NILF T+ SA  C TC        P    +               
Sbjct  1    MASKNSAFLALFFALNILFVTLPSATSCNTCKPIPKPKPPPKPKATPCPPPPRPSVPTPP  60

Query  512  -----------nkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAV  366
                       +   CP DALKLGVC NVL  LL + +G P  K CCSLI+GL D++AA+
Sbjct  61   TKPVTPPSSPGSSKNCPIDALKLGVCGNVLSGLLNIQLGQPSSKQCCSLIQGLADVDAAI  120

Query  365  CLCTAIKANILGInlnvplslslllnVCGKKVPSGFQC  252
            CLCTA+KAN+LGINLNVP+SLS+LLNVC KKVPSGFQC
Sbjct  121  CLCTALKANVLGINLNVPISLSVLLNVCDKKVPSGFQC  158



>dbj|BAJ08385.1| qLTG3-1 [Oryza longistaminata]
Length=204

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCANVL  L+ + +G PP++PCCSLI+GL DLEAAVCLCTA++ANILGINL
Sbjct  120  CPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINL  179

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG+ VPSGFQC
Sbjct  180  NLPINLSLLVNYCGRSVPSGFQC  202



>ref|XP_008786992.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=143

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCA+VL  L+ L +G PPK PCCSL++GLVDLEAAVCLCT +KANILGI L
Sbjct  60   CPVDALKLGVCADVLNGLIHLKLGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIKL  119

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+ LSLLLN CGK  P GFQCP
Sbjct  120  NLPIHLSLLLNYCGKNTPKGFQCP  143



>gb|KCW77747.1| hypothetical protein EUGRSUZ_D02041 [Eucalyptus grandis]
Length=121

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 12/133 (9%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK    LAL +  NI+F ++ +A              P P+P+    CP++ALKLGVC
Sbjct  1    MASKNYPSLALVLSLNIIFASLATA------------WTPNPTPTAAASCPENALKLGVC  48

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             ++LG+LL + VG PPK+PCCSLI GL DLEAA CLC  I A++LG+ ++VPLSLSLLL+
Sbjct  49   LDLLGSLLNVTVGTPPKEPCCSLIGGLADLEAAACLCIVIDADVLGLQIDVPLSLSLLLD  108

Query  287  VCGKKVPSGFQCP  249
             C KKVP GFQCP
Sbjct  109  ACSKKVPPGFQCP  121



>ref|XP_006286053.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
 gb|EOA18951.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
Length=137

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVC N L  L  + +G PP  PCCSLIEGLVDLEAAVCLCTA+KA++LGINL
Sbjct  54   CPKDALKLGVCVNALNLLKDVTLGTPPVTPCCSLIEGLVDLEAAVCLCTALKASVLGINL  113

Query  320  nvplslslllnVCGKKVPSGFQCP  249
             +P++LSLLLNVC +K P GFQCP
Sbjct  114  YLPINLSLLLNVCSRKAPRGFQCP  137



>ref|XP_006302912.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
 gb|EOA35810.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
Length=170

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 99/154 (64%), Gaps = 13/154 (8%)
 Frame = -1

Query  674  HLQRVI------TVKMASKKTSVLALFIVFNILFCTMVSACGTC-------pspkpkpkp  534
            H  R I       + MAS+ T  LALF++ N LF T +SACG C                
Sbjct  17   HTHRSIPYIQKRNITMASRATKSLALFLILNFLFFTTISACGKCGCPSPKPKPNPKPKPT  76

Query  533  kptpspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCT  354
                      KCPKDALKLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCT
Sbjct  77   PKPSPSPATAKCPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIKGLADLEAAACLCT  136

Query  353  AIKANILGInlnvplslslllnVCGKKVPSGFQC  252
            A+KANILGINLN+P+SLSLLLNVC KKVP GFQC
Sbjct  137  ALKANILGINLNIPVSLSLLLNVCSKKVPPGFQC  170



>ref|XP_010422218.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=148

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 100/147 (68%), Gaps = 15/147 (10%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSA-CG--------------TCpspkpkpkpkptpsps  513
            MA   ++ LALFI  NILF T+ +A CG                     +    P  +PS
Sbjct  1    MALNNSASLALFIALNILFVTLTAADCGCNPSPKVSTPSVPSPSVPSPKRRPVTPPTTPS  60

Query  512  nkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANIL  333
            + G CP DAL+LGVCANVL +LL + +G P  + CCSLI+GLVD++AAVCLCTA++ANIL
Sbjct  61   SSGNCPIDALRLGVCANVLSSLLNVQLGQPSSQSCCSLIQGLVDVDAAVCLCTALRANIL  120

Query  332  GInlnvplslslllnVCGKKVPSGFQC  252
            GINLNVP+SLS+LLNVC +K+PSGFQC
Sbjct  121  GINLNVPISLSVLLNVCNRKLPSGFQC  147



>gb|EYU30301.1| hypothetical protein MIMGU_mgv1a018370mg [Erythranthe guttata]
Length=119

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCA++L  LL + VG PPK PCCSLIEGLVDLEAAVCLCTAIKAN+LGIN+
Sbjct  36   CPKDTLKLGVCADLLNGLLNVTVGTPPKTPCCSLIEGLVDLEAAVCLCTAIKANVLGINI  95

Query  320  nvplslslllnVCGKKVPSGFQC  252
            +VP+SL+LLLNVC K VP  F C
Sbjct  96   DVPISLTLLLNVCTKSVPKDFVC  118



>ref|XP_010553781.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Tarenaya 
hassleriana]
Length=128

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 94/134 (70%), Gaps = 9/134 (7%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTC--pspkpkpkpkptpspsnkgKCPKDALKLG  474
            MASK     AL I+FN+LF T+VS+      P P      K  P P++K  CP+DALKL 
Sbjct  1    MASKA----ALIILFNVLFFTLVSSTSVPCPPPPTKTHHKKYPPVPTHKATCPRDALKLK  56

Query  473  VCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsll  294
            VCANVL  +   +   PP+  CC+LI+ LVDLEAA CLCTA+KAN+LGI LNVP+SLSL+
Sbjct  57   VCANVLNLVKVSL---PPQSNCCALIKDLVDLEAAACLCTALKANVLGIKLNVPVSLSLV  113

Query  293  lnVCGKKVPSGFQC  252
            LN CGKKVPSGFQC
Sbjct  114  LNHCGKKVPSGFQC  127



>ref|XP_002533292.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29086.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=137

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSAC----GTCpspkpkpkpkptpspsnkgKCPKDALK  480
            MAS+  +  A  +  N+LF T+VS+            P P        S   KCP+D LK
Sbjct  1    MASRTLASTAFLLSINLLFFTLVSSTYCPPSAPKGHAPHPIKPSPVPSSKPAKCPRDTLK  60

Query  479  LGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplsls  300
            LGVC ++L +LL + VG PPK PCCSLI  LVDLEAAVCLCT IKA++LGINL+VP+ LS
Sbjct  61   LGVCVDLLKDLLSVTVGTPPKTPCCSLIADLVDLEAAVCLCTTIKASLLGINLSVPVDLS  120

Query  299  lllnVCGKKVPSGFQC  252
            LLLN CGKKVP GF+C
Sbjct  121  LLLNYCGKKVPEGFKC  136



>ref|XP_010422221.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 100/148 (68%), Gaps = 16/148 (11%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSA--CG--------------TCpspkpkpkpkptpsp  516
            MASK ++ LALF   NI+F T+ +A  CG                          P  +P
Sbjct  1    MASKNSASLALFFAINIIFFTLTAATDCGCNPNPKVPTPSVPSPSVPSPNPRPVTPPNTP  60

Query  515  snkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANI  336
             + GKCP DAL+LGVCANVL +LL + +G P  + CCSLI+GLVDL+AA+CLCTA++AN+
Sbjct  61   GSSGKCPIDALRLGVCANVLSSLLNVQLGQPSSQSCCSLIQGLVDLDAAICLCTALRANV  120

Query  335  LGInlnvplslslllnVCGKKVPSGFQC  252
            LGINLNVP+SLS+LLNVC +K+PSGFQC
Sbjct  121  LGINLNVPISLSVLLNVCNRKLPSGFQC  148



>ref|XP_009114615.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=129

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MA K +  LA+F+ FNILF  +  A      P    KPKP P+      CPKD +KLGVC
Sbjct  1    MALKNS--LAIFLAFNILFFALTEA-ARYGCPPSSYKPKPGPTTPAIETCPKDTVKLGVC  57

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
             N L  L   +   PP KPCCSLI+GLVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLN
Sbjct  58   VNALNLLNATLGA-PPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLN  116

Query  287  VCGKKVPSGFQCP  249
            VC +K P GFQCP
Sbjct  117  VCNRKAPRGFQCP  129



>gb|EPS71802.1| hypothetical protein M569_02964 [Genlisea aurea]
Length=146

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP D LKLGVCAN+LG+LLG+V+G PPK+PCCS+I+GLVDLEAAVCLCTAIKA+ILGINL
Sbjct  63   CPIDTLKLGVCANLLGDLLGVVIGTPPKEPCCSVIQGLVDLEAAVCLCTAIKADILGINL  122

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+SLS+LLNVC KKVP GF CP
Sbjct  123  NIPVSLSVLLNVCSKKVPPGFICP  146



>ref|NP_001152564.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG43950.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48252.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW59243.1| cortical cell-delineating protein [Zea mays]
Length=131

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG-TCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MA K +  +ALF+  N++   M SACG  CP+P P     PTP+P++ GKCP+DALKLGV
Sbjct  1    MAGKAS--VALFLAVNLVVFAMASACGGNCPTPTPSTPSTPTPTPASFGKCPRDALKLGV  58

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslll  291
            CANVLG +   V   PP +PCC L++GLVDLEAAVCLCTAIK  +LGI LN+P+ LSL+L
Sbjct  59   CANVLGLIKAKVGV-PPTEPCCPLLKGLVDLEAAVCLCTAIKGEVLGIKLNLPVDLSLIL  117

Query  290  nVCGKKVPSGFQC  252
            N CGK VP+GF+C
Sbjct  118  NHCGKTVPTGFKC  130



>ref|XP_010519362.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Tarenaya hassleriana]
Length=124

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 96/132 (73%), Gaps = 9/132 (7%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK    +AL I+ +++F T+VS+  T     P P  K  P+P +K  CP+DALKL VC
Sbjct  1    MASK----VALVILVHVVFATLVSS--TSVPCPPPPHKKYPPTPHHKATCPRDALKLKVC  54

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL  +   +   PP+  CC+LI+ LVDLEAA CLCTA++AN+LGINLNVP+SLSL+LN
Sbjct  55   ANVLNLVKVSL---PPQSSCCALIKDLVDLEAAACLCTALRANVLGINLNVPISLSLVLN  111

Query  287  VCGKKVPSGFQC  252
             CGKKVPSGFQC
Sbjct  112  HCGKKVPSGFQC  123



>ref|XP_009626056.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MASK +  +ALF+  N++  +MVS C T   PKPKPKP P P  S    CP D LKLGVC
Sbjct  1    MASKHS--VALFLCLNLVLFSMVSGCRT--CPKPKPKPCPPPPSSETATCPIDTLKLGVC  56

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            A+VLG +  ++   PP  PCCSL+ GL ++EAA+CLCTAIKANILGINLNVP+SLSLLLN
Sbjct  57   ADVLGLVNAVIGS-PPVTPCCSLLSGLANVEAALCLCTAIKANILGINLNVPISLSLLLN  115

Query  287  VCGKKVPSGFQCP  249
            VC K+ PSGFQCP
Sbjct  116  VCSKEAPSGFQCP  128



>ref|XP_004976456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=129

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 97/132 (73%), Gaps = 4/132 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MA K +  +ALF+  N+    M SACG    P P     PTP+P++ GKCP+DALKLGVC
Sbjct  1    MAGKAS--IALFLAVNLAVFAMASACGG-SCPTPSTPSTPTPTPASFGKCPRDALKLGVC  57

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLG +   +   PP +PCC L+EGLVDL+AAVCLCTAIK NILGINLN+P+ +SL+LN
Sbjct  58   ANVLGLIKAKIGV-PPTEPCCPLLEGLVDLQAAVCLCTAIKGNILGINLNLPIDVSLILN  116

Query  287  VCGKKVPSGFQC  252
             CGK VP+GF+C
Sbjct  117  HCGKTVPTGFKC  128



>ref|XP_002446914.1| hypothetical protein SORBIDRAFT_06g024780 [Sorghum bicolor]
 gb|EES11242.1| hypothetical protein SORBIDRAFT_06g024780 [Sorghum bicolor]
Length=129

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MA K T VL  F+  N+    M SACG    P P     PTP+P++ GKCP+DALKLGVC
Sbjct  1    MAGKATIVL--FLAVNLAVFAMASACGG-NCPTPSTPSTPTPTPASFGKCPRDALKLGVC  57

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLG +   V   PP +PCC L+EGLVDLEAA+CLCTAIK NILGINLN+P+ LSL+LN
Sbjct  58   ANVLGLIKAKVGV-PPTEPCCPLLEGLVDLEAALCLCTAIKGNILGINLNLPIDLSLILN  116

Query  287  VCGKKVPSGFQC  252
             CGK VP+GF+C
Sbjct  117  HCGKSVPTGFKC  128



>ref|XP_006396753.1| hypothetical protein EUTSA_v10029038mg [Eutrema salsugineum]
 gb|ESQ38206.1| hypothetical protein EUTSA_v10029038mg [Eutrema salsugineum]
Length=153

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 95/152 (63%), Gaps = 20/152 (13%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSA--CG------------------TCpspkpkpkpkp  528
            M+SK ++ LALF   NILF T+ +A  CG                              P
Sbjct  1    MSSKNSASLALFFALNILFFTLTTATDCGCNPSPKPKPSPSPMPKPPKHVPSPNPMPVPP  60

Query  527  tpspsnkgKCPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAI  348
              +P +   CP D LKLGVCANVL  LL + +G P  + CCSL++GLVDLEAAVCLCTA+
Sbjct  61   PSTPGSSENCPIDVLKLGVCANVLSGLLNIQLGQPSTQECCSLVQGLVDLEAAVCLCTAL  120

Query  347  KANILGInlnvplslslllnVCGKKVPSGFQC  252
            +AN+LGINLNVP+SLS+LLN C KKVPSGF+C
Sbjct  121  RANVLGINLNVPISLSVLLNKCNKKVPSGFEC  152



>ref|XP_009411010.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=137

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLG CANVL  L+   VG PPK+PCCSLI+GLVDLEAAVCLCTAIKAN+LGI+L
Sbjct  54   CPVDALKLGGCANVLDGLIHAKVGEPPKEPCCSLIDGLVDLEAAVCLCTAIKANVLGIHL  113

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLLLN CGK+ P+GF+C
Sbjct  114  NLPINLSLLLNYCGKQSPTGFKC  136



>gb|KFK43474.1| hypothetical protein AALP_AA1G129700 [Arabis alpina]
Length=140

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 99/140 (71%), Gaps = 8/140 (6%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCp--------spkpkpkpkptpspsnkgKCPK  492
            MAS+ TS +ALF+  N+LF T +SACG+C                        + GKCPK
Sbjct  1    MASRTTSSIALFLALNLLFFTTISACGSCTPCGGGCPSPKPKLTPTPKPTPSPSSGKCPK  60

Query  491  DALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvp  312
            D LKLGVCANVL  LL L +G PP +PCCSLI+GL D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  61   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  120

Query  311  lslslllnVCGKKVPSGFQC  252
            +SLSLLLNVC KKVPS FQC
Sbjct  121  ISLSLLLNVCSKKVPSDFQC  140



>ref|XP_009598876.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Nicotiana 
tomentosiformis]
Length=93

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPK+ LKLGVCANVLGNLLGL +GN PKKPCC+LI+GL D+EAA+CLCTAIKAN+LGINL
Sbjct  10   CPKNTLKLGVCANVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLGINL  69

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            NVPLSLSLLLNVCGKKVPSGF CP
Sbjct  70   NVPLSLSLLLNVCGKKVPSGFICP  93



>gb|ADA67933.1| putative 14 kDa proline-rich protein DC2.15 [Wolffia arrhiza]
Length=135

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACG-TCpspkpkpkpkptpspsnkgKCPKDALKLGV  471
            MA+K  +  ALF++ N+LF ++V+A      +PKP P P P P+P   GKCP D LKLGV
Sbjct  1    MAAKTGTSAALFVLLNVLFFSLVTATYCPPDTPKPTPIPTPKPTPKPTGKCPVDTLKLGV  60

Query  470  CAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILG-Inlnvplslsll  294
            CAN+L  L+ + +G PPK PCC+LI+GL DLEAA+CLCT +KAN+LG I+LN+P++LSLL
Sbjct  61   CANLLNGLINIQLGTPPKTPCCNLIKGLADLEAALCLCTVLKANVLGLISLNLPINLSLL  120

Query  293  lnVCGKKVPSGFQCP  249
            +N CGK VP+GF CP
Sbjct  121  VNYCGKSVPTGFICP  135



>ref|XP_010533776.1| PREDICTED: lipid transfer protein EARLI 1 [Tarenaya hassleriana]
Length=139

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLGVCANVL  LL L +G PP  PCCSLI+GL D+EAAVCLCTA+KANILGINL
Sbjct  56   CPKDTLKLGVCANVLNGLLNLQLGQPPVTPCCSLIQGLADVEAAVCLCTALKANILGINL  115

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLLLNVC KKVPSGFQC
Sbjct  116  NLPISLSLLLNVCSKKVPSGFQC  138



>ref|XP_009382414.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCANVLG LL + +G PPK+PCC+L++GLVDLEAAVCLCTA+K N+LG+ L
Sbjct  62   CPRDALKLGVCANVLGGLLNITLGTPPKEPCCTLLQGLVDLEAAVCLCTALKGNVLGLVL  121

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLLLN CGK+VP+GF C
Sbjct  122  NLPISLSLLLNYCGKEVPTGFLC  144



>gb|EMS52512.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=142

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 86/140 (61%), Gaps = 9/140 (6%)
 Frame = -1

Query  641  SKKTSVLALFIVFNILFCTMVSACG---------TCpspkpkpkpkptpspsnkgKCPKD  489
            + K +V+A  +  N+LF T+   CG                             G CP D
Sbjct  2    ATKAAVIATLLALNLLFFTLADDCGCKLPSPPPPGGGGGGGGGGGGGKGGGGGTGGCPID  61

Query  488  ALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvpl  309
            ALKLG CANVLG L+ L     PK+ CCSL++GL DL+AAVCLCTA+KANILGI+LNVP+
Sbjct  62   ALKLGACANVLGGLINLRPVTTPKQTCCSLLQGLADLDAAVCLCTALKANILGIHLNVPV  121

Query  308  slslllnVCGKKVPSGFQCP  249
             LSLL+N CGK VPSGFQCP
Sbjct  122  DLSLLVNYCGKNVPSGFQCP  141



>ref|NP_176440.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAD43608.1|AC005698_7 T3P18.7 [Arabidopsis thaliana]
 gb|AAQ65111.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD95067.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD93991.1| similar to 14KD proline-rich protein DC2.15 precursor [Arabidopsis 
thaliana]
 dbj|BAD94286.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAF01655.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 dbj|BAF02193.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 gb|AEE33973.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=149

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+KANILGINL
Sbjct  67   CPRDALKLGVCANVLNGLLNVTLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINL  126

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+PLSLSLLLNVC KKVP GFQC
Sbjct  127  NIPLSLSLLLNVCSKKVPRGFQC  149



>ref|XP_009134277.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
 emb|CDX90838.1| BnaA03g25180D [Brassica napus]
Length=113

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 86/132 (65%), Gaps = 20/132 (15%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MAS+ +  LALF+  N+LF T  SA  TC +                  CP+D+L+LGVC
Sbjct  1    MASRTS--LALFLAVNLLFFTYTSA--TCYNTGS---------------CPRDSLQLGVC  41

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVL  +   +   PP KPCCSLI GL DLEAAVCLCT +KANILGI LN+P++LS+LLN
Sbjct  42   ANVLKLVDLTLGN-PPVKPCCSLIAGLADLEAAVCLCTVLKANILGIKLNLPINLSVLLN  100

Query  287  VCGKKVPSGFQC  252
            VC +K P  FQC
Sbjct  101  VCSRKAPKNFQC  112



>ref|XP_004298648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 1/83 (1%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LKLG CA+VL  L+ LVVG PPK PCCSLI+GLVDL+AAVCLCTAIKAN+LGINL
Sbjct  56   CPKDTLKLGACADVLNGLVHLVVG-PPKFPCCSLIQGLVDLDAAVCLCTAIKANVLGINL  114

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLSLLLN CGKKVPSG++C
Sbjct  115  NVPVSLSLLLNYCGKKVPSGYEC  137



>ref|XP_004976454.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=127

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 98/132 (74%), Gaps = 6/132 (5%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVC  468
            MA K +  +ALF+  N++   + SA G    P P P   PTP+P++ G+CP+DALKLGVC
Sbjct  1    MAGKAS--IALFLAVNLVVLAVASAGGV---PCPPPPSTPTPTPASFGRCPRDALKLGVC  55

Query  467  AnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslsllln  288
            ANVLG +   V   PP +PCC L+EGLVDLEAAVCLCTAIK NILGINLN+P+ +SL+LN
Sbjct  56   ANVLGLIKAKVGV-PPTEPCCPLLEGLVDLEAAVCLCTAIKGNILGINLNLPIDVSLILN  114

Query  287  VCGKKVPSGFQC  252
             CGK VP+GF+C
Sbjct  115  HCGKTVPTGFKC  126



>ref|XP_010919518.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=128

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP + LKLGVCA+VL  L+  +   PPKKPCC+L+EGLVDLEAAVCLCTA+KANILGI L
Sbjct  46   CPMNTLKLGVCADVLKALVVKIGK-PPKKPCCTLLEGLVDLEAAVCLCTALKANILGIKL  104

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P+ LSLLLN CGKK P GFQCP
Sbjct  105  NIPIDLSLLLNYCGKKAPKGFQCP  128



>ref|XP_004986077.1| PREDICTED: putative glycine-rich cell wall structural protein 
1-like [Setaria italica]
Length=203

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCANVL  L+ + +G PP+ PCC+LI+GL DLEAAVCLCTA++AN+LGI +
Sbjct  120  CPIDALKLGVCANVLQGLINVTLGTPPRTPCCTLIQGLADLEAAVCLCTALRANVLGITI  179

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG++VP+GFQC
Sbjct  180  NLPINLSLLVNYCGRRVPNGFQC  202



>ref|XP_010448889.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVC N L  L  + +G PP  PCCSLI+GLVDLEAAVCLCTA+KA++LGINL
Sbjct  53   CPKDALKLGVCVNALNLLNDVTLGTPPVTPCCSLIQGLVDLEAAVCLCTALKASVLGINL  112

Query  320  nvplslslllnVCGKKVPSGFQCP  249
            N+P++LSLLLNVC +K P GFQCP
Sbjct  113  NLPINLSLLLNVCSRKAPRGFQCP  136



>ref|XP_010476166.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 98/142 (69%), Gaps = 10/142 (7%)
 Frame = -1

Query  647  MASKKTSVLALFIVFNILFCTMVSACGTCp----------spkpkpkpkptpspsnkgKC  498
            MAS+ TS +ALF+  N+L  T +SACG+C                         S   KC
Sbjct  1    MASRTTSSIALFLALNLLLFTTISACGSCTPCGGGCPSPKPKPTPKPKPTPSPSSGSKKC  60

Query  497  PKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInln  318
            PKD LKLGVCANVL  LL L +G PP +PCCSLI+GL +LEAAVCLCTA+KAN+LGINLN
Sbjct  61   PKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGINLN  120

Query  317  vplslslllnVCGKKVPSGFQC  252
            +P+SLSLLLNVC K++PSGFQC
Sbjct  121  LPISLSLLLNVCSKQLPSGFQC  142



>ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=152

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP+DALKLGVCAN+LG   G+VVGNPP  PCCSL+ GLVDLEAAVCLCTAIKAN+LGINL
Sbjct  69   CPRDALKLGVCANLLGRAAGVVVGNPPTTPCCSLLAGLVDLEAAVCLCTAIKANVLGINL  128

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLLLN CG+  P+GF C
Sbjct  129  NIPVSLSLLLNACGRTPPTGFTC  151



>ref|NP_199500.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAB10228.1| extensin-like protein [Arabidopsis thaliana]
 dbj|BAC42204.1| putative extensin [Arabidopsis thaliana]
 gb|AAO63846.1| putative extensin [Arabidopsis thaliana]
 gb|AED95444.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=127

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -1

Query  629  SVLALFIVFNILFCTMVSACGTCpspkpkpkpkptpspsnkgKCPKDALKLGVCAnvlgn  450
            S +AL +VFN++F T VS+      P P       P+  +     KDALKL VCANVL  
Sbjct  4    SKVALLLVFNVIFFTFVSSTSVPCPPPPPKSYHKKPATPSLKPTCKDALKLKVCANVLDV  63

Query  449  llglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInlnvplslslllnVCGKKV  270
            +   +   PP   CC+LI+GLVDLEAAVCLCTA+KAN+LGINLNVP+SL+++LN CGKKV
Sbjct  64   VKVSL---PPTSNCCALIKGLVDLEAAVCLCTALKANVLGINLNVPISLNVVLNHCGKKV  120

Query  269  PSGFQC  252
            PSGF+C
Sbjct  121  PSGFKC  126



>ref|XP_010430305.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+KANILGINL
Sbjct  67   CPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINL  126

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLLLNVC KKVP GFQC
Sbjct  127  NIPISLSLLLNVCSKKVPPGFQC  149



>ref|XP_002874775.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51034.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
Length=168

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCANVL +LL + +G P  +PCCSLI+GLVDL+AA+CLCTA++AN+LGINL
Sbjct  85   CPIDALKLGVCANVLSSLLNIQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLGINL  144

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLS+LLNVC +KVPSGFQC
Sbjct  145  NVPISLSVLLNVCNRKVPSGFQC  167



>ref|XP_010473467.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+KANILGINL
Sbjct  75   CPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINL  134

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLLLNVC KKVP GFQC
Sbjct  135  NIPISLSLLLNVCSKKVPPGFQC  157



>ref|XP_010418243.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKDALKLGVCANVL  LL + +G PP +PCC+LI+GL DLEAA CLCTA+KANILGINL
Sbjct  75   CPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINL  134

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLLLNVC KKVP GFQC
Sbjct  135  NIPISLSLLLNVCSKKVPPGFQC  157



>tpg|DAA42812.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=189

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DALKLGVCAN+L  L+   +G PP+ PCC+LI+GL DLEAAVCLCT ++AN+LGINL
Sbjct  106  CPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINL  165

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P++LSLL+N CG++VPSGFQC
Sbjct  166  NLPINLSLLVNYCGRRVPSGFQC  188



>ref|XP_010088890.1| hypothetical protein L484_020878 [Morus notabilis]
 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis]
Length=135

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CPKD LK GVCA++L  L  ++VG PP  PCCSL++GL D+EAAVCLCTAIKAN+LGINL
Sbjct  52   CPKDTLKFGVCADLLNGLEHVIVGTPPVTPCCSLLKGLADVEAAVCLCTAIKANVLGINL  111

Query  320  nvplslslllnVCGKKVPSGFQC  252
            N+P+SLSLLLN CGKK P GFQC
Sbjct  112  NIPVSLSLLLNYCGKKAPKGFQC  134



>ref|NP_192985.1| putative lipid transfer protein [Arabidopsis thaliana]
 sp|Q39176.1|ERLI1_ARATH RecName: Full=Lipid transfer protein EARLI 1; AltName: Full=Protein 
EARLY ARABIDOPSIS ALUMINUM INDUCED 1; Short=pEARLI1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL06564.1|AF412111_1 AT4g12480/T1P17_70 [Arabidopsis thaliana]
 gb|AAC37471.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB41718.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB78291.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AAM91484.1| AT4g12480/T1P17_70 [Arabidopsis thaliana]
 dbj|BAF02055.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AEE83138.1| putative lipid transfer protein [Arabidopsis thaliana]
Length=168

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  500  CPKDALKLGVCAnvlgnllglvvgNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGInl  321
            CP DAL+LGVCANVL +LL + +G P  +PCCSLI+GLVDL+AA+CLCTA++AN+LGINL
Sbjct  85   CPIDALRLGVCANVLSSLLNIQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLGINL  144

Query  320  nvplslslllnVCGKKVPSGFQC  252
            NVP+SLS+LLNVC +KVPSGFQC
Sbjct  145  NVPISLSVLLNVCNRKVPSGFQC  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1235160523400