BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7771_g1_i2 len=1290 path=[1268:0-796 2065:797-965 2234:966-1289]

Length=1290
                                                                      Score     E

ref|XP_009772681.1|  PREDICTED: uncharacterized protein LOC104223027    256   2e-79   
ref|XP_009598312.1|  PREDICTED: uncharacterized protein LOC104094146    256   2e-79   
ref|XP_009758374.1|  PREDICTED: uncharacterized protein LOC104211072    238   2e-72   
ref|XP_009598310.1|  PREDICTED: uncharacterized protein LOC104094144    238   3e-72   
ref|XP_006360774.1|  PREDICTED: uncharacterized protein LOC102601440    222   1e-66   
ref|XP_002315763.1|  GCN5-related N-acetyltransferase family protein    221   4e-66   Populus trichocarpa [western balsam poplar]
ref|XP_004247573.1|  PREDICTED: uncharacterized protein LOC101247659    217   1e-64   
gb|EYU41469.1|  hypothetical protein MIMGU_mgv11b016407mg               214   1e-63   
ref|XP_011030672.1|  PREDICTED: uncharacterized protein YIR042C-like    212   9e-63   
ref|XP_006489421.1|  PREDICTED: uncharacterized protein LOC102614108    210   4e-62   
ref|XP_006419971.1|  hypothetical protein CICLE_v10005998mg             210   7e-62   
ref|XP_006360773.1|  PREDICTED: uncharacterized protein LOC102601098    209   3e-61   
ref|XP_006419970.1|  hypothetical protein CICLE_v10005999mg             207   5e-61   
ref|XP_006489417.1|  PREDICTED: uncharacterized protein LOC102612612    207   7e-61   
ref|XP_006360811.1|  PREDICTED: uncharacterized protein LOC102585769    208   2e-60   
ref|XP_006419968.1|  hypothetical protein CICLE_v10005971mg             206   2e-60   
ref|XP_003631992.1|  PREDICTED: uncharacterized protein YIR042C         205   5e-60   
ref|XP_004247574.1|  PREDICTED: uncharacterized protein LOC101247959    205   8e-60   
gb|KDP40198.1|  hypothetical protein JCGZ_02196                         204   1e-59   
ref|XP_002282836.1|  PREDICTED: uncharacterized protein YIR042C         203   2e-59   Vitis vinifera
ref|XP_010096155.1|  putative N-acetyltransferase p20                   202   9e-59   
ref|XP_009335319.1|  PREDICTED: uncharacterized protein YIR042C-like    202   9e-59   
ref|XP_008224290.1|  PREDICTED: uncharacterized protein LOC103324032    202   1e-58   
ref|XP_006489419.1|  PREDICTED: uncharacterized protein LOC102613222    201   1e-58   
ref|XP_009345874.1|  PREDICTED: uncharacterized protein YIR042C-like    198   2e-57   
ref|XP_009791424.1|  PREDICTED: uncharacterized protein LOC104238686    198   3e-57   
ref|XP_009369862.1|  PREDICTED: uncharacterized protein YIR042C-like    198   3e-57   
ref|XP_010256100.1|  PREDICTED: uncharacterized protein LOC104596...    198   3e-57   
ref|XP_002517113.1|  N-acetyltransferase, putative                      197   3e-57   Ricinus communis
ref|XP_010256101.1|  PREDICTED: uncharacterized protein LOC104596...    197   4e-57   
ref|XP_007223417.1|  hypothetical protein PRUPE_ppa011306mg             197   1e-56   
ref|XP_007034798.1|  Acyl-CoA N-acyltransferases superfamily prot...    196   2e-56   
ref|XP_011090703.1|  PREDICTED: uncharacterized protein LOC105171328    196   2e-56   
ref|XP_009799208.1|  PREDICTED: uncharacterized protein LOC104245314    195   2e-56   
ref|XP_004298274.1|  PREDICTED: uncharacterized N-acetyltransfera...    195   5e-56   
ref|XP_006450888.1|  hypothetical protein CICLE_v10009635mg             194   7e-56   
ref|XP_004247668.2|  PREDICTED: uncharacterized protein LOC101251328    196   3e-55   
ref|XP_008224289.1|  PREDICTED: uncharacterized protein YIR042C-like    192   5e-55   
ref|XP_004299034.1|  PREDICTED: uncharacterized N-acetyltransfera...    191   1e-54   
emb|CDO99079.1|  unnamed protein product                                191   2e-54   
ref|XP_004241046.1|  PREDICTED: uncharacterized protein LOC101259756    189   1e-53   
ref|XP_009602118.1|  PREDICTED: uncharacterized protein LOC104097...    186   5e-53   
ref|XP_010906188.1|  PREDICTED: uncharacterized protein LOC105033200    186   6e-53   
gb|EYU41471.1|  hypothetical protein MIMGU_mgv1a020258mg                183   7e-52   
ref|XP_008438654.1|  PREDICTED: uncharacterized protein LOC103483697    183   1e-51   
ref|XP_010326726.1|  PREDICTED: uncharacterized protein LOC101251034    186   2e-51   
ref|XP_009408784.1|  PREDICTED: uncharacterized protein LOC103991148    182   7e-51   
ref|XP_010096156.1|  putative N-acetyltransferase YoaA                  180   2e-50   
ref|XP_006360813.1|  PREDICTED: uncharacterized protein LOC102586435    179   4e-50   
ref|XP_009141208.1|  PREDICTED: uncharacterized protein LOC103865178    179   5e-50   
ref|XP_010259083.1|  PREDICTED: uncharacterized protein LOC104598621    179   6e-50   
ref|XP_004134133.1|  PREDICTED: uncharacterized N-acetyltransfera...    178   7e-50   
ref|XP_008804728.1|  PREDICTED: uncharacterized protein LOC103717925    178   9e-50   
emb|CDY15350.1|  BnaC04g42730D                                          177   1e-49   
ref|XP_010542784.1|  PREDICTED: uncharacterized protein LOC104815883    177   5e-49   
ref|XP_006410340.1|  hypothetical protein EUTSA_v10017278mg             176   1e-48   
ref|XP_002881212.1|  hypothetical protein ARALYDRAFT_902252             175   1e-48   
ref|XP_009602115.1|  PREDICTED: uncharacterized protein LOC104097...    174   1e-48   
ref|XP_010259080.1|  PREDICTED: uncharacterized protein LOC104598618    175   2e-48   
ref|XP_008777144.1|  PREDICTED: uncharacterized protein LOC103697125    174   2e-48   
ref|XP_010259077.1|  PREDICTED: uncharacterized protein LOC104598617    174   2e-48   
ref|XP_006433080.1|  hypothetical protein CICLE_v10002694mg             174   3e-48   
ref|XP_008804727.1|  PREDICTED: uncharacterized protein LOC103717924    174   3e-48   
ref|XP_006360812.1|  PREDICTED: uncharacterized protein LOC102586105    174   4e-48   
ref|NP_180763.1|  Acyl-CoA N-acyltransferases (NAT) superfamily p...    174   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KDO80196.1|  hypothetical protein CISIN_1g043366mg                   172   4e-48   
ref|XP_008224291.1|  PREDICTED: uncharacterized protein LOC103324033    172   1e-47   
ref|XP_010916800.1|  PREDICTED: uncharacterized protein LOC105041549    174   2e-47   
ref|XP_010414037.1|  PREDICTED: uncharacterized protein LOC104700253    172   2e-47   
gb|AFK39517.1|  unknown                                                 171   4e-47   
ref|XP_010256364.1|  PREDICTED: uncharacterized protein LOC104596777    171   5e-47   
ref|XP_009144033.1|  PREDICTED: uncharacterized protein LOC103867686    171   6e-47   
ref|XP_009141207.1|  PREDICTED: uncharacterized protein LOC103865176    171   7e-47   
ref|XP_010510107.1|  PREDICTED: uncharacterized protein LOC104786393    170   8e-47   
ref|XP_010024259.1|  PREDICTED: uncharacterized protein LOC104414784    170   1e-46   
emb|CDY42093.1|  BnaA05g10930D                                          169   2e-46   
ref|XP_006295070.1|  hypothetical protein CARUB_v10024139mg             169   2e-46   
gb|AFK47627.1|  unknown                                                 169   2e-46   
ref|XP_010469638.1|  PREDICTED: uncharacterized protein LOC104749662    169   3e-46   
ref|XP_010256098.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    169   4e-46   
emb|CDY71229.1|  BnaA05g34970D                                          168   5e-46   
emb|CDY15351.1|  BnaC04g42720D                                          168   6e-46   
ref|XP_010026944.1|  PREDICTED: uncharacterized protein LOC104417346    167   1e-45   
ref|XP_010326725.1|  PREDICTED: uncharacterized protein LOC104649389    167   1e-45   
ref|XP_010096154.1|  putative N-acetyltransferase p20                   166   2e-45   
ref|XP_009398545.1|  PREDICTED: uncharacterized protein LOC103983102    167   2e-45   
ref|XP_004135660.1|  PREDICTED: uncharacterized N-acetyltransfera...    166   3e-45   
ref|XP_011026785.1|  PREDICTED: uncharacterized protein LOC105127253    165   4e-45   
gb|KEH43818.1|  acetyltransferase (GNAT) domain protein                 165   7e-45   
ref|XP_008218221.1|  PREDICTED: uncharacterized protein LOC103318600    164   8e-45   
ref|NP_180762.1|  Acyl-CoA N-acyltransferases (NAT) superfamily p...    165   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006379840.1|  GCN5-related N-acetyltransferase family protein    164   9e-45   
ref|XP_006379839.1|  hypothetical protein POPTR_0008s15450g             164   2e-44   
ref|XP_010259199.1|  PREDICTED: uncharacterized protein LOC104598717    164   2e-44   
emb|CDY42090.1|  BnaA05g10960D                                          164   2e-44   
ref|NP_001150788.1|  N-acetyltransferase                                164   2e-44   Zea mays [maize]
ref|XP_008345703.1|  PREDICTED: uncharacterized protein LOC103408647    163   2e-44   
ref|XP_011089101.1|  PREDICTED: uncharacterized protein LOC105170156    163   3e-44   
gb|KDP40197.1|  hypothetical protein JCGZ_02195                         163   3e-44   
ref|XP_003610737.1|  N-acetyltransferase, putative                      164   3e-44   
ref|XP_010906187.1|  PREDICTED: uncharacterized protein LOC105033199    164   3e-44   
ref|XP_002278864.1|  PREDICTED: uncharacterized protein LOC100261442    163   3e-44   Vitis vinifera
gb|AFK44871.1|  unknown                                                 163   3e-44   
gb|AAM63289.1|  putative alanine acetyl transferase                     163   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881211.1|  hypothetical protein ARALYDRAFT_902251             163   4e-44   
ref|XP_004494667.1|  PREDICTED: uncharacterized N-acetyltransfera...    163   4e-44   
ref|XP_006419967.1|  hypothetical protein CICLE_v10006418mg             162   5e-44   
ref|XP_006489416.1|  PREDICTED: uncharacterized protein LOC102612310    162   5e-44   
gb|KEH43819.1|  acetyltransferase (GNAT) domain protein                 163   5e-44   
ref|NP_001236452.1|  uncharacterized protein LOC100527210               162   5e-44   
ref|XP_004511370.1|  PREDICTED: uncharacterized N-acetyltransfera...    163   7e-44   
ref|XP_010510108.1|  PREDICTED: uncharacterized protein LOC104786395    162   1e-43   
ref|XP_003626377.1|  N-acetyltransferase, putative                      165   1e-43   
ref|XP_010025070.1|  PREDICTED: uncharacterized protein LOC104415471    162   1e-43   
gb|AES82595.2|  acetyltransferase (GNAT) domain protein                 161   1e-43   
ref|XP_011026764.1|  PREDICTED: uncharacterized protein LOC105127...    162   1e-43   
ref|XP_004981459.1|  PREDICTED: uncharacterized protein LOC101779450    162   2e-43   
ref|XP_007204930.1|  hypothetical protein PRUPE_ppa020574mg             161   2e-43   
ref|XP_006410339.1|  hypothetical protein EUTSA_v10017288mg             161   2e-43   
ref|NP_001237364.1|  uncharacterized protein LOC100500394               161   3e-43   
ref|XP_010024260.1|  PREDICTED: uncharacterized protein LOC104414787    160   3e-43   
ref|XP_006408131.1|  hypothetical protein EUTSA_v10021594mg             160   4e-43   
ref|XP_009772680.1|  PREDICTED: uncharacterized protein LOC104223026    160   4e-43   
emb|CDY12238.1|  BnaC04g12680D                                          160   4e-43   
ref|XP_002271588.1|  PREDICTED: uncharacterized protein LOC100260509    160   5e-43   Vitis vinifera
ref|XP_007030665.1|  Acyl-CoA N-acyltransferases superfamily prot...    162   5e-43   
ref|XP_010673099.1|  PREDICTED: uncharacterized protein LOC104889554    160   6e-43   
ref|XP_010414039.1|  PREDICTED: uncharacterized protein LOC104700255    160   6e-43   
ref|XP_008390913.1|  PREDICTED: uncharacterized protein LOC103453141    159   9e-43   
emb|CAN75167.1|  hypothetical protein VITISV_008627                     163   1e-42   Vitis vinifera
ref|NP_001237983.1|  uncharacterized protein LOC100527055               159   1e-42   
ref|XP_008224292.1|  PREDICTED: uncharacterized protein LOC103324034    160   1e-42   
ref|XP_004300955.1|  PREDICTED: uncharacterized N-acetyltransfera...    159   2e-42   
ref|XP_003553748.1|  PREDICTED: uncharacterized protein LOC100776...    159   2e-42   
ref|XP_007157116.1|  hypothetical protein PHAVU_002G044100g             160   2e-42   
ref|XP_010469639.1|  PREDICTED: uncharacterized protein LOC104749663    159   2e-42   
ref|XP_003557676.1|  PREDICTED: uncharacterized protein LOC100842786    159   2e-42   
ref|XP_004511371.1|  PREDICTED: uncharacterized N-acetyltransfera...    159   2e-42   
ref|XP_008450752.1|  PREDICTED: uncharacterized protein LOC103492240    159   2e-42   
emb|CDO99080.1|  unnamed protein product                                158   3e-42   
ref|XP_010422469.1|  PREDICTED: uncharacterized protein LOC104707746    158   3e-42   
ref|XP_003610743.1|  N-acetyltransferase, putative                      171   4e-42   
gb|KHN43223.1|  Putative N-acetyltransferase YoaA                       157   4e-42   
ref|XP_002517114.1|  N-acetyltransferase, putative                      157   6e-42   Ricinus communis
ref|XP_003610739.1|  N-acetyltransferase, putative                      157   6e-42   
ref|XP_007034796.1|  Acyl-CoA N-acyltransferases (NAT) superfamil...    157   7e-42   
ref|XP_010096153.1|  putative N-acetyltransferase p20                   157   8e-42   
ref|XP_009774277.1|  PREDICTED: uncharacterized protein LOC104224348    156   9e-42   
ref|XP_009335320.1|  PREDICTED: uncharacterized protein LOC103928037    157   1e-41   
ref|XP_010024256.1|  PREDICTED: uncharacterized protein LOC104414782    157   1e-41   
gb|EYU41470.1|  hypothetical protein MIMGU_mgv1a024789mg                155   2e-41   
ref|XP_006360775.1|  PREDICTED: uncharacterized protein LOC102601771    154   7e-41   
ref|XP_006489418.1|  PREDICTED: uncharacterized protein LOC102612920    155   7e-41   
ref|XP_007224462.1|  hypothetical protein PRUPE_ppa022546mg             154   8e-41   
ref|XP_003633665.1|  PREDICTED: uncharacterized protein LOC100250390    154   8e-41   
ref|XP_009768909.1|  PREDICTED: uncharacterized protein LOC104219858    154   9e-41   
emb|CDP08589.1|  unnamed protein product                                154   1e-40   
ref|XP_004302006.1|  PREDICTED: uncharacterized N-acetyltransfera...    154   1e-40   
ref|XP_008350627.1|  PREDICTED: uncharacterized protein LOC103413983    154   1e-40   
ref|XP_009608599.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    154   1e-40   
gb|KEH34246.1|  acetyltransferase (GNAT) domain protein                 155   1e-40   
ref|XP_006296107.1|  hypothetical protein CARUB_v10025258mg             154   1e-40   
ref|XP_008350626.1|  PREDICTED: uncharacterized protein LOC103413982    154   1e-40   
ref|XP_008388638.1|  PREDICTED: uncharacterized protein LOC103450996    154   1e-40   
gb|AFK45763.1|  unknown                                                 153   1e-40   
gb|EYU32739.1|  hypothetical protein MIMGU_mgv1a019358mg                152   3e-40   
ref|XP_004981454.1|  PREDICTED: uncharacterized protein LOC101777556    152   3e-40   
ref|XP_003516755.1|  PREDICTED: uncharacterized protein LOC100809953    152   5e-40   
gb|KEH24544.1|  acetyltransferase (GNAT) domain protein                 151   8e-40   
ref|NP_001050839.1|  Os03g0664800                                       152   9e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004230137.1|  PREDICTED: uncharacterized protein LOC101248425    151   1e-39   
ref|XP_010659954.1|  PREDICTED: uncharacterized protein LOC100255...    151   1e-39   
ref|XP_008644435.1|  PREDICTED: uncharacterized protein LOC103625815    152   1e-39   
gb|KHN43224.1|  Putative N-acetyltransferase YoaA                       150   1e-39   
ref|XP_004981455.1|  PREDICTED: uncharacterized protein LOC101777978    151   1e-39   
emb|CDY15325.1|  BnaC04g42980D                                          150   2e-39   
ref|XP_003557568.1|  PREDICTED: uncharacterized protein LOC100834953    150   2e-39   
ref|XP_011090702.1|  PREDICTED: uncharacterized protein LOC105171...    150   3e-39   
ref|XP_007034797.1|  Acyl-CoA N-acyltransferases (NAT) superfamil...    154   4e-39   
gb|KHN30485.1|  Putative N-acetyltransferase p20                        149   5e-39   
ref|XP_009335338.1|  PREDICTED: uncharacterized protein LOC103928052    149   5e-39   
ref|XP_011090699.1|  PREDICTED: uncharacterized protein LOC105171...    150   5e-39   
ref|XP_004134439.1|  PREDICTED: putative ribosomal N-acetyltransf...    149   6e-39   
ref|XP_007225078.1|  hypothetical protein PRUPE_ppa017792mg             148   6e-39   
ref|XP_010659953.1|  PREDICTED: uncharacterized protein LOC100255...    149   6e-39   
ref|XP_011090701.1|  PREDICTED: uncharacterized protein LOC105171...    150   7e-39   
ref|XP_009616265.1|  PREDICTED: uncharacterized protein LOC104108842    149   8e-39   
ref|XP_003559607.1|  PREDICTED: uncharacterized protein LOC100839147    149   1e-38   
emb|CDY40688.1|  BnaC03g34040D                                          148   1e-38   
ref|XP_008665582.1|  PREDICTED: uncharacterized protein LOC103644167    149   1e-38   
gb|AFK40352.1|  unknown                                                 148   2e-38   
ref|XP_002271721.1|  PREDICTED: uncharacterized protein LOC100267445    148   2e-38   Vitis vinifera
emb|CAN75166.1|  hypothetical protein VITISV_008626                     149   2e-38   Vitis vinifera
ref|XP_010312209.1|  PREDICTED: uncharacterized protein LOC101257220    147   3e-38   
ref|XP_010485882.1|  PREDICTED: uncharacterized protein LOC104764126    147   5e-38   
ref|XP_010088118.1|  putative N-acetyltransferase YoaA                  146   6e-38   
emb|CDY10659.1|  BnaA05g17030D                                          145   1e-37   
ref|XP_010546623.1|  PREDICTED: uncharacterized protein LOC104818651    145   1e-37   
gb|ABK24907.1|  unknown                                                 145   1e-37   Picea sitchensis
ref|XP_010511497.1|  PREDICTED: uncharacterized protein LOC104787585    145   1e-37   
ref|XP_006347815.1|  PREDICTED: uncharacterized protein LOC102605071    145   2e-37   
gb|EYU32738.1|  hypothetical protein MIMGU_mgv1a022954mg                145   2e-37   
ref|XP_009616264.1|  PREDICTED: uncharacterized protein LOC104108841    145   2e-37   
ref|XP_010488292.1|  PREDICTED: uncharacterized protein LOC104766156    145   2e-37   
ref|XP_009145312.1|  PREDICTED: uncharacterized protein LOC103869025    145   2e-37   
ref|XP_002466308.1|  hypothetical protein SORBIDRAFT_01g005400          144   3e-37   Sorghum bicolor [broomcorn]
ref|XP_010463981.1|  PREDICTED: uncharacterized protein LOC104744605    144   3e-37   
ref|XP_008438655.1|  PREDICTED: uncharacterized protein LOC103483698    144   5e-37   
ref|XP_007147125.1|  hypothetical protein PHAVU_006G098000g             144   6e-37   
ref|XP_002885512.1|  hypothetical protein ARALYDRAFT_479775             143   8e-37   
ref|XP_006604834.1|  PREDICTED: uncharacterized protein LOC100776...    142   9e-37   
gb|EAY92158.1|  hypothetical protein OsI_13871                          144   9e-37   Oryza sativa Indica Group [Indian rice]
gb|EAZ28890.1|  hypothetical protein OsJ_12930                          143   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_188895.1|  GCN5-related N-acetyltransferase (GNAT) family ...    142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011026773.1|  PREDICTED: uncharacterized protein LOC105127...    142   2e-36   
ref|NP_001051537.1|  Os03g0794200                                       143   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010674903.1|  PREDICTED: uncharacterized protein LOC104890975    142   2e-36   
ref|XP_006406147.1|  hypothetical protein EUTSA_v10022340mg             142   2e-36   
ref|XP_010466541.1|  PREDICTED: uncharacterized protein LOC104746712    142   2e-36   
gb|KCW84192.1|  hypothetical protein EUGRSUZ_B01057                     141   3e-36   
gb|KFK39550.1|  hypothetical protein AALP_AA3G258600                    141   3e-36   
ref|XP_004247666.1|  PREDICTED: uncharacterized protein LOC101250737    140   7e-36   
ref|XP_003559324.1|  PREDICTED: uncharacterized protein LOC100842902    145   1e-35   
ref|XP_003610742.1|  N-acetyltransferase, putative                      139   5e-35   
ref|XP_006299352.1|  hypothetical protein CARUB_v10015517mg             137   1e-34   
dbj|BAJ92857.1|  predicted protein                                      137   2e-34   
ref|XP_003610738.1|  N-acetyltransferase, putative                      137   2e-34   
emb|CAN76024.1|  hypothetical protein VITISV_027073                     139   3e-34   Vitis vinifera
ref|NP_001050840.2|  Os03g0665000                                       136   9e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002968716.1|  hypothetical protein SELMODRAFT_90075              135   1e-33   
ref|XP_002466307.1|  hypothetical protein SORBIDRAFT_01g005390          134   2e-33   Sorghum bicolor [broomcorn]
ref|XP_002990603.1|  hypothetical protein SELMODRAFT_131939             134   3e-33   
ref|XP_006651663.1|  PREDICTED: uncharacterized protein LOC102710483    136   3e-33   
ref|XP_010417714.1|  PREDICTED: uncharacterized protein LOC104703403    132   6e-33   
ref|XP_008669755.1|  PREDICTED: uncharacterized protein LOC103646915    133   6e-33   
ref|NP_001051538.2|  Os03g0794300                                       132   1e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ABK26534.1|  unknown                                                 132   1e-32   Picea sitchensis
ref|XP_009768931.1|  PREDICTED: uncharacterized protein LOC104219852    127   8e-32   
dbj|BAJ99997.1|  predicted protein                                      129   2e-31   
ref|XP_009364603.1|  PREDICTED: uncharacterized protein LOC103954494    128   2e-31   
ref|XP_001752501.1|  predicted protein                                  127   5e-31   
ref|XP_002466702.1|  hypothetical protein SORBIDRAFT_01g012580          128   6e-31   Sorghum bicolor [broomcorn]
ref|XP_002517111.1|  N-acetyltransferase, putative                      127   7e-31   Ricinus communis
ref|XP_004982231.1|  PREDICTED: uncharacterized protein LOC101781723    128   9e-31   
ref|XP_008644621.1|  PREDICTED: uncharacterized protein LOC103626014    127   1e-30   
gb|AIB05867.1|  GNAT transcription factor                               127   1e-30   
gb|AFW68045.1|  hypothetical protein ZEAMMB73_370881                    126   2e-30   
gb|AFK47955.1|  unknown                                                 125   3e-30   
tpg|DAA58807.1|  TPA: hypothetical protein ZEAMMB73_892973              125   6e-30   
gb|EMT23819.1|  Putative N-acetyltransferase yoaA                       124   1e-29   
ref|XP_004982232.1|  PREDICTED: uncharacterized protein LOC101782119    124   1e-29   
ref|XP_010243606.1|  PREDICTED: uncharacterized protein LOC104587619    121   2e-29   
emb|CDZ81244.1|  Spermidine N(1)-acetyltransferase                      123   2e-29   
emb|CDZ80249.1|  ribosomal-protein-S5-alanine N-acetyltransferase       122   3e-29   
ref|XP_002517112.1|  conserved hypothetical protein                     124   3e-29   Ricinus communis
ref|XP_008675436.1|  PREDICTED: uncharacterized protein LOC103651557    124   4e-29   
ref|XP_006651902.1|  PREDICTED: uncharacterized protein LOC102718258    121   4e-29   
ref|XP_008665583.1|  PREDICTED: uncharacterized protein LOC103644168    122   4e-29   
ref|XP_010466542.1|  PREDICTED: uncharacterized protein LOC104746713    120   1e-28   
ref|XP_003621899.1|  Acetyltransferase                                  125   1e-28   
ref|XP_003551826.1|  PREDICTED: uncharacterized protein LOC100802886    119   3e-28   
gb|KHN13901.1|  Putative ribosomal-protein-alanine acetyltransferase    119   3e-28   
gb|AAR88610.1|  hypothetical protein                                    120   7e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AES78117.2|  acetyltransferase (GNAT) domain protein                 117   2e-27   
ref|XP_009774267.1|  PREDICTED: uncharacterized protein LOC104224338    117   3e-27   
ref|XP_002466703.1|  hypothetical protein SORBIDRAFT_01g012590          116   1e-26   Sorghum bicolor [broomcorn]
gb|EAY92160.1|  hypothetical protein OsI_13873                          115   1e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001051539.1|  Os03g0794400                                       114   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009793148.1|  PREDICTED: uncharacterized protein LOC104240057    112   8e-26   
ref|XP_001759526.1|  predicted protein                                  112   2e-25   
ref|XP_002884478.1|  hypothetical protein ARALYDRAFT_317360             111   2e-25   
ref|XP_010906224.1|  PREDICTED: uncharacterized protein LOC105033218    111   3e-25   
ref|XP_003621901.1|  N-acetyltransferase, putative                      110   7e-25   
ref|XP_008390977.1|  PREDICTED: uncharacterized protein LOC103453207    107   1e-24   
ref|XP_006346703.1|  PREDICTED: uncharacterized protein LOC102602591    109   1e-24   
ref|XP_006433081.1|  hypothetical protein CICLE_v10003433mg             107   1e-24   
emb|CBI26278.3|  unnamed protein product                                106   3e-24   
ref|NP_001235559.1|  uncharacterized protein LOC100526889               107   9e-24   
ref|XP_004292502.1|  PREDICTED: putative ribosomal-protein-alanin...    104   2e-23   
ref|XP_010096157.1|  hypothetical protein L484_005436                   102   1e-22   
ref|XP_006365720.1|  PREDICTED: uncharacterized protein LOC102593455    101   1e-21   
ref|XP_008669540.1|  PREDICTED: uncharacterized protein LOC103646608    100   3e-21   
gb|EAZ28891.1|  hypothetical protein OsJ_12931                        99.8    3e-21   
ref|XP_002517115.1|  N-acetyltransferase, putative                    94.7    6e-20   
ref|WP_008300087.1|  Putative ribosomal N-acetyltransferase YdaF      96.3    1e-19   
ref|WP_006836916.1|  alanine acetyltransferase                        95.9    1e-19   
gb|KHN15737.1|  Putative ribosomal-protein-alanine acetyltransferase  93.2    2e-19   
ref|XP_006606906.1|  PREDICTED: uncharacterized protein LOC102668718  93.6    4e-19   
emb|CEG32046.1|  ribosomal-protein-alanine N-acetyltransferase        93.6    9e-19   
ref|WP_028542977.1|  acetyltransferase                                93.6    1e-18   
ref|WP_012370336.1|  GCN5 family N-acetyltransferase                  93.6    1e-18   
ref|WP_017426615.1|  MULTISPECIES: GNAT family acetyltraansferase     93.2    1e-18   
ref|WP_013370053.1|  GNAT family acetyltraansferase                   92.8    2e-18   
ref|WP_025724271.1|  acetyltransferase                                92.8    2e-18   
ref|WP_025676347.1|  acetyltransferase                                92.4    2e-18   
ref|WP_018671087.1|  GNAT family acetyltraansferase                   92.4    2e-18   
ref|WP_040101811.1|  acetyltransferase                                92.0    3e-18   
ref|WP_029419458.1|  GNAT family acetyltransferase                    92.0    3e-18   
ref|WP_026587396.1|  alanine acetyltransferase                        91.7    4e-18   
ref|WP_029594882.1|  alanine acetyltransferase                        91.7    4e-18   
ref|WP_013056334.1|  alanine acetyltransferase                        91.7    5e-18   
ref|WP_034313028.1|  alanine acetyltransferase                        91.7    5e-18   
ref|WP_035422697.1|  GNAT family acetyltransferase                    91.3    6e-18   
ref|WP_040058060.1|  alanine acetyltransferase                        91.3    6e-18   
ref|WP_033543040.1|  alanine acetyltransferase                        90.9    8e-18   
ref|WP_034653182.1|  alanine acetyltransferase                        90.9    9e-18   
ref|WP_019393466.1|  hypothetical protein                             90.5    1e-17   
ref|WP_026828409.1|  GCN5 family acetyltransferase                    90.9    1e-17   
ref|WP_029324284.1|  alanine acetyltransferase                        90.5    1e-17   
ref|WP_016763626.1|  alanine acetyltransferase                        90.5    1e-17   
ref|WP_034095002.1|  acetyltransferase                                90.1    1e-17   
ref|WP_003344940.1|  GNAT family acetyltraansferase                   90.1    1e-17   
ref|WP_016820600.1|  acetyltransferase                                90.1    1e-17   
ref|WP_025749219.1|  alanine acetyltransferase                        90.1    2e-17   
ref|WP_021066400.1|  hypothetical protein                             89.7    2e-17   
ref|WP_025364380.1|  acetyltransferase                                90.1    2e-17   
ref|WP_003512354.1|  GCN5 family N-acetyltransferase                  90.1    2e-17   
gb|AIG26377.1|  putative ribosomal N-acetyltransferase YdaF           89.7    2e-17   
ref|WP_026833039.1|  GCN5 family acetyltransferase                    90.1    2e-17   
ref|WP_039269712.1|  acetyltransferase                                89.7    2e-17   
ref|WP_025907987.1|  alanine acetyltransferase                        89.7    2e-17   
ref|WP_014970341.1|  GCN5 family N-acetyltransferase                  90.1    2e-17   
ref|WP_028106335.1|  GCN5 family acetyltransferase                    90.1    2e-17   
ref|WP_038986395.1|  acetyltransferase                                89.4    2e-17   
ref|WP_011025788.1|  GCN5 family N-acetyltransferase                  89.4    3e-17   
ref|WP_031414729.1|  acetyltransferase                                89.4    3e-17   
emb|CEG32816.1|  GNAT family acetyltransferase                        89.0    3e-17   
ref|WP_022588763.1|  GCN5 family N-acetyltransferase                  89.0    4e-17   
ref|WP_028409941.1|  alanine acetyltransferase                        89.4    4e-17   
ref|WP_025721628.1|  acetyltransferase                                89.0    4e-17   
ref|WP_015359621.1|  acetyltransferase, GNAT family [                 89.0    4e-17   
ref|WP_006640059.1|  N-acyltransferase YnaD                           88.6    4e-17   
ref|WP_036153690.1|  GCN5 family acetyltransferase                    88.6    4e-17   
ref|WP_013496139.1|  GCN5 family acetyltransferase                    89.7    4e-17   
ref|WP_029333511.1|  alanine acetyltransferase                        88.6    6e-17   
ref|WP_026831308.1|  GCN5 family acetyltransferase                    89.0    6e-17   
ref|WP_009610066.1|  GCN5 family N-acetyltransferase                  88.6    6e-17   
ref|WP_003323067.1|  alanine acetyltransferase                        88.6    6e-17   
ref|WP_041074415.1|  alanine acetyltransferase                        88.6    6e-17   
ref|WP_016204685.1|  ribosomal-protein-alanine N-acetyltransferase    88.2    7e-17   
ref|WP_041054092.1|  alanine acetyltransferase                        88.2    7e-17   
ref|XP_003559316.1|  PREDICTED: uncharacterized protein LOC100839557  89.0    7e-17   
ref|WP_033578536.1|  MULTISPECIES: alanine acetyltransferase          88.2    8e-17   
ref|WP_004401199.1|  Acetyltransferase                                87.8    9e-17   
ref|WP_003869578.1|  GCN5 family N-acetyltransferase                  87.8    9e-17   
ref|WP_033391627.1|  GCN5 family acetyltransferase                    87.8    9e-17   
ref|WP_002204086.1|  alanine acetyltransferase                        87.8    1e-16   
ref|WP_019686629.1|  acetyltransferase                                87.8    1e-16   
ref|WP_026690438.1|  alanine acetyltransferase                        87.8    1e-16   
ref|WP_034307034.1|  GCN5 family acetyltransferase                    87.8    1e-16   
ref|WP_031534676.1|  alanine acetyltransferase                        87.8    1e-16   
ref|WP_029516449.1|  acetyltransferase                                87.8    1e-16   
gb|AIS52617.1|  N-acetyltransferase p20                               87.4    1e-16   
ref|WP_040826842.1|  GCN5 family acetyltransferase                    87.4    1e-16   
emb|CEG21272.1|  Putative ribosomal N-acetyltransferase YdaF          87.4    1e-16   
ref|WP_005831185.1|  MULTISPECIES: GNAT family acetyltransferase      87.4    1e-16   
ref|WP_023179159.1|  acetyltransferase                                87.4    1e-16   
ref|WP_013309357.1|  GNAT family acetyltraansferase                   87.0    2e-16   
ref|WP_037257964.1|  GCN5 family acetyltransferase                    86.7    2e-16   
ref|WP_015149143.1|  acetyltransferase, ribosomal protein N-acety...  87.0    2e-16   
ref|WP_017717007.1|  hypothetical protein                             87.0    2e-16   
ref|WP_006570348.1|  MULTISPECIES: GCN5 family N-acetyltransferase    86.7    2e-16   
ref|WP_034537583.1|  acetyltransferase                                86.7    2e-16   
ref|WP_006260834.1|  MULTISPECIES: GNAT family acetyltraansferase     86.7    3e-16   
ref|XP_001786974.1|  predicted protein                                86.7    3e-16   
gb|EKP95369.1|  acetyltransferase, ribosomal protein N-acetylase      87.4    3e-16   
gb|EZP76902.1|  N-acetyltransferase                                   86.7    3e-16   
ref|WP_041121751.1|  GCN5 family acetyltransferase                    86.7    3e-16   
ref|XP_006423531.1|  hypothetical protein CICLE_v10029795mg           84.0    3e-16   
ref|WP_025126095.1|  acetyltransferase                                86.7    3e-16   
ref|WP_027892097.1|  GCN5 family acetyltransferase                    86.3    3e-16   
ref|WP_012959068.1|  alanine acetyltransferase                        86.3    4e-16   
ref|WP_034842869.1|  GCN5 family acetyltransferase [                  86.3    4e-16   
ref|WP_028413912.1|  alanine acetyltransferase                        86.3    4e-16   
ref|WP_026499611.1|  GCN5 family acetyltransferase                    86.3    4e-16   
ref|WP_007355894.1|  MULTISPECIES: GCN5 family N-acetyltransferase    86.3    5e-16   
ref|WP_025784457.1|  alanine acetyltransferase                        85.9    5e-16   
ref|WP_026583142.1|  alanine acetyltransferase                        85.9    5e-16   
ref|WP_023347794.1|  hypothetical protein                             85.5    5e-16   
ref|WP_026800762.1|  GCN5 family acetyltransferase                    85.9    6e-16   
ref|WP_022627830.1|  alanine acetyltransferase                        85.9    6e-16   
ref|XP_004494670.1|  PREDICTED: uncharacterized N-acetyltransfera...  84.0    6e-16   
ref|WP_006266668.1|  GNAT family acetyltraansferase                   85.5    6e-16   
ref|XP_004494671.1|  PREDICTED: uncharacterized N-acetyltransfera...  83.6    6e-16   
ref|WP_028227819.1|  GCN5 family acetyltransferase                    85.5    8e-16   
ref|WP_028504633.1|  hypothetical protein                             85.1    9e-16   
ref|WP_021253716.1|  MULTISPECIES: ribosomal-protein-alanine N-ac...  85.1    9e-16   
ref|WP_002090703.1|  alanine acetyltransferase                        85.1    9e-16   
ref|WP_023614143.1|  MULTISPECIES: hypothetical protein               85.1    1e-15   
ref|WP_016093808.1|  hypothetical protein                             85.1    1e-15   
ref|WP_006256736.1|  GNAT family acetyltraansferase                   85.1    1e-15   
ref|WP_019156517.1|  hypothetical protein                             85.1    1e-15   
ref|WP_002139958.1|  alanine acetyltransferase                        85.1    1e-15   
ref|WP_035206828.1|  alanine acetyltransferase                        84.7    1e-15   
ref|WP_039042316.1|  alanine acetyltransferase                        84.7    1e-15   
dbj|BAP41241.1|  GCN5-related N-acetyltransferase                     84.7    1e-15   
ref|WP_034547301.1|  hypothetical protein                             84.7    1e-15   
ref|WP_028392623.1|  alanine acetyltransferase                        84.7    1e-15   
ref|WP_000506637.1|  N-acetyltransferase                              84.3    1e-15   
ref|WP_022584859.1|  GNAT family acetyltraansferase                   84.7    1e-15   
ref|WP_017185127.1|  hypothetical protein                             84.7    1e-15   
ref|WP_015204805.1|  N-acetyltransferase GCN5                         84.7    2e-15   
ref|WP_000506672.1|  N-acetyltransferase                              84.3    2e-15   
ref|WP_038185292.1|  alanine acetyltransferase                        84.3    2e-15   
ref|WP_000506642.1|  MULTISPECIES: N-acetyltransferase                84.3    2e-15   
ref|WP_000506656.1|  N-acetyltransferase                              84.0    2e-15   
gb|KEZ52813.1|  alanine acetyltransferase                             84.3    2e-15   
emb|CEG25325.1|  ribosomal-protein-alanine N-acetyltransferase        84.3    2e-15   
ref|WP_028545308.1|  acetyltransferase                                84.0    2e-15   
ref|XP_002310528.1|  hypothetical protein POPTR_0007s04440g           82.8    2e-15   
ref|WP_017813244.1|  hypothetical protein                             84.0    2e-15   
ref|WP_026565799.1|  GCN5 family acetyltransferase                    84.0    3e-15   
ref|WP_000506639.1|  MULTISPECIES: N-acetyltransferase                83.6    3e-15   
ref|WP_000506662.1|  N-acetyltransferase                              83.6    3e-15   
gb|AIF67372.1|  hypothetical protein GZ22_12455                       83.6    3e-15   
ref|WP_017151880.1|  N-acetyltransferase                              83.6    3e-15   
ref|WP_034801337.1|  GCN5 family acetyltransferase                    84.0    3e-15   
ref|WP_040047491.1|  alanine acetyltransferase                        83.6    3e-15   
ref|WP_038565968.1|  hypothetical protein                             83.6    3e-15   
ref|WP_033695878.1|  acetyltransferase                                83.6    3e-15   
gb|KER73584.1|  GCN5 family acetyltransferase                         83.6    4e-15   
ref|WP_000506663.1|  N-acetyltransferase                              83.6    4e-15   
ref|WP_010896872.1|  alanine acetyltransferase                        83.6    4e-15   
ref|WP_036135736.1|  hypothetical protein                             83.2    4e-15   
ref|WP_036207712.1|  hypothetical protein                             83.2    4e-15   
ref|WP_000506659.1|  N-acetyltransferase                              83.2    4e-15   
ref|WP_020294689.1|  GCN5-related N-acetyltransferase                 83.2    4e-15   
ref|WP_013522853.1|  MULTISPECIES: GCN5 family N-acetyltransferase    83.2    5e-15   
ref|WP_000506658.1|  N-acetyltransferase                              83.2    5e-15   
ref|WP_038241804.1|  alanine acetyltransferase                        83.2    5e-15   
ref|WP_036651144.1|  GCN5 family acetyltransferase                    83.2    5e-15   
ref|WP_038557605.1|  GCN5 family acetyltransferase                    83.2    5e-15   
ref|WP_000506666.1|  N-acetyltransferase                              82.8    5e-15   
ref|WP_039230826.1|  alanine acetyltransferase                        83.2    5e-15   
ref|WP_015375298.1|  MULTISPECIES: GCN5-related N-acetyltransferase   83.2    5e-15   
ref|WP_000506657.1|  N-acetyltransferase                              82.8    5e-15   
ref|WP_000506667.1|  N-acetyltransferase                              82.8    6e-15   
ref|WP_011733024.1|  N-acetyltransferase                              83.2    6e-15   
ref|WP_000506638.1|  MULTISPECIES: N-acetyltransferase                82.8    6e-15   
ref|WP_016119342.1|  hypothetical protein                             82.8    7e-15   
ref|WP_000506665.1|  N-acetyltransferase                              82.8    7e-15   
gb|KDV23495.1|  GCN5 family acetyltransferase                         82.8    7e-15   
ref|WP_000506681.1|  N-acetyltransferase                              82.4    7e-15   
ref|WP_000506636.1|  MULTISPECIES: N-acetyltransferase                82.4    7e-15   
ref|WP_016087374.1|  ribosomal-protein-alanine acetyltransferase      82.4    7e-15   
ref|WP_000506664.1|  N-acetyltransferase                              82.4    7e-15   
ref|WP_033010499.1|  GCN5 family acetyltransferase                    82.8    7e-15   
ref|WP_016134784.1|  ribosomal-protein-alanine acetyltransferase      82.4    7e-15   
ref|WP_000506660.1|  N-acetyltransferase                              82.4    8e-15   
gb|EAZ05259.1|  hypothetical protein OsI_27461                        82.0    8e-15   
ref|WP_000506673.1|  N-acetyltransferase                              82.4    8e-15   
ref|WP_020383730.1|  hypothetical protein                             82.4    9e-15   
ref|WP_040225608.1|  alanine acetyltransferase                        82.0    1e-14   
ref|WP_021262224.1|  ribosomal-protein-alanine N-acetyltransferase    82.4    1e-14   
ref|WP_016124758.1|  ribosomal-protein-alanine acetyltransferase      82.0    1e-14   
ref|WP_000506669.1|  N-acetyltransferase                              82.0    1e-14   
ref|WP_036226223.1|  GCN5 family acetyltransferase                    82.0    1e-14   
ref|WP_000506655.1|  N-acetyltransferase                              82.0    1e-14   
ref|WP_034817812.1|  alanine acetyltransferase                        82.0    1e-14   
ref|WP_025366214.1|  alanine acetyltransferase                        82.0    1e-14   
ref|WP_017673819.1|  N-acetyltransferase                              82.0    1e-14   
ref|WP_000506670.1|  MULTISPECIES: N-acetyltransferase                82.0    1e-14   
ref|WP_025113764.1|  GCN5 family acetyltransferase                    82.0    1e-14   
dbj|GAF64471.1|  putative acetyltransferase                           82.0    1e-14   
ref|WP_020615481.1|  hypothetical protein                             82.0    1e-14   
ref|WP_000506661.1|  MULTISPECIES: N-acetyltransferase                81.6    1e-14   
ref|WP_028406886.1|  GCN5 family acetyltransferase                    82.0    1e-14   
dbj|GAM13533.1|  acetyltransferase, GNAT family                       81.6    1e-14   
ref|WP_000506674.1|  N-acetyltransferase                              81.6    1e-14   
ref|WP_000506671.1|  N-acetyltransferase                              81.6    1e-14   
ref|WP_036147299.1|  GCN5 family acetyltransferase                    81.6    1e-14   
ref|WP_036248397.1|  GCN5 family acetyltransferase                    82.0    1e-14   
ref|WP_019242371.1|  hypothetical protein                             82.0    1e-14   
ref|WP_017426045.1|  MULTISPECIES: alanine acetyltransferase          81.6    1e-14   
ref|WP_009879256.1|  N-acetyltransferase                              81.6    2e-14   
ref|WP_020390021.1|  hypothetical protein                             81.6    2e-14   
gb|EZP76991.1|  GCN5-related N-acetyltransferase                      81.6    2e-14   
ref|WP_036198436.1|  alanine acetyltransferase                        81.6    2e-14   
ref|WP_000506641.1|  N-acetyltransferase                              81.6    2e-14   
ref|WP_036123610.1|  MULTISPECIES: GCN5 family acetyltransferase      81.6    2e-14   
gb|EYU32737.1|  hypothetical protein MIMGU_mgv1a026134mg              79.3    2e-14   
ref|WP_019502776.1|  hypothetical protein                             81.6    2e-14   
ref|WP_017561350.1|  N-acetyltransferase                              81.3    2e-14   
ref|WP_000506714.1|  MULTISPECIES: N-acetyltransferase                81.3    2e-14   
ref|WP_005546546.1|  GCN5 family N-acetyltransferase                  81.6    2e-14   
ref|WP_006969755.1|  hypothetical protein                             81.6    2e-14   
ref|WP_001977340.1|  N-acetyltransferase                              81.3    2e-14   
ref|WP_016131554.1|  ribosomal-protein-alanine acetyltransferase      81.3    2e-14   
ref|WP_041040986.1|  acetyltransferase                                81.6    2e-14   
ref|WP_029672651.1|  hypothetical protein                             80.9    2e-14   
ref|WP_035507893.1|  MULTISPECIES: GCN5 family acetyltransferase      81.3    2e-14   
ref|WP_009610076.1|  GCN5 family N-acetyltransferase                  81.3    2e-14   
ref|WP_021161503.1|  Acetyltransferase, GNAT family                   81.3    2e-14   
ref|WP_040687177.1|  GCN5 family acetyltransferase                    81.3    2e-14   
ref|WP_017211914.1|  GNAT family acetyltransferase                    81.3    2e-14   
ref|WP_007127800.1|  GNAT family acetyltraansferase                   81.3    2e-14   
gb|ELS34174.1|  GCN5-related N-acetyltransferase                      81.3    2e-14   
ref|WP_012094497.1|  N-acetyltransferase                              81.3    2e-14   
ref|WP_026592893.1|  acetyltransferase                                80.9    2e-14   
gb|AHV98806.1|  GCN5-like N-acetyltransferase                         81.3    2e-14   



>ref|XP_009772681.1| PREDICTED: uncharacterized protein LOC104223027 [Nicotiana sylvestris]
Length=202

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +1

Query  253  QSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaa  432
            Q  DA  D  SDITLRPL+ +D +D++E+ +DDNV+KFCSW+ FTS E A  Y+A+ A  
Sbjct  21   QKEDAATDGDSDITLRPLDLTDVDDFMEWFADDNVSKFCSWDTFTSKEDAMNYVADIAIP  80

Query  433  HPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVE  612
            HPW++ IC+ GK VGS++V PF G D CR E+GY LASKYWGKGIATKAVKMAA ++FVE
Sbjct  81   HPWFQAICLNGKPVGSISVSPFHGTDRCRGELGYVLASKYWGKGIATKAVKMAATAIFVE  140

Query  613  WAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTF  792
            W HLERLEAVVDV+N GSQRVLEKAGF++E VLRKYYLLKG P D VMFSL+STDP+V +
Sbjct  141  WPHLERLEAVVDVDNPGSQRVLEKAGFRKEGVLRKYYLLKGKPKDIVMFSLLSTDPQVNY  200

Query  793  FM  798
            FM
Sbjct  201  FM  202



>ref|XP_009598312.1| PREDICTED: uncharacterized protein LOC104094146 [Nicotiana tomentosiformis]
Length=211

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = +1

Query  262  DAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPW  441
            DA  D  SDITLRPL+ +D +D++E+ +DDNV+KFCSW+ FTS E A  Y+A+ A  HPW
Sbjct  32   DAATDGKSDITLRPLDLTDVDDFMEWFADDNVSKFCSWDTFTSKEDAMNYVADVAIPHPW  91

Query  442  YRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAH  621
            ++ IC+ GK VGS++V PF G D CR E+GY LASKYWGKGIATKAVKMAAAS+FVEW H
Sbjct  92   FQAICLNGKPVGSISVSPFHGTDRCRGELGYVLASKYWGKGIATKAVKMAAASIFVEWPH  151

Query  622  LERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTFFM  798
            LERLEAVVDV+N GSQRVLEKAGF +E VL+KYYLLKG P D VMFSL+STDP+VT+F+
Sbjct  152  LERLEAVVDVDNPGSQRVLEKAGFTKEGVLKKYYLLKGKPKDIVMFSLLSTDPQVTYFI  210



>ref|XP_009758374.1| PREDICTED: uncharacterized protein LOC104211072 [Nicotiana sylvestris]
Length=202

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  262  DAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPW  441
            DA  +DYSDI+LR L+ +D +D++E+ +D+NV KFCS   F   E A +YIA     HPW
Sbjct  24   DAATEDYSDISLRLLDLTDVDDFMEWSADENVNKFCSGFTFKCKEDAMRYIAGVVIPHPW  83

Query  442  YRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAH  621
            +R IC+ GK +GS++V PF G D CR EIG  L+SKYWGKGIATKAVKMAAA++F+EW H
Sbjct  84   FRAICLSGKPIGSISVLPFNGSDRCRGEIGNELSSKYWGKGIATKAVKMAAATIFIEWPH  143

Query  622  LERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTFFM  798
            LERLEAVVDVEN GSQRVLEKAGF +E VLRKYYLLKG P D VMFSL+STD +VT+FM
Sbjct  144  LERLEAVVDVENPGSQRVLEKAGFTKEGVLRKYYLLKGRPRDIVMFSLLSTDLQVTYFM  202



>ref|XP_009598310.1| PREDICTED: uncharacterized protein LOC104094144 [Nicotiana tomentosiformis]
 ref|XP_009598311.1| PREDICTED: uncharacterized protein LOC104094144 [Nicotiana tomentosiformis]
Length=202

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  262  DAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPW  441
            DA  +DYSD++LR L+  D +D++E+ +D+NV KFCS   F   E A +YIA+    HPW
Sbjct  24   DAATEDYSDVSLRLLDLRDVDDFMEWSADENVNKFCSGFTFKCKEDAMRYIADVVIPHPW  83

Query  442  YRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAH  621
            +R IC+ GK +GS++V PF G + CR EIGY L+SKYWGKGIATKAVKMAAA++F +W H
Sbjct  84   FRAICLNGKPIGSISVLPFHGSNRCRGEIGYELSSKYWGKGIATKAVKMAAATIFFDWPH  143

Query  622  LERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTFFM  798
            LERLEAVVDVEN GSQRVLEKAGF +E VLRKYYLLKG P D VMFSL+STDP+VT+FM
Sbjct  144  LERLEAVVDVENPGSQRVLEKAGFIKEGVLRKYYLLKGRPRDIVMFSLLSTDPQVTYFM  202



>ref|XP_006360774.1| PREDICTED: uncharacterized protein LOC102601440 [Solanum tuberosum]
Length=186

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 2/181 (1%)
 Frame = +1

Query  235  SAMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyi  414
            S +E  +  +   DD   ITLR LE +D +D++E+  DDNV+KFCSW+ F S E A  Y+
Sbjct  7    SNLENLKLSNKLEDDI--ITLRLLELTDVDDFMEWLGDDNVSKFCSWDTFKSKEDAISYV  64

Query  415  aedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAA  594
             + A  HPW++ IC+ GK +G+++V PF G + CR E+GY +ASKYWGKGIATKAVKMA 
Sbjct  65   VDVAIPHPWFKAICLNGKPIGTISVSPFYGTNKCRGELGYVIASKYWGKGIATKAVKMAV  124

Query  595  ASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIST  774
            +++FVEW HLERLEAVVDV+N GSQRVLEK GF +E VLRKYYLLKG   D VMFS++S+
Sbjct  125  SAIFVEWPHLERLEAVVDVDNPGSQRVLEKVGFNKEGVLRKYYLLKGKTKDIVMFSILSS  184

Query  775  D  777
            D
Sbjct  185  D  185



>ref|XP_002315763.1| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
 gb|EEF01934.1| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
Length=186

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 136/180 (76%), Gaps = 3/180 (2%)
 Frame = +1

Query  256  SPDAF---GDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaeda  426
            +PD     GD+ SDI+LRPL+ SD +D++ + +D  V +FC+WEP+T+ E A  YI    
Sbjct  7    TPDLLKEGGDELSDISLRPLDLSDIDDFMVWATDAEVARFCTWEPYTNKEDALNYIKNYV  66

Query  427  aaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVF  606
              HPW++ +C+  + +G+V+V    GCD CR E+GY LAS+YWGKG ATKAVK+ A ++F
Sbjct  67   LPHPWFKAVCLNNRPIGAVSVTKNSGCDICRGELGYVLASQYWGKGFATKAVKLVAKTIF  126

Query  607  VEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            +EW HLERLEA+VDV+N GSQRVLEKAGF+RE VLR+YY+LKG   D VMFSL+STDP++
Sbjct  127  IEWPHLERLEALVDVQNGGSQRVLEKAGFEREGVLRRYYMLKGKSRDMVMFSLLSTDPQI  186



>ref|XP_004247573.1| PREDICTED: uncharacterized protein LOC101247659 [Solanum lycopersicum]
Length=184

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLR L+ +D +D++E+  DDNV+KFCSW+ F S E A  Y+ + A  HPW++ IC+ GK
Sbjct  22   ITLRLLDLTDVDDFMEWFGDDNVSKFCSWDTFKSKEDAVSYVIDVAIPHPWFKAICLNGK  81

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             +G+++V PF G + CR E+GY +ASKYWGKGIATKAVKMA +++FV+W HLERLEAVVD
Sbjct  82   PIGTISVSPFYGTNKCRGELGYVIASKYWGKGIATKAVKMAVSAIFVDWPHLERLEAVVD  141

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+N GSQRVLEK GF++E VLRKYYLLKG   D VMFS++S D
Sbjct  142  VDNPGSQRVLEKVGFRKEGVLRKYYLLKGKTKDIVMFSILSGD  184



>gb|EYU41469.1| hypothetical protein MIMGU_mgv11b016407mg [Erythranthe guttata]
Length=180

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            SDITLRP+  SDA+ ++++  D+ V+KFCSW+ F + EAA +Y   +   HPW R IC+ 
Sbjct  7    SDITLRPVTISDADHFMQWYFDEKVSKFCSWDVFATKEAAVEYFMRNEITHPWNRAICMS  66

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+ VG V+V PF+G + CRAEIGY + S+Y GKG+AT AV+MAA +VFVEW  LER+EAV
Sbjct  67   GRVVGCVSVSPFQGSNKCRAEIGYVVGSEYCGKGVATAAVRMAANAVFVEWGGLERVEAV  126

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTFFM  798
            VD EN  SQRV+EKAGF +E VLRKYYLLKG P DAV+FSL+STDP V +FM
Sbjct  127  VDAENPASQRVVEKAGFVKEGVLRKYYLLKGKPRDAVIFSLLSTDPAVHYFM  178



>ref|XP_011030672.1| PREDICTED: uncharacterized protein YIR042C-like [Populus euphratica]
 ref|XP_011013870.1| PREDICTED: uncharacterized protein YIR042C-like [Populus euphratica]
Length=186

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 134/180 (74%), Gaps = 3/180 (2%)
 Frame = +1

Query  256  SPDAF---GDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaeda  426
            +PD     GD++SDI+LRPL+ SD +D++ + +D  V +FC+WEP+T+ E A  YI    
Sbjct  7    TPDLLKEGGDEFSDISLRPLDLSDIDDFMVWATDAEVARFCTWEPYTNKEDALNYIKNSV  66

Query  427  aaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVF  606
              HPW++ +C+  + +G+V+V      D CR E+GY LAS+YWGKG ATKAVK+ A ++F
Sbjct  67   LPHPWFKAVCLNNRPIGAVSVTKNSDNDFCRGELGYVLASQYWGKGFATKAVKLVAKTIF  126

Query  607  VEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            +EW HLERLEA+VDV+N GSQRVLEKAGF+RE VLR+Y +LKG   D VMFSL+STDP++
Sbjct  127  IEWPHLERLEALVDVQNVGSQRVLEKAGFEREGVLRRYCILKGKSRDMVMFSLLSTDPQI  186



>ref|XP_006489421.1| PREDICTED: uncharacterized protein LOC102614108 [Citrus sinensis]
 gb|KDO74538.1| hypothetical protein CISIN_1g029943mg [Citrus sinensis]
Length=185

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + SDI+LRP++ SD +D++ + SDD VT FCS+ P+TS E   K+I      HPW+  IC
Sbjct  16   ELSDISLRPMDLSDVDDFMVWASDDKVTHFCSYGPYTSREQGIKHIENKVIPHPWFMAIC  75

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V  +A+G+++V   +G D CR EIGY L SKYWGKGIAT+AVKMA+ ++F EW HLERLE
Sbjct  76   VNNRAIGAISVSANQGNDKCRGEIGYVLGSKYWGKGIATRAVKMASDAIFAEWPHLERLE  135

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            A+VDVEN GSQ+VL KAGF +E VLRKY++ KG   D +MFSL+STDP +
Sbjct  136  ALVDVENVGSQKVLLKAGFMQEGVLRKYFIHKGKTRDTIMFSLLSTDPRI  185



>ref|XP_006419971.1| hypothetical protein CICLE_v10005998mg [Citrus clementina]
 gb|ESR33211.1| hypothetical protein CICLE_v10005998mg [Citrus clementina]
Length=185

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + SDI+LRP++ SD +D++ + SDD VT FCS+ P+TS E   K+I      HPW+  IC
Sbjct  16   ELSDISLRPMDLSDVDDFMVWASDDKVTHFCSYGPYTSREQGIKHIENKVIPHPWFMAIC  75

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V  +A+G+++V   +G D CR EIGY L SKYWGKGIAT+AVKMA+ ++F EW HLERLE
Sbjct  76   VDNRAIGAISVSANQGNDKCRGEIGYVLGSKYWGKGIATRAVKMASDAIFAEWPHLERLE  135

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            A+VDVEN GSQ+VL KAGF +E VLRKY++ KG   D +MFSL+STDP +
Sbjct  136  ALVDVENVGSQKVLLKAGFMQEGVLRKYFIHKGKTRDTIMFSLLSTDPRI  185



>ref|XP_006360773.1| PREDICTED: uncharacterized protein LOC102601098 [Solanum tuberosum]
Length=205

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEP-FTSVEaaakyiaedaaaHPWYRGICVKG  465
            I+LR L+ +D +D++E+ +DDNV KFCS +  F S E A +YIA+    HPWYR IC+  
Sbjct  35   ISLRLLDLTDIDDFMEWFTDDNVNKFCSRDTTFISKEDAMQYIADVVIPHPWYRAICLND  94

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            K +GS++V PF G D CR EIGY ++SKYWGKGIATKAVKM A+++FV+W HL RLE +V
Sbjct  95   KPIGSISVSPFHGSDICRGEIGYEISSKYWGKGIATKAVKMVASTIFVDWPHLARLEGIV  154

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTFF  795
             V+N GSQRVLEKAGF +E VLRKYYL+KG P D VMFSL+  D ++T+F
Sbjct  155  AVDNIGSQRVLEKAGFIKEGVLRKYYLVKGIPIDIVMFSLLFIDQQLTYF  204



>ref|XP_006419970.1| hypothetical protein CICLE_v10005999mg [Citrus clementina]
 ref|XP_006489420.1| PREDICTED: uncharacterized protein LOC102613801 [Citrus sinensis]
 gb|ESR33210.1| hypothetical protein CICLE_v10005999mg [Citrus clementina]
 gb|KDO74539.1| hypothetical protein CISIN_1g047585mg [Citrus sinensis]
Length=185

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 125/169 (74%), Gaps = 0/169 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S I+LRPLE SD +D++ + SD  V +FC WE +T+ E    YI      HPW+R IC
Sbjct  16   ELSHISLRPLELSDIDDFMVWVSDPKVARFCPWESYTNKEDGINYIKTKVPQHPWFRAIC  75

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V  + VG+ +V+P  G D CRAE+GY LASKYWGKGIAT+AVK+   ++F EW HLERLE
Sbjct  76   VNNRPVGATSVRPNSGNDMCRAELGYVLASKYWGKGIATQAVKIVTKTIFDEWPHLERLE  135

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            AVVDVEN  SQRVLEKAGFKRE VL KY+++KG+  D V+FSL+STDP+
Sbjct  136  AVVDVENVASQRVLEKAGFKREGVLGKYFIMKGSTKDMVVFSLLSTDPK  184



>ref|XP_006489417.1| PREDICTED: uncharacterized protein LOC102612612 [Citrus sinensis]
Length=192

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            SDI+LR L+ SD +D++ + SD+ VT+FCS++ +TS E    YI    + HPWYR ICV 
Sbjct  25   SDISLRLLDLSDIDDFMVWASDEKVTRFCSFDSYTSKEDGINYIKNTVSRHPWYRAICVN  84

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             + VGS++V    G D CR E+GY LA+ YWGKGIATKAVKM A ++F EW HLERLEA+
Sbjct  85   NRPVGSISVTANSGNDKCRGELGYVLAADYWGKGIATKAVKMVANTIFDEWPHLERLEAL  144

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            V V+N GSQRVLEKAGFKREAVLRKY +LKG   D V+FSL+STDP
Sbjct  145  VVVDNAGSQRVLEKAGFKREAVLRKYLILKGTTRDCVIFSLLSTDP  190



>ref|XP_006360811.1| PREDICTED: uncharacterized protein LOC102585769 [Solanum tuberosum]
Length=243

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = +1

Query  205  TPFSQITEIFSAMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPF  384
            T    IT+     E  +S +   D  + I+LR L+ +D +D++E+ +DDNV KFCS + F
Sbjct  54   TRLDDITDGAPFREKLKSSNNEDDQSNIISLRLLDLTDVDDFMEWFTDDNVNKFCSSDGF  113

Query  385  TSVEaaakyiaedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKG  564
             S E + +YIA+    HPWYR IC+  K +GS++V PF G D CR EIGY ++SKYWGKG
Sbjct  114  LSKEDSMRYIADVVIPHPWYRAICLNDKPIGSISVSPFHGSDICRGEIGYDISSKYWGKG  173

Query  565  IATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPT  744
            IATKAVKM A+++FV+W HL RLE VV V+N GSQRVLEKAGF +E VLRKYYL+KG P 
Sbjct  174  IATKAVKMVASTIFVDWPHLARLEGVVAVDNVGSQRVLEKAGFVKEGVLRKYYLVKGKPI  233

Query  745  DAVMFSLI  768
            D VMFSL+
Sbjct  234  DIVMFSLL  241



>ref|XP_006419968.1| hypothetical protein CICLE_v10005971mg [Citrus clementina]
 gb|ESR33208.1| hypothetical protein CICLE_v10005971mg [Citrus clementina]
Length=192

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LR L+ SD +D++ + SDD VT+FCS++ +TS E    YI    + HPWYR ICV 
Sbjct  25   SVISLRLLDLSDIDDFMVWASDDKVTRFCSFDSYTSKEDGINYIKNTVSRHPWYRAICVN  84

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             + VGS++V    G D CR E+GY LA+ YWGKGIATKAVKM A ++F EW HLERLEA+
Sbjct  85   NRPVGSISVTANSGNDKCRGELGYVLAADYWGKGIATKAVKMVANTIFDEWPHLERLEAL  144

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            V V+N GSQRVLEKAGFKREAVLRKY +LKG   D V+FSL+STDP
Sbjct  145  VVVDNAGSQRVLEKAGFKREAVLRKYLILKGTTRDCVIFSLLSTDP  190



>ref|XP_003631992.1| PREDICTED: uncharacterized protein YIR042C [Vitis vinifera]
Length=180

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +++LRPL+ SD +D++ + +DD V++FC+W+ +TS EA   YI      HPW++ IC+  
Sbjct  14   ELSLRPLDLSDIDDFMVWATDDKVSRFCTWDTYTSKEAGIDYIKNIVIPHPWFKAICLDN  73

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            KA+G+++V    G D CR E+GYALASKYWGKGI T+AVKM A+++F EW HLERLEA+V
Sbjct  74   KAIGAISVSANNGNDRCRGELGYALASKYWGKGIVTRAVKMVASTIFNEWPHLERLEALV  133

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            DVEN GSQRVLEK GF+RE VLRK+ +LKG   D V++SL+STDP+
Sbjct  134  DVENGGSQRVLEKVGFQREGVLRKFVILKGRCRDLVIYSLLSTDPQ  179



>ref|XP_004247574.1| PREDICTED: uncharacterized protein LOC101247959 [Solanum lycopersicum]
Length=205

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWE-PFTSVEaaakyiaedaaaHPWYRGICVKG  465
            I+LR L+ +D +D++E+ +D+NV KFCS +  F S E A +YIA+    HPWYR IC+  
Sbjct  35   ISLRLLDLTDVDDFMEWFTDENVNKFCSCDTSFISKEDAMQYIADVVIPHPWYRAICLND  94

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            K +GS++V  F G D CR EIGY L+SKYWGKGIAT AVKM A+++FV+W HL RLE VV
Sbjct  95   KPIGSISVSSFHGSDICRGEIGYELSSKYWGKGIATMAVKMVASTIFVDWPHLARLEGVV  154

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTFF  795
             V+N GSQRVLEKAGF +E VLRKYYL+KG P D VMFSL+S D ++ +F
Sbjct  155  AVDNIGSQRVLEKAGFIKEGVLRKYYLVKGKPIDIVMFSLLSIDQQLAYF  204



>gb|KDP40198.1| hypothetical protein JCGZ_02196 [Jatropha curcas]
Length=186

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 126/172 (73%), Gaps = 0/172 (0%)
 Frame = +1

Query  271  GDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRG  450
            GD++S+++LRP + SD ED++ + +D+ VT FCS++P+ S E    YI      HPWYR 
Sbjct  15   GDEFSNLSLRPFDVSDIEDFMVWATDEKVTYFCSFDPYKSKEDGINYIKNTVIPHPWYRA  74

Query  451  ICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLER  630
            IC+  + +GS++V    G D CR E+GY LAS+YWGKGIAT+AVKM A ++F E   LER
Sbjct  75   ICLNNRPIGSISVTKNSGNDICRGELGYLLASQYWGKGIATRAVKMVAKAIFKEQPELER  134

Query  631  LEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            LEA+VDVEN GSQRVLEKAGF RE VLRKY++ KG   D VMFSL+STDP +
Sbjct  135  LEALVDVENVGSQRVLEKAGFTREGVLRKYFIQKGRIRDMVMFSLLSTDPVI  186



>ref|XP_002282836.1| PREDICTED: uncharacterized protein YIR042C [Vitis vinifera]
 emb|CBI26277.3| unnamed protein product [Vitis vinifera]
Length=180

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +++LRPL+ SD +D++ + +DD V++FC+W+ +TS EA   YI      HPW++ IC+  
Sbjct  14   ELSLRPLDLSDIDDFMVWATDDKVSRFCTWDTYTSKEAGIDYIKNIVIPHPWFKAICLDN  73

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            KA+G+++V    G D CR E+GY LASKYWGKGI T+AVKM A+++F EW HLERLEA+V
Sbjct  74   KAIGAISVSANNGNDRCRGELGYVLASKYWGKGIVTRAVKMVASTIFNEWPHLERLEALV  133

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            DVEN GSQRVLEK GF+RE VLRK+ +LKG   D V++SL+STDP+
Sbjct  134  DVENGGSQRVLEKVGFQREGVLRKFVILKGRCRDMVIYSLLSTDPQ  179



>ref|XP_010096155.1| putative N-acetyltransferase p20 [Morus notabilis]
 gb|EXB63471.1| putative N-acetyltransferase p20 [Morus notabilis]
Length=191

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 129/183 (70%), Gaps = 6/183 (3%)
 Frame = +1

Query  253  QSPDAFGDD------YSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyi  414
            + PD  G D      +  I+LR L+ SD +D++ + +D+ VT+FC+WEP+TS E    +I
Sbjct  8    RKPDHNGTDIGGDHEFQRISLRLLDLSDIDDFMVWATDEKVTRFCTWEPYTSREEGMNFI  67

Query  415  aedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAA  594
             +    HPW+R IC+  + +G+++V    G D CR E+GY L SKYWGKGIAT+AVKM A
Sbjct  68   NDKVIPHPWFRAICLGDRPIGAISVTANSGNDRCRGELGYVLGSKYWGKGIATQAVKMVA  127

Query  595  ASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIST  774
             ++F +W  LERLEA+VDVEN GSQRVLEK GF+RE VLRKY+LLKG   D V+FSL+ST
Sbjct  128  KTIFKDWPQLERLEALVDVENVGSQRVLEKGGFQREGVLRKYFLLKGKSRDMVIFSLLST  187

Query  775  DPE  783
            D +
Sbjct  188  DSQ  190



>ref|XP_009335319.1| PREDICTED: uncharacterized protein YIR042C-like [Pyrus x bretschneideri]
Length=186

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRPL+  D +D++ + +D+ V  FC+WEP+ S E    YI +    HPW R IC
Sbjct  17   DLSKITLRPLDLDDIDDFMVWATDEKVPVFCTWEPYASKEEGLNYIKDVVIPHPWLRAIC  76

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +    +GS++V PF G D CR E+GY L SKYWGKGIAT+AVK+ A ++F EW HL+RLE
Sbjct  77   LDNMPIGSISVTPFSGNDRCRGELGYVLGSKYWGKGIATQAVKLVADAIFKEWPHLDRLE  136

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VDV+N GSQRVLEK GF+RE VLRKY +LKG   D V+FSL+STD
Sbjct  137  ALVDVDNVGSQRVLEKVGFQREGVLRKYCILKGRSRDMVIFSLLSTD  183



>ref|XP_008224290.1| PREDICTED: uncharacterized protein LOC103324032 [Prunus mume]
Length=186

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D+S ITLRPLE SD +D++ + +D+ V +FC+WEP+ S E    +I      HPW+  IC
Sbjct  17   DFSMITLRPLELSDIDDFMVWATDEKVPRFCTWEPYASKEEGLNFIKNVVLPHPWFMAIC  76

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            ++ + +GS++V    G D CR E+GY L S+YWGKGI T+AVK+ A  +F EW HLERLE
Sbjct  77   LENRPIGSISVTSNSGNDRCRGELGYVLGSRYWGKGIVTQAVKLVADIIFKEWTHLERLE  136

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VDVEN  SQRVLEKAGF+RE VLRKY++LKG   D VMF+L+S D
Sbjct  137  ALVDVENVASQRVLEKAGFQREGVLRKYFILKGRSRDMVMFALLSID  183



>ref|XP_006489419.1| PREDICTED: uncharacterized protein LOC102613222 [Citrus sinensis]
Length=192

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LR L+ SD +D++ + SDD VT+FCS++ +TS E    YI    + HPWYR ICV 
Sbjct  25   SVISLRLLDLSDIDDFMVWASDDKVTRFCSFDSYTSKEDGINYIKNTVSRHPWYRAICVN  84

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             + VGS++V    G D CR E+GY LA+ YWGKGIATKAVKM A ++F EW HLERLEA+
Sbjct  85   NRPVGSISVTANSGNDKCRGELGYVLAADYWGKGIATKAVKMVANTIFDEWPHLERLEAL  144

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
              V+N GSQRVLEKAGF REAVLRKY +LKG   D V+FSL+STDP
Sbjct  145  AVVDNVGSQRVLEKAGFTREAVLRKYRILKGTTRDRVIFSLLSTDP  190



>ref|XP_009345874.1| PREDICTED: uncharacterized protein YIR042C-like [Pyrus x bretschneideri]
Length=186

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRPL+ +D +D++ + +D+ VT FC+WEP+ S E A  +I +    HPW++ IC
Sbjct  17   DLSKITLRPLDLADIDDFMVWGTDEKVTVFCTWEPYASKEEALNFIKDVVVPHPWFKAIC  76

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  + +G+++V  F G + CR E+GY L SKYWGKGIA++AVK+ A ++F EW HL+RLE
Sbjct  77   LDNRPIGAISVTAFPGNNRCRGELGYVLGSKYWGKGIASRAVKLVADTIFKEWTHLDRLE  136

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VDV+N GSQR+LEK GF+RE VLRKY +LKG   D V+FSL+STD
Sbjct  137  ALVDVDNVGSQRLLEKVGFQREGVLRKYCMLKGRSRDMVIFSLLSTD  183



>ref|XP_009791424.1| PREDICTED: uncharacterized protein LOC104238686 [Nicotiana sylvestris]
Length=187

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            ++++ITLR +E SD +D++E+ +D+ V+ FC W+ +TS + A  YI  +A  HPW R IC
Sbjct  16   EFTEITLRQIELSDVDDFMEWATDEKVSHFCIWDTYTSKDQALDYIKNNAIPHPWLRVIC  75

Query  457  VKGKAVGSVTVKPFRG-CDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            +K +A+G+++V P  G  DSCRAE+GY LA KYWGKGI T+AVKM A ++F EW++LER+
Sbjct  76   IKNRAIGAISVTPNSGNIDSCRAELGYVLAYKYWGKGIVTRAVKMVATTIFSEWSNLERI  135

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            EA+VD++N+GSQRVLEK GF RE VLRK+  +KG   D V+FSL+STD
Sbjct  136  EALVDIDNKGSQRVLEKVGFLREGVLRKFMSIKGKSGDMVIFSLLSTD  183



>ref|XP_009369862.1| PREDICTED: uncharacterized protein YIR042C-like [Pyrus x bretschneideri]
Length=186

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRPL+ +D +D++ + +D+ VT FC+WEP+ S E A  +I +    HPW++ IC
Sbjct  17   DLSKITLRPLDLADIDDFMVWGTDEKVTVFCTWEPYASKEDALNFIKDVVVPHPWFKAIC  76

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  + +G+++V  F G + CR E+GY L SKYWGKGIA++AVK+ A ++F EW HL+RLE
Sbjct  77   LDNRPIGAISVTAFPGNNRCRGELGYVLGSKYWGKGIASQAVKLVADTIFKEWTHLDRLE  136

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VDV+N GSQR+LEK GF+RE VLRKY +LKG   D V+FSL+STD
Sbjct  137  ALVDVDNVGSQRLLEKVGFQREGVLRKYCMLKGRSRDMVIFSLLSTD  183



>ref|XP_010256100.1| PREDICTED: uncharacterized protein LOC104596566 isoform X1 [Nelumbo 
nucifera]
Length=197

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = +1

Query  274  DDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEP--FTSVEaaakyiaedaaaHPWYR  447
            D   +I+LRPLE +D +D++ + +DD VT+FCSW+   + S +   KYI +    HPW+R
Sbjct  26   DGLPEISLRPLELADVDDFMVWATDDRVTRFCSWDSCTYASKDDGLKYIEDTVIPHPWFR  85

Query  448  GICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            GIC+  + +G+++VKP+ G DSCR E+GY LAS+YWG+GIAT+AVKM   S+F +W HLE
Sbjct  86   GICLNNRPIGAISVKPYSGNDSCRGELGYVLASEYWGRGIATQAVKMVVLSIFKDWPHLE  145

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            RLEA+VD EN GSQRVLEK GF +E VLRKY + KG+  D VM+SL+ST+
Sbjct  146  RLEALVDTENLGSQRVLEKVGFMKEGVLRKYVIQKGSTRDMVMYSLLSTE  195



>ref|XP_002517113.1| N-acetyltransferase, putative [Ricinus communis]
 gb|EEF45276.1| N-acetyltransferase, putative [Ricinus communis]
Length=186

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 121/170 (71%), Gaps = 0/170 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D+S+I+LR L  SD +D++ + +D+ V  FCSWEP+TS E    Y+ +    HPW   IC
Sbjct  17   DFSNISLRSLGLSDIDDFMVWAADEKVAHFCSWEPYTSKEDGLNYMKKTVLPHPWIMAIC  76

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +    +G+++V    G D CR E+GY LASKYWGKGIATKAVKM A ++F E   LERLE
Sbjct  77   LNNTPIGAISVTKNSGSDICRGELGYVLASKYWGKGIATKAVKMVAETIFSERPELERLE  136

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            A+VDV+N GSQ+VLEK GFKRE VLRKY++ KG   D VMFSL+STDP +
Sbjct  137  ALVDVQNVGSQKVLEKVGFKREGVLRKYFIRKGRSRDMVMFSLLSTDPVI  186



>ref|XP_010256101.1| PREDICTED: uncharacterized protein LOC104596566 isoform X2 [Nelumbo 
nucifera]
Length=185

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = +1

Query  274  DDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEP--FTSVEaaakyiaedaaaHPWYR  447
            D   +I+LRPLE +D +D++ + +DD VT+FCSW+   + S +   KYI +    HPW+R
Sbjct  14   DGLPEISLRPLELADVDDFMVWATDDRVTRFCSWDSCTYASKDDGLKYIEDTVIPHPWFR  73

Query  448  GICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            GIC+  + +G+++VKP+ G DSCR E+GY LAS+YWG+GIAT+AVKM   S+F +W HLE
Sbjct  74   GICLNNRPIGAISVKPYSGNDSCRGELGYVLASEYWGRGIATQAVKMVVLSIFKDWPHLE  133

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            RLEA+VD EN GSQRVLEK GF +E VLRKY + KG+  D VM+SL+ST+
Sbjct  134  RLEALVDTENLGSQRVLEKVGFMKEGVLRKYVIQKGSTRDMVMYSLLSTE  183



>ref|XP_007223417.1| hypothetical protein PRUPE_ppa011306mg [Prunus persica]
 gb|EMJ24616.1| hypothetical protein PRUPE_ppa011306mg [Prunus persica]
Length=215

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D+S ITLRPLE SD +D++ + +D+ V +FC+WEP+ S E    +I      HPW+  IC
Sbjct  46   DFSMITLRPLELSDIDDFMVWATDEKVPRFCTWEPYASKEEGLNFIKNVVLPHPWFMAIC  105

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            ++ + +G+++V    G   CR E+GY L S+YWGKGI T+AVK+ A  +F EW HLERL 
Sbjct  106  LENRPIGAISVTSNSGTSRCRGELGYVLGSRYWGKGIVTQAVKLVADIIFKEWTHLERLV  165

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VDVEN  SQRVLEKAGF+RE VLRKY++LKG   D VMF L+STD
Sbjct  166  ALVDVENVASQRVLEKAGFQREGVLRKYFILKGRSRDMVMFGLLSTD  212



>ref|XP_007034798.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007034799.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05724.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY05725.1| Acyl-CoA N-acyltransferases superfamily protein isoform 1 [Theobroma 
cacao]
Length=186

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +1

Query  322  EDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKAVGSVTVKPFR  501
            +D++ + +D+ V +FC+WEP+T+ E    +I      HPW+R IC+  + +G+++V    
Sbjct  32   DDFMVWATDEKVARFCTWEPYTNKEDGLNFIRNTVLPHPWFRAICLDNRPIGAISVIANS  91

Query  502  GCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLE  681
            G D CR E+GY LASKYWGKGIAT+AVKM A ++FVEW HLERLEA+V+VEN GSQRVLE
Sbjct  92   GNDKCRGELGYVLASKYWGKGIATRAVKMVAKTIFVEWPHLERLEALVEVENVGSQRVLE  151

Query  682  KAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            KAGF++E VLRKY++ KG   D VMFSL+STDP++
Sbjct  152  KAGFQKEGVLRKYFIRKGRTRDMVMFSLVSTDPQI  186



>ref|XP_011090703.1| PREDICTED: uncharacterized protein LOC105171328 [Sesamum indicum]
Length=186

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +ITLRP+   D +D++ + +DD VTKFC W+ +TS E A  YI   A  HPW R IC+  
Sbjct  19   NITLRPIALPDVDDFMVWATDDRVTKFCLWDTYTSKEQAVDYIKNQAIPHPWLRAICIGD  78

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G++TV P  G  SCRAE+GY LA K+WGKGIAT+AVKM  +++F +W HL+RL+AVV
Sbjct  79   RVIGTITVDPCSGFGSCRAELGYVLAHKHWGKGIATRAVKMVVSTIFKDWPHLQRLQAVV  138

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
             V N+GSQRVLEKAGF+RE VLR Y L KG P D VMFS +     V
Sbjct  139  HVANKGSQRVLEKAGFQREGVLRSYVLFKGKPIDVVMFSTLGNHSSV  185



>ref|XP_009799208.1| PREDICTED: uncharacterized protein LOC104245314 [Nicotiana sylvestris]
Length=183

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            ++++ITLR +E SD +D++E+ +D+  ++FC W+  TS + A  YI  +   HPW R IC
Sbjct  13   EFTEITLRQIELSDVDDFMEWATDEKFSRFCIWDTCTSKDQALDYIKNNDIYHPWSRAIC  72

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +K KA+  ++V P  GC SCRAE+GY LA KYWGKGI T+AVKM A ++F EW++LER+E
Sbjct  73   IKNKAIREISVMPNSGCHSCRAELGYELAHKYWGKGIVTRAVKMVATTIFSEWSNLERIE  132

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A VD++N+GSQRVLEK GF RE VLRK+  + G   D V+FSL+STD
Sbjct  133  AFVDIDNKGSQRVLEKVGFLREGVLRKFMSINGKSRDMVIFSLLSTD  179



>ref|XP_004298274.1| PREDICTED: uncharacterized N-acetyltransferase p20-like [Fragaria 
vesca subsp. vesca]
Length=185

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 0/169 (0%)
 Frame = +1

Query  271  GDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRG  450
            GD+   ITLR +  SD +D++ + +D+ V +FC+WEP+ S E    +I E    HPW+R 
Sbjct  14   GDEVFTITLRKMGLSDIDDFMVWGTDEKVARFCTWEPYGSKEEGLNHIKEKILPHPWFRA  73

Query  451  ICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLER  630
            IC+ G+ VG + V P  G D CRAEIGYAL SKYW KGI T+AVKM   ++F EW HLER
Sbjct  74   ICLDGRPVGVILVNPNSGNDRCRAEIGYALGSKYWRKGIVTRAVKMVVNTIFKEWTHLER  133

Query  631  LEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            LE +VDV N GSQRVLEKAGF+RE VLRK+Y+ KG   D V++S++S++
Sbjct  134  LEGLVDVNNVGSQRVLEKAGFQREGVLRKHYINKGRTIDEVIYSILSSE  182



>ref|XP_006450888.1| hypothetical protein CICLE_v10009635mg [Citrus clementina]
 ref|XP_006476118.1| PREDICTED: uncharacterized protein LOC102606951 [Citrus sinensis]
 gb|ESR64128.1| hypothetical protein CICLE_v10009635mg [Citrus clementina]
Length=185

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 120/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + SD ED + + SDD VT+FC+WE   S +    +  +    HPW++ IC
Sbjct  18   DLSSISLRPFDLSDVEDSMLWASDDQVTRFCTWE---SEDGINFFKNKVINNHPWFKAIC  74

Query  457  VKGKAVGSVTVKPFRG-CDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            +  K +G++ V P  G C+ CRA +GY +ASKYWGKGIAT+AVKM    +F EW HL+RL
Sbjct  75   LGNKPIGAILVTPNSGDCNKCRAILGYVVASKYWGKGIATRAVKMVTGIIFDEWPHLQRL  134

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            EA VDV+N  SQ+VL+KAGFKRE VLRKY  LKG  TD VMFSL+STD ++
Sbjct  135  EATVDVDNLASQKVLQKAGFKREGVLRKYITLKGKATDVVMFSLLSTDHKI  185



>ref|XP_004247668.2| PREDICTED: uncharacterized protein LOC101251328 [Solanum lycopersicum]
Length=302

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = +1

Query  271  GDDYSD---ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPW  441
             DDYSD   I+LRPL+ +D +D++E   DDNV+ F S EPF S E A +++ +     PW
Sbjct  71   ADDYSDSDMISLRPLDLTDVDDFMECYMDDNVSMFYSCEPFESKEEAMQHMVDFELTRPW  130

Query  442  YRGICVKGKAVGSVTVKPF-RGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWA  618
             R IC+  K +G++ V P  +   SCRAEIGY ++SKYWGKGIATKAVKM A+++FVEW 
Sbjct  131  NRAICLNDKVIGTICVTPLDQEWYSCRAEIGYEISSKYWGKGIATKAVKMVASTIFVEWP  190

Query  619  HLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
             L RLE VVDVEN  SQRVLEKAGF RE ++RKYYL  G P D VMFSL+STD
Sbjct  191  CLARLEGVVDVENPASQRVLEKAGFTREGIMRKYYLRDGEPRDMVMFSLLSTD  243



>ref|XP_008224289.1| PREDICTED: uncharacterized protein YIR042C-like [Prunus mume]
Length=177

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRPL  +D +D++ + +D+  + FC+WEP+ + E A  YI E    HPW+R IC
Sbjct  8    DLSKISLRPLGLADIDDFMVWGTDEKASIFCTWEPYATKEEALNYIKEKILPHPWFRAIC  67

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  + +G++ V    G D CR E+GY L SKYWGKGIAT+AVK+ A ++F EW HLERLE
Sbjct  68   LDNRPIGAILVTSNSGGDRCRGELGYVLGSKYWGKGIATQAVKLVADTIFKEWTHLERLE  127

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A VDV+N GSQRVLEK+GF RE VLRK+++LKG   D V+FSL+ST+
Sbjct  128  AFVDVDNVGSQRVLEKSGFLREGVLRKFFILKGRTRDTVIFSLLSTE  174



>ref|XP_004299034.1| PREDICTED: uncharacterized N-acetyltransferase p20-like [Fragaria 
vesca subsp. vesca]
Length=180

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LRPL  SD +D + + SD+ V  FC+WE +T+ E   K+I E    HPW+R IC+ 
Sbjct  12   SKISLRPLGVSDIDDVMVWASDEKVVLFCTWEAYTNKEDGIKFIKEHVVPHPWFRAICLD  71

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             K +G++++    G DSCR E+GY L SKYWGKGIAT+AV++ A ++F EWAHLERLEA+
Sbjct  72   NKPIGAISICTKPGNDSCRGELGYVLGSKYWGKGIATRAVRIVADTIFKEWAHLERLEAL  131

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            VDV N GSQRVLEKAGF++E VLRKY +LKG   D VM+SL+ +D
Sbjct  132  VDVNNVGSQRVLEKAGFQKEGVLRKYVVLKGRTCDMVMYSLLPSD  176



>emb|CDO99079.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 123/180 (68%), Gaps = 0/180 (0%)
 Frame = +1

Query  238  AMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyia  417
            A EP +  + F +    IT+RP E SD ++ + + +DD V+++C W+ +TS E A  YI 
Sbjct  2    AEEPSKLSEGFQESSEVITIRPTELSDVDELMVYLTDDQVSRYCIWDTYTSREQALDYIK  61

Query  418  edaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAA  597
              A  HPW + IC+  +A+G+++V P  G   CRAE+GY L   YWGKGI T+AVK  A+
Sbjct  62   NIAIPHPWSKVICIDNRAIGAISVTPNSGNSKCRAELGYVLGQYYWGKGIMTRAVKTVAS  121

Query  598  SVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            ++F EW +LERLEA VDV N+ SQRVLEK+GF+RE VLRKY +LKG   D VMFS +STD
Sbjct  122  AIFDEWPYLERLEATVDVNNKASQRVLEKSGFQREGVLRKYKMLKGYSRDVVMFSFLSTD  181



>ref|XP_004241046.1| PREDICTED: uncharacterized protein LOC101259756 [Solanum lycopersicum]
Length=193

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = +1

Query  250  QQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaa  429
            + S  + G +  +ITLRP+E +D +D++E+ +D+ V++FC+W+ +T  + A  YI  +A 
Sbjct  3    ETSSKSEGKEIDEITLRPIELTDVDDFMEWATDEKVSQFCTWDTYTCKDEALDYINNNAI  62

Query  430  aHPWYRGICVKGKAVGSVTVKPFRG-CDSCRAEIGYALASKYWGKGIATKAVKMAAASVF  606
             HPW R IC K +A+G+++V P  G  DSCRAE+GY LA KYWGKGI TKAVK+  +++F
Sbjct  63   LHPWLRVICTKNRAIGAISVTPNSGYLDSCRAELGYVLAYKYWGKGIVTKAVKIVVSNIF  122

Query  607  VEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
             EW  LER+EA VDV+N+GSQRVLEKAGF +E VLRK+  +KG   D  +FS++S D
Sbjct  123  KEWPDLERIEAFVDVDNKGSQRVLEKAGFLKEGVLRKFRTIKGRSRDMFIFSILSAD  179



>ref|XP_009602118.1| PREDICTED: uncharacterized protein LOC104097268 isoform X2 [Nicotiana 
tomentosiformis]
Length=171

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 123/168 (73%), Gaps = 3/168 (2%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            DI LRP+E SDA+D++ + +D+ V+ FC+W+ + S + A +++  +A  HPW++ IC+  
Sbjct  7    DIILRPIEISDADDFMLWAADEKVSHFCTWDTYNSKDQALEFLNTNAIPHPWFKAICINN  66

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            KA+GS++V P  G    RAE+GY LA KYWGKGI TKAVKM  + +F EW +LERLEA+V
Sbjct  67   KAIGSISVTPNSGT---RAELGYVLAYKYWGKGIVTKAVKMVTSIIFSEWPNLERLEALV  123

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVT  789
            DV+N GSQRVLEKA F +E VLRKY +LKG   D V+FS ++TD  ++
Sbjct  124  DVDNTGSQRVLEKASFFKEGVLRKYMVLKGRSRDMVIFSFLATDSPLS  171



>ref|XP_010906188.1| PREDICTED: uncharacterized protein LOC105033200 [Elaeis guineensis]
Length=183

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 118/166 (71%), Gaps = 0/166 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LRP   SD +D++ + SDD V+KFCSW+ +T+ +   KY+ E    HPW+R ICV G+
Sbjct  17   ISLRPFVLSDVDDFMVWASDDKVSKFCSWDTYTNKDDLLKYMKETVLPHPWFRAICVGGR  76

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             VG+++V    G D CR E+GY L S YWGKGI T AV++  AS+F+E   LER+EA+VD
Sbjct  77   PVGAISVILGSGNDRCRGELGYVLGSGYWGKGIVTAAVRLVVASIFMEVEGLERVEALVD  136

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            V N+ SQRVLEK GF +E VLRKY +LKG+  D VM+S ISTDP V
Sbjct  137  VTNKASQRVLEKVGFHKEGVLRKYMILKGSMRDMVMYSFISTDPLV  182



>gb|EYU41471.1| hypothetical protein MIMGU_mgv1a020258mg [Erythranthe guttata]
Length=167

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            ++ITLRP+E SD +D++ + +D+ VT+FC W  +TS E A  YI   A  HPW R IC+ 
Sbjct  2    TNITLRPIELSDVDDFMTWATDERVTRFCLWSTYTSKEQAVDYIKNHAIPHPWLRLICLD  61

Query  463  -GKAVGSVTVKPF--RGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
              +AVGS+TV P    G D CRA+IGY +A +YWG+GIAT AVK AAA++F EW HL RL
Sbjct  62   DNRAVGSITVTPCTDSGYDRCRAKIGYVVAHEYWGRGIATLAVKTAAAAIFKEWPHLRRL  121

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            E V DV+NRGSQRVLEK+GF+RE VLR Y  LKG   D VM+S++
Sbjct  122  EGVADVDNRGSQRVLEKSGFEREGVLRNYVELKGKIVDVVMYSIV  166



>ref|XP_008438654.1| PREDICTED: uncharacterized protein LOC103483697 [Cucumis melo]
Length=169

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLRPL+ +D +D++ + +D+   ++CSWEP+     A K+I +   +HP+YR ICV G
Sbjct  2    ELTLRPLDLTDIDDFMGWAADEKAARYCSWEPYQDKSEAIKFINDQVLSHPYYRAICVDG  61

Query  466  KAVGSVTVKPFRGC-DSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            + VG+++V       D CR E+GY L SK+WGKGI T AVK+ A  +FVEW  LERLEA+
Sbjct  62   RPVGAISVMSNTAARDKCRGELGYVLGSKFWGKGIGTAAVKLVAERIFVEWPELERLEAL  121

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            VDVEN  SQRVLEKAGF+RE VLRKY +LKGN  D VMFS + TD
Sbjct  122  VDVENFASQRVLEKAGFQREGVLRKYGVLKGNVRDYVMFSFLKTD  166



>ref|XP_010326726.1| PREDICTED: uncharacterized protein LOC101251034 [Solanum lycopersicum]
Length=278

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  274  DDYSDI-TLRPLEPSDAEDYLEFRSDDNVTKFCSWEP-FTSVEaaakyiaedaaaHPWYR  447
            DD SDI +L   + +D +D++E+ +DDNV KFCS +  F S E A +YIA     HPW+R
Sbjct  103  DDQSDIISLCLFDLTDVDDFMEWFTDDNVNKFCSRDTTFISKEDAMQYIAVVVIPHPWHR  162

Query  448  GICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
             IC+  K +GS+ V  F G D CR EIGY L+SKYWGKGI+T AVKM A+++FV+W HL 
Sbjct  163  AICLNDKPIGSIYVSSFHGSDICRGEIGYELSSKYWGKGISTMAVKMVASTIFVDWPHLA  222

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIS  771
            RLE VV V+N GSQRVLEK GF +E VLRKYY +KG   D VMFSLI+
Sbjct  223  RLEGVVAVDNIGSQRVLEKTGFIKEGVLRKYYYVKGKSIDLVMFSLIN  270



>ref|XP_009408784.1| PREDICTED: uncharacterized protein LOC103991148 [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +ITLR  + SD +DY+ + SDD VT FC W+ +T  E   +Y+ E    HPW+R IC+ G
Sbjct  35   EITLRRFDLSDLDDYMVWASDDRVTAFCRWDSYTDKEDLRRYMRETVLPHPWFRAICLGG  94

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G+++V    GCD C+ E+GY LA+ +WG+G AT AVKMA  SVF E   LER+EA+V
Sbjct  95   RPIGALSVDLGVGCDRCKGELGYVLATAHWGRGYATAAVKMAVRSVFQEVEGLERVEALV  154

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            DV+N+GSQRVLEKAGF RE VLRK  + KG   D VMFS ISTD  V
Sbjct  155  DVDNKGSQRVLEKAGFVREGVLRKSMVSKGRTRDLVMFSFISTDASV  201



>ref|XP_010096156.1| putative N-acetyltransferase YoaA [Morus notabilis]
 gb|EXB63472.1| putative N-acetyltransferase YoaA [Morus notabilis]
Length=190

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 111/160 (69%), Gaps = 0/160 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LR  + SD +D+  +  D+ V +FCSWE   S E   + +      HPW + IC+  K
Sbjct  26   ISLRAFDLSDVDDFTSWAGDEKVCRFCSWEARFSKENGLELLKSRIFYHPWCKSICLGDK  85

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G ++V P  G D CRAEIGY++ S YW KGIAT AVK+ A ++F EW HLERLEA+VD
Sbjct  86   SIGDISVTPNSGSDRCRAEIGYSVGSAYWNKGIATYAVKLVANAIFWEWPHLERLEALVD  145

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            VEN  SQRVLEKAGF+R+ VL+KYY+LKGN  D VM+S I
Sbjct  146  VENVASQRVLEKAGFERDGVLKKYYILKGNTRDMVMYSFI  185



>ref|XP_006360813.1| PREDICTED: uncharacterized protein LOC102586435 [Solanum tuberosum]
Length=174

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 118/164 (72%), Gaps = 1/164 (1%)
 Frame = +1

Query  289  ITLRPLEPSDA-EDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            I+LR L+ +D  +D++E+  D+NV+ F +   F + + A +YI +    HPW+R IC+ G
Sbjct  8    ISLRLLDQTDVVDDFMEWSLDENVSNFFTRGTFLTKKDAKRYITKFIVTHPWFRAICLNG  67

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            K +G + V P  G D  + EIGY L+SKYWGKGIATKAVKM AA++FVEW HL RLE +V
Sbjct  68   KPIGYICVSPDVGSDRFKGEIGYVLSSKYWGKGIATKAVKMVAATIFVEWPHLVRLEGMV  127

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +++N  SQRVLEKAGF RE VLRKYY+ K   +D VMFSL+STD
Sbjct  128  NIDNIRSQRVLEKAGFTREGVLRKYYIFKRKLSDLVMFSLLSTD  171



>ref|XP_009141208.1| PREDICTED: uncharacterized protein LOC103865178 [Brassica rapa]
 emb|CDY60956.1| BnaA04g28860D [Brassica napus]
Length=199

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I LRP+  SD +D++ + +D NVT+FC+WEP+TS EA   YI      HPW R IC+   
Sbjct  36   IHLRPMTLSDIDDFMVWATDINVTRFCTWEPYTSQEAGIAYINSFVLPHPWLRAICLDDD  95

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            +A+GS++V P    DS R EIGY + SKYWGKGIAT+AV++ AA +F E   +ERLEA+V
Sbjct  96   RAIGSISVTP---VDSIRGEIGYVIGSKYWGKGIATEAVRLVAAEIFKEMPEMERLEALV  152

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+RK+  LKGN  D VMFS + +D
Sbjct  153  DVDNVGSQKVLEKVGFVREGVMRKFMCLKGNVRDMVMFSFLPSD  196



>ref|XP_010259083.1| PREDICTED: uncharacterized protein LOC104598621 [Nelumbo nucifera]
Length=185

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = +1

Query  274  DDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGI  453
            ++ SDI+LRPL  +D +D + + +DD V +FC W+ +TS E A  Y+ + A  HPW R I
Sbjct  15   EELSDISLRPLVLADVDDLMVWVTDDQVARFCRWDTYTSREDALNYMRDVAILHPWLRAI  74

Query  454  CVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            C+K + +GS++V    G + CR E+ YALAS++WG+G+AT+AVKM  +SVF ++ +LERL
Sbjct  75   CLKNRPIGSISVTSGFGNEKCRGELSYALASEHWGRGLATQAVKMVVSSVFHDFPYLERL  134

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            EA+VD EN  SQRVLEK GF RE  LRKY ++KG+  D VM+SL+S D
Sbjct  135  EALVDSENLRSQRVLEKVGFTREGFLRKYLIVKGSSRDIVMYSLLSAD  182



>ref|XP_004134133.1| PREDICTED: uncharacterized N-acetyltransferase YoaA-like [Cucumis 
sativus]
 ref|XP_004164323.1| PREDICTED: uncharacterized N-acetyltransferase YoaA-like [Cucumis 
sativus]
 gb|KGN56965.1| hypothetical protein Csa_3G146510 [Cucumis sativus]
Length=169

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 116/165 (70%), Gaps = 1/165 (1%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLRPL+ +D +D++ + +D+   ++CSWEP+     A K+I +   +HP+YR ICV G
Sbjct  2    ELTLRPLDLTDIDDFMGWATDEKAARYCSWEPYQDKSEAIKFINDQVLSHPYYRAICVDG  61

Query  466  KAVGSVTVKPFRGC-DSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            + VG+++V       D CR E+GY L SK+WGKGI T AVK+    +FVEW  LERLEA+
Sbjct  62   RPVGAISVMSNTAARDKCRGELGYVLGSKFWGKGIVTAAVKLVMERIFVEWPELERLEAL  121

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            VDVEN  SQRV+EKAGF+RE VLRKY +LKG   D VMFS + TD
Sbjct  122  VDVENFASQRVMEKAGFQREGVLRKYGVLKGKVRDYVMFSFLKTD  166



>ref|XP_008804728.1| PREDICTED: uncharacterized protein LOC103717925 [Phoenix dactylifera]
Length=183

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LRP   SD +D++ + SDD V+KFCSW+ +T+ +   KY+ E    HPW+R ICV G+
Sbjct  17   ISLRPFVLSDVDDFMVWASDDKVSKFCSWDTYTNKDDLLKYVKETVLPHPWFRSICVGGR  76

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             VG+++V    G + CR E+GY L S+YWGKGI T AV++   S+F E   LER+ A+VD
Sbjct  77   PVGAISVSLGSGDERCRGELGYVLGSEYWGKGIVTAAVRLVVGSIFKEVEGLERVGALVD  136

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            V+N+ SQRVL+K GF +E VLRKY +LKG+  D VM+S ISTDP V
Sbjct  137  VDNKASQRVLQKVGFHKEGVLRKYVVLKGSIRDMVMYSFISTDPLV  182



>emb|CDY15350.1| BnaC04g42730D [Brassica napus]
Length=182

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I LRP+  SD +D++ + +D NVT+FC+WEP+TS EA   YI      HPW R IC+   
Sbjct  19   IHLRPMTLSDIDDFMVWATDINVTRFCTWEPYTSQEAGIAYINSFVLPHPWLRAICLDDD  78

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            +A+GS++V P    DS R EIGY + SKYWGKGIAT+AV++ AA +F E   +ERLEA+V
Sbjct  79   RAIGSISVTP---VDSIRGEIGYVIGSKYWGKGIATEAVRLVAAEIFKEKPEMERLEALV  135

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+RK+  LKGN  D VMFS + +D
Sbjct  136  DVDNIGSQKVLEKVGFVREGVMRKFMCLKGNVRDMVMFSFLPSD  179



>ref|XP_010542784.1| PREDICTED: uncharacterized protein LOC104815883 [Tarenaya hassleriana]
Length=204

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +++LRP++ SD +D++E+ +D  V +FC+WEP+TS EA   +I +    HPW R IC+ G
Sbjct  36   EVSLRPMDLSDIDDFMEWATDSKVARFCTWEPYTSREAGIAHIRDQILPHPWLRAICLAG  95

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            K +GS++V P    D  R ++GY + S YWG+GIAT AV++ AA VF +   + RLEA+V
Sbjct  96   KPIGSISVTP---VDKIRWKLGYVIGSGYWGRGIATAAVRLVAAEVFRDMPAMARLEALV  152

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVT  789
            D+EN GSQRVLEK GF RE VLRK+ L KG+  D VMFSL+  DP ++
Sbjct  153  DLENMGSQRVLEKVGFTREGVLRKFMLHKGSVRDMVMFSLLPDDPLLS  200



>ref|XP_006410340.1| hypothetical protein EUTSA_v10017278mg [Eutrema salsugineum]
 gb|ESQ51793.1| hypothetical protein EUTSA_v10017278mg [Eutrema salsugineum]
Length=189

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I LRP+  SD +D++ + +D NVT+FC+WEP+TS EA   +I +    HPW R IC+   
Sbjct  26   IHLRPMTLSDIDDFMVWATDTNVTRFCTWEPYTSREAGMAFINDVVLPHPWLRAICLDND  85

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS++V P    D  R EIGY + SKYWGKGIAT+AV++ AA +F E   +ERLEA+V
Sbjct  86   RPIGSISVTP---VDKIRGEIGYVIGSKYWGKGIATEAVRLVAAEIFKEKPEMERLEALV  142

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+RK+  LKGN  D VMFS + +D
Sbjct  143  DVDNVGSQKVLEKVGFVREGVMRKFMYLKGNVRDMVMFSFLPSD  186



>ref|XP_002881212.1| hypothetical protein ARALYDRAFT_902252 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57471.1| hypothetical protein ARALYDRAFT_902252 [Arabidopsis lyrata subsp. 
lyrata]
Length=188

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 116/164 (71%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I LRP+  SD +D++ + +D +V +FC+WEP+TS EAA  ++ + A  HPW R IC+   
Sbjct  25   IHLRPMTLSDVDDFMVWATDSDVARFCTWEPYTSREAAIAFLNDVALPHPWLRAICLDND  84

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS++V P    D  R EIGY L SKYWGKGIAT+AV++ AA +F E   +ERLEA+V
Sbjct  85   RPIGSISVTP---VDKIRGEIGYVLGSKYWGKGIATEAVRLVAAEIFKEKPEMERLEALV  141

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQRVLEK GF RE V+RK+  LKGN  D VMFS + +D
Sbjct  142  DVDNVGSQRVLEKVGFVREGVMRKFMYLKGNVRDMVMFSFLPSD  185



>ref|XP_009602115.1| PREDICTED: uncharacterized protein LOC104097268 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602117.1| PREDICTED: uncharacterized protein LOC104097268 isoform X1 [Nicotiana 
tomentosiformis]
Length=171

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 113/154 (73%), Gaps = 3/154 (2%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            DI LRP+E SDA+D++ + +D+ V+ FC+W+ + S + A +++  +A  HPW++ IC+  
Sbjct  7    DIILRPIEISDADDFMLWAADEKVSHFCTWDTYNSKDQALEFLNTNAIPHPWFKAICINN  66

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            KA+GS++V P  G    RAE+GY LA KYWGKGI TKAVKM  + +F EW +LERLEA+V
Sbjct  67   KAIGSISVTPNSGT---RAELGYVLAYKYWGKGIVTKAVKMVTSIIFSEWPNLERLEALV  123

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTD  747
            DV+N GSQRVLEKA F +E VLRKY +LKG   D
Sbjct  124  DVDNTGSQRVLEKASFFKEGVLRKYMVLKGRSRD  157



>ref|XP_010259080.1| PREDICTED: uncharacterized protein LOC104598618 [Nelumbo nucifera]
Length=189

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 122/175 (70%), Gaps = 0/175 (0%)
 Frame = +1

Query  274  DDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGI  453
            ++ SDI+LRPL  +D +D + + +DD V  FC W+ + S E A  YI + A  HPW R I
Sbjct  15   EELSDISLRPLVLADMDDLMVWVTDDQVAHFCRWDTYKSREDALNYIRDVAIPHPWLRAI  74

Query  454  CVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            C+K + +GS++V P  G + CR E+ YALAS++WG+G+AT+AVKM  +S+F ++  LERL
Sbjct  75   CLKNRPIGSISVTPGSGNEKCRGELSYALASEHWGQGLATQAVKMVVSSLFHDFPDLERL  134

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTFFM  798
            EA+VD  N  SQRVLEK GF RE +LRKY ++KG+  D VM+S++S D +   F+
Sbjct  135  EALVDSRNLRSQRVLEKVGFTREGILRKYRIVKGSSRDLVMYSILSVDLKSLSFV  189



>ref|XP_008777144.1| PREDICTED: uncharacterized protein LOC103697125 [Phoenix dactylifera]
Length=176

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +1

Query  289  ITLRPLEPS--DAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            ITLRP EPS  D E  + + SD  VT+F    P+ +   A  YI +    HPWYR ICV 
Sbjct  9    ITLRPFEPSESDVEAMMTWASDPRVTRFQRRGPYATASDALHYIIDHVLPHPWYRAICVD  68

Query  463  -GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEA  639
             G+ VGS++V P    D CRA +GY LA  YWG+GI T A++ AAA+VF EW  LERLEA
Sbjct  69   DGRPVGSISVNPVPN-DPCRASVGYRLAYDYWGRGIVTAALRGAAATVFEEWPFLERLEA  127

Query  640  VVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            V DVEN  SQRVLEKAGF+RE VLRKY +LKG   D VMFSL++TDP
Sbjct  128  VADVENPASQRVLEKAGFQREGVLRKYIMLKGERRDMVMFSLLATDP  174



>ref|XP_010259077.1| PREDICTED: uncharacterized protein LOC104598617 [Nelumbo nucifera]
 ref|XP_010259078.1| PREDICTED: uncharacterized protein LOC104598617 [Nelumbo nucifera]
 ref|XP_010259079.1| PREDICTED: uncharacterized protein LOC104598617 [Nelumbo nucifera]
Length=174

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRP   +D +D++ + SDD VT F  W  F+S E A  YI +    HPW R IC
Sbjct  4    NLSSITLRPFRLTDLDDFMVWASDDQVTHFMRWNTFSSREEALNYIRDVCIPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G ++VKP  G D CRAE+GYA+A KYWG+GIAT+A+KMA + VF +  +L RL+
Sbjct  64   LDDRSIGFISVKPASGNDYCRAEVGYAIAFKYWGQGIATRALKMALSCVFKDMPYLVRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VD++N+ S+RVLEKAGF +E VLRKY LLK    D  ++S +STD
Sbjct  124  ALVDIDNKASERVLEKAGFLKEGVLRKYCLLKSGVKDLAIYSFLSTD  170



>ref|XP_006433080.1| hypothetical protein CICLE_v10002694mg [Citrus clementina]
 gb|ESR46320.1| hypothetical protein CICLE_v10002694mg [Citrus clementina]
 gb|KDO53335.1| hypothetical protein CISIN_1g030910mg [Citrus sinensis]
Length=169

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +ITLRP + SD +D++ +  D+NVTK+C W  FT  + A  ++ E   +HPWYR ICVK 
Sbjct  6    EITLRPFKISDVDDFMGWAGDENVTKYCRWNTFTFRDDAVAFLKEVIKSHPWYRAICVKD  65

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS+ V P  G D  R EIGYA+++KYWGKG+AT+AVK+A A  F E  +L+R+E +V
Sbjct  66   RPIGSIYVMPGIGKDERRGEIGYAISAKYWGKGVATEAVKIAVACAFKELKYLDRIEGLV  125

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
              EN+ SQRV+EKAGF RE +LRKY+ +KG   D V+FS +  D
Sbjct  126  FSENKASQRVMEKAGFIREGLLRKYFFVKGKSVDIVVFSTVEAD  169



>ref|XP_008804727.1| PREDICTED: uncharacterized protein LOC103717924 [Phoenix dactylifera]
Length=183

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 116/166 (70%), Gaps = 0/166 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LRP   SD +D++ + SDD V+KFC+W+ +T+ +   KY+ E    HPW+R ICV G+
Sbjct  17   ISLRPFVLSDVDDFMVWASDDKVSKFCTWDTYTNKDDLLKYVKETVLPHPWFRSICVGGR  76

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             VG+++V    G +  R E+GY L S+YWGKGI T AV++   S+F E   LER+ A+VD
Sbjct  77   PVGAISVSLGSGEERFRGELGYVLGSEYWGKGIVTAAVRLVVGSIFKEVEGLERVSALVD  136

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            V+N+ SQRVL+K GF +E VLRKY +LKG+  D VM+S ISTDP V
Sbjct  137  VDNKASQRVLQKVGFHKEGVLRKYAILKGSIRDMVMYSFISTDPLV  182



>ref|XP_006360812.1| PREDICTED: uncharacterized protein LOC102586105 [Solanum tuberosum]
Length=181

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LR LE SD +D++E+ SDDNV+KF     F S E AA +IA+      W+R IC+ GK
Sbjct  9    ISLRLLEVSDVDDFMEWSSDDNVSKFSQERTFKSKEDAASHIAKFIVPQRWFRAICLNGK  68

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             +G ++V PF G    + EI Y L+SKYWG+GIATKAVKM AA++F++W  L  LE  VD
Sbjct  69   PIGYISVSPFGGSYKSKGEIKYVLSSKYWGRGIATKAVKMMAATIFIDWPQLASLEGKVD  128

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSL  765
            +EN GSQRVLEKAGF +E V RKYY  KG  +D VM SL
Sbjct  129  IENTGSQRVLEKAGFTKEVVFRKYYFFKGKLSDLVMLSL  167



>ref|NP_180763.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis 
thaliana]
 gb|AAK17146.1|AF325078_1 putative alanine acetyl transferase [Arabidopsis thaliana]
 gb|AAD15401.1| putative alanine acetyl transferase [Arabidopsis thaliana]
 gb|ABD60717.1| At2g32030 [Arabidopsis thaliana]
 gb|AEC08624.1| GCN5-related N-acetyltransferase-like protein [Arabidopsis thaliana]
Length=188

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I LRP+  SD +D++ + +D NVT+FC+WEP+TS EAA  Y+ +    HPW R IC+   
Sbjct  25   IHLRPMTLSDVDDFMVWATDSNVTRFCTWEPYTSREAAIAYLNDALLPHPWLRAICLDND  84

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS++V P    D  R EIGY L SKYWGKGIAT+AV++ A  +F E   ++RLEA+V
Sbjct  85   RPIGSISVTP---VDEIRGEIGYVLGSKYWGKGIATEAVRLVAGEIFKEKPEMQRLEALV  141

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF +E V+RK+  LKGN  D VMFS + +D
Sbjct  142  DVDNVGSQKVLEKVGFVKEGVMRKFMYLKGNVRDMVMFSFLPSD  185



>gb|KDO80196.1| hypothetical protein CISIN_1g043366mg, partial [Citrus sinensis]
Length=145

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 4/148 (3%)
 Frame = +1

Query  346  DDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKAVGSVTVKPFRG-CDSCRA  522
            DD VT+FC+WE   S +    +  +    HPW++ IC+  K +G++ V P  G C+ CRA
Sbjct  1    DDQVTRFCTWE---SEDGINFFKNKVINNHPWFKAICLGNKPIGAILVTPNSGDCNKCRA  57

Query  523  EIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKRE  702
             +GY +ASKYWGKGIAT+AVKM    +F EW HL+RLEA VDV+N  SQ+VL+KAGFKRE
Sbjct  58   ILGYVVASKYWGKGIATRAVKMVTGIIFDEWPHLQRLEATVDVDNLASQKVLQKAGFKRE  117

Query  703  AVLRKYYLLKGNPTDAVMFSLISTDPEV  786
             VLRKY  LKG  TD VMFSL+STD ++
Sbjct  118  GVLRKYITLKGKATDVVMFSLLSTDHKI  145



>ref|XP_008224291.1| PREDICTED: uncharacterized protein LOC103324033 [Prunus mume]
Length=174

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +ITLRP  PSDAED+L +  D+ VT+F  W  FTS E A  YI +    HP+ R IC+  
Sbjct  8    EITLRPYRPSDAEDFLTYAGDEKVTQFTRWNTFTSKEEALSYIKDFCIPHPYCRSICIHD  67

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            +++G + +KP  G D CRAE+GYALA++YWG+GIAT+AVKMA +  F E   L R++A+V
Sbjct  68   RSIGFLFIKPQGGDDKCRAEVGYALAAEYWGQGIATRAVKMAISDGFKELTDLVRMQALV  127

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
             VEN+ SQRVLEK GF +E +LRKY   KG   D  M+SL+S+D
Sbjct  128  LVENKASQRVLEKLGFYKEGLLRKYTFHKGAVQDVFMYSLLSSD  171



>ref|XP_010916800.1| PREDICTED: uncharacterized protein LOC105041549 [Elaeis guineensis]
Length=256

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D +D+ LRP   SD +D++ + SDD V+KFC W+ +T+ +   KY+ E    HPW+R IC
Sbjct  87   DTADL-LRPFVLSDVDDFMVWASDDKVSKFCRWDTYTNKDGLLKYMKETVLPHPWFRAIC  145

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V G+ VG+++V    G D CR E+GYAL S+YWGKGIAT  V++   S+F+E   LER+E
Sbjct  146  VGGRLVGAISVILGSGNDRCRGELGYALGSEYWGKGIATAKVRLVVGSIFMEVEGLERVE  205

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            A+VDV    SQRVLEK GF++E VLRKY  LKG+  D VM+S IST+P
Sbjct  206  ALVDVTKEASQRVLEKVGFRKEGVLRKYTSLKGSRRDMVMYSFISTEP  253



>ref|XP_010414037.1| PREDICTED: uncharacterized protein LOC104700253 [Camelina sativa]
Length=186

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I LRP+  SD +D++ + +D  VT++C+WEP TS EAA  Y+      HPW R IC++  
Sbjct  23   IHLRPMTLSDIDDFMVWATDSKVTRYCTWEPHTSKEAAISYLNNVLLPHPWLRAICLEND  82

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS++V P    D  R EIGY + SKYWGKGIAT+AV++ AA +F +   +ERLEA+V
Sbjct  83   RPIGSISVTP---VDEIRGEIGYLIGSKYWGKGIATEAVRLVAAEIFKDKPEMERLEALV  139

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+RK+  LKGN  D VMFSL+ +D
Sbjct  140  DVDNVGSQKVLEKVGFVREGVMRKFMYLKGNVRDMVMFSLLPSD  183



>gb|AFK39517.1| unknown [Lotus japonicus]
Length=179

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 113/171 (66%), Gaps = 3/171 (2%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            + I+LRPL+ SD +D + + +D+ V KFC+WE +TS E    +I   A+   W + IC+ 
Sbjct  9    NQISLRPLQLSDLDDVMVWTTDEKVAKFCTWETYTSKEDGINFIENIASKFLWCKAICLD  68

Query  463  GKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
             +A+G V++  +   D CR   AE+GY + SKYWGKGI T  VK    + F E   LERL
Sbjct  69   DRAIGCVSLSSYAEHDKCRNKSAELGYVMGSKYWGKGIVTNVVKRVVKAAFTELPQLERL  128

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            EA+VDVEN GSQ+VLEKAGF RE VLRKY  +KG   D VMFS++S DP+V
Sbjct  129  EALVDVENVGSQKVLEKAGFYREGVLRKYLFIKGKSRDMVMFSVLSNDPQV  179



>ref|XP_010256364.1| PREDICTED: uncharacterized protein LOC104596777 [Nelumbo nucifera]
Length=172

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + SD +D++ +  DD VTK   W+ FTS E A  YI +    HPW R IC
Sbjct  2    DPSRISLRPFKLSDVDDFMVWAGDDQVTKHLRWKTFTSREDALNYIKDVCIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  ++VG ++V P  G D  RA++GYALA+KYWG+GIAT AVKMA   VF +  HL RL+
Sbjct  62   LDDRSVGFISVMPASGDDIHRADMGYALAAKYWGQGIATIAVKMALGCVFKDIPHLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVT  789
            A+ +VENR SQRVLEKAGF +E VLRKY  LKG   D V++S I T+  + 
Sbjct  122  AMTNVENRASQRVLEKAGFTKEGVLRKYGFLKGKINDLVIYSFICTETLIN  172



>ref|XP_009144033.1| PREDICTED: uncharacterized protein LOC103867686 [Brassica rapa]
Length=184

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 113/165 (68%), Gaps = 4/165 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FCSWEP TS E A KYI +    HPW R IC++  
Sbjct  21   ISLRPMTLSDVDDYMVWATDAEVARFCSWEPCTSREEAIKYITDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + V P    D+ R EIGY LA KYWGKG AT+AV++  A +F E   +ERLEA+V
Sbjct  81   RPIGYILVMP---VDNIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEMPEIERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            DV+N GSQRVLEK GF RE V+R Y ++KG+  D VMFS + +DP
Sbjct  138  DVDNMGSQRVLEKVGFTREGVMRNYIIMKGSVRDMVMFSFLPSDP  182



>ref|XP_009141207.1| PREDICTED: uncharacterized protein LOC103865176 [Brassica rapa]
 emb|CDY60958.1| BnaA04g28870D [Brassica napus]
Length=184

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 113/165 (68%), Gaps = 4/165 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FCSWEP TS E A KYI +    HPW R IC++  
Sbjct  21   ISLRPMTLSDVDDYMVWATDAKVARFCSWEPCTSREEAIKYITDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + + P    D  R EIGY LA KYWGKG AT+AV++  A VF E   +ERLEA+V
Sbjct  81   RPIGYILIMP---VDKIRKEIGYVLARKYWGKGFATEAVRLVTAEVFKEMPEVERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            DV+N GSQRVLEK GF RE V+RK+ ++KG+  D VMFS + TDP
Sbjct  138  DVDNVGSQRVLEKVGFTREGVMRKFIVMKGSVRDMVMFSFLPTDP  182



>ref|XP_010510107.1| PREDICTED: uncharacterized protein LOC104786393 [Camelina sativa]
Length=184

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I LRP+  SD +D++ + +D  VT++C+WEP  S EAA  ++      HPW R IC++  
Sbjct  21   IHLRPMTLSDIDDFMVWATDSKVTRYCTWEPHMSKEAAISHLNNVVLPHPWLRAICLEND  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS++V P    D  R EIGY + SKYWGKGIAT+AV++ AA +F E   +ERLEA+V
Sbjct  81   RPIGSISVTP---VDEIRGEIGYLIGSKYWGKGIATEAVRLVAAEIFKEKPEMERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+R +  LKGN  D VMFSL+ +D
Sbjct  138  DVDNVGSQKVLEKVGFVREGVMRNFMYLKGNVRDMVMFSLLPSD  181



>ref|XP_010024259.1| PREDICTED: uncharacterized protein LOC104414784 [Eucalyptus grandis]
 gb|KCW60713.1| hypothetical protein EUGRSUZ_H03446 [Eucalyptus grandis]
Length=187

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LRPL+ SD +D++ + +D +V +FC WEP+TS + A  YIA     HP++R IC+ G+
Sbjct  20   ISLRPLQLSDVDDFMVWATDPDVARFCRWEPYTSRDDALAYIAGTVLPHPYHRAICLDGR  79

Query  469  AVGSVTVKPFR-GCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFV-EWAHLERLEAV  642
             VG V V+      D+CR E+GY L S YWG+GI T+AV++A A VF      LER+EAV
Sbjct  80   PVGVVAVERNEVARDACRGELGYVLGSGYWGRGIMTEAVRLAVAEVFGGARPELERVEAV  139

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            VDVEN+ SQ+VLEKAGF+RE V++KY++LKG   DAVMFS ++TD
Sbjct  140  VDVENKASQKVLEKAGFRREGVMKKYFVLKGKTRDAVMFSRLATD  184



>emb|CDY42093.1| BnaA05g10930D [Brassica napus]
Length=184

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 113/165 (68%), Gaps = 4/165 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FCSWEP TS E A KYI +    HPW R IC++  
Sbjct  21   ISLRPMTLSDVDDYMVWATDAEVARFCSWEPCTSREEAIKYITDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + + P    D+ R EIGY LA KYWGKG AT+AV++  A +F E   +ERLEA+V
Sbjct  81   RPIGYILIMP---VDNIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEMPEIERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            DV+N GSQRVLEK GF RE V+R Y ++KG+  D VMFS + +DP
Sbjct  138  DVDNVGSQRVLEKVGFTREGVMRNYIIMKGSVRDMVMFSFLPSDP  182



>ref|XP_006295070.1| hypothetical protein CARUB_v10024139mg [Capsella rubella]
 gb|EOA27968.1| hypothetical protein CARUB_v10024139mg [Capsella rubella]
Length=184

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 114/164 (70%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            + LRP+  SD  D++ + +D  VT++C+WEP+TS EA  +Y+      HPW R IC++  
Sbjct  21   VHLRPMTLSDINDFMVWATDSKVTRYCTWEPYTSKEAGIEYMNNVILPHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS++V P    D  R EIGY L SKYWG+GIAT+AV++ AA +F E   +ERLEA+V
Sbjct  81   RPIGSISVTP---VDKIRGEIGYLLGSKYWGRGIATEAVRLVAAEIFKEKPDMERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DVEN GSQ+VLEK GF RE V+RK+  LKG+  D VMFS + +D
Sbjct  138  DVENVGSQKVLEKVGFVREGVMRKFMYLKGDVRDMVMFSFLPSD  181



>gb|AFK47627.1| unknown [Lotus japonicus]
Length=179

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 110/171 (64%), Gaps = 3/171 (2%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            + I+LRPL  SD +D + + +D+ V KFC+WE +TS E    +I   A    W + IC+ 
Sbjct  9    TQISLRPLHLSDLDDVMVWTTDEKVPKFCTWETYTSKEDGINFIENIATKFLWCKAICLD  68

Query  463  GKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
             +AVG V +  +   D CR   AE+GY L SKYWGKGIAT  VK     VF E  HLERL
Sbjct  69   DRAVGFVHLSSYAEHDKCRIKSAELGYVLGSKYWGKGIATYVVKQVVKDVFSELPHLERL  128

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            EA+VDVEN GS RVLEKAGF+RE VL+KY   KG   D VMFS++STD  V
Sbjct  129  EALVDVENVGSLRVLEKAGFQREGVLKKYLFFKGKSRDMVMFSVLSTDLNV  179



>ref|XP_010469638.1| PREDICTED: uncharacterized protein LOC104749662 [Camelina sativa]
Length=183

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 114/164 (70%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I +RP+  SD +D++ + +D  VT++C+W+P TS EA   Y+      HPW R IC++  
Sbjct  20   IHVRPMTLSDIDDFMVWATDSKVTRYCTWKPHTSKEATISYLNNVVLPHPWLRAICLEND  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +GS++V P    D  R EIGY + SKYWGKGIAT+AV++ AA +F +   +ERLEA+V
Sbjct  80   RPIGSISVTP---VDEIRGEIGYLIGSKYWGKGIATEAVRLVAAEIFKDKPEMERLEALV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+RK+  LKGN  D VMFSL+ +D
Sbjct  137  DVDNVGSQKVLEKVGFVREGVMRKFMYLKGNVRDMVMFSLLPSD  180



>ref|XP_010256098.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104596565 
[Nelumbo nucifera]
Length=185

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S+ITLRP   SD +D++    DD VT+F  W  FTS E +  YI +    HPW R I 
Sbjct  4    DLSNITLRPFRLSDLDDFMGXAGDDQVTRFIRWNTFTSKEESLNYIKDVCIPHPWRRSIY  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G ++VK   G D CRA+IGYA+A +YWGKGIAT A+KMA + VF +   L RL+
Sbjct  64   LDDRSIGFISVKSASGDDYCRADIGYAVAFEYWGKGIATAALKMAVSGVFKDMPGLVRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VD++N+ SQRVLEK GF +E VLRKY LLKG   D V++S + TD
Sbjct  124  ALVDIDNKASQRVLEKVGFLKEGVLRKYCLLKGRIRDLVIYSFLCTD  170



>emb|CDY71229.1| BnaA05g34970D [Brassica napus]
Length=184

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 113/165 (68%), Gaps = 4/165 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FCSWEP TS E A KYI +    HPW R IC++  
Sbjct  21   ISLRPMTLSDVDDYMVWATDAEVARFCSWEPCTSREEAIKYITDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + + P    D+ R EIGY LA KYWGKG AT+AV++  A +F E   +ERLEA+V
Sbjct  81   RPIGYILIMP---VDNIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEMPEIERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            DV+N GSQRVLEK GF RE V+R + ++KG+  D VMFS + +DP
Sbjct  138  DVDNVGSQRVLEKVGFTREGVMRNFIIMKGSVRDMVMFSFLPSDP  182



>emb|CDY15351.1| BnaC04g42720D [Brassica napus]
Length=184

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FCSWEP TS E A KYI +    HPW R IC++  
Sbjct  21   ISLRPMTLSDVDDYMVWATDAEVARFCSWEPCTSREEAIKYITDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + + P    D  R EIGY LA KYWGKG AT+AV++  A VF     +ERLEA+V
Sbjct  81   RPIGYILIMP---VDKIRKEIGYVLARKYWGKGFATEAVRLVTAEVFKAMPEVERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            DV+N GSQRVLEK GF RE V+RK+ ++KG+  D VMFS + TDP
Sbjct  138  DVDNVGSQRVLEKVGFTREGVMRKFIVMKGSVRDMVMFSFLPTDP  182



>ref|XP_010026944.1| PREDICTED: uncharacterized protein LOC104417346 [Eucalyptus grandis]
 gb|KCW60712.1| hypothetical protein EUGRSUZ_H03445 [Eucalyptus grandis]
Length=183

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = +1

Query  241  MEPQQ---SPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaaky  411
            ME Q+   +P + G   S I+LRPL+ SD +D++ + +D  V +FC WEP+TS +    Y
Sbjct  1    MEEQKQKTAPTSGGSGGSKISLRPLQLSDVDDFMVWATDPEVARFCRWEPYTSRDDGLAY  60

Query  412  iaedaaaHPWYRGICVKGKAVGSVTV-KPFRGCDSCRAEIGYALASKYWGKGIATKAVKM  588
            IA  A  HP++R IC+ G+ VG ++V +     ++CR E+ YAL S YWG+GIA +AV+M
Sbjct  61   IAGTALPHPYFRAICLDGRPVGCLSVTRNEDRMEACRGELSYALGSGYWGRGIAAEAVRM  120

Query  589  AAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            A A VF E   LER+EA+V  EN+ SQRVLEKAGF RE +LRKY ++KG   DA MFS +
Sbjct  121  AVAEVFGERPELERVEAIVYAENKASQRVLEKAGFTREGLLRKYVVIKGRTRDAFMFSRL  180

Query  769  STD  777
            STD
Sbjct  181  STD  183



>ref|XP_010326725.1| PREDICTED: uncharacterized protein LOC104649389 [Solanum lycopersicum]
Length=174

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LR LE SDA D++E+ SD+N+ KF     F S E A  ++A+      W+R IC+ G 
Sbjct  8    ISLRLLEASDAGDFMEWCSDENINKFSQQRTFKSKEDAMIHLAKYIVPRRWFRAICLNGN  67

Query  469  AVGSVTVKPFR-GCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
             +G ++V P R G D  + EI Y L+SKYWG+GIATKAVKM  A++FV+   + RLE  V
Sbjct  68   PIGYISVSPLRDGSDKSKGEIKYVLSSKYWGRGIATKAVKMMVATIFVDSPLMNRLEGKV  127

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            D+EN GSQRVLEKAGF +E VLR+YY   G  +D V+FSL+ TD
Sbjct  128  DIENIGSQRVLEKAGFTKECVLRRYYYFNGKLSDLVIFSLLPTD  171



>ref|XP_010096154.1| putative N-acetyltransferase p20 [Morus notabilis]
 gb|EXB63470.1| putative N-acetyltransferase p20 [Morus notabilis]
Length=171

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 110/167 (66%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRPL+ SDA D LE+  DD VT+   W   TS+E A  YI + A  HPWYR IC
Sbjct  2    DSSRISLRPLKLSDANDLLEWAGDDRVTRHSRWNTITSIEEALAYIEKFATPHPWYRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G ++VKP  G D CRA + Y L + +WGKGI T A++M  + VF E+  L RLE
Sbjct  62   LDDRSIGFISVKPESGEDRCRAHVSYVLGADHWGKGITTTALRMTISLVFKEFHDLVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
             VV++EN  SQRVLEKAGF +E  LRKY   KG   D  ++SL+STD
Sbjct  122  TVVEIENSASQRVLEKAGFLKEGHLRKYGFSKGEIKDVFVYSLLSTD  168



>ref|XP_009398545.1| PREDICTED: uncharacterized protein LOC103983102 [Musa acuminata 
subsp. malaccensis]
Length=189

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +ITLRP + SD   ++ + SD  VT+F    P TS E A +Y+A+    HPWYR ICV G
Sbjct  20   EITLRPFDLSDVGAFMTWASDPRVTRFQRRGPCTSEEDARRYLADHVLPHPWYRAICVDG  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + VGS+  KP +G +  +A + Y LA ++WG+GIAT A++ A +S+  EW HLERLEA+ 
Sbjct  80   RPVGSINAKPGQGEERFKASVAYRLAYQHWGRGIATAALRAAVSSLLEEWPHLERLEAIA  139

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            +VEN  SQRVLEKAGF RE +LRKY +L G   D VM+SL++T P
Sbjct  140  EVENPASQRVLEKAGFLREGLLRKYVMLHGKSRDVVMYSLLATGP  184



>ref|XP_004135660.1| PREDICTED: uncharacterized N-acetyltransferase YoaA-like [Cucumis 
sativus]
 ref|XP_004157280.1| PREDICTED: uncharacterized N-acetyltransferase YoaA-like [Cucumis 
sativus]
 gb|KGN66155.1| hypothetical protein Csa_1G574230 [Cucumis sativus]
Length=173

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRP E SD +D++ +  DD V KF  W  FTS E A  +I +    HPW R IC
Sbjct  6    ELSRITLRPFELSDVDDFMVWAGDDRVMKFIRWNVFTSKEQAHDFIRDVCIPHPWRRSIC  65

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V G++VG V+V P+ G D C+A++GYA+A +YWG+GIAT+A++MA   VF  +  + RL+
Sbjct  66   VDGRSVGFVSVYPWSGEDRCKADVGYAVAREYWGRGIATEALRMAVPKVFERFPDVVRLQ  125

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A V  ENR SQRV+EK GF++E +LRKY  +KG   D +++S +S+D
Sbjct  126  AFVYTENRASQRVVEKVGFQKEGILRKYCYIKGEIMDLIVYSFLSSD  172



>ref|XP_011026785.1| PREDICTED: uncharacterized protein LOC105127253 [Populus euphratica]
Length=171

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + SD +D+L++ SDD VT++  W   TS E A  ++ +    HPW R IC
Sbjct  2    DSSRISLRPFKLSDVDDFLKWASDDRVTRYLRWNSITSREEALAHLEKVVIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++ P    D CRA  GYALA++YWG+GIAT A KMA +SVF +  +L RL+
Sbjct  62   LDDRSIGYISIFPESNDDRCRANFGYALAAEYWGQGIATIASKMAVSSVFQDLPYLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+VENR SQRVLEK GF +E +LRKY   KG   D +++S +STD
Sbjct  122  ALVEVENRSSQRVLEKTGFVKEGLLRKYGYCKGEIRDMLVYSFLSTD  168



>gb|KEH43818.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=190

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 114/173 (66%), Gaps = 5/173 (3%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP+  SD +D L + SD+ V K+C+WEP+T+ E    +I   A+   W+R IC
Sbjct  20   DLSQISLRPISLSDLDDVLVWTSDEKVAKYCTWEPYTNKEDCIDFIQNIASKSLWFRAIC  79

Query  457  VKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            +  +A+G +        D CR   AE+GYA++SKYWGKGIAT  VK    + F E+ +LE
Sbjct  80   LCNQAIGCIDF--CLSSDRCRNKSAELGYAMSSKYWGKGIATLVVKQVVEAAFKEFPYLE  137

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            RLEA VDVEN  SQRVLEKAGF+RE VLRKY   KG   D VMFS++S + ++
Sbjct  138  RLEAQVDVENMASQRVLEKAGFQREGVLRKYLFSKGKSRDMVMFSILSGEVQI  190



>ref|XP_008218221.1| PREDICTED: uncharacterized protein LOC103318600 [Prunus mume]
Length=168

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 113/166 (68%), Gaps = 0/166 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLRP   SD +D + +  DD VT+   W+  T+ + A  +I +    HPW R IC+  +
Sbjct  2    ITLRPFRLSDVDDLMSYAGDDQVTRSLRWKTLTTRDEALTFIKDVCIPHPWRRAICIDDR  61

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G VT+ P  G D  +A++GYA+A+KYWG+GI TKAVK+A + VF ++  L RL+A  D
Sbjct  62   SIGFVTIFPGSGDDRYKADLGYAIAAKYWGQGITTKAVKIAVSQVFNDFPILVRLQAFAD  121

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            VEN+ SQRVLEK+GF+RE VLRKY  LKGN  D V++S +ST+  V
Sbjct  122  VENKASQRVLEKSGFQREGVLRKYGYLKGNLKDLVVYSFLSTEVAV  167



>ref|NP_180762.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis 
thaliana]
 gb|AAD15402.1| putative alanine acetyl transferase [Arabidopsis thaliana]
 gb|ABD60714.1| At2g32020 [Arabidopsis thaliana]
 gb|AEC08623.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Arabidopsis 
thaliana]
Length=183

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW R IC++  
Sbjct  20   ISLRPMTLSDVDDYMVWATDPKVARFCTWEPCTSRDEAIKYITDRVLTHPWLRAICLEDD  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D+ R EIGY LA KYWGKG AT+AV++  A VF E+  +ERLEA+V
Sbjct  80   RPIGYILIM---AVDNIRKEIGYVLARKYWGKGFATEAVRLVTAEVFEEFPEIERLEALV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQRVLEK GF RE V+RK+  +KG+  D VMFS +STD
Sbjct  137  DVDNVGSQRVLEKVGFTREGVMRKFICIKGSVRDTVMFSFLSTD  180



>ref|XP_006379840.1| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
 gb|ERP57637.1| GCN5-related N-acetyltransferase family protein [Populus trichocarpa]
Length=171

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + SD +D+L++ SDD VT++  W   TS E A  ++ + A  HPW R IC
Sbjct  2    DSSRISLRPFKLSDVDDFLKWASDDRVTRYLRWNSITSREEALAHLEKVAIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++ P    D CRA  GYALA++YWG+GIAT A KMA +SVF +  +L RL+
Sbjct  62   LDDRSIGYISIFPESNDDRCRANFGYALAAEYWGQGIATIASKMAVSSVFQDLPYLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+VENR SQRVLEK GF +E +LRKY   KG   D  ++S +STD
Sbjct  122  ALVEVENRSSQRVLEKTGFVKEGLLRKYGYCKGEIRDMFVYSFLSTD  168



>ref|XP_006379839.1| hypothetical protein POPTR_0008s15450g [Populus trichocarpa]
 gb|ERP57636.1| hypothetical protein POPTR_0008s15450g [Populus trichocarpa]
Length=184

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 0/164 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLRP + SDA+D+L +  DD VT+F  W  F+  E A  YI +    HP+ R ICV  +
Sbjct  19   ITLRPYKESDADDFLGYAGDDQVTRFTRWNTFSCKEEALVYIKDFCIPHPYCRSICVNDR  78

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G V ++   G D CRAE+GYA+A+KYWG+G+ T+A+KMA +     +  L RL+A VD
Sbjct  79   SIGFVFIRQESGDDKCRAELGYAIAAKYWGQGVTTRALKMAISDGLRSFPDLVRLQARVD  138

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            VEN+ SQRVLEK GF +E VLRKY   KG   D V++SL+STDP
Sbjct  139  VENKASQRVLEKLGFLKEGVLRKYMYNKGKVIDLVVYSLLSTDP  182



>ref|XP_010259199.1| PREDICTED: uncharacterized protein LOC104598717 [Nelumbo nucifera]
Length=188

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LR  + SD + ++E+  DD VT++C W+ +TS + A   + +   +HPWYR +CV G+
Sbjct  21   ISLRLFQLSDVDSFMEWAGDDEVTRYCRWDTYTSKDDALNLLKDVIRSHPWYRAVCVDGR  80

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             +GS+ V P  G D  R EIGYA   K+WG+GIAT AVK+  ++VF E  +LER+E +V 
Sbjct  81   PIGSIYVMPGTGKDERRGEIGYAFGVKHWGQGIATMAVKLVMSTVFEEMPYLERVEGLVF  140

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
             EN  SQRVLEKAGF R+ +LRKY+ +KG   D V++S++  +P +
Sbjct  141  AENVASQRVLEKAGFVRDGLLRKYFFVKGKSRDIVVYSVVPGEPSI  186



>emb|CDY42090.1| BnaA05g10960D [Brassica napus]
Length=184

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  +D +DY+ + +D  V +FCSWEP TS E A KYI++    HPW R IC++  
Sbjct  21   ISLRPMTLADVDDYMVWATDAEVARFCSWEPCTSREEAIKYISDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D  R EIGY LA KYWGKG AT+AV++  A +F E   +ERLEA+V
Sbjct  81   RPIGYILIM---AVDDIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEMPEIERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            DV+N GSQRVLEK GF RE V+R + ++KG+  D VMFS + +DP
Sbjct  138  DVDNVGSQRVLEKVGFTREGVMRNFIIMKGSVRDMVMFSFLPSDP  182



>ref|NP_001150788.1| N-acetyltransferase [Zea mays]
 gb|ACF84386.1| unknown [Zea mays]
 gb|ACG40386.1| N-acetyltransferase [Zea mays]
 tpg|DAA51866.1| TPA: N-acetyltransferase [Zea mays]
 gb|AIB04970.1| GNAT transcription factor, partial [Zea mays]
Length=193

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 118/198 (60%), Gaps = 11/198 (6%)
 Frame = +1

Query  193  ETNPTPFSQITEIFSAMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCS  372
            E   TP +Q       M+P+  P        ++TLR  E SD +  + + SD  V   C 
Sbjct  2    EATATPRTQ-----EVMKPE--PGTAKVTVDEVTLRKFELSDVDAMMAWASDPQVAAVCR  54

Query  373  WEPFTSVEaaakyiaedaaaHPWYRGICVKG--KAVGSVTVKPFRGCDSCRAEIGYALAS  546
            WEP+ S E    +I +    HPW+R IC++G  + VG+V+V P    D CRAE+GY LA 
Sbjct  55   WEPYESTEPLLAFIRDVVLPHPWFRAICLRGEPRPVGAVSVSP--TGDPCRAELGYVLAR  112

Query  547  KYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYL  726
             +WG+G+AT AVK   A+VF E   LER+EA+VDV N  SQRVLEKAGF REAVLRKY  
Sbjct  113  AHWGRGVATAAVKRTVATVFAEVPGLERVEALVDVANPASQRVLEKAGFTREAVLRKYGA  172

Query  727  LKGNPTDAVMFSLISTDP  780
            +KG   D VM S I TDP
Sbjct  173  IKGVVRDMVMSSFIDTDP  190



>ref|XP_008345703.1| PREDICTED: uncharacterized protein LOC103408647 [Malus domestica]
Length=168

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLRP + SDA+D + +  DD VT+   W+  T+ + A  +I +    HPW R IC+  +
Sbjct  6    ITLRPFKLSDADDLMSYAGDDQVTRSLRWKTLTTKDEALTFIKDVCIPHPWRRSICIDDR  65

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G VTV P    D  +A++GYA+A+KYWG+GI TKAV++A + VF +   L RL+A  D
Sbjct  66   SIGFVTVFPGSSDDRHKADLGYAIAAKYWGQGITTKAVEVAISQVFKDSPSLVRLQAFAD  125

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            VEN+ SQRVLEKAGF++E VLR+Y  LKGN  D V++SL+STD
Sbjct  126  VENKASQRVLEKAGFQKEGVLRRYGYLKGNIKDLVIYSLLSTD  168



>ref|XP_011089101.1| PREDICTED: uncharacterized protein LOC105170156 [Sesamum indicum]
Length=170

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP + SDA+D L +  DD VT+   W+  TS + A  +I +    HPW R IC
Sbjct  2    DPSRITLRPFKLSDADDMLVWAGDDRVTRSLRWKTLTSKDEALAFIEQVCIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V P  G D CRA++GYA+  +YWG+GI T+AVKMA A VF ++  + RL+
Sbjct  62   IDDRSIGFVSVFPGYGDDRCRADLGYAIGVEYWGQGITTRAVKMATAQVFNDFPEIVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A   VEN+ SQRVLE+AGF +E +LRKY  LKG+  D ++FS +STD
Sbjct  122  AFASVENKASQRVLERAGFVKEGLLRKYSYLKGSIQDVLVFSFLSTD  168



>gb|KDP40197.1| hypothetical protein JCGZ_02195 [Jatropha curcas]
Length=171

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I++RP + SD +D+L++ SDD VT    W   T+ E A K++ E A +HPW R IC
Sbjct  2    DPSRISIRPFKLSDVDDFLKWASDDRVTSNLRWNSITTTEEALKHLKEVAISHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++  + G D CRA IGYA+A++YWG+GIAT A+KMA +SVF +   L RLE
Sbjct  62   LDHRSIGCISIWQYSGDDRCRANIGYAVATEYWGQGIATIALKMALSSVFQDIPELVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V V+N+GSQRV+EK GF +E +LRKY   KG   D +++S +STD
Sbjct  122  ALVAVKNKGSQRVVEKVGFSKEGLLRKYTFCKGEFRDLIIYSFLSTD  168



>ref|XP_003610737.1| N-acetyltransferase, putative [Medicago truncatula]
 gb|AES93695.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=190

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 113/173 (65%), Gaps = 3/173 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D + ITLRPL  SD +D + + +D+ V KFCSWE +TS +    +I   A    W + IC
Sbjct  18   DLTQITLRPLNLSDLDDLMIWTTDEKVAKFCSWELYTSKDDGINFIENIATKFLWCKAIC  77

Query  457  VKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            +  +A+G V++      D  R   AE+GY L SKYWGKG+AT  VK      F E ++LE
Sbjct  78   INDRAIGCVSLSSSSPGDKSRNKCAELGYVLGSKYWGKGVATCVVKQVVKVAFCELSYLE  137

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            RLEA+VDVEN GSQRVLEKAGF++E VLRKY ++KG   D ++ S++ TDP++
Sbjct  138  RLEALVDVENAGSQRVLEKAGFQKEGVLRKYLVMKGKSRDMIISSVLFTDPQL  190



>ref|XP_010906187.1| PREDICTED: uncharacterized protein LOC105033199 [Elaeis guineensis]
Length=185

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 108/168 (64%), Gaps = 1/168 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   ITLRP   SD +D++ + SDD V +F   EP T  EAA  +I +D   HPWYR IC
Sbjct  16   DIPLITLRPFMISDVDDFMAWASDDRVMQFFG-EPRTDKEAALAHIKDDIIPHPWYRAIC  74

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V  + VG + + P  G D  RA +GY LA  +WG+GI   AVK A A++F EW  LERLE
Sbjct  75   VDDRPVGWIFISPAPGNDHRRASMGYGLAYNHWGRGIMPAAVKKAVATIFKEWPRLERLE  134

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            A   VEN  SQRVL+K GF+RE VLRKY +LKG   D VMFS +STDP
Sbjct  135  AFTAVENERSQRVLQKTGFQREGVLRKYAVLKGVSRDVVMFSFLSTDP  182



>ref|XP_002278864.1| PREDICTED: uncharacterized protein LOC100261442 [Vitis vinifera]
 emb|CBI26276.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 113/166 (68%), Gaps = 0/166 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LRP + SD ED++ +  DD VT++  W   TS E A KY+ E A  HPW R IC+ 
Sbjct  4    SRISLRPFKLSDVEDFMSWAGDDRVTRYLRWNTITSREEAFKYLKEVAIPHPWRRSICLD  63

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             +++G ++VKP  G D CRA IGYAL  +YWG+GI T A+KMA + VF E+  L R++A+
Sbjct  64   DQSIGYISVKPESGDDRCRAHIGYALGWEYWGQGIVTVALKMALSIVFKEFPDLVRVQAL  123

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            V+VEN+GSQRVLEK GF +E ++RKY   KG   D  ++  +STDP
Sbjct  124  VEVENKGSQRVLEKVGFLKEGLVRKYGFNKGEVRDMFIYGFLSTDP  169



>gb|AFK44871.1| unknown [Lotus japonicus]
Length=177

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S +TLRP + +D +D+L +  DD VT+   W+   S E    +I +    HPW R IC
Sbjct  5    DLSRVTLRPFKLTDVDDFLLWAGDDQVTRNLRWKTCGSREEVFLFIRDVCIPHPWRRSIC  64

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V  +++G V+V  + G + C+A+IGYA+AS YWG+GIAT+A+K+    VF+++ +L RL+
Sbjct  65   VDDRSIGFVSVYQWPGDERCKADIGYAIASNYWGQGIATQALKIVVPQVFMDFPNLLRLQ  124

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A  DVEN+ SQRVLEKAGF RE VLRKY  +KG+  D V+FS +STD
Sbjct  125  AFTDVENKASQRVLEKAGFLREGVLRKYTYIKGDIKDLVVFSFLSTD  171



>gb|AAM63289.1| putative alanine acetyl transferase [Arabidopsis thaliana]
Length=183

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW + IC++  
Sbjct  20   ISLRPMTLSDVDDYMVWATDPKVARFCTWEPCTSRDEAIKYITDRVLTHPWLQAICLEDD  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D+ R EIGY LA KYWGKG AT+AV++  A VF E+  +ERLEA+V
Sbjct  80   RPIGYILIM---AVDNIRKEIGYVLARKYWGKGFATEAVRLVTAEVFEEFPEIERLEALV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQRVLEK GF RE V+RK+  +KG+  D VMFS +STD
Sbjct  137  DVDNVGSQRVLEKVGFTREGVMRKFICIKGSVRDTVMFSFLSTD  180



>ref|XP_002881211.1| hypothetical protein ARALYDRAFT_902251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57470.1| hypothetical protein ARALYDRAFT_902251 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 112/164 (68%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW R IC++  
Sbjct  20   ISLRPMTLSDVDDYMVWATDPKVARFCTWEPCTSRDEAIKYITDRVLTHPWLRAICLEDD  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D+ R EIGY LA KYWGKG AT+AV++  A +F E+  +ERLEA+V
Sbjct  80   RPIGYILIM---AVDNIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEFPEIERLEALV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQRVLEK GF RE V+RK+  +KG+  D VMFS + TD
Sbjct  137  DVDNVGSQRVLEKVGFTREGVMRKFLCIKGSVRDTVMFSFLPTD  180



>ref|XP_004494667.1| PREDICTED: uncharacterized N-acetyltransferase p20-like isoform 
X1 [Cicer arietinum]
 ref|XP_004494668.1| PREDICTED: uncharacterized N-acetyltransferase p20-like isoform 
X2 [Cicer arietinum]
 ref|XP_004494669.1| PREDICTED: uncharacterized N-acetyltransferase p20-like isoform 
X3 [Cicer arietinum]
Length=177

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I LRP + SD +D+L +  DD V K   W+   S E A  +I +    HPW R IC
Sbjct  5    DLSAICLRPFKLSDVDDFLLWAGDDEVIKNIRWKTCGSREEAQSFIRDVCIPHPWRRSIC  64

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V P+ G D C+A+IGYA+A+ YWG+GIATKA+K+A + VF+++  L RL+
Sbjct  65   LNDRSIGFVSVYPWSGDDRCKADIGYAVAANYWGQGIATKALKIALSQVFIDFPDLLRLQ  124

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A  DV+N GS RVLEKAGF RE VLRKY  +KG   D V+FS +STD
Sbjct  125  AFADVDNTGSIRVLEKAGFLREGVLRKYTYIKGIIKDLVVFSFLSTD  171



>ref|XP_006419967.1| hypothetical protein CICLE_v10006418mg [Citrus clementina]
 gb|ESR33207.1| hypothetical protein CICLE_v10006418mg [Citrus clementina]
Length=171

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 112/167 (67%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP   SD +D+L + SDD VT++  W+  TS E A  Y+   A  HPW R IC
Sbjct  2    DPSRISLRPYNLSDVDDFLLWASDDRVTRYLRWDTITSREEALAYLEMVAIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++KP  G D CRA IGYA+A++YWG G+AT A+KMA + VF E   L RL 
Sbjct  62   LDDRSIGYISIKPESGDDRCRAHIGYAVAAEYWGHGMATLALKMAVSKVFDEIPDLVRLH  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V++EN+ SQRVLEK GF +E +LRKY   KG   D  ++S +STD
Sbjct  122  ALVELENKASQRVLEKVGFVKEGLLRKYGFCKGEIRDMFVYSFLSTD  168



>ref|XP_006489416.1| PREDICTED: uncharacterized protein LOC102612310 [Citrus sinensis]
Length=171

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 112/167 (67%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP   SD +D+L + SDD VT++  W+  TS E A  Y+   A  HPW R IC
Sbjct  2    DPSRISLRPYNLSDVDDFLLWASDDRVTRYLRWDEITSREEALAYLEMVAIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++KP  G D CRA IGYA+A++YWG G+AT A+KMA + VF E   L RL 
Sbjct  62   LDDRSIGYISIKPESGDDRCRAHIGYAVAAEYWGHGMATLALKMAVSKVFDEIPDLVRLH  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V++EN+ SQRVLEK GF +E +LRKY   KG   D  ++S +STD
Sbjct  122  ALVELENKASQRVLEKVGFVKEGLLRKYGFCKGEIRDMFVYSFLSTD  168



>gb|KEH43819.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=190

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP+  SD +D + + SD  V K+C+WEP+T+ E    +I   A+   W+R IC
Sbjct  20   DLSQISLRPISLSDLDDVMLWTSDAKVAKYCTWEPYTNKEKGIDFIQNIASKSLWFRAIC  79

Query  457  VKGKAVGSVTVKPFRGC-DSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHL  624
            ++ +A+G      F+ C D CR   A++GY+L+S YWGKGIAT  VK    + F E+ +L
Sbjct  80   LRDQAIGCT---EFQVCSDRCRDKSAQLGYSLSSMYWGKGIATMVVKKVVDAAFKEFPYL  136

Query  625  ERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            ERLEA VDVEN  SQRVLEKAGF+RE VLRKY   KG   D VMFS++S++ ++
Sbjct  137  ERLEARVDVENVASQRVLEKAGFEREGVLRKYLFFKGKSIDVVMFSILSSEVKL  190



>ref|NP_001236452.1| uncharacterized protein LOC100527210 [Glycine max]
 gb|ACU16261.1| unknown [Glycine max]
Length=177

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 115/171 (67%), Gaps = 1/171 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + SD +D+L +  DD VT+   W+   S E A  +I +    HPW R IC
Sbjct  5    DLSRISLRPFKMSDVDDFLIWAGDDQVTRNLRWKTCGSREEALAFIRDVCIPHPWRRSIC  64

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V P+ G + C+A+IGYA+ + YWG+GIATKA+  A   VF ++  L RL+
Sbjct  65   LDDRSIGFVSVYPWSGDERCKADIGYAIGTNYWGQGIATKALMTAVPQVFKDFNELLRLQ  124

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVT  789
            A VDVEN+ SQRVLEKAGF RE VLRKY  LKG   D V++S +STD E+T
Sbjct  125  AFVDVENKASQRVLEKAGFLREGVLRKYTYLKGVVKDLVLYSFLSTD-EIT  174



>ref|XP_004511370.1| PREDICTED: uncharacterized N-acetyltransferase p20-like [Cicer 
arietinum]
Length=191

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 109/173 (63%), Gaps = 3/173 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D+S ITLRPL  SD +D + + +D  V KFCSWEP  S E    YI   A    W + IC
Sbjct  19   DFSQITLRPLHLSDIDDVMVWTTDKKVAKFCSWEPHNSKEDGINYIENIATKFLWCKAIC  78

Query  457  VKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
               +A+G +++      D  R   AE+GY L S YWG+GIAT AVK      F E +HLE
Sbjct  79   FSDRAIGCISLSSNSPHDISRNKSAELGYVLGSNYWGRGIATFAVKQVVKVTFSELSHLE  138

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            R+EA+VDV+N GSQ+VLEK+GF++E VLRKY  LKG   D +M+S+   DP+V
Sbjct  139  RIEALVDVQNVGSQKVLEKSGFQKEGVLRKYVQLKGKGRDMIMYSVFDNDPKV  191



>ref|XP_010510108.1| PREDICTED: uncharacterized protein LOC104786395 [Camelina sativa]
Length=181

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 111/164 (68%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            ++LRP+  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW R IC++  
Sbjct  18   VSLRPMTLSDVDDYMVWATDPEVARFCTWEPCTSRDEAIKYITDRVLTHPWLRAICLEDD  77

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D  R EIGY LA KYWGKG AT+AV++  A +F E+  +ERLEA+V
Sbjct  78   RPIGYILIM---AVDEIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEFPEIERLEALV  134

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQRVLEK GF RE V+RK+  +KG+  D VMFS + TD
Sbjct  135  DVDNVGSQRVLEKVGFTREGVMRKFLCIKGSVRDTVMFSFLPTD  178



>ref|XP_003626377.1| N-acetyltransferase, putative [Medicago truncatula]
Length=273

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 118/177 (67%), Gaps = 3/177 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + +D +D++ +  DD VTK   W+   S E A  +I +    HPW R IC
Sbjct  5    DLSRISLRPFKLTDVDDFMLWAGDDEVTKNIRWKTCNSREEAQTFIKDVCIPHPWRRSIC  64

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +   ++G V+V P+ G D C+A++GYA+AS YWG+GIATKA+K+A + VF +++ L RL+
Sbjct  65   LDDHSIGFVSVYPWSGDDRCKADMGYAVASNYWGQGIATKAIKIALSQVFNDFSDLLRLQ  124

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD---PEVTFFM  798
            A   V+N+ SQRVLEKAGF RE VLRKY  +KG   D  +FS +STD   P + FF+
Sbjct  125  AFTYVDNKASQRVLEKAGFLREGVLRKYTYIKGTIMDLAVFSFLSTDEIPPVIYFFL  181



>ref|XP_010025070.1| PREDICTED: uncharacterized protein LOC104415471 [Eucalyptus grandis]
 gb|KCW61660.1| hypothetical protein EUGRSUZ_H04392 [Eucalyptus grandis]
Length=178

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 0/169 (0%)
 Frame = +1

Query  271  GDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRG  450
            G D S ++LRP   SDA+D+L F  DD VT+F  W    S E A   I +    HPW R 
Sbjct  3    GVDPSAVSLRPFRISDADDFLSFAGDDQVTRFLRWNTLASREEALATIRDVCMPHPWRRA  62

Query  451  ICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLER  630
            +CV  + VG V++ P  G D CRA+IGYA+A ++WGKG+AT+AV+M  + VF +   + R
Sbjct  63   VCVGDRCVGVVSIWPGSGDDRCRADIGYAVAREWWGKGVATRAVRMTLSQVFGDLPDVLR  122

Query  631  LEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            ++A V  +N+ SQRVLEKAGF R+ +LRKY  LKG   D  ++S +STD
Sbjct  123  IQAFVGADNKASQRVLEKAGFTRDGLLRKYTYLKGTLQDLYLYSFLSTD  171



>gb|AES82595.2| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=177

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + +D +D++ +  DD VTK   W+   S E A  +I +    HPW R IC
Sbjct  5    DLSRISLRPFKLTDVDDFMLWAGDDEVTKNIRWKTCNSREEAQTFIKDVCIPHPWRRSIC  64

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +   ++G V+V P+ G D C+A++GYA+AS YWG+GIATKA+K+A + VF +++ L RL+
Sbjct  65   LDDHSIGFVSVYPWSGDDRCKADMGYAVASNYWGQGIATKAIKIALSQVFNDFSDLLRLQ  124

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A   V+N+ SQRVLEKAGF RE VLRKY  +KG   D  +FS +STD
Sbjct  125  AFTYVDNKASQRVLEKAGFLREGVLRKYTYIKGTIMDLAVFSFLSTD  171



>ref|XP_011026764.1| PREDICTED: uncharacterized protein LOC105127242 isoform X1 [Populus 
euphratica]
Length=184

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 112/164 (68%), Gaps = 0/164 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLRP + SDA+D+L +  DD VT+F  W  F+  E A  YI +    HP+ R ICV  +
Sbjct  19   ITLRPYKESDADDFLGYAGDDQVTRFTRWNTFSCKEEALVYIKDFCIPHPYCRSICVNDR  78

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G V ++   G + CRAE+GYA+A+KYWG+G+ T+A+K+A +     +  L RL+A VD
Sbjct  79   SIGFVFIRQESGDEKCRAELGYAMAAKYWGQGVTTRALKLAISDGLRSFPDLVRLQARVD  138

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            VEN+ SQRVLEK GF +E +LRKY  +KG   D V++SL+STDP
Sbjct  139  VENKASQRVLEKLGFLKEGLLRKYMYIKGKFIDLVVYSLLSTDP  182



>ref|XP_004981459.1| PREDICTED: uncharacterized protein LOC101779450 [Setaria italica]
Length=185

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 110/171 (64%), Gaps = 8/171 (5%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLR  E SD +  + + SD  V   C W+P+ S E    +I +    HPW+R ICV G
Sbjct  14   EVTLRKFELSDVDAMMAWASDPQVAAVCRWDPYESTEPLLAFIRDVVLPHPWFRAICVAG  73

Query  466  ------KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
                  + VG+V+V P    D CRAE+GY LA  +WG+G+AT AVK   A+VF E   LE
Sbjct  74   GGDEEPRPVGAVSVSP--TGDPCRAELGYVLARAHWGRGVATAAVKRTVAAVFGEVPGLE  131

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            R+EA+VDV N  SQRVLEKAGF REAVLRKY ++KG   D V+FS I+TDP
Sbjct  132  RVEALVDVNNTASQRVLEKAGFTREAVLRKYGVVKGVVRDMVIFSFINTDP  182



>ref|XP_007204930.1| hypothetical protein PRUPE_ppa020574mg [Prunus persica]
 gb|EMJ06129.1| hypothetical protein PRUPE_ppa020574mg [Prunus persica]
Length=167

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLRP   SD +D + +  DD VT+   W+  T+ + A  +I +    HPW + IC+  +
Sbjct  2    ITLRPFRLSDVDDLMSYAGDDQVTRSLRWKTLTTRDEALTFIKDVCIPHPWRQAICIDDR  61

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G VT+ P  G D  +A++GYA+A+KYWG+GI TKAVK+A + +F ++  L RL+A  D
Sbjct  62   SIGFVTIFPGSGDDRYKADLGYAIAAKYWGQGITTKAVKIAVSQIFNDFPILVRLQAFAD  121

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            VEN+ SQRV EK+GF+RE VLRKY  LKGN  D V++S +ST+  V
Sbjct  122  VENKASQRVFEKSGFQREGVLRKYGYLKGNIKDLVVYSFLSTEVAV  167



>ref|XP_006410339.1| hypothetical protein EUTSA_v10017288mg [Eutrema salsugineum]
 gb|ESQ51792.1| hypothetical protein EUTSA_v10017288mg [Eutrema salsugineum]
Length=184

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 109/164 (66%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FCSWEP  S E A KYI +    HPW R IC++  
Sbjct  21   ISLRPMTLSDVDDYMVWATDAKVARFCSWEPCKSREEAIKYITDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
             A+G + V P    D  R EIGY LA KYWGKG  T+AV++  A +F E   +ERLEA+V
Sbjct  81   HAIGYILVMP---VDKIRKEIGYVLARKYWGKGFGTEAVRLVTAEIFKEMPEIERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            D +N GSQRVLEK GF RE V+RK+ ++KG+  D VMFS + +D
Sbjct  138  DEDNVGSQRVLEKVGFTREGVMRKFMVMKGSVRDMVMFSFLPSD  181



>ref|NP_001237364.1| uncharacterized protein LOC100500394 [Glycine max]
 gb|ACU15466.1| unknown [Glycine max]
 gb|KHN02740.1| Putative N-acetyltransferase p20 [Glycine soja]
Length=190

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 114/176 (65%), Gaps = 9/176 (5%)
 Frame = +1

Query  271  GDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRG  450
            G D + I+LRP+   D +D + + +D+ V ++C+WEP+TS E    +I   A    W+R 
Sbjct  16   GFDLTQISLRPISLDDLDDLMLWTTDEKVARYCTWEPYTSKEDGINFIQNIAGKSLWFRA  75

Query  451  ICVKGKAVGSVTVKPFRGCDSCR------AEIGYALASKYWGKGIATKAVKMAAASVFVE  612
            IC+  +A+G +    F  C+  R       E+GYALAS YWGKGIAT AVK      F E
Sbjct  76   ICLNNRAIGCI---DFFSCEGQRRNRHKSVELGYALASIYWGKGIATHAVKQVIKVAFSE  132

Query  613  WAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            + HLERL+A+VDVEN  SQ+VLEKAGF+RE VLRKY ++KG   D VMFS++S DP
Sbjct  133  FPHLERLQALVDVENVASQKVLEKAGFQREGVLRKYVVIKGKSRDMVMFSVLSNDP  188



>ref|XP_010024260.1| PREDICTED: uncharacterized protein LOC104414787 [Eucalyptus grandis]
 gb|KCW60716.1| hypothetical protein EUGRSUZ_H03449 [Eucalyptus grandis]
Length=174

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S ITLRP E SDA ++L +  DD VT++  W+  TS+EAA  Y+   A  HP  R IC+ 
Sbjct  6    SAITLRPFELSDASNFLLWAGDDRVTRYLRWDSITSLEAAESYLRNVAIPHPCRRSICLG  65

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G ++G V+V+P  G + CRA + YA+ +++WG+G AT A++MAA  VF E   L RLEA 
Sbjct  66   GHSIGYVSVRPGSGDERCRAHVSYAVGAEFWGRGFATAALRMAARRVFDEMPDLVRLEAF  125

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+GSQRVLEK GF +E +LRKY + KG   D  ++SL+STD
Sbjct  126  VEVENKGSQRVLEKVGFVKEGLLRKYGICKGEVRDMYVYSLLSTD  170



>ref|XP_006408131.1| hypothetical protein EUTSA_v10021594mg [Eutrema salsugineum]
 gb|ESQ49584.1| hypothetical protein EUTSA_v10021594mg [Eutrema salsugineum]
Length=187

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 108/167 (65%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S +TLRP +  DA D+L +  DD VT    W  FT+ E A  +I +    HPW R IC
Sbjct  4    DLSRVTLRPFDLMDAHDFLRWAGDDRVTGNLRWPDFTTEEQALAFIRDVCLPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++ P  G D  +A IGY L+ +YWGKGIAT+AV +A + VF +  HL RL+
Sbjct  64   IDDRSIGFISIFPETGLDRFKAHIGYGLSHEYWGKGIATRAVSIAVSQVFSDLPHLLRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A V  +N+ SQRVL+K GF+RE +LRKY  LKG   D  +FSL+S+D
Sbjct  124  AFVQTQNKASQRVLDKVGFQREGLLRKYTYLKGKIYDVFVFSLLSSD  170



>ref|XP_009772680.1| PREDICTED: uncharacterized protein LOC104223026 [Nicotiana sylvestris]
Length=171

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + SDA+D L + SDD VT +  W   TS++AA+KYI E A  HPW R IC
Sbjct  2    DSSRISLRPFKLSDADDLLIWASDDKVTSYLRWHTITSIQAASKYIQEVAIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G ++V+P  G +  +A IGYA+ S YWG+GI T A+KMA   VF ++ +L RLE
Sbjct  62   LDDRSIGYISVRPESGSERHKARIGYAIGSDYWGQGIVTMAIKMAIPIVFRDFPYLVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+ EN GSQRVLEK GFK+E  LRKY   KG   D  ++S +STD
Sbjct  122  ALVEPENVGSQRVLEKVGFKKEGFLRKYGFNKGEIRDMFIYSFLSTD  168



>emb|CDY12238.1| BnaC04g12680D [Brassica napus]
Length=184

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 108/165 (65%), Gaps = 4/165 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LR +  SD + Y+ + +D  V +FCSWEP TS E A  YI +    HPW R IC++  
Sbjct  21   ISLRQMTLSDVDHYMVWATDAKVAQFCSWEPCTSREEAITYITDSVLTHPWLRAICLEDD  80

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D  R EIGY LA KYWGKG AT+AV++  A +F E   +ERLEA+V
Sbjct  81   RPIGYILIM---AVDDIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEMPEIERLEALV  137

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            DV+N GSQRVLEK GF RE V+R + ++KG+  D VMFS + +DP
Sbjct  138  DVDNMGSQRVLEKVGFTREGVMRNFIIMKGSVRDMVMFSFLPSDP  182



>ref|XP_002271588.1| PREDICTED: uncharacterized protein LOC100260509 [Vitis vinifera]
Length=178

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 110/170 (65%), Gaps = 0/170 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +TLRP   SD +D++ +  DD VT+   W+  TS E A  +I E    HPW R IC
Sbjct  2    DSGTVTLRPFRVSDVDDFILWAGDDQVTRNIRWKTITSKEEALTFIKEVCIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V  + G + C+A+I Y +A+KYWG+GI TKAVKMA   VF ++  L RL+
Sbjct  62   IDDRSIGFVSVYRWSGNEICKADIAYGIAAKYWGQGITTKAVKMAVLEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            A   VEN+ SQRVLEKAGF +E +LRKY  LKG   D V++S +STD  V
Sbjct  122  AFAAVENKASQRVLEKAGFTKEGLLRKYTFLKGQLKDLVIYSFLSTDITV  171



>ref|XP_007030665.1| Acyl-CoA N-acyltransferases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY11167.1| Acyl-CoA N-acyltransferases superfamily protein, putative [Theobroma 
cacao]
Length=222

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP +  DA+D+L F  D+ VT+   W+  TS E A  +I +    HPW R IC
Sbjct  4    DLSKITLRPFKLEDADDFLSFAGDEQVTRHLRWKTLTSKEEALTHIKDVCIPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            ++ +++G V++ PF G D C A  G+ +A KYWG G+ATKAVKMAA+  FV++  + RLE
Sbjct  64   IEDRSIGFVSIFPFSGDDRCSANFGFGVAVKYWGHGVATKAVKMAASQFFVDFPGVVRLE  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTD  747
            A VDV+N+ SQR++EKAGF++E +LRKY  LKG   D
Sbjct  124  AFVDVDNKASQRIVEKAGFQKEGMLRKYAHLKGKLRD  160



>ref|XP_010673099.1| PREDICTED: uncharacterized protein LOC104889554 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = +1

Query  268  FGDDYSDITLRPLE-PSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWY  444
            +  D S ++LRP +  +D +D + + SD+ V  FCSW+ +TS E A +Y+      HP++
Sbjct  5    YPQDESLLSLRPFDLTTDVDDLMVWVSDNQVAHFCSWDTYTSKEQAIEYVHNFVLQHPYH  64

Query  445  RGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHL  624
            R IC+  +A+G+++V    G D CR E+GY LAS+YWG+GIAT AVK   +++F E   L
Sbjct  65   RVICLNNRAIGAISVTCNAGNDKCRGELGYVLASQYWGRGIATWAVKAVGSAIFEERPEL  124

Query  625  ERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            ERLEA+VDVEN GSQRVLEK GF +E VLRKY + KG   D VMFSL+STD
Sbjct  125  ERLEALVDVENVGSQRVLEKGGFLKEGVLRKYCIQKGRTRDMVMFSLLSTD  175



>ref|XP_010414039.1| PREDICTED: uncharacterized protein LOC104700255 [Camelina sativa]
Length=183

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 111/164 (68%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW R IC++  
Sbjct  20   ISLRPMTLSDVDDYMVWATDPKVARFCTWEPCTSRDEAIKYITDRVLTHPWLRAICLEDD  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D  R EIGY LA KYWGKG AT+AV++  A +F E+  +ER+EA+V
Sbjct  80   RPIGYILIM---AVDDIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEFPEIERVEALV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+RK+  +KG+  D VMFS + TD
Sbjct  137  DVDNVGSQKVLEKVGFTREGVMRKFLYIKGSVRDTVMFSFLPTD  180



>ref|XP_008390913.1| PREDICTED: uncharacterized protein LOC103453141 [Malus domestica]
Length=171

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 116/165 (70%), Gaps = 0/165 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LRP + SDA+D+L++ SDD VT++  W   TS E A  YI + A  HPW + IC+ 
Sbjct  4    SRISLRPFKVSDADDFLKWASDDKVTRYLRWNTITSREEALAYIEKVAIPHPWRQSICLD  63

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
              ++G V+VKP  G D+CRA + YA++++YWG+GIA +A++MA + V+ E+  L R+EA+
Sbjct  64   DHSIGYVSVKPEPGDDTCRAHVSYAVSAEYWGQGIAKQALRMAMSRVYKEFPCLVRVEAL  123

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+GSQ VLEK GF +E +LRKY   KG   D  ++S +STD
Sbjct  124  VEVENKGSQMVLEKVGFVKEGLLRKYGYCKGEIRDMFIYSFLSTD  168



>emb|CAN75167.1| hypothetical protein VITISV_008627 [Vitis vinifera]
Length=302

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 112/170 (66%), Gaps = 0/170 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +TLRP   SD +D++ +  DD VT+   W+  TS E A  +I +    HPW R IC
Sbjct  2    DSGRVTLRPFRVSDVDDFILWAGDDQVTRNIRWKTVTSKEEALTFIKDVCIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V  + G D C+A+I YA+A+KYWG+GI TKAVKMA + VF ++  L RL+
Sbjct  62   IDDRSIGFVSVYQWSGNDICKADIAYAIAAKYWGQGITTKAVKMAVSEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            A   VEN+ SQRVLEKAGF +E +LRKY  LKG   D V++S +STD  V
Sbjct  122  AFAAVENKASQRVLEKAGFTKEGLLRKYTFLKGQLKDLVIYSFLSTDISV  171



>ref|NP_001237983.1| uncharacterized protein LOC100527055 [Glycine max]
 gb|ACU16095.1| unknown [Glycine max]
 gb|KHN30487.1| Putative N-acetyltransferase p20 [Glycine soja]
Length=185

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 116/175 (66%), Gaps = 3/175 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D  +I LRPL+ SD +D L + SD+ V  FCSW+P++S +    +I   A+   W R IC
Sbjct  10   DLGEICLRPLQVSDLDDLLVWTSDEKVAAFCSWDPYSSKDEGINFIQNIASKFLWCRAIC  69

Query  457  VKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            +K +A+G +++      D  R   AE+GY L SKYWGKG+AT AVK    +   E  HLE
Sbjct  70   LKDRAIGCISLSSNSEHDKSRSRSAELGYVLGSKYWGKGVATVAVKKVVKAALSELPHLE  129

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTF  792
            R+EA+VDV N GSQRVLEKAGF++E +LRKY   KG P D V+FSL+STDP+ +F
Sbjct  130  RIEALVDVFNVGSQRVLEKAGFQKEGILRKYIFQKGKPRDMVIFSLLSTDPKPSF  184



>ref|XP_008224292.1| PREDICTED: uncharacterized protein LOC103324034 [Prunus mume]
Length=218

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 127/197 (64%), Gaps = 5/197 (3%)
 Frame = +1

Query  190  RETNPTPFSQITEIFSAMEPQQ-SPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKF  366
            R  NP P    T    ++EP Q S ++     S I+LRP + SDA D+L++ SDD VT++
Sbjct  23   RSYNP-PLYMPTCSKLSLEPSQISCNSMNS--SRISLRPFKLSDANDFLKWASDDKVTRY  79

Query  367  CSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALAS  546
              W   TS E A  YI + A  HPW + IC+  +++G V+VKP +G D+CRA + Y +++
Sbjct  80   LRWNTITSREEALTYIDKLAT-HPWRQSICLDDQSIGYVSVKPEQGDDTCRAHVSYVVSA  138

Query  547  KYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYL  726
            +YWG+GIAT A+ MA   VF E   L R+EA+V+VEN+GSQRVLEK GF +E +LRKY  
Sbjct  139  EYWGQGIATVALSMAMCRVFRELPCLVRIEALVEVENKGSQRVLEKVGFLKEGLLRKYGY  198

Query  727  LKGNPTDAVMFSLISTD  777
             KG   D  ++S +STD
Sbjct  199  CKGEIRDMFIYSFLSTD  215



>ref|XP_004300955.1| PREDICTED: uncharacterized N-acetyltransferase p20-like [Fragaria 
vesca subsp. vesca]
Length=183

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLRP   SDAED+L +  D+ VT+F  W    S E A  YI E    H + + IC   +
Sbjct  17   ITLRPYRLSDAEDFLMYAGDERVTQFTRWNTLNSKEQALSYIKEFCIPHCYCKSICFNDR  76

Query  469  AVGSVTVKPF-RGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            ++G + +KP+    + CRAE+GY +A++YWG+GIAT+A+KMA   VF ++  L RL+A V
Sbjct  77   SIGFLFIKPYDEDNEKCRAEVGYVVAAEYWGRGIATRALKMAIIDVFKQFTDLVRLQAKV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
             +EN+GSQRVLEK GF++E +LRKY + +G  +D  M+SL+STDP
Sbjct  137  LIENKGSQRVLEKLGFQKEGLLRKYTIHRGTASDLFMYSLLSTDP  181



>ref|XP_003553748.1| PREDICTED: uncharacterized protein LOC100776526 isoform X1 [Glycine 
max]
Length=172

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 109/169 (64%), Gaps = 2/169 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRPL+ SD +D++    DD VT++  W  F S E A  +I +    HPW R IC
Sbjct  2    NLSRITLRPLKLSDVDDFMVVAGDDRVTRYTRWNTFVSREQALTFIRDHQ--HPWTRAIC  59

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V    +G V+V P  G D CRAEIG  +A+ YWG+GIAT+A K+AA+ VF +   L RL+
Sbjct  60   VDDVTIGYVSVSPGSGDDRCRAEIGCYIATDYWGQGIATEATKIAASQVFKDLPGLVRLQ  119

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            A V VEN+ SQRVLEKAGF REA+L++Y  +KG   D  +FSL+  D  
Sbjct  120  AFVAVENKASQRVLEKAGFLREAILKRYAYVKGMIKDVAIFSLVLQDTH  168



>ref|XP_007157116.1| hypothetical protein PHAVU_002G044100g [Phaseolus vulgaris]
 gb|ESW29110.1| hypothetical protein PHAVU_002G044100g [Phaseolus vulgaris]
Length=237

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 119/194 (61%), Gaps = 6/194 (3%)
 Frame = +1

Query  226  EIFSAMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaa  405
            ++ + + P + P+   +  + I+LRP++ SD +D L + SD+ V  FC+W+P+TS E   
Sbjct  44   KLNNPINPMERPEG-KEILTRISLRPIQLSDLDDLLVWTSDEKVATFCTWDPYTSKEDGI  102

Query  406  kyiaedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATK  576
             +I   A    W R IC+  +A+G V++      D  R    E+GY L SKYWGKG+AT 
Sbjct  103  NFIQNIATKFVWCRAICLNDRAIGCVSLSSNSEHDKSRNRSVELGYVLGSKYWGKGVATL  162

Query  577  AVKMAAASVFVEWA--HLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDA  750
             VK      F E    ++ER+EA+VDV N GSQRVLEKAGF+RE +LRKY  LKG   D 
Sbjct  163  VVKQVVKVAFTELPLPNMERVEALVDVLNVGSQRVLEKAGFQREGILRKYSFLKGKSRDM  222

Query  751  VMFSLISTDPEVTF  792
            VMFSL+STD  + F
Sbjct  223  VMFSLLSTDSHLQF  236



>ref|XP_010469639.1| PREDICTED: uncharacterized protein LOC104749663 [Camelina sativa]
Length=181

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 111/164 (68%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            ++LR +  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW R IC++  
Sbjct  18   VSLRSMTLSDVDDYMVWATDPEVARFCTWEPCTSRDEAIKYITDRVLTHPWLRAICIEDD  77

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D+ R EIGY LA KYWGKG AT+AV++  A +F E+  +ER+EA+V
Sbjct  78   RPIGYILIM---AVDNIRKEIGYVLARKYWGKGFATEAVRLVTAEIFKEFPEIERVEALV  134

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DVEN GSQ+VLEK GF RE V+RK+  +KG+  D VMFS + TD
Sbjct  135  DVENVGSQKVLEKVGFTREGVMRKFLYIKGSVRDTVMFSFLPTD  178



>ref|XP_003557676.1| PREDICTED: uncharacterized protein LOC100842786 [Brachypodium 
distachyon]
Length=191

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 111/171 (65%), Gaps = 8/171 (5%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLRP   +D +  + + SD  V   C WEP+ S E    +I +    HPW+R IC+ G
Sbjct  17   EVTLRPFTLADVDAMMAWASDPVVAAPCRWEPYESTEPLLAFIKDTVLPHPWFRAICLSG  76

Query  466  ------KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
                  + VG+++V P    D+CRAE+GY LA  +WGKG+AT AV+ A  +VF E   LE
Sbjct  77   SGDGDGRPVGALSVSPT--ADACRAELGYVLARAHWGKGVATAAVRRALGAVFEEVEGLE  134

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            R+EA+VD  N  SQRVLEKAGF REA+LR+Y +LKG+  D V++S +STDP
Sbjct  135  RVEALVDARNAASQRVLEKAGFTREALLRRYCVLKGDVKDMVIYSFVSTDP  185



>ref|XP_004511371.1| PREDICTED: uncharacterized N-acetyltransferase p20-like [Cicer 
arietinum]
Length=198

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 109/180 (61%), Gaps = 10/180 (6%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTS-------VEaaakyiaedaaaH  435
            D S ITLRPL  SD +D + + +D+ V KFCSWE  T+       +E        +    
Sbjct  19   DLSQITLRPLHLSDLDDVMVWTTDEKVAKFCSWETHTTKDDGINYIERKINNNKNENKKV  78

Query  436  PWYRGICVKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVF  606
             W + IC+   A+G +++      D  R   AE+GY L SKYWG+GIAT  VK      F
Sbjct  79   LWCKAICLNDHAIGFISLSSRSPHDKSRNKSAELGYVLGSKYWGRGIATYVVKQVVKVAF  138

Query  607  VEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
             E ++LER+EA+VDVEN GSQRVLEKAGF++E VLRKY  LKG   D VMFS++  DP+V
Sbjct  139  SELSYLERIEAMVDVENVGSQRVLEKAGFQKEGVLRKYVFLKGKSRDMVMFSVLVNDPKV  198



>ref|XP_008450752.1| PREDICTED: uncharacterized protein LOC103492240 [Cucumis melo]
Length=192

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRP + SD +D++ +  DD V K   W  FTS E A  +I +    HPW R IC
Sbjct  25   EVSRITLRPFQLSDVDDFMVWAGDDRVMKSIRWNVFTSKEQAHDFIRDVCIPHPWRRSIC  84

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V G++VG V+V P+ G D C+A++GYA+A +YWG+GI T+A+K+A   VF ++  + RL+
Sbjct  85   VDGRSVGFVSVYPWSGEDRCKADVGYAVAREYWGRGIVTEALKIAVPQVFEKFPEVVRLQ  144

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A V +ENR SQRV+EK GF++E +LRKY  +KG   D  ++S +S+D
Sbjct  145  AFVFIENRASQRVVEKVGFQKEGLLRKYCYIKGELKDLFVYSFLSSD  191



>emb|CDO99080.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I++RP + SDAED+L + SDD VT++  W    ++E A KYI E A  HPW R IC+ 
Sbjct  4    SRISVRPFKLSDAEDFLTWASDDQVTQYLRWNTIYTIEEALKYIQEVAIPHPWRRSICLD  63

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             +++G ++VKP  G D  RA +GYA++S+YWG+GI T A+K+A +S   E+  L RLEA+
Sbjct  64   DRSIGYISVKPESGSDRHRAHVGYAISSEYWGQGIVTVALKIAISSALKEFPLLVRLEAL  123

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+ EN+GSQRVLEK GF +E  LRKY   KG   D +++S + TD
Sbjct  124  VEEENKGSQRVLEKVGFLKEGFLRKYGYNKGKIRDMIIYSFLVTD  168



>ref|XP_010422469.1| PREDICTED: uncharacterized protein LOC104707746 [Camelina sativa]
Length=183

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            ++LRP+  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW R IC++  
Sbjct  20   VSLRPMTLSDVDDYMVWATDPEVARFCTWEPCTSRDEAIKYITDRVLTHPWIRAICLEDD  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D  R E+GY LA KYWGKG AT+AV++    +F E+  +ER+EA+V
Sbjct  80   RPIGYILIM---AVDDIRKEMGYVLARKYWGKGFATEAVRLVTTEIFKEFPEIERVEALV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQ+VLEK GF RE V+RKY  +KG+  D VMFS + TD
Sbjct  137  DVDNVGSQKVLEKVGFTREGVMRKYLYIKGSVRDTVMFSFLPTD  180



>ref|XP_003610743.1| N-acetyltransferase, putative [Medicago truncatula]
 gb|AES93701.1| kinase interacting (KIP1-like) family protein, putative [Medicago 
truncatula]
Length=1908

 Score =   171 bits (433),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 89/191 (47%), Positives = 119/191 (62%), Gaps = 5/191 (3%)
 Frame = +1

Query  214   SQITEIFSAMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSV  393
             S + E F + +P  +  +   D + ITLRP   SD +D + +R+D+ V KFCSWEP+TS 
Sbjct  1717  SVMEETFISSKPSGNEQSI--DLNQITLRPFHLSDLDDLMVWRTDEKVAKFCSWEPYTSK  1774

Query  394   EaaakyiaedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKG  564
             E    +I        W + IC+  +A+G V++K     D  R   AE+ Y LASKYWGKG
Sbjct  1775  EQGISFIENIPNKFLWCKAICLNNRAIGRVSLKSRSPHDKSRNKTAELAYVLASKYWGKG  1834

Query  565   IATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPT  744
             IAT  VK      F E +HLER+EA VDVEN GSQRVLEKAGF++E  L KY ++KG   
Sbjct  1835  IATYVVKQVVKVAFSELSHLERVEAFVDVENVGSQRVLEKAGFQKEGTLGKYLVMKGKSR  1894

Query  745   DAVMFSLISTD  777
             D ++FS++STD
Sbjct  1895  DMIIFSVLSTD  1905



>gb|KHN43223.1| Putative N-acetyltransferase YoaA [Glycine soja]
Length=173

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 110/170 (65%), Gaps = 3/170 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRPL+ SD +D++    DD VT++  W  F S E A  +I +    HPW R IC
Sbjct  2    NLSRITLRPLKLSDVDDFMVVAGDDRVTRYTRWNTFVSREQALTFIRDHQ--HPWTRAIC  59

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYAL-ASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            V    +G V+V P  G D CRAEI YA+ A+ YWG+GIAT+A K+AA+ VF +   L RL
Sbjct  60   VDDVTIGYVSVSPGSGDDRCRAEIDYAIIATDYWGQGIATEATKIAASQVFKDLPGLVRL  119

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            +A V VEN+ SQRVLEKAGF REA+L++Y  +KG   D  +FSL+  D  
Sbjct  120  QAFVAVENKASQRVLEKAGFLREAILKRYAYVKGMIKDVAIFSLVLQDTH  169



>ref|XP_002517114.1| N-acetyltransferase, putative [Ricinus communis]
 gb|EEF45277.1| N-acetyltransferase, putative [Ricinus communis]
Length=171

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 0/170 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I++RP + SD +D+L++ SDD VT    W   TS E A +++ + A  HPW R IC
Sbjct  2    DPSRISIRPFKLSDVDDFLKWASDDRVTWNLRWNSITSKEEALEHLEKVAIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  ++VG ++V  F G D CRA IGYAL++++WG+G+AT A+KM  +SVF +   L RLE
Sbjct  62   LDDRSVGYISVWQFSGDDRCRANIGYALSTEHWGQGVATIAMKMCLSSVFKDIPDLVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            A V+VENR SQRV EK GF +E +LRKY   KG   D V++S +STD  +
Sbjct  122  AFVEVENRRSQRVAEKVGFLKEGLLRKYMYCKGEIRDYVVYSFLSTDKSL  171



>ref|XP_003610739.1| N-acetyltransferase, putative [Medicago truncatula]
 gb|AES93697.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
 gb|AFK35182.1| unknown [Medicago truncatula]
Length=188

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D + ITLR    SD +D + + +D+ V KFCSWEP+TS E    +I    +     + IC
Sbjct  18   DLNQITLRSFNLSDLDDVMVWHTDEKVAKFCSWEPYTSREDGINFIESIESKFLCCKAIC  77

Query  457  VKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            +  +A+G V +  F   D  R   AE+GY L+SKYWGKGI T AVK      F E+++LE
Sbjct  78   INDRAIGCVLL--FTPEDKSRKQSAELGYNLSSKYWGKGIVTCAVKQIVKIAFDEFSYLE  135

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            RLEA+VDVEN GSQRVLEKAGF++E  LRKY ++KG   D +MFS++S D ++
Sbjct  136  RLEALVDVENVGSQRVLEKAGFQKEGTLRKYLVMKGKSRDMIMFSVLSNDLQL  188



>ref|XP_007034796.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein, putative 
[Theobroma cacao]
 gb|EOY05722.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein, putative 
[Theobroma cacao]
Length=171

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LR    SD +D+L++ S D VT++  W   TS E A  Y+ + A   P+ R IC
Sbjct  2    DPSRISLRRFLISDVDDFLKWASADKVTRYLRWNTITSREEALSYLEKVAIPQPYRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +   ++G V++KP  G D CRA +GYA++++YWG+GIAT A+KMA ++VF E+  L RLE
Sbjct  62   LDDHSIGYVSIKPGSGDDECRAHLGYAVSAEYWGQGIATAALKMAVSNVFKEFPGLVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V VEN+GSQ+VLEK GF +E +LRKY   KG   D +++S +STD
Sbjct  122  AIVLVENQGSQKVLEKVGFLKEGLLRKYGFFKGEIRDVLVYSFLSTD  168



>ref|XP_010096153.1| putative N-acetyltransferase p20 [Morus notabilis]
 gb|EXB63469.1| putative N-acetyltransferase p20 [Morus notabilis]
Length=171

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 109/167 (65%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   I++RP + SD +D+LE+ SDD VT++  W   T+ E A  Y+ +    HPW R IC
Sbjct  2    DSPRISIRPFKLSDVDDFLEWASDDRVTRYLRWNTITTKEEALTYVEKVVIPHPWRRTIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            + G+++G V+VKP  G + CRA + YA+ + YWG+GI   A+++  +S   E+  L RLE
Sbjct  62   LDGRSIGYVSVKPESGDNKCRAHVSYAVGAAYWGQGIVAMALRVMISSALKEFPDLVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+VENR SQRVLEK GF +E +LRKY   KG   D  ++S +STD
Sbjct  122  ALVEVENRASQRVLEKVGFLKEGLLRKYGFCKGEIRDMFIYSFLSTD  168



>ref|XP_009774277.1| PREDICTED: uncharacterized protein LOC104224348 [Nicotiana sylvestris]
Length=171

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 110/167 (66%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + +D +D + +  DD VT+   W+  TS E A  +I E    HPW R IC
Sbjct  2    DSSRISLRPFKLTDVDDMMLWAGDDRVTRTIRWKTLTSKEEALTFIKEVCIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V P  G D  R +IGYA+A +YWG+GIAT A+KM    V+ ++  + RL+
Sbjct  62   IDDRSIGFVSVFPGSGDDRSRGDIGYAIAVEYWGQGIATNAIKMTIPQVYNDFPEIVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+ DVEN+ SQRVLEKAGF +E +LRKY   KG   D VM+SL+ST+
Sbjct  122  ALADVENKASQRVLEKAGFIKEGILRKYGYHKGKIVDLVMYSLLSTE  168



>ref|XP_009335320.1| PREDICTED: uncharacterized protein LOC103928037 [Pyrus x bretschneideri]
Length=196

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 113/165 (68%), Gaps = 0/165 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LRP   SDA+D+L++ SDD VT++  W   TS E A  YI + A  HPW + IC+ 
Sbjct  29   SRISLRPFRVSDADDFLKWASDDKVTRYLRWNTITSREEALAYIEKVAIPHPWRQSICLD  88

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
              ++G V+VKP  G D CRA + YA++++YWG+GIA +A++MA + VF E+  L R+EA+
Sbjct  89   DHSIGYVSVKPEPGDDMCRAHVSYAVSAEYWGQGIAKQALRMAMSRVFKEFPCLVRVEAL  148

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+GSQ VLEK GF +E +LRKY   KG   D  ++S +S D
Sbjct  149  VEVENKGSQMVLEKVGFVKEGLLRKYGYCKGEIRDMFIYSFLSAD  193



>ref|XP_010024256.1| PREDICTED: uncharacterized protein LOC104414782 [Eucalyptus grandis]
 gb|KCW60711.1| hypothetical protein EUGRSUZ_H03444 [Eucalyptus grandis]
Length=186

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 114/162 (70%), Gaps = 1/162 (1%)
 Frame = +1

Query  295  LRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKAV  474
            LRPL+ SD +D++ +  D +V  FC +EP+TS EAA  YIA     HP++R ICV G+ V
Sbjct  22   LRPLKLSDVDDFMAWAGDPDVAHFCRFEPYTSREAALAYIAGTVLPHPYFRAICVDGRPV  81

Query  475  GSVTVKPFRG-CDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDV  651
            G V+V   +   D+CR E+GYALAS YWG+GIAT+A + A A  F     LER+EA+VDV
Sbjct  82   GQVSVTRNKSPADACRGELGYALASGYWGRGIATEAARAAVAEAFSARPELERVEAIVDV  141

Query  652  ENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            EN+ SQRVLEKAGF RE +LRKY +LKG   + V+FS +STD
Sbjct  142  ENKPSQRVLEKAGFTREGLLRKYRVLKGRTRNVVVFSRLSTD  183



>gb|EYU41470.1| hypothetical protein MIMGU_mgv1a024789mg [Erythranthe guttata]
Length=170

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 112/167 (67%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D + I+LRP + SDA+D+L + SDD VT++  W   T++E A  Y+ + A  HPW R IC
Sbjct  2    DSTRISLRPFKLSDADDFLAWASDDKVTRYLRWNTVTTIEEALIYVQKVAIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  ++VG ++V+P  G D  RA IGYA+ S  WG GIAT AV++A  SVF ++  + RLE
Sbjct  62   LDDRSVGYISVRPESGDDRHRAHIGYAVGSDCWGLGIATAAVRLAIPSVFEKFPFIVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+ EN GSQRVLEK GF +E  LRKY   KG   D +++S +STD
Sbjct  122  ALVEEENIGSQRVLEKVGFVKECFLRKYCFNKGEVRDMLIYSFLSTD  168



>ref|XP_006360775.1| PREDICTED: uncharacterized protein LOC102601771 [Solanum tuberosum]
Length=173

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (66%), Gaps = 2/169 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D + I+LRP   SDA +   + +D+NVT +  W   TS+EAA  YI +    HPW R IC
Sbjct  2    DNTRISLRPFNISDANNLFTWANDENVTYYLRWNTITSIEAARNYIQQVVIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCD--SCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLER  630
            +  +++G V+V+P  G D  + RA IGYA+ S YWG+GI TKA+KMA   VF ++ +L R
Sbjct  62   LDDRSIGYVSVRPESGSDDQNHRAHIGYAIGSDYWGQGIVTKALKMAIPIVFNDFPNLVR  121

Query  631  LEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +EA+V+ +N GSQ+VLEK GFK+E  LRKY   KG   D  ++S +STD
Sbjct  122  VEALVEPQNIGSQKVLEKVGFKKEGFLRKYGFNKGEIRDMFIYSFLSTD  170



>ref|XP_006489418.1| PREDICTED: uncharacterized protein LOC102612920 [Citrus sinensis]
Length=190

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 115/184 (63%), Gaps = 2/184 (1%)
 Frame = +1

Query  226  EIFSAMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaa  405
            E+F   +    P   G   S I+LRP    D +D+L +  DD  T++  W+  TS E A 
Sbjct  6    ELFPVSDHSLQPRFNGP--SRISLRPFNLYDVDDFLLWARDDRATRYLRWDTITSREEAL  63

Query  406  kyiaedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVK  585
             Y+ + A  HPW R IC+  +++G + +KP  G D CRA I YA+A++YWG+G+AT A+K
Sbjct  64   AYLEKVAIPHPWRRSICLDDRSIGYIPIKPESGDDRCRAHIRYAVAAEYWGQGMATLALK  123

Query  586  MAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSL  765
            MA + VF E   L RL A+V++EN+ SQRVLEKAGF +E +LRKY   KG   D  ++S 
Sbjct  124  MAVSKVFDEIPDLVRLHALVELENKASQRVLEKAGFVKEGLLRKYGFCKGEIRDMFVYSF  183

Query  766  ISTD  777
            +STD
Sbjct  184  LSTD  187



>ref|XP_007224462.1| hypothetical protein PRUPE_ppa022546mg [Prunus persica]
 gb|EMJ25661.1| hypothetical protein PRUPE_ppa022546mg [Prunus persica]
Length=170

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 113/165 (68%), Gaps = 1/165 (1%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LRP + SDA D+L++ SDD VT++  W   TS E A  YI + A  HPW + IC+ 
Sbjct  4    SRISLRPFKLSDANDFLKWASDDKVTRYLRWNTITSREEALTYIEKLAT-HPWRQSICLD  62

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             +++G V+VKP +G D CRA + Y ++++Y G+GIAT A++MA   VF E   L R+EA+
Sbjct  63   DQSIGYVSVKPEQGDDMCRAHVSYVVSAEYCGQGIATVALRMAMCRVFRELPCLVRIEAL  122

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+GSQRVLEK GF +E +LRKY   KG   D  ++S +STD
Sbjct  123  VEVENKGSQRVLEKVGFLKEGLLRKYGYCKGEIRDMFIYSFLSTD  167



>ref|XP_003633665.1| PREDICTED: uncharacterized protein LOC100250390 [Vitis vinifera]
Length=177

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 108/167 (65%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +TLRP   SD +D + +  D+ VT+   W+  TS E A  +I E    HP+YR IC
Sbjct  2    DSESLTLRPFRVSDVDDLMLWAGDEQVTRTIRWKTITSKEEALTFIKEVCIPHPFYRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V V    G D  +A +GY +A+KYWG+GIATK VKM  + VF ++  L RL+
Sbjct  62   IDDRSIGFVYVIRGSGADRQKASMGYGVAAKYWGQGIATKTVKMVISEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            AV  VEN  SQRVLEKAGF REA+LRK+  LKG   D V++SL+STD
Sbjct  122  AVAVVENIASQRVLEKAGFTREALLRKHSFLKGQLKDLVIYSLLSTD  168



>ref|XP_009768909.1| PREDICTED: uncharacterized protein LOC104219858 [Nicotiana sylvestris]
Length=172

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 106/166 (64%), Gaps = 2/166 (1%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S ITLRP   SD +D L +  DD VTK   +   TS E A  +I +     PW R IC+ 
Sbjct  4    SRITLRPYRSSDVDDLLLWGGDDRVTKSIHFTTLTSQEDALTFIEKSTI--PWRRSICID  61

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             +++G V  +P  G D CRAEIGYALA++YWG+GI  KAVKMA   +F ++  + RL+A+
Sbjct  62   DRSIGIVVARPGSGDDRCRAEIGYALAAEYWGQGITPKAVKMAIPLIFNDFPEIVRLQAL  121

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
             D  N+ S RVLEKAGF +E + RKY+  KG   D V++SL+STDP
Sbjct  122  SDANNKASHRVLEKAGFVKEGMFRKYFYFKGEIKDVVLYSLLSTDP  167



>emb|CDP08589.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 106/167 (63%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP   SDA+D L +  DD VT+   W+   S E A  +I E    HPW R IC
Sbjct  2    DLSRITLRPFRLSDADDLLLWAGDDRVTRSIRWKTLASKEEALTFIGEVCIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V   + G V+V P  G + CRA+IGYALA +YWG+GI T+A+K+A   VF ++  + RL+
Sbjct  62   VDDLSKGFVSVFPGSGNERCRADIGYALAVEYWGQGITTEALKLAVPQVFKDFPEVLRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A    EN  SQRVLEKAGF +E  LRKY  LKGN  D V++S +STD
Sbjct  122  AYAAAENIASQRVLEKAGFLKEGTLRKYSYLKGNLCDLVVYSFLSTD  168



>ref|XP_004302006.1| PREDICTED: uncharacterized N-acetyltransferase YoaA-like [Fragaria 
vesca subsp. vesca]
Length=170

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 108/167 (65%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP   SD ED + +  D+ VT+   W+  T+ E A  ++ +    HPW R IC
Sbjct  4    DLSSITLRPFRLSDVEDLMTYAGDEQVTRNLRWKTLTTKEEAFTFLKDVCIPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G ++V P+ G +  +A++GY +A KYWG+GIAT+ VK A   VF +  HL R++
Sbjct  64   IDDRSIGFISVFPWSGDEGHKADMGYGIAPKYWGQGIATEVVKTAVPQVFRDLPHLLRIQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A    +N+ SQRVLEKAGF+RE +LRKY  +KG   D V++S +STD
Sbjct  124  AFAYSDNKASQRVLEKAGFQREGLLRKYEYIKGEIIDMVVYSFLSTD  170



>ref|XP_008350627.1| PREDICTED: uncharacterized protein LOC103413983 [Malus domestica]
Length=193

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 110/168 (65%), Gaps = 1/168 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFC-SWEPFTSVEaaakyiaedaaaHPWYRGI  453
            D S I LRP   SDA+D L F  DD VT+    ++  T+ + A  +I      HPW R I
Sbjct  4    DLSRIALRPFRLSDADDVLSFGGDDQVTRVLRGFKTLTTXDEALNFIKNVCIPHPWRRSI  63

Query  454  CVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            C+   ++G VT+ P  G D  +A++GYALA++YWG+GI  KAV++A + VF ++  L RL
Sbjct  64   CIDDXSIGFVTMFPGSGDDRHKADMGYALAARYWGQGITAKAVRIALSQVFKDYPDLVRL  123

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            ++ V VEN+ SQRVLEK GF+RE VLRKY  LKG+  D V++S +S+D
Sbjct  124  QSFVAVENKASQRVLEKVGFQREGVLRKYLYLKGDIKDMVVYSFLSSD  171



>ref|XP_009608599.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104102565 
[Nicotiana tomentosiformis]
Length=171

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 110/167 (66%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + SDA+D L + SDD VT +  W   TS+EAA+KYI E A  HPW R IC
Sbjct  2    DSSRISLRPFKLSDADDLLIWASDDKVTSYLRWHTITSIEAASKYIQEVAIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G ++V+P  G +  +A I YA+ S YWG GI T A+KMA   VF ++ +L RLE
Sbjct  62   LDDRSIGYISVRPESGSERHKARIAYAVGSDYWGXGIVTMAIKMAIPIVFKDFPYLVRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+ EN GSQRVLEK GFK+E  LR Y   KG   D  ++S +S D
Sbjct  122  ALVEPENVGSQRVLEKVGFKKEGFLRXYGFNKGEIRDMFIYSFLSID  168



>gb|KEH34246.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=219

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 107/170 (63%), Gaps = 3/170 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRP E SD +D++    DD VT +   + F S E A  YI +    HPW R IC
Sbjct  4    NLSRITLRPFELSDVDDFMLVVGDDRVTNYTRRKSFVSREQALCYIQDVCIPHPWTRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDS---CRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            +  + +G +++ P    D    CRAEIGYALA+ YWG+GI T+AVK+A + VF +   L 
Sbjct  64   IDNQTIGFISISPAGSGDDDDRCRAEIGYALAANYWGQGICTQAVKVAVSQVFKDIPDLV  123

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            R++A V +EN+ SQRVLEK GF RE +LRKY  +KG   D  MFSL+S D
Sbjct  124  RIQAFVSMENQASQRVLEKVGFLREGILRKYSYVKGIVKDVAMFSLLSED  173



>ref|XP_006296107.1| hypothetical protein CARUB_v10025258mg [Capsella rubella]
 gb|EOA29005.1| hypothetical protein CARUB_v10025258mg [Capsella rubella]
Length=183

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 109/164 (66%), Gaps = 4/164 (2%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK-G  465
            ++LR +  SD +DY+ + +D  V +FC+WEP TS + A KYI +    HPW R IC++  
Sbjct  20   VSLRLMTLSDVDDYMVWATDPKVARFCTWEPCTSRDEAIKYITDRVLTHPWLRAICLEDN  79

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            + +G + +      D  R EIGY LA KYWGKG AT+AV++  + +F E+  +ER+EA+V
Sbjct  80   RPIGYILIM---AVDDIRKEIGYVLARKYWGKGFATEAVRLLTSEIFKEFPEIERVEALV  136

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            DV+N GSQRVLEK GF RE V+RK+  +KG   D VMFS + +D
Sbjct  137  DVDNVGSQRVLEKVGFTREGVMRKFLCIKGRVRDTVMFSFLPSD  180



>ref|XP_008350626.1| PREDICTED: uncharacterized protein LOC103413982 [Malus domestica]
Length=193

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 110/168 (65%), Gaps = 1/168 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFC-SWEPFTSVEaaakyiaedaaaHPWYRGI  453
            D S I LRP   SDA+D L F  DD VT+    ++  T+ + A  +I      HPW R I
Sbjct  4    DLSRIALRPFRLSDADDVLSFGGDDQVTRVLRGFKTLTTKDEALNFIKNVCIPHPWRRSI  63

Query  454  CVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            C+   ++G VT+ P  G D  +A++GYALA++YWG+GI  KAV++A + VF ++  L RL
Sbjct  64   CIDDHSIGFVTMFPGSGDDRHKADMGYALAARYWGQGITAKAVRIALSQVFKDYPDLVRL  123

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            ++ V VEN+ SQRVLEK GF+RE VLRKY  LKG+  D V++S +S+D
Sbjct  124  QSFVAVENKASQRVLEKVGFQREGVLRKYLYLKGDIKDMVVYSFLSSD  171



>ref|XP_008388638.1| PREDICTED: uncharacterized protein LOC103450996 [Malus domestica]
Length=193

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 110/168 (65%), Gaps = 1/168 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFC-SWEPFTSVEaaakyiaedaaaHPWYRGI  453
            D S I LRP   SDA+D L F  DD VT+    ++  T+ + A  +I      HPW R I
Sbjct  4    DLSRIALRPFRLSDADDVLSFGGDDQVTRVLRGFKTLTTXDEALNFIKNVCIPHPWRRSI  63

Query  454  CVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            C+   ++G VT+ P  G D  +A++GYALA++YWG+GI  KAV++A + VF ++  L RL
Sbjct  64   CIDDXSIGFVTMFPGSGDDRHKADMGYALAARYWGQGITAKAVRIALSQVFKDYPDLVRL  123

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            ++ V VEN+ SQRVLEK GF+RE VLRKY  LKG+  D V++S +S+D
Sbjct  124  QSFVAVENKXSQRVLEKVGFQREGVLRKYLYLKGDIKDMVVYSFLSSD  171



>gb|AFK45763.1| unknown [Medicago truncatula]
Length=178

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 106/170 (62%), Gaps = 3/170 (2%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRP E SD +D++    DD VT     + F S E A  YI +    HPW R IC
Sbjct  4    NLSRITLRPFELSDVDDFMLVVGDDRVTNCTRRKSFVSREQALCYIQDVCIPHPWTRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDS---CRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
            +  + +G +++ P    D    CRAEIGYALA+ YWG+GI T+AVK+A + VF +   L 
Sbjct  64   IDNQTIGFISISPAGSGDDDDRCRAEIGYALAANYWGQGICTQAVKVAVSQVFKDIPDLV  123

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            R++A V +EN+ SQRVLEK GF RE +LRKY  +KG   D  MFSL+S D
Sbjct  124  RIQAFVSMENQASQRVLEKVGFLREGILRKYSYVKGIVKDVAMFSLLSED  173



>gb|EYU32739.1| hypothetical protein MIMGU_mgv1a019358mg [Erythranthe guttata]
Length=170

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 112/169 (66%), Gaps = 0/169 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP + SDA+D L +  DD VT+    +   S E A  +I  ++  H W R IC
Sbjct  2    DLSRITLRPFKQSDAQDMLSWAGDDRVTEADRLKTLKSKEEALAFIERNSTPHLWMRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V  ++ G +TV    G + CR +IGYALA +YWGKGI T+AV+MA   VF E+  + RL+
Sbjct  62   VDDRSFGLLTVYVGSGDERCRGDIGYALAVEYWGKGITTRAVEMAVPKVFEEFPQILRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            A+ +V N+GS+RVLEKAGF ++A++RK+Y LKG   D V++S+++ D +
Sbjct  122  AMTNVNNKGSRRVLEKAGFTKDALMRKHYYLKGEIQDVVVYSILAPDSD  170



>ref|XP_004981454.1| PREDICTED: uncharacterized protein LOC101777556 [Setaria italica]
Length=171

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 106/168 (63%), Gaps = 4/168 (2%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV-  459
            +++TLR  E +D +  + + SD  V  FC WEP+ S E    ++ +    HPW+R +C  
Sbjct  2    AEVTLRRFELTDVDAMMAWASDPQVAAFCRWEPYESREPLLAFLRDTVLPHPWFRAVCAV  61

Query  460  -KGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
              G  VG+V+V P    + CR E+GY LA  +WGKG+AT AV+ A   VF E   L R+E
Sbjct  62   PGGAVVGAVSVAP--TAERCRGELGYVLARAHWGKGVATAAVRRALRDVFAEVEGLRRVE  119

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            A+VDV+N  SQRV EKAGF+RE VLR++Y  KG   D VM+S +++DP
Sbjct  120  ALVDVDNPASQRVAEKAGFRREGVLRRHYWHKGRARDMVMYSFLASDP  167



>ref|XP_003516755.1| PREDICTED: uncharacterized protein LOC100809953 [Glycine max]
Length=170

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D+S I+LRP + SDA+D+L++  DD VT++  W   TS E A  YI + A  HPW + IC
Sbjct  2    DHSRISLRPFKASDADDFLKWGGDDRVTRYLRWNSITSKEEALAYIEKVAIPHPWRQSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V   ++G V+VKP  G   C+A + YALA++YWG+GI  +A++ A   VF ++  ++RLE
Sbjct  62   VDDCSIGYVSVKPESGDYRCKAHVSYALAAEYWGQGIVAEALRRAIPIVFKKFPEVKRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIST  774
            A+V+ EN+GSQRVL K GF  E VLRKY   KG+  D ++FS ++T
Sbjct  122  ALVEEENKGSQRVLHKVGFVMEGVLRKYAFCKGDIKDFLIFSFLAT  167



>gb|KEH24544.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=160

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + +D +D++ +  DD VTK   W+   S E A  +I +    HPW R IC
Sbjct  5    DLSRISLRPFKLTDVDDFMLWAGDDEVTKNIRWKTCNSREEAQTFIKDVCIPHPWRRSIC  64

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +   ++G V+V P+ G D C+A++GYA+AS YWG+GIATKA+K+A + VF +++ L RL+
Sbjct  65   LDDHSIGFVSVYPWSGDDRCKADMGYAVASNYWGQGIATKAIKIALSQVFNDFSDLLRLQ  124

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPT  744
            A   V+N+ SQRVLEKAGF RE VLRKY  +K N T
Sbjct  125  AFTYVDNKASQRVLEKAGFLREGVLRKYTYIKENQT  160



>ref|NP_001050839.1| Os03g0664800 [Oryza sativa Japonica Group]
 gb|AAR88605.1| putative acetyltransferase [Oryza sativa Japonica Group]
 gb|AAS07320.1| putative acetyltransferase [Oryza sativa Japonica Group]
 gb|ABF98054.1| acetyltransferase, GNAT family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12753.1| Os03g0664800 [Oryza sativa Japonica Group]
 gb|EAY91288.1| hypothetical protein OsI_12903 [Oryza sativa Indica Group]
 gb|EAZ28035.1| hypothetical protein OsJ_12001 [Oryza sativa Japonica Group]
 dbj|BAH01447.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 110/183 (60%), Gaps = 20/183 (11%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            +TLR    +DAE    + SD  V +F   + ++ V+ A +YI +    HPWYR ICV G 
Sbjct  10   VTLREFTEADAEALFAWASDPRVVRFQRRDAYSHVDEARRYIVDKVLPHPWYRAICVAGA  69

Query  466  -KAVGSVTVKPF----------------RGCDSCRAEIGYALASKYWGKGIATKAVKMAA  594
             + VGS++VKP                  GC  CRA +GY +A  +WG+G+AT+AV+  A
Sbjct  70   DRPVGSISVKPADDLPLPEPESETGRLRSGC--CRASVGYRVAHAHWGRGVATRAVRAVA  127

Query  595  ASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIST  774
             +V  EW  LERLEAV DVEN  SQRVLEKAGF RE VLR+Y +LKG P D VMFS +  
Sbjct  128  EAVLAEWPWLERLEAVADVENPASQRVLEKAGFAREGVLRRYVVLKGRPRDMVMFSRVRA  187

Query  775  DPE  783
            D E
Sbjct  188  DLE  190



>ref|XP_004230137.1| PREDICTED: uncharacterized protein LOC101248425 [Solanum lycopersicum]
Length=171

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 109/165 (66%), Gaps = 0/165 (0%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S I+LRP + SD +D + +  DD VT+   W+  TS E A  +I +    HPW R IC+ 
Sbjct  4    SRISLRPFKLSDVDDMMLWAGDDRVTQTIRWDTLTSKEEALTFIKDVCIPHPWRRSICID  63

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             +++G V+V P  G D  RA++GYA+A +YWG+GI T+A+K+    V+ E++ + RL+A+
Sbjct  64   DRSIGFVSVFPGSGDDRSRADVGYAVAFEYWGQGIGTEALKLTIPQVYSEFSEVMRLQAL  123

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            VDVEN+ SQRVLEK GF +E  LRKY   KG   D  M+SL+ST+
Sbjct  124  VDVENKASQRVLEKVGFIKEGKLRKYGYHKGKLVDLFMYSLLSTE  168



>ref|XP_010659954.1| PREDICTED: uncharacterized protein LOC100255573 isoform X2 [Vitis 
vinifera]
Length=177

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +TLRP   SD +D++ +  DD VT+   W+  TS E A  +I E    HP+ R IC
Sbjct  2    DSGRVTLRPFRVSDVDDFILWAGDDQVTRNIRWKTVTSKEEALTFIKEVCIPHPFCRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V V    G D  +A++GY +A+K+WG+GIATK VKM  + VF ++  L RL+
Sbjct  62   IDDRSIGFVYVIRGSGADRHKADMGYGVAAKHWGQGIATKTVKMVISEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            AV  VEN  SQRVLEKAGF REA+LRK+  LKG   D V++SL+STD
Sbjct  122  AVAVVENIASQRVLEKAGFTREALLRKHSFLKGQLKDLVIYSLLSTD  168



>ref|XP_008644435.1| PREDICTED: uncharacterized protein LOC103625815 [Zea mays]
 ref|XP_008644436.1| PREDICTED: uncharacterized protein LOC103625815 [Zea mays]
 ref|XP_008644437.1| PREDICTED: uncharacterized protein LOC103625815 [Zea mays]
 gb|AFW67380.1| hypothetical protein ZEAMMB73_611690 [Zea mays]
 gb|AIB05648.1| GNAT transcription factor, partial [Zea mays]
Length=195

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 106/166 (64%), Gaps = 4/166 (2%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLR  E +D +  +E+ SD  V  FC WEP+ S E   +++ +    HPWYR ICV G
Sbjct  26   EVTLRRFELTDVDAMMEWASDPQVAAFCRWEPYASAEPLLEFLRDAVLPHPWYRAICVSG  85

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVF--VEWAHLERLEA  639
              VG+V++ P    + CR E+GY LA  +WGKG+AT AV+ A    F  +E   L R+EA
Sbjct  86   AVVGAVSLAP--TPERCRWELGYVLARAHWGKGVATAAVRRALRDAFADLEPEGLRRVEA  143

Query  640  VVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +VDV N  SQRV EKAGF+RE VLR++Y  KG   D VM+S +S+D
Sbjct  144  LVDVGNPASQRVAEKAGFRREGVLRRHYWHKGRARDMVMYSFLSSD  189



>gb|KHN43224.1| Putative N-acetyltransferase YoaA [Glycine soja]
Length=162

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 107/159 (67%), Gaps = 1/159 (1%)
 Frame = +1

Query  313  SDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKAVGSVTVK  492
            SD +D+L +  DD VT+   W+   S E A  +I +    HPW R IC+  +++G V+V 
Sbjct  2    SDVDDFLIWAGDDQVTRNLRWKTCGSREEALAFIRDVCIPHPWRRSICLDDRSIGFVSVY  61

Query  493  PFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQR  672
            P+ G + C+A+IGYA+ + YWG+GIATKA+  A   VF ++  L RL+A VDVEN+ SQR
Sbjct  62   PWSGDERCKADIGYAIGTNYWGQGIATKALMTAVPQVFKDFNELLRLQAFVDVENKASQR  121

Query  673  VLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVT  789
            VLEKAGF RE VLRKY  LKG   D V++S +STD E+T
Sbjct  122  VLEKAGFLREGVLRKYTYLKGVVKDLVLYSFLSTD-EIT  159



>ref|XP_004981455.1| PREDICTED: uncharacterized protein LOC101777978 [Setaria italica]
Length=189

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 110/172 (64%), Gaps = 8/172 (5%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            +TLRP E +D +  + + SD   T F +W  +TS +A   ++ +    HPW+R +C+ G 
Sbjct  19   VTLRPFELADVDAMMAWASDPEATAFMTWCAYTSRDALLAFLRDAVLPHPWFRAVCLAGG  78

Query  469  ------AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLER  630
                   VG+V+V P    D CRAE+G  LA  +WGKG+AT A+K   A+VF +   +ER
Sbjct  79   DGEPRCPVGAVSVTP--TADRCRAELGIVLARAHWGKGVATAALKRTVAAVFGDLEGVER  136

Query  631  LEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            +EAVVDV+N  SQR LEKAGF+REAVLR Y ++KG   D V++S ISTDP V
Sbjct  137  VEAVVDVDNAASQRALEKAGFQREAVLRSYCVVKGRLRDMVIYSFISTDPLV  188



>emb|CDY15325.1| BnaC04g42980D [Brassica napus]
Length=180

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP+  SD +DY+ + +D  V +FCSWEP TS E A KYI +    HPW R IC++  
Sbjct  19   ISLRPMILSDVDDYMVWATDAKVARFCSWEPCTSREEAIKYITDSVLTHPWLRAICLEDD  78

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            +  G + +      D  R EIGY L  KYWGKG AT+AV++  A VF E   +ERLEA+V
Sbjct  79   RPNGYILIM---SVDKIRKEIGYLLTKKYWGKGFATEAVRLVTAEVFKEMPEVERLEALV  135

Query  646  DVENRGSQRVLEKAGFKREAVL-RKYYLLKGNPTDAVMFSLI  768
            DV+N GSQRVLEK GF RE VL R + ++KG+  D VMFS +
Sbjct  136  DVDNIGSQRVLEKVGFTREGVLMRNFIVMKGSIRDMVMFSFL  177



>ref|XP_003557568.1| PREDICTED: uncharacterized protein LOC100834953 [Brachypodium 
distachyon]
Length=173

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 105/169 (62%), Gaps = 5/169 (3%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLR  + SD +  + + SD  V   CSWEP++S E    Y+ +    HPWYR IC+  
Sbjct  3    EVTLRRFDLSDVDAMISWASDPEVAVCCSWEPYSSTEPVLAYLRDTVLPHPWYRAICLAS  62

Query  466  KA----VGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
             A    VG V++      + CR E+GY LA  +WGKG+AT AVK A  +VF E   L R+
Sbjct  63   AADDRPVGFVSLS-LSPEERCRGELGYVLARAHWGKGVATAAVKRALGAVFGEVEGLARV  121

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            EA+VDV+N  SQRV EKAGF RE VLRK+Y LKG   D VMFS +S DP
Sbjct  122  EALVDVDNAASQRVAEKAGFTREGVLRKHYWLKGRARDLVMFSFVSGDP  170



>ref|XP_011090702.1| PREDICTED: uncharacterized protein LOC105171327 isoform X3 [Sesamum 
indicum]
Length=191

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 104/162 (64%), Gaps = 0/162 (0%)
 Frame = +1

Query  292  TLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKA  471
            +LRP  PSDAED+L +  DD VT +  W+  TS E A  YI + A  HPW + IC+   +
Sbjct  26   SLRPFRPSDAEDFLAWARDDKVTHYLRWKTITSREEALIYIQQVAIPHPWRQSICLDNHS  85

Query  472  VGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDV  651
            +G ++VKP    D  RA +GYA+ S+YWG+GI T A+K+A   VF ++  L RLEA+V+ 
Sbjct  86   IGYISVKPESSNDRHRAHVGYAIGSEYWGQGIVTAALKIAIPIVFEKFPFLVRLEALVEE  145

Query  652  ENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +N GSQ+VLEK GF RE  LRKY   KG   D  ++S + TD
Sbjct  146  DNVGSQKVLEKVGFVREGFLRKYGFNKGEIRDMFIYSFLKTD  187



>ref|XP_007034797.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
 gb|EOY05723.1| Acyl-CoA N-acyltransferases (NAT) superfamily protein [Theobroma 
cacao]
Length=320

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 104/161 (65%), Gaps = 0/161 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +ITLRP E SD +D++++  DD V        FTS E A  Y+ E     PW R IC++G
Sbjct  2    EITLRPYELSDVDDFMKWSCDDKVISRTRLRYFTSREDALSYLKEVVIPRPWCRAICLEG  61

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            K +G +  KP    + CR  I YAL S YWGK IATKAVKM    VF E+ ++ER++ +V
Sbjct  62   KPIGFIAFKPCSANEKCRGSISYALGSTYWGKSIATKAVKMVVPIVFKEFPYVERVQGLV  121

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            DV+N+ SQRVLEKAGF++E  LRKY +L G  +D  +FSL+
Sbjct  122  DVDNKASQRVLEKAGFQKEGTLRKYLILNGKTSDVYVFSLL  162



>gb|KHN30485.1| Putative N-acetyltransferase p20 [Glycine soja]
Length=170

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D+S I+LRP + SDA+D+L++  DD VT++  W   TS E A  YI + A  HPW + IC
Sbjct  2    DHSRISLRPFKASDADDFLKWGGDDRVTRYLRWNSITSKEEALAYIEKVAIPHPWRQSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V   ++G V+VKP  G   C+A + YALA++YWG+GI  +A++ A   VF ++  ++RLE
Sbjct  62   VDDCSIGYVSVKPESGDYRCKAHVSYALAAEYWGQGIVAEALRRAIPIVFKKFPEVKRLE  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIST  774
            A+V+ EN+GSQRVL K GF    VLRKY   KG+  D ++FS ++T
Sbjct  122  ALVEEENKGSQRVLHKVGFVMGGVLRKYAFCKGDIKDFLIFSFLAT  167



>ref|XP_009335338.1| PREDICTED: uncharacterized protein LOC103928052 [Pyrus x bretschneideri]
Length=165

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 100/157 (64%), Gaps = 0/157 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +ITLRP   SDAED+ ++  D+ VT+F  W  F S E    YI +    HP+ R IC+  
Sbjct  9    EITLRPYRLSDAEDFSKYTGDETVTQFTRWNTFKSKEEVLSYIKDACIPHPYCRSICIND  68

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
             ++G V VKP  G D CRAEIG ALA++YWG+GI  +AVKMA    F E+  L R++A+V
Sbjct  69   CSIGMVFVKPQDGDDMCRAEIGSALAAEYWGQGIVIRAVKMAITEGFKEFTDLVRMQALV  128

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVM  756
             +EN+ SQRVLEK GF  E +LR+Y + KG   D  M
Sbjct  129  LIENKASQRVLEKLGFHMEGLLREYTIHKGTVKDVFM  165



>ref|XP_011090699.1| PREDICTED: uncharacterized protein LOC105171327 isoform X1 [Sesamum 
indicum]
Length=213

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 104/162 (64%), Gaps = 0/162 (0%)
 Frame = +1

Query  292  TLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKA  471
            +LRP  PSDAED+L +  DD VT +  W+  TS E A  YI + A  HPW + IC+   +
Sbjct  48   SLRPFRPSDAEDFLAWARDDKVTHYLRWKTITSREEALIYIQQVAIPHPWRQSICLDNHS  107

Query  472  VGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDV  651
            +G ++VKP    D  RA +GYA+ S+YWG+GI T A+K+A   VF ++  L RLEA+V+ 
Sbjct  108  IGYISVKPESSNDRHRAHVGYAIGSEYWGQGIVTAALKIAIPIVFEKFPFLVRLEALVEE  167

Query  652  ENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +N GSQ+VLEK GF RE  LRKY   KG   D  ++S + TD
Sbjct  168  DNVGSQKVLEKVGFVREGFLRKYGFNKGEIRDMFIYSFLKTD  209



>ref|XP_004134439.1| PREDICTED: putative ribosomal N-acetyltransferase YdaF-like [Cucumis 
sativus]
 ref|XP_004164326.1| PREDICTED: putative ribosomal N-acetyltransferase YdaF-like [Cucumis 
sativus]
 gb|KGN56966.1| hypothetical protein Csa_3G146520 [Cucumis sativus]
Length=170

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S I++RP   SDA+D+L + SD+ VT++  W   TS E A  Y+ + A  H W R IC
Sbjct  2    NSSRISIRPFNLSDADDFLRWASDERVTRYLRWNTITSKEEALTYLEKVAIPHQWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            + G++VG V+ KP    + CRA I YA+A+++WG+GIAT A++ A  +   ++  L R++
Sbjct  62   LDGRSVGYVSFKP-ESEEKCRAHISYAVAAEHWGQGIATIALRAAIPAALRQFPELVRVQ  120

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+VEN GSQ+VLEK GF RE VLRKY   KG   D V+FSL+ TD
Sbjct  121  AMVEVENEGSQKVLEKLGFCREGVLRKYGFCKGEIRDLVVFSLLRTD  167



>ref|XP_007225078.1| hypothetical protein PRUPE_ppa017792mg [Prunus persica]
 gb|EMJ26277.1| hypothetical protein PRUPE_ppa017792mg [Prunus persica]
Length=151

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 26/169 (15%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRPL  +D +D++ + +D+ V  FC+WEP+ +                      
Sbjct  8    DLSKISLRPLGLADIDDFMVWGTDEKVAIFCTWEPYAT----------------------  45

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
             K +A+  +  K          E+GY L SKYWGKGIAT+AVK+ A ++F EW HLERLE
Sbjct  46   -KEEALNYIKEKIL---PQTPGELGYVLGSKYWGKGIATQAVKLVADTIFKEWTHLERLE  101

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            A VDV+N GSQRVLEK+GF RE VLRK+++LKG   D V+FSL+ST+ E
Sbjct  102  AFVDVDNVGSQRVLEKSGFLREGVLRKFFILKGRTRDMVIFSLLSTECE  150



>ref|XP_010659953.1| PREDICTED: uncharacterized protein LOC100255573 isoform X1 [Vitis 
vinifera]
Length=177

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 108/167 (65%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +TLRP   SD +D + +  D+ VT+   W+  TS E A  +I E    HP+ R IC
Sbjct  2    DSESLTLRPFRVSDVDDLILWAGDEQVTRTIRWKTITSKEEALTFIKEVCIPHPFCRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V V    G D  +A++GY +A+K+WG+GIATK VKM  + VF ++  L RL+
Sbjct  62   IDDRSIGFVYVIRGSGADRHKADMGYGVAAKHWGQGIATKTVKMVISEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            AV  VEN  SQRVLEKAGF REA+LRK+  LKG   D V++SL+STD
Sbjct  122  AVAVVENIASQRVLEKAGFTREALLRKHSFLKGQLKDLVIYSLLSTD  168



>ref|XP_011090701.1| PREDICTED: uncharacterized protein LOC105171327 isoform X2 [Sesamum 
indicum]
Length=211

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 104/162 (64%), Gaps = 0/162 (0%)
 Frame = +1

Query  292  TLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGKA  471
            +LRP  PSDAED+L +  DD VT +  W+  TS E A  YI + A  HPW + IC+   +
Sbjct  46   SLRPFRPSDAEDFLAWARDDKVTHYLRWKTITSREEALIYIQQVAIPHPWRQSICLDNHS  105

Query  472  VGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDV  651
            +G ++VKP    D  RA +GYA+ S+YWG+GI T A+K+A   VF ++  L RLEA+V+ 
Sbjct  106  IGYISVKPESSNDRHRAHVGYAIGSEYWGQGIVTAALKIAIPIVFEKFPFLVRLEALVEE  165

Query  652  ENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +N GSQ+VLEK GF RE  LRKY   KG   D  ++S + TD
Sbjct  166  DNVGSQKVLEKVGFVREGFLRKYGFNKGEIRDMFIYSFLKTD  207



>ref|XP_009616265.1| PREDICTED: uncharacterized protein LOC104108842 [Nicotiana tomentosiformis]
Length=171

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 108/170 (64%), Gaps = 0/170 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP + +D +D + +  DD VT+   W   TS E A  +I E    HPW R IC
Sbjct  2    DSSRISLRPFKLTDVDDMMLWAGDDRVTRTIRWNTLTSTEEALTFIKEVCLPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V    G D  R ++GYA+A +YWG+GIAT AVKM    V+ ++  + R +
Sbjct  62   INDRSIGFVSVFSGSGDDRSRGDVGYAIAVEYWGQGIATNAVKMTIPQVYNDFPEIVRPQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            A+ DV+N+ SQRVL KAGF +E +LRKY   KG   D VM+SL+ST+ ++
Sbjct  122  ALADVKNKASQRVLVKAGFIKEGILRKYGYHKGKIVDLVMYSLLSTESDI  171



>ref|XP_003559607.1| PREDICTED: uncharacterized protein LOC100839147 [Brachypodium 
distachyon]
Length=191

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 106/173 (61%), Gaps = 9/173 (5%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLR    +D E    + SD  V +F   E ++ V+ A +YI +    HPWYR ICV  
Sbjct  8    EVTLREFAEADTEALFSWASDPRVVRFQRREAYSRVDEARRYILDHVLPHPWYRAICVGS  67

Query  466  KAVGSVTVKPFRGCDS---------CRAEIGYALASKYWGKGIATKAVKMAAASVFVEWA  618
              VGS+++KP    +           RA +GY LA  YWG+GIAT+AV+MAA + F EW 
Sbjct  68   VVVGSISIKPGPAEEGGSRRRSPSSTRASLGYRLAHGYWGRGIATRAVRMAAEAAFAEWP  127

Query  619  HLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
             L RLEAV D EN  SQRVLEKAGF RE VLR+Y +LKG P D VMFS + TD
Sbjct  128  WLARLEAVADGENPASQRVLEKAGFVREGVLRRYLVLKGRPRDMVMFSSVDTD  180



>emb|CDY40688.1| BnaC03g34040D [Brassica napus]
 emb|CDX74159.1| BnaA03g28880D [Brassica napus]
Length=175

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 102/161 (63%), Gaps = 0/161 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S +TLRP   +DA D+L + SD  VT    W+ FTS E A  +I +    HPW R IC
Sbjct  4    DLSRVTLRPFSLTDAHDFLRWASDVRVTGNLRWQTFTSEEEALVFIRDVCLPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G ++V P  G D  +A IGY L+ +YWGKGIAT+AV +A   VF +  H+ RL+
Sbjct  64   IDDRSIGFISVFPETGDDRFKAHIGYGLSHEYWGKGIATRAVSIAVPQVFNDLPHVLRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMF  759
            A V  +N+ SQRVLEK GF+RE +LRKY  +KG   D  ++
Sbjct  124  AFVQTQNKASQRVLEKVGFQREGLLRKYSYVKGEIHDVFVY  164



>ref|XP_008665582.1| PREDICTED: uncharacterized protein LOC103644167 [Zea mays]
 tpg|DAA51865.1| TPA: hypothetical protein ZEAMMB73_071768 [Zea mays]
 gb|AIB05274.1| GNAT transcription factor, partial [Zea mays]
Length=193

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 112/197 (57%), Gaps = 11/197 (6%)
 Frame = +1

Query  193  ETNPTPFSQITEIFSAMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCS  372
            E   TP +Q       M+P+  P        ++TLR  E SD +  + + SD  V   C 
Sbjct  2    EATATPRTQ-----EVMKPE--PGTVKVTVDEVTLRKFELSDVDAMMAWASDPQVAALCR  54

Query  373  WEPFTSVEaaakyiaedaaaHPWYRGICV--KGKAVGSVTVKPFRGCDSCRAEIGYALAS  546
            WEP+ S E    +I +    H W+R IC+  + + VG+V+V P    D CRAE+GY LA 
Sbjct  55   WEPYESTEPLLAFIRDVVLPHQWFRAICLGSEPRPVGAVSVSP--TGDPCRAELGYVLAR  112

Query  547  KYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYL  726
             +WG+G+AT AVK    +VF E   LER+EA+VDV N  SQRVLEKAGF REAVLRKY  
Sbjct  113  AHWGRGVATAAVKRTVTAVFGEVPGLERVEALVDVANLASQRVLEKAGFTREAVLRKYGA  172

Query  727  LKGNPTDAVMFSLISTD  777
             KG   D VM S I  D
Sbjct  173  NKGVVRDKVMCSFIDPD  189



>gb|AFK40352.1| unknown [Medicago truncatula]
Length=175

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 104/157 (66%), Gaps = 7/157 (4%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I+LRP+  SD +D + + SD  V K+C+WEP+T+ E    +I   A+   W+R IC
Sbjct  20   DLSQISLRPISLSDLDDVMLWTSDAKVAKYCTWEPYTNKEKGIDFIQNIASKSLWFRAIC  79

Query  457  VKGKAVGSVTVKPFRGC-DSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHL  624
            ++ +A+G      F+ C D CR   A++GY+L+S YWGKGIAT  VK    + F E+ +L
Sbjct  80   LRDQAIGCT---EFQVCSDRCRDKSAQLGYSLSSMYWGKGIATMVVKKVVDAAFKEFPYL  136

Query  625  ERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKG  735
            ERLEA VDVEN  SQRVLEKAGF+RE VLRKY   KG
Sbjct  137  ERLEARVDVENVASQRVLEKAGFEREGVLRKYLFFKG  173



>ref|XP_002271721.1| PREDICTED: uncharacterized protein LOC100267445 [Vitis vinifera]
Length=177

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 107/169 (63%), Gaps = 0/169 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +T RP   SD +D++ +  D+ VT+   W+  TS E A  +I E    H + R IC
Sbjct  2    DSERVTFRPFRVSDVDDFILWAGDEQVTRTIRWKTITSKEEALTFIKEVCIPHHFCRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V V  + G D  +A+IGY +A+K+WG+GIATKAVKM  + VF ++  L RL+
Sbjct  62   IDDRSIGFVLVIRWSGADRHKADIGYGVAAKHWGQGIATKAVKMVISEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            A   VEN  SQRVLEKAGF RE +LRKY  LKG   D V++SL+STD  
Sbjct  122  AFAVVENIASQRVLEKAGFTREGLLRKYTFLKGQLKDLVIYSLLSTDSN  170



>emb|CAN75166.1| hypothetical protein VITISV_008626 [Vitis vinifera]
Length=230

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 108/167 (65%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +TLRP   SD +D + +  D+ VT+   W+  TS E A  +I E    HP+ R IC
Sbjct  2    DSESLTLRPFRVSDVDDLILWAGDEQVTRTIRWKTITSKEEALTFIKEVCIPHPFCRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V V    G D  +A++GY +A+KYWG+GIATK VKM  + VF ++  L RL+
Sbjct  62   IDDRSIGFVYVIRGSGADRHKADMGYGVAAKYWGQGIATKNVKMVISEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            AV  VEN  SQRVLEKAGF REA+LRK+  LKG   D V++SL+STD
Sbjct  122  AVAVVENIASQRVLEKAGFTREALLRKHSFLKGQLKDLVIYSLLSTD  168



>ref|XP_010312209.1| PREDICTED: uncharacterized protein LOC101257220 [Solanum lycopersicum]
Length=167

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 106/167 (63%), Gaps = 2/167 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP   +D +D L + SDD VT+   +    S + A  +I + +   PW R IC
Sbjct  2    DSSKITLRPYRSTDVDDVLSWASDDRVTRSIHFSTLISKDEALTFIHKSSI--PWRRSIC  59

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  ++VG V  +P  G D CRAE+GYALA ++WG+GI  KAV+MA   +  E+  + RL+
Sbjct  60   IDDRSVGIVVARPGSGDDRCRAEVGYALAVEFWGQGITPKAVEMAIPLILEEFPEIVRLQ  119

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+ D +N+ S RVLEKAGF++E + RKY+  KG   D V++S +STD
Sbjct  120  ALTDAKNKASHRVLEKAGFRKEGMFRKYFYFKGEIKDVVLYSFLSTD  166



>ref|XP_010485882.1| PREDICTED: uncharacterized protein LOC104764126 [Camelina sativa]
Length=182

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 98/161 (61%), Gaps = 0/161 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S + LRP E  DA D+L +  DD VT    W  FTS E A  +I +    HPW R IC
Sbjct  4    DLSRVNLRPFELKDAHDFLRWAGDDRVTGNLRWPAFTSEEEALVFIRDVCVPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            + G+++G +++ P  G D  +A IGY L  +YWGKG+ T AV +A + VF +  H+ RL+
Sbjct  64   IDGRSIGFISIFPETGDDRFKAHIGYGLCHEYWGKGVTTMAVSVAVSQVFNDLPHVFRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMF  759
            A V  +N+ SQRVLEK GF+RE +LR Y  LKG   D  ++
Sbjct  124  AFVQTQNKASQRVLEKVGFQREGLLRSYTFLKGKIYDVFVY  164



>ref|XP_010088118.1| putative N-acetyltransferase YoaA [Morus notabilis]
 ref|XP_010106390.1| putative N-acetyltransferase YoaA [Morus notabilis]
 gb|EXC10341.1| putative N-acetyltransferase YoaA [Morus notabilis]
 gb|EXC35891.1| putative N-acetyltransferase YoaA [Morus notabilis]
Length=176

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S+ITLRP   +D +  + +  DD VT+   W+  TS + A  +I +     PW R IC
Sbjct  4    NLSEITLRPFNLTDVDGLMSYAGDDQVTRKLRWKTLTSKDEALTFIKDVCILRPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++  ++V P  G D C+A+IGY +A KYWG+G+AT+AV+MA   VF +   + RL+
Sbjct  64   IDDRSISFISVFPGSGDDRCKADIGYGVAPKYWGQGVATRAVEMALPLVFKDLPEVVRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A V VEN+ SQRVLEKAGF++E +LR Y  +KG   D  ++S +STD
Sbjct  124  AFVFVENKASQRVLEKAGFQKEGLLRSYCFIKGVLRDLFVYSFLSTD  170



>emb|CDY10659.1| BnaA05g17030D [Brassica napus]
Length=180

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 111/167 (66%), Gaps = 2/167 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP + SDA+D L++  DD+VT++  W    +VE A ++I + A  HPW R IC+   
Sbjct  7    IFLRPFDLSDADDVLKWAGDDDVTRYLRWTSVKTVEEARQHILQTAIPHPWRRSICLLKD  66

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+V+P  G   CRA++GYA++ ++WG+GIAT AV+MA    F  +  + RL+AV
Sbjct  67   GRSIGCVSVRPDTGDGRCRADLGYAVSRQFWGRGIATAAVRMAVEQAFEIFPDVVRLQAV  126

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            V+VEN  SQ+VLEKAGF++E +L+KY   KG   D  ++S +    E
Sbjct  127  VEVENEASQKVLEKAGFEKEGLLKKYGFCKGGIRDMFLYSFVKVLKE  173



>ref|XP_010546623.1| PREDICTED: uncharacterized protein LOC104818651 [Tarenaya hassleriana]
Length=180

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 110/169 (65%), Gaps = 0/169 (0%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +++LRP E  D ++ L++  D+ VT++  W   T+ E A  ++ +    HPW R IC++ 
Sbjct  4    NLSLRPFELGDVKELLKWAGDERVTRYLQWPRLTTEEEAFAFVRDVCLPHPWRRSICLRD  63

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            +++G V+V P    ++ +A  GY L+ ++WGKGIAT+AV+MA + V  +  HL RL+A V
Sbjct  64   RSIGFVSVFPESAENNFKAYFGYGLSYEHWGKGIATRAVEMAVSEVLKDLPHLLRLQAFV  123

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTF  792
             VEN+ SQR+LEK GF+RE +LRKY  LKG   D  ++SL+ +D  + +
Sbjct  124  QVENKASQRILEKTGFQREGLLRKYISLKGQIHDVFVYSLLPSDLPLVY  172



>gb|ABK24907.1| unknown [Picea sitchensis]
Length=179

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            +TLR  + +D ED++ + +D+ V  FCSWE + S E A KYI+ +A  HPW++ ICV GK
Sbjct  10   VTLRDFKMTDVEDFMVWATDEEVAHFCSWEVYKSREQAEKYISTEAIPHPWFKAICVDGK  69

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            AVG +++    G   CR EIGY  A+  WGKGI T+AVK+  ++ F +   LER+E +V+
Sbjct  70   AVGGISLNRGEGHARCRGEIGYVTAAHCWGKGIVTQAVKLGVSAAFQDLPDLERIEGLVE  129

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
             +N  SQRVLEKAGF +E +L +Y   KG   D  ++ ++S D
Sbjct  130  PQNLASQRVLEKAGFVKEGLLSRYLNFKGKTRDFYVYRILSAD  172



>ref|XP_010511497.1| PREDICTED: uncharacterized protein LOC104787585 [Camelina sativa]
Length=169

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP   SDAED  ++ SDD+VT++  W+   ++E A ++I   A  HPW R I +  +
Sbjct  6    IFLRPFNVSDAEDVFKWASDDDVTRYLRWDSVKTLEEAEQHILNKAIPHPWRRSISLIQE  65

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+VKP  G   CRA++ YALA ++WG+GIAT AV++A    F ++  + RL+AV
Sbjct  66   GRSIGYVSVKPDSGDGRCRADLAYALAKEFWGRGIATAAVRIAVGQAFQDFPVVVRLQAV  125

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            V+VEN+ SQRVLEKAGF++E +L KY   KG   D  ++S +
Sbjct  126  VEVENKASQRVLEKAGFRKEGLLEKYGFSKGMIKDMFLYSFV  167



>ref|XP_006347815.1| PREDICTED: uncharacterized protein LOC102605071 [Solanum tuberosum]
Length=171

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ++LRP + +D +D + +  DD VT+   W   TS E A  +I +    HP  R IC
Sbjct  2    DSSRMSLRPFKLTDVDDMMLWAGDDRVTQTIRWNTLTSKEEALTFIKDVCIPHPCRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V P  G D  RA++GYA+A +YWG+GI T+A+KM    V+ E+  + RL+
Sbjct  62   IDDRSIGFVSVFPGSGDDRSRADVGYAVAFEYWGQGIGTEALKMTIPQVYSEFPEVIRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VDVEN+ SQRVLEK GF +E  LRKY   KG   D  M+SL+ST+
Sbjct  122  ALVDVENKASQRVLEKVGFIKEGKLRKYGYHKGKLVDLFMYSLLSTE  168



>gb|EYU32738.1| hypothetical protein MIMGU_mgv1a022954mg [Erythranthe guttata]
Length=168

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 112/169 (66%), Gaps = 2/169 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP   SDAED L +  DD VTK    +   S E A  +I  ++  + W R IC
Sbjct  2    DLSRITLRPFNQSDAEDILSWIGDDRVTKSDRMKTLKSKEEALSFIGREST-NLWRRSIC  60

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            ++ +++G +TV      ++CR EIGYALA +YWGKGI T+AV+MA   VF E+  + RL+
Sbjct  61   IEDRSIGMLTVYLGSDDEACRGEIGYALAVEYWGKGITTRAVEMAVPKVFDEFPQIVRLQ  120

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
             + +VEN+GS+RVLEKAGFK + ++RKY+ LKG   D V++S++S D +
Sbjct  121  GMTNVENKGSRRVLEKAGFKMDGLMRKYFYLKGQIQD-VVYSVLSPDSD  168



>ref|XP_009616264.1| PREDICTED: uncharacterized protein LOC104108841 [Nicotiana tomentosiformis]
Length=173

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK  462
            S ITLRP   +D ED L +  DD VT+   +    S E A  +I +     PW R IC+ 
Sbjct  4    SRITLRPYRSTDVEDLLLWGGDDRVTRSIHFNTLASKEDALTFIEKSTI--PWRRSICID  61

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             +++G V  +P    D CRAEIGYALA  YWG+GI  KAVKMA   +F ++  + RL+A+
Sbjct  62   DRSIGIVVARPGSDDDRCRAEIGYALAVDYWGQGITPKAVKMAIPLIFSDFPEIVRLQAL  121

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
             D  N+ S RVLEKAGF +E + RKY+  KG   D V++SL+STD
Sbjct  122  SDANNKASHRVLEKAGFVKEGMFRKYFYFKGEIKDVVLYSLLSTD  166



>ref|XP_010488292.1| PREDICTED: uncharacterized protein LOC104766156 [Camelina sativa]
Length=169

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP + SDAED  ++ SDD+VT++  W+   ++E A ++I   A  HPW R I +  +
Sbjct  6    IFLRPFKVSDAEDVFKWASDDDVTRYLRWDSVKTLEEAEQHILNKAIPHPWRRSISLIQE  65

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+VKP  G   CRA++ YALA ++WG+GIAT AV+MA    F ++  + RL+AV
Sbjct  66   GRSIGYVSVKPDSGDGRCRADLAYALAKEFWGRGIATAAVRMALGQAFQDFPVVVRLQAV  125

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            V+VEN+ SQRVLEK GF++E +L KY   KG   D  ++S +
Sbjct  126  VEVENKASQRVLEKVGFRKEGLLEKYGFSKGVIKDMFLYSFV  167



>ref|XP_009145312.1| PREDICTED: uncharacterized protein LOC103869025 [Brassica rapa]
Length=180

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 111/167 (66%), Gaps = 2/167 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP + SDAED L++  DD+VT++  W    +VE A ++I + A  HPW R IC+   
Sbjct  7    IFLRPFDLSDAEDVLKWAGDDDVTRYLRWTSVKTVEEARQHILQTAIPHPWRRSICLLKD  66

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+V+P  G   CRA++GYA++ ++WG+GIAT AV+MA    F  +  + RL+AV
Sbjct  67   GRSIGCVSVRPDTGDGRCRADLGYAVSRQFWGRGIATAAVRMAVEQAFEIFPDVVRLQAV  126

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPE  783
            V+VEN  S++VLEKAGF++E +L+KY   KG   D  ++S +    E
Sbjct  127  VEVENEASRKVLEKAGFEKEGLLKKYGFCKGGIRDMFLYSFVKVLKE  173



>ref|XP_002466308.1| hypothetical protein SORBIDRAFT_01g005400 [Sorghum bicolor]
 gb|EER93306.1| hypothetical protein SORBIDRAFT_01g005400 [Sorghum bicolor]
Length=155

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 5/152 (3%)
 Frame = +1

Query  331  LEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVK---GKAVGSVTVKPFR  501
            + + SD  V   C W+ + S E    +I +    HPW+R IC++   G+ VG+V+V P  
Sbjct  2    MAWASDPQVAAPCRWDAYESTEPLLAFIRDTVLPHPWFRAICLESGSGRPVGAVSVSP--  59

Query  502  GCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLE  681
              D CRAE+GY LA  +WG+G+AT AVK A A+VF E   LER+EA+VDV N  SQRVLE
Sbjct  60   TGDPCRAELGYVLARAHWGRGVATAAVKRAVATVFAEVQGLERVEALVDVANPASQRVLE  119

Query  682  KAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            KAGF+RE VLR++Y  KG   D VM+S +S D
Sbjct  120  KAGFRREGVLRRHYWHKGRARDMVMYSFLSDD  151



>ref|XP_010463981.1| PREDICTED: uncharacterized protein LOC104744605 [Camelina sativa]
Length=182

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 98/161 (61%), Gaps = 0/161 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S + LRP E  DA D+L +  DD VT    W  FTS E A  +I +    HPW R IC
Sbjct  4    DLSRVNLRPFELKDAHDFLRWAGDDRVTGNLRWPAFTSEEEALVFIRDVCVPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++ P  G D  +A IGY L  +YWGKGI T+AV +A + VF +  H+ RL+
Sbjct  64   IDDRSIGFISIFPETGDDRFKAHIGYGLCHEYWGKGITTRAVSVAVSQVFNDLPHVLRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMF  759
            A V  +N+ SQRV+EK GF+RE +LR Y  LKG   D  ++
Sbjct  124  AFVQTQNKASQRVVEKVGFQREGLLRSYTFLKGKIYDVFVY  164



>ref|XP_008438655.1| PREDICTED: uncharacterized protein LOC103483698 [Cucumis melo]
Length=170

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 109/167 (65%), Gaps = 1/167 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S I++RP   SDA+D+L + SD+ VT++  W   TS E A  YI + A  H W R IC
Sbjct  2    NSSRISIRPFNLSDADDFLRWASDERVTRYLRWNTITSKEEALTYIEKVAIPHQWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            + G++VG V+ KP    + CRA I YA+A+++WG+GIAT A++ A  +   E+  + R++
Sbjct  62   LDGRSVGYVSFKP-ESEEKCRAHISYAVAAEHWGQGIATIALRAAIPTALREFQEVVRVQ  120

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+V+VEN GSQ+VLEK GF RE VLRKY   K    D V+FS + T+
Sbjct  121  AMVEVENEGSQKVLEKLGFCREGVLRKYGFCKSEIRDLVVFSFLRTE  167



>ref|XP_007147125.1| hypothetical protein PHAVU_006G098000g [Phaseolus vulgaris]
 gb|ESW19119.1| hypothetical protein PHAVU_006G098000g [Phaseolus vulgaris]
Length=177

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S I LRP + SD +D+  +  DD VT+   W+   S E A  +I +    HPW R +C
Sbjct  5    DLSTIRLRPFKISDVDDFFLWAGDDEVTRNLLWKTCGSKEEALTFIRDVCIPHPWRRSVC  64

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
                ++G V+V P+ G +  +A+IGYA+ S YWG+GIATK +++A   VF ++ +L RL+
Sbjct  65   HGDCSIGFVSVYPWSGDERHKADIGYAIGSSYWGQGIATKVLQIAVPQVFKDFPNLLRLQ  124

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A VDV+N+ SQRVLEK GF RE VLRKY   KG   D V++S +ST+
Sbjct  125  AFVDVDNKPSQRVLEKVGFIREGVLRKYTYFKGVLKDFVVYSFLSTE  171



>ref|XP_002885512.1| hypothetical protein ARALYDRAFT_479775 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61771.1| hypothetical protein ARALYDRAFT_479775 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 107/165 (65%), Gaps = 2/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP   SDAED L++  DD+VT++  W+   ++E A ++I   A  H W R I +   
Sbjct  6    IFLRPFNVSDAEDVLKWAGDDDVTRYLRWDSVQTIEEAKQHILNKAIPHQWRRSISLVQH  65

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+VKP  G   CRA++ YA+A ++WG+GIAT AV+MA    F ++  L RL+AV
Sbjct  66   GRSLGYVSVKPDSGDGRCRADLAYAIAKEFWGRGIATAAVRMAVEQAFEDFPELVRLQAV  125

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+ SQR LEKAGF++E +L KY   KG   D  ++S +  D
Sbjct  126  VEVENKASQRELEKAGFRKEGLLEKYGFSKGVIKDMFLYSFVKDD  170



>ref|XP_006604834.1| PREDICTED: uncharacterized protein LOC100776526 isoform X2 [Glycine 
max]
Length=149

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 98/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            + S ITLRPL+ SD +D++    DD VT++  W  F S E A  +I +    HPW R IC
Sbjct  2    NLSRITLRPLKLSDVDDFMVVAGDDRVTRYTRWNTFVSREQALTFIRDHQ--HPWTRAIC  59

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V    +G V+V P  G D CRAEIG  +A+ YWG+GIAT+A K+AA+ VF +   L RL+
Sbjct  60   VDDVTIGYVSVSPGSGDDRCRAEIGCYIATDYWGQGIATEATKIAASQVFKDLPGLVRLQ  119

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYL  726
            A V VEN+ SQRVLEKAGF REA+L+   +
Sbjct  120  AFVAVENKASQRVLEKAGFLREAILKSILV  149



>gb|EAY92158.1| hypothetical protein OsI_13871 [Oryza sativa Indica Group]
Length=193

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 118/194 (61%), Gaps = 14/194 (7%)
 Frame = +1

Query  238  AMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyia  417
            + EP  +  A G    +++LR  + +D +  + + SD  V   C WEP+ S E    Y+ 
Sbjct  4    SQEPPHAAAARGA--VEVSLRRFDLADVDAMMVWASDPQVAAVCRWEPYESTEPLLAYLR  61

Query  418  edaaaHPWYRGICVKG----------KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGI  567
            +    HPW+R ICV            + VG+V+V P    D+CRAE+GY +A  +WGKG+
Sbjct  62   DTVLPHPWFRAICVAAAFDGDGGGDDRPVGAVSVSP--TADACRAELGYVVARAHWGKGV  119

Query  568  ATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTD  747
            AT AVK   A+VF E   LER+EA+VDV N  SQRVLEKAGF+REAVLR Y +LKG   D
Sbjct  120  ATAAVKRVVAAVFGEVEGLERVEALVDVRNAASQRVLEKAGFRREAVLRSYCVLKGEVRD  179

Query  748  AVMFSLISTDPEVT  789
             V++S ISTDP V+
Sbjct  180  MVIYSFISTDPLVS  193



>gb|EAZ28890.1| hypothetical protein OsJ_12930 [Oryza sativa Japonica Group]
Length=193

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 118/194 (61%), Gaps = 14/194 (7%)
 Frame = +1

Query  238  AMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyia  417
            + EP  +  A G    +++LR  + +D +  + + SD  V   C WEP+ S E    Y+ 
Sbjct  4    SQEPPHAAAARG--AVEVSLRRFDLADVDAMMVWASDPQVAAVCRWEPYESTEPLLAYLR  61

Query  418  edaaaHPWYRGICVKG----------KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGI  567
            +    HPW+R ICV            + VG+V+V P    D+CRAE+GY +A  +WGKG+
Sbjct  62   DTVLPHPWFRAICVSAAFDGDGGGEDRPVGAVSVSPT--ADACRAELGYVVARAHWGKGV  119

Query  568  ATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTD  747
            AT AVK   A+VF E   LER+EA+VDV N  SQRVLEKAGF+REAVLR Y +LKG   D
Sbjct  120  ATAAVKRVVAAVFGEVEGLERVEALVDVRNAASQRVLEKAGFRREAVLRSYCVLKGEVRD  179

Query  748  AVMFSLISTDPEVT  789
             V++S ISTDP V+
Sbjct  180  MVIYSFISTDPLVS  193



>ref|NP_188895.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis 
thaliana]
 dbj|BAB01471.1| alanine acetyl transferase-like protein [Arabidopsis thaliana]
 gb|ABN04781.1| At3g22560 [Arabidopsis thaliana]
 gb|AEE76653.1| GCN5-related N-acetyltransferase (GNAT) family protein [Arabidopsis 
thaliana]
Length=175

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 2/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP   SDAED  ++  DD+VT++  W+   S+E A ++I   A  HPW R I +   
Sbjct  8    IFLRPFNLSDAEDVFKWAGDDDVTRYLRWDSVNSLEEAKQHILNKAIPHPWRRSISLLQD  67

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G ++G V+VKP  G   CRA++ YA+A ++WG+GIAT AV+MA      ++  + RL+AV
Sbjct  68   GHSIGYVSVKPDSGDGRCRADLAYAVAKEFWGRGIATAAVRMAVEQALEDFPEVVRLQAV  127

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+ SQRVLEKAGF++E +L KY   KG   D  ++S +  D
Sbjct  128  VEVENKASQRVLEKAGFRKEGLLEKYGFSKGVIRDMFLYSYVKDD  172



>ref|XP_011026773.1| PREDICTED: uncharacterized protein LOC105127242 isoform X2 [Populus 
euphratica]
Length=177

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ITLRP + SDA+D+L +  DD VT+F  W  F+  E A  YI +    HP+ R ICV  +
Sbjct  19   ITLRPYKESDADDFLGYAGDDQVTRFTRWNTFSCKEEALVYIKDFCIPHPYCRSICVNDR  78

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G V ++   G + CRAE+GYA+A+KYWG+G+ T+A+K+A +     +  L RL+A VD
Sbjct  79   SIGFVFIRQESGDEKCRAELGYAMAAKYWGQGVTTRALKLAISDGLRSFPDLVRLQARVD  138

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKG  735
            VEN+ SQRVLEK GF +E +LRKY  +K 
Sbjct  139  VENKASQRVLEKLGFLKEGLLRKYMYIKA  167



>ref|NP_001051537.1| Os03g0794200 [Oryza sativa Japonica Group]
 gb|AAO37988.1| putative acetyltransferase [Oryza sativa Japonica Group]
 gb|ABF99319.1| acetyltransferase, GNAT family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13451.1| Os03g0794200 [Oryza sativa Japonica Group]
Length=193

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 118/194 (61%), Gaps = 14/194 (7%)
 Frame = +1

Query  238  AMEPQQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyia  417
            + EP  +  A G    +++LR  + +D +  + + SD  V   C WEP+ S E    Y+ 
Sbjct  4    SQEPPHAAAARG--AVEVSLRRFDLADVDAMMVWASDPQVAAVCRWEPYESTEPLLAYLR  61

Query  418  edaaaHPWYRGICVKG----------KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGI  567
            +    HPW+R ICV            + VG+V+V P    D+CRAE+GY +A  +WGKG+
Sbjct  62   DTVLPHPWFRAICVAAAFDGDGGGEDRPVGAVSVSP--TADACRAELGYVVARAHWGKGV  119

Query  568  ATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTD  747
            AT AVK   A+VF E   LER+EA+VDV N  SQRVLEKAGF+REAVLR Y +LKG   D
Sbjct  120  ATAAVKRVVAAVFGEVEGLERVEALVDVRNAASQRVLEKAGFRREAVLRSYCVLKGEVRD  179

Query  748  AVMFSLISTDPEVT  789
             V++S ISTDP V+
Sbjct  180  MVIYSFISTDPLVS  193



>ref|XP_010674903.1| PREDICTED: uncharacterized protein LOC104890975 [Beta vulgaris 
subsp. vulgaris]
Length=177

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 103/163 (63%), Gaps = 0/163 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LRP + +D +D++ +  DD VTK   W   TS E A  YI +    HPW R IC+   
Sbjct  8    ISLRPFKITDVDDFMIWAGDDEVTKNLQWRTITSKEEALVYIKDVCIPHPWRRSICIDDH  67

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            ++G +T+ P  G   CRA +GYA++ +YW KGIA++A+K+    V  ++  L RL+A V 
Sbjct  68   SIGMITIFPESGDGRCRAHVGYAVSKEYWNKGIASRALKLGINQVIKDYPDLVRLQAFVS  127

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            VEN+ SQRVLEK GF +E +LRKY  +K    D  ++S++ST+
Sbjct  128  VENKASQRVLEKCGFLQEGLLRKYSYVKEQLKDMFIYSILSTE  170



>ref|XP_006406147.1| hypothetical protein EUTSA_v10022340mg [Eutrema salsugineum]
 gb|ESQ47600.1| hypothetical protein EUTSA_v10022340mg [Eutrema salsugineum]
Length=172

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 109/165 (66%), Gaps = 2/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP   SDA D L++  DD+VT++  W+   +VE A ++I + A  HPW R I +   
Sbjct  7    IFLRPFNLSDAGDVLKWAGDDDVTRYLRWDSIKTVEEAQQHILQKAIPHPWRRSISLLDD  66

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+V+P  G   CRA +GYA+A ++WG+GIAT AV+MA       +  + R++AV
Sbjct  67   GRSIGCVSVRPDSGDGMCRANLGYAVAKEFWGRGIATAAVRMAVEEALEVFPTVVRIQAV  126

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+ SQ+VLEKAGF++E +L+KY L KG   D  ++S +  D
Sbjct  127  VEVENKASQKVLEKAGFQKEGLLKKYGLCKGVVRDMFLYSFVKDD  171



>ref|XP_010466541.1| PREDICTED: uncharacterized protein LOC104746712 [Camelina sativa]
Length=169

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP + SDAED  ++ SDD+VT++  W+   ++E A ++I   A  HPW R I +  +
Sbjct  6    IFLRPFKVSDAEDVFKWGSDDDVTRYLRWDSVKTLEEAEQHILYKAIPHPWRRSISLLQE  65

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+VKP  G   CRA++ YALA ++WG+GIAT AV+MA    F ++  + R++AV
Sbjct  66   GRSIGYVSVKPDSGDGRCRADLAYALAKEFWGRGIATAAVRMAVGQAFQDFPVVVRIQAV  125

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            V+VEN+ SQRVLEK GF++E +L KY    G   D  ++S +
Sbjct  126  VEVENKASQRVLEKVGFRKEGLLEKYGFSNGVIKDMFLYSFV  167



>gb|KCW84192.1| hypothetical protein EUGRSUZ_B01057 [Eucalyptus grandis]
Length=153

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 100/166 (60%), Gaps = 20/166 (12%)
 Frame = +1

Query  280  YSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV  459
            +SDI L  ++ SD   +  + +D+ V++FC+W+ FTS E   ++I      HPWYR IC+
Sbjct  6    FSDIALHAMDLSDINSFAAWATDNRVSRFCTWDTFTSKEEGIRHITNTVLPHPWYRAICL  65

Query  460  KGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEA  639
                VGSV+++P                    G+GI   AVKMA A++F EW  L RL+A
Sbjct  66   DDHPVGSVSMRP--------------------GRGIMMWAVKMAVAAIFREWPKLLRLQA  105

Query  640  VVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +VDVEN GS RV EKAGF+ E VLRKY +LKG   D V FSL+S+D
Sbjct  106  LVDVENVGSIRVQEKAGFRTEGVLRKYIVLKGRARDLVTFSLLSSD  151



>gb|KFK39550.1| hypothetical protein AALP_AA3G258600 [Arabis alpina]
Length=176

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 109/165 (66%), Gaps = 2/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            I+LRP   SDAED L++  DD+VT++  W    ++E A ++I   A  HPW R I +   
Sbjct  6    ISLRPFNLSDAEDVLKWAGDDDVTRYLRWASVKTLEEAQQHILTKAIPHPWRRSISLLND  65

Query  466  -KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
             +++G V+VKP  G   CRA +GYA+A ++WG+GIAT+AV+MA    F ++  + R++AV
Sbjct  66   RRSIGYVSVKPDSGDSRCRAHLGYAVAREFWGRGIATEAVRMALNQAFKDFPEVVRIQAV  125

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            V+VEN+ SQRVLEK GF++E +L+KY   +G   D  +++ +  D
Sbjct  126  VEVENKASQRVLEKVGFEKEGLLKKYGYCQGVIRDMFLYAFVKDD  170



>ref|XP_004247666.1| PREDICTED: uncharacterized protein LOC101250737 [Solanum lycopersicum]
Length=170

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            I+LR L+  DA+D++E+  D+NV +F S   F++ + A  YI        W+R IC+  K
Sbjct  8    ISLRLLDERDADDFMEWSLDENVKEFFSVGHFSTKKDAKIYINRSIVRQQWFRAICLNEK  67

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             +G + V P  G +  R EI Y L+SKYWG+GIATKAVKM A+++FV+  +L RLE +V 
Sbjct  68   PIGYIEVLPDHGIERFRGEIRYMLSSKYWGRGIATKAVKMVASTIFVDLPYLVRLEGMVY  127

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAV  753
            + N  SQRVLEKAGF RE VLRKYY  K    D V
Sbjct  128  IGNIRSQRVLEKAGFTREGVLRKYYRYKRELRDLV  162



>ref|XP_003559324.1| PREDICTED: uncharacterized protein LOC100842902 [Brachypodium 
distachyon]
Length=370

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 104/168 (62%), Gaps = 6/168 (4%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLR  + SD +  + + SD  V  FC WEP++S E+   Y+ +    HPWYR ICV  
Sbjct  2    EVTLRRFDLSDVDAMMSWASDPEVAAFCRWEPYSSTESLLAYLRDTVLPHPWYRAICVGS  61

Query  466  KA-----VGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLER  630
             A     VG V++ P    + CR E+GY +A  +WGKG+AT AVK A   VF E   L R
Sbjct  62   GAGNDRPVGLVSLAP-SPEERCRGELGYLVARAHWGKGVATAAVKRALGVVFGEVEELAR  120

Query  631  LEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIST  774
            +EA+VDV+N  SQRV EKAGF+RE VLR++Y  KG   D VM+S IS 
Sbjct  121  VEALVDVDNAASQRVAEKAGFRREGVLRRHYWHKGRARDLVMYSFISN  168


 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 89/172 (52%), Gaps = 8/172 (5%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFC--SWEPFTSVEaaakyiae--daaaHPWYRGIC  456
            + LRP +  D +  L + SD         +W+P  S E+   ++         PW R IC
Sbjct  196  VALRPFDLGDFDAELTWASDPVAAAPMPRAWDPCPSRESLLAFLWLWDSPLRRPWVRAIC  255

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWA--HLER  630
            +   A  +  V   R  D CRAEIG  LA  +    +A  A++ A A+ F +     +ER
Sbjct  256  IGPGAGVAGAVAVTRTDDRCRAEIGVVLARAHSSVTVAAAAMRRAVAAFFGDGGLEGVER  315

Query  631  LEAVVDVE--NRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDP  780
            +EAVVD    +   +R LE+AGF+REAVLR Y  ++G P D  ++S ISTDP
Sbjct  316  VEAVVDAGGGDGAPRRALEEAGFRREAVLRSYRAVEGQPRDMAIYSFISTDP  367



>ref|XP_003610742.1| N-acetyltransferase, putative [Medicago truncatula]
 gb|AES93700.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=191

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 105/174 (60%), Gaps = 6/174 (3%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSW-EPFTSVEaaakyiaedaaaHPWYRGI  453
            D + ITLR    SD +D + + +D+ V KF  W EP+TS +    +I   A  +   + I
Sbjct  20   DLNQITLRSFNLSDLDDLMVWHTDEKVAKF--WGEPYTSKDQGINFIKNMAGKYLRCKAI  77

Query  454  CVKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFVEWAHL  624
            C    A+G + +      D  R   AEIGY LASKYWGKGIAT AVK      F E+  L
Sbjct  78   CHNDHAIGCIKLSSSSLYDKSRNRCAEIGYVLASKYWGKGIATCAVKQMVKVAFSEFQSL  137

Query  625  ERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            ERL+A+VD++N GSQ+VLEK GF++E +LRKY   KG   D +MFSL+ TD ++
Sbjct  138  ERLQALVDMDNVGSQKVLEKVGFQKEGLLRKYVFFKGKSRDMIMFSLLFTDLQL  191



>ref|XP_006299352.1| hypothetical protein CARUB_v10015517mg [Capsella rubella]
 gb|EOA32250.1| hypothetical protein CARUB_v10015517mg [Capsella rubella]
Length=170

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--K  462
            I LRP + SDAED  ++ S+D+VT++  W+   ++E A ++I   A  HPW R I +   
Sbjct  6    IFLRPFKASDAEDVFKWASEDDVTRYLRWDSVKTLEEAEQHILNKAIPHPWRRSISLLQD  65

Query  463  GKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAV  642
            G+++G V+VKP  G   CRA++ YA+  ++WG+GIAT AV+MA    F ++  + R++AV
Sbjct  66   GRSIGYVSVKPDSGDGRCRADLAYAVGKEFWGRGIATAAVRMAVEQAFEDFPEVVRIQAV  125

Query  643  VDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            V+VEN+ SQRV EK GF++E +L KY L KG   D  ++  +
Sbjct  126  VEVENKASQRVSEKVGFRKEGLLEKYGLSKGVIKDMFLYGFV  167



>dbj|BAJ92857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 4/167 (2%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            ++TLR     D +  + + SD  V   C WEP+ S E    +I +    HPW+R IC+ G
Sbjct  18   EVTLRRFGLDDVDAMMAWASDPQVAAPCRWEPYESTEPLLAFIRDVVLPHPWFRAICLAG  77

Query  466  ---KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
               + VG+++V P     +CRAE+GY LA  +WGKG+AT AV+ A A+VF E   L+R+E
Sbjct  78   GGDRPVGAISVSPTDD-GACRAELGYVLARAHWGKGVATAAVRRAVAAVFGEVEGLQRVE  136

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            A+VDV N  SQRVLEKAGF+REAVLR+Y +LKG   D +++S ISTD
Sbjct  137  ALVDVANVASQRVLEKAGFRREAVLRRYCVLKGAVKDMIIYSFISTD  183



>ref|XP_003610738.1| N-acetyltransferase, putative [Medicago truncatula]
 gb|AES93696.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=193

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 108/177 (61%), Gaps = 9/177 (5%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSW-EPFTSVEaaakyiaedaaaHPWY-RG  450
            D + ITLR    SD +D + +++D+ V KF  W EP+TS +    +I    + +    + 
Sbjct  19   DLNQITLRSFNLSDLDDVMVWQTDEKVAKF--WGEPYTSKDQGINFIENIESEYLLQCKA  76

Query  451  ICVKGKAVGSVTVKPFRGCDSCR---AEIGYALASKYWGKGIATKAVKMAAASVFV--EW  615
            IC     +G + +      D  R   AEIGY LASKYWGKGIAT AVK      F   E+
Sbjct  77   ICHNDHVIGCIKLFSSSLHDKSRYKCAEIGYVLASKYWGKGIATCAVKQMVMVTFAFSEF  136

Query  616  AHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEV  786
            ++LERLEA+VDV+N GSQRVLEK GF++E VLRKY   KG   D +MFSL+STD ++
Sbjct  137  SYLERLEALVDVDNVGSQRVLEKVGFQKEGVLRKYVFFKGKSRDMIMFSLLSTDIQL  193



>emb|CAN76024.1| hypothetical protein VITISV_027073 [Vitis vinifera]
Length=255

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 96/147 (65%), Gaps = 0/147 (0%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D   +TLRP   SD +D++ +  DD VT+   W+  TS E A  +I E    HPW R IC
Sbjct  2    DSGTVTLRPFRVSDVDDFILWAGDDQVTRNIRWKTITSKEEALTFIKEVCIPHPWRRSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G V+V  + G + C+A+I Y +A+KYWG+GI TKAVKMA   VF ++  L RL+
Sbjct  62   IDDRSIGFVSVYRWSGNEICKADIAYGIAAKYWGQGITTKAVKMAVLEVFKDFPDLVRLQ  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRK  717
            A   VEN+ SQRVLEKAGF +E +LRK
Sbjct  122  AFAAVENKASQRVLEKAGFTKEGLLRK  148



>ref|NP_001050840.2| Os03g0665000 [Oryza sativa Japonica Group]
 gb|EEC75873.1| hypothetical protein OsI_12904 [Oryza sativa Indica Group]
 dbj|BAF12754.2| Os03g0665000 [Oryza sativa Japonica Group]
Length=214

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 104/171 (61%), Gaps = 8/171 (5%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG-  465
            +TLRPL  +DA+D++ + SD+ V +F       + E A   I +    HPW+R ICV   
Sbjct  21   VTLRPLGLADADDFMAWASDERVMRFLRRPLCAAREQAVAQIRDTVLGHPWFRAICVDDD  80

Query  466  ------KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
                  + VG V+V P+      RA +GYAL+   WG+GIAT A+ M  A VF E   LE
Sbjct  81   DAGAGRRPVGQVSVWPYADEGGHRANLGYALSHGLWGRGIATAAITMVVARVFDELPGLE  140

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLK-GNPTDAVMFSLISTD  777
            RLEAV DVEN  SQR LEKAGF++E VLR+Y + + G   DAV++S +++D
Sbjct  141  RLEAVTDVENVRSQRALEKAGFRKEGVLRRYIVRRSGEVMDAVIYSFLASD  191



>ref|XP_002968716.1| hypothetical protein SELMODRAFT_90075 [Selaginella moellendorffii]
 gb|EFJ29832.1| hypothetical protein SELMODRAFT_90075 [Selaginella moellendorffii]
Length=188

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 0/160 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            +TLR    SD +D +E+  DD VT+F  WE +TS +AA ++       HPW+R IC    
Sbjct  2    LTLREFRASDIDDMMEWAMDDAVTEFLVWETYTSRDAAVEFFHAFIVPHPWFRAICWADV  61

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            A+GS+++ P  G  +CRAE+GY LA +YWG+GI T AV+ A    F E   + R+EA+V 
Sbjct  62   AIGSLSLTPGSGIHACRAELGYVLARRYWGRGIMTAAVRAAVEQGFRELQSIARIEAIVF  121

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
             EN  SQRVL KAGF    + R Y ++K    D  +F ++
Sbjct  122  RENAASQRVLIKAGFASTGLQRSYVIVKNKLRDCYVFEMV  161



>ref|XP_002466307.1| hypothetical protein SORBIDRAFT_01g005390 [Sorghum bicolor]
 gb|EER93305.1| hypothetical protein SORBIDRAFT_01g005390 [Sorghum bicolor]
Length=188

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 117/188 (62%), Gaps = 11/188 (6%)
 Frame = +1

Query  250  QQSPDAFGDDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaa  429
            +Q   A     + +TLR  E +D +  +E+ SD  VT F +W+ +TS EA   ++ +   
Sbjct  2    EQEAAAQQGSVAAVTLRRFELADVDAMMEWASDHEVTAFMTWDAYTSREALLAFLRDAVL  61

Query  430  aHPWYRGICVKG---------KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAV  582
             HPW+R +C+           +AVG+V+V P    D+CRAE+   LA  +WGKG+AT AV
Sbjct  62   PHPWFRAVCLGAVGGEGHGPPRAVGAVSVTPTD--DACRAELCVVLARAHWGKGVATAAV  119

Query  583  KMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFS  762
            K A A+ F E   +ER+EA+VD++N  ++RVLEKAGF+RE VLR Y ++KG   D V++S
Sbjct  120  KRAVAAAFGELRGVERVEALVDIDNAAARRVLEKAGFQRETVLRSYCVVKGRLRDMVVYS  179

Query  763  LISTDPEV  786
             ISTDP V
Sbjct  180  FISTDPLV  187



>ref|XP_002990603.1| hypothetical protein SELMODRAFT_131939 [Selaginella moellendorffii]
 gb|EFJ08235.1| hypothetical protein SELMODRAFT_131939 [Selaginella moellendorffii]
Length=188

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 95/160 (59%), Gaps = 0/160 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            +TLR    SD +D +E+  DD VT+F  WE +TS +AA ++       HPW+R IC    
Sbjct  2    LTLREFRASDIDDMMEWAMDDAVTEFLVWETYTSRDAAVEFFHAFIVPHPWFRAICWADV  61

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
            A+GS+++ P  G  +CRAE+GY LA +YWG+GI T AV  A    F E   + R+EA+V 
Sbjct  62   AIGSLSLTPGSGIHACRAELGYVLARRYWGRGIMTAAVTAAVEQGFRELQSIARIEAIVF  121

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
             EN  SQRVL KAGF    + R Y ++K    D  +F ++
Sbjct  122  RENAASQRVLIKAGFASTGLQRSYVIVKNKLRDCYVFEMV  161



>ref|XP_006651663.1| PREDICTED: uncharacterized protein LOC102710483 [Oryza brachyantha]
Length=259

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 102/164 (62%), Gaps = 1/164 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            +TLRPL  +DA+D++ + SD+ V +F       + E A   I +    HPW+R ICV G+
Sbjct  19   VTLRPLGLADADDFMAWASDERVMRFLKRPLCATREQAVAQIGDTVLGHPWFRAICVAGR  78

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             VG V+V P+      RA +GYALA   WG+GIA  A+    A VF E   LERLEAV D
Sbjct  79   PVGQVSVWPYADEGGHRANLGYALAHGLWGRGIAAAAIIQVVARVFDELPGLERLEAVTD  138

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLK-GNPTDAVMFSLISTD  777
            VEN  SQRVLEKAGF+RE VLR Y + + G   DA ++S +++D
Sbjct  139  VENVRSQRVLEKAGFRREGVLRSYIVRRSGEVMDAAIYSFLASD  182


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  622  LERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLK-GNPTDAVMFSLISTD  777
            LERLEAV DVEN  SQRVLEKAGF+RE VLR Y + + G   DA ++S +++D
Sbjct  197  LERLEAVTDVENVRSQRVLEKAGFRREGVLRSYIVRRSGEVMDAAIYSFLASD  249



>ref|XP_010417714.1| PREDICTED: uncharacterized protein LOC104703403 [Camelina sativa]
Length=173

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 94/159 (59%), Gaps = 4/159 (3%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S + LRP E  DA D+L +  DD VT    W  FTS E A  +I +    HPW R IC
Sbjct  4    DLSGVNLRPFELKDAHDFLRWGGDDRVTGNLRWPAFTSEEEALVFIRDVCVPHPWRRSIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++ P  G D  +A IGY L  +YWGKGI  +AV +A + VF +  H+ RL+
Sbjct  64   IDDRSIGFISIFPETGDDRFKAHIGYGLCHEYWGKGITIRAVSVAVSQVFNDLPHVLRLQ  123

Query  637  AVVDVENRGSQRVLEKAGFKREAVLR----KYYLLKGNP  741
            A V  +N+ SQRV+EK GF+RE +LR      + L  NP
Sbjct  124  AFVQTQNKASQRVVEKIGFQREGLLRISCPLIFFLFHNP  162



>ref|XP_008669755.1| PREDICTED: uncharacterized protein LOC103646915 [Zea mays]
 tpg|DAA38828.1| TPA: hypothetical protein ZEAMMB73_086683 [Zea mays]
 gb|AIB05897.1| GNAT transcription factor, partial [Zea mays]
Length=195

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 110/167 (66%), Gaps = 6/167 (4%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKG  465
            +++LR    SDAE ++ + SD  V +F   + +  V+ A +YIA+    HPWYR ICV  
Sbjct  18   EVSLREFTMSDAEAFMSWASDPRVVRFQRRDAYEHVDQARRYIADHILPHPWYRAICVGA  77

Query  466  KA----VGSVTVKPFRGCDS--CRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLE  627
             A    VGS++VKP    D    RA +GY LA  +WG+GIAT+AV+ AAA+VF  W  L 
Sbjct  78   GAPLPVVGSISVKPGPTEDGRPFRASVGYRLARAHWGRGIATRAVRAAAAAVFAAWPWLL  137

Query  628  RLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            RLEAV DV+N  SQRVLEKAGF RE VLRKY LLKG P D VMFS++
Sbjct  138  RLEAVADVDNPASQRVLEKAGFAREGVLRKYVLLKGQPRDMVMFSIV  184



>ref|NP_001051538.2| Os03g0794300 [Oryza sativa Japonica Group]
 gb|AAO37986.1| putative acetyltransferase [Oryza sativa Japonica Group]
 gb|ABF99320.1| acetyltransferase, GNAT family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY92159.1| hypothetical protein OsI_13872 [Oryza sativa Indica Group]
 dbj|BAF13452.2| Os03g0794300 [Oryza sativa Japonica Group]
Length=177

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +1

Query  286  DITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV--  459
            ++TLR  E SD +  + + SD  V  FC WEP+ S E    Y+ +    HPW+R IC+  
Sbjct  2    EVTLRRFELSDVDAMMAWASDPAVAAFCRWEPYQSTEPLLAYLRDTVLPHPWFRAICLAT  61

Query  460  -------KGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFV-EW  615
                    G+ VG+V++ P    D+CR E+GY +A  +WGKG+AT AV+ A A+V   E 
Sbjct  62   GAGAGDGDGRPVGAVSLAP--TADACRGELGYVVARAHWGKGVATAAVRRAVAAVLGGEV  119

Query  616  AHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            + L R+EA+VDV+NR SQRV+EKAGF+RE VLR++Y  KG   D VM+S +S+D
Sbjct  120  SGLARVEALVDVDNRASQRVVEKAGFRREGVLRRHYWHKGRVRDLVMYSFVSSD  173



>gb|ABK26534.1| unknown [Picea sitchensis]
Length=179

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 94/160 (59%), Gaps = 0/160 (0%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            + LR    +D +D  E+ SD+ VTKF +WE F S E   +++ +    HPW++ IC  GK
Sbjct  19   VQLRNFCLADLDDLYEWASDEEVTKFMTWETFKSKEKLREFLVKVVIPHPWFKAICFNGK  78

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             +G V +K   G  SCRAE+GYA+A KYW  G  T+AV       F E   L+R+EA+V 
Sbjct  79   PIGHVMLKQGTGIQSCRAEMGYAIARKYWRMGFTTQAVITTLKMGFKELQGLKRIEALVL  138

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
             EN  S RVLEKAGF +E  L  Y  +KG   D ++FS +
Sbjct  139  PENVASARVLEKAGFVKEGFLPNYVHVKGTVRDCLLFSYV  178



>ref|XP_009768931.1| PREDICTED: uncharacterized protein LOC104219852 [Nicotiana sylvestris]
Length=110

 Score =   127 bits (319),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +1

Query  466  KAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVV  645
            KA+GS++V P       RAE+GY LA KYWGKGI  K VKM  + +F E  +LER+EA+V
Sbjct  6    KAIGSISVTP---NSVIRAELGYVLAYKYWGKGIVRKTVKMVTSVIFTELPNLERIEALV  62

Query  646  DVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVT  789
            DV+N+GSQRVLEKAGF +E VLRKY +LKG   D V+FS ++TD  ++
Sbjct  63   DVDNKGSQRVLEKAGFLKEGVLRKYMVLKGRSRDMVIFSFLATDSHLS  110



>dbj|BAJ99997.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 109/177 (62%), Gaps = 13/177 (7%)
 Frame = +1

Query  283  SDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV-  459
            +++TLR    +DAE    + SD  V  F   E +  V+ A +YI +    HPWYR IC+ 
Sbjct  9    TEVTLREFTEADAEALFAWASDPRVVLFQRREAYARVDEARRYILDHVLPHPWYRAICLG  68

Query  460  ---KGKAVGSVTVKPFRGC---------DSCRAEIGYALASKYWGKGIATKAVKMAAASV  603
                  AVGS++VKP R            + RA +GY +A  +WG+GIAT+AV MAAA+ 
Sbjct  69   TGEDAVAVGSISVKPCRPSAMAGEEEEERAPRASLGYRVAHGHWGRGIATRAVVMAAAAA  128

Query  604  FVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLIST  774
            F EW  L RLEAV DVEN  SQRVLEKAGF RE VLR+Y +LKG P D VMFSL++ 
Sbjct  129  FAEWPWLLRLEAVADVENPASQRVLEKAGFVREGVLRRYVVLKGTPRDMVMFSLVAA  185



>ref|XP_009364603.1| PREDICTED: uncharacterized protein LOC103954494 [Pyrus x bretschneideri]
Length=176

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = +1

Query  346  DDNVTKFC-SWEPFTSVEaaakyiaedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRA  522
            DD VT+    +   T+ + A  +I      HPW R IC+  +++G VT+ P  G D  +A
Sbjct  10   DDQVTRVLRGFRTLTTKDEALNFIKNVCIPHPWRRSICIDDRSIGFVTMFPGSGDDRHKA  69

Query  523  EIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKRE  702
            ++GYALA++YWG GI TKAVK+A + VF ++  L RL++ V VEN+ SQRVLEK GF+RE
Sbjct  70   DMGYALAARYWGLGITTKAVKIALSQVFKDYPDLVRLQSFVAVENKASQRVLEKVGFQRE  129

Query  703  AVLRKYYLLKGNPTDAVMFSL  765
             +LRKY  LKG+  D V++S 
Sbjct  130  GMLRKYLYLKGDIKDMVVYSF  150



>ref|XP_001752501.1| predicted protein [Physcomitrella patens]
 gb|EDQ82740.1| predicted protein [Physcomitrella patens]
Length=178

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 100/172 (58%), Gaps = 2/172 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S +TLR     D   +L + +DD VTK+  W+ +TS + A  Y+   A  HPW + IC
Sbjct  4    DESRVTLRGFNTDDLAGFLGWATDDEVTKWLMWDSYTSEQDALNYLQHVAIPHPWIKAIC  63

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            V GKA GS+ V+   G ++CR  +GY LA  YWG+G+AT AVK      F +   + R+E
Sbjct  64   VDGKAAGSIQVERGTGYNACRGVMGYCLARNYWGRGVATIAVKKMLTLAF-QGMDIARVE  122

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNP-TDAVMFSLISTDPEVT  789
            A+V  +N  S+RVLEKAGFK E  + KY L+KG   TD  + +  + D  V 
Sbjct  123  ALVIQDNIASRRVLEKAGFKLEGAMLKYLLIKGKKLTDCFLLATYAPDHAVN  174



>ref|XP_002466702.1| hypothetical protein SORBIDRAFT_01g012580 [Sorghum bicolor]
 gb|EER93700.1| hypothetical protein SORBIDRAFT_01g012580 [Sorghum bicolor]
Length=199

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 100/172 (58%), Gaps = 9/172 (5%)
 Frame = +1

Query  289  ITLRPLEPSDAE--DYLEFRSDDNVTKFCSWEPFTSV-EaaakyiaedaaaHPWYRGICV  459
            ++LR L  +DA+   ++ + SDD V ++    P     E A   I +    HPW+R +CV
Sbjct  26   VSLRELSLADADVDAFMSWASDDRVMRYLVKRPRCDTREQAVAQIRDTVLGHPWFRAVCV  85

Query  460  KGK-----AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHL  624
             G       VG V+V P+      RA IGYALA   WG+GIA  A++M    VF +   L
Sbjct  86   GGGDGRPVPVGQVSVWPYADEGGRRANIGYALAHDQWGRGIAVAAIRMVVGRVFDDLPGL  145

Query  625  ERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPT-DAVMFSLISTD  777
            ERLEAV DVEN  SQRVLEKAGF RE VLR+Y   +G    DAVM+S +S+D
Sbjct  146  ERLEAVTDVENVRSQRVLEKAGFHREGVLRRYIAGRGGEARDAVMYSFLSSD  197



>ref|XP_002517111.1| N-acetyltransferase, putative [Ricinus communis]
 gb|EEF45274.1| N-acetyltransferase, putative [Ricinus communis]
Length=183

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 105/172 (61%), Gaps = 2/172 (1%)
 Frame = +1

Query  277  DYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGIC  456
            D S ITLRP + SD +D+L++ +DD V K   W+  T+ E A  ++ + A   PW+  IC
Sbjct  2    DPSRITLRPFKLSDVDDFLKWVNDDRVAKNVRWDAITTREEAVAHLEKVAIPQPWHHSIC  61

Query  457  VKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLE  636
            +  +++G +++      D   A I YA A+++WG+GIAT A+KMA + VF+E   L RL 
Sbjct  62   LDDRSIGYISLWKVSDDDKSTASIAYATAAEHWGQGIATIALKMALSRVFIELPDLVRLM  121

Query  637  AVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTDPEVTF  792
            A V  EN+ SQRVLEK GF +  ++RK Y  KG   D +++  +S + EV +
Sbjct  122  AYVLKENKRSQRVLEKFGFVKTDLIRKMY--KGEMKDILVYGFLSKNKEVDY  171



>ref|XP_004982231.1| PREDICTED: uncharacterized protein LOC101781723 [Setaria italica]
Length=220

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 101/170 (59%), Gaps = 7/170 (4%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV---  459
            ++LRPL  +DA+ ++ + SDD V +F       + E A   I +    HPW+R +CV   
Sbjct  32   VSLRPLGLADADAFMAWASDDRVMRFLKRPLCATREQAVAQIRDTVLGHPWFRAVCVGDG  91

Query  460  --KGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
              +   VG V+V P+      RA +GYALA  +WG+GIA  A+      VF +   LERL
Sbjct  92   GGRPVPVGQVSVWPYADEGGRRANLGYALARDHWGRGIAAAAIVQVVGRVFDDLPGLERL  151

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPT--DAVMFSLISTD  777
            EAV DV+N  SQRVLEKAGF+RE +LR+Y   +G     DAV++S +S+D
Sbjct  152  EAVTDVDNARSQRVLEKAGFRREGLLRRYIAGRGGAQARDAVIYSFLSSD  201



>ref|XP_008644621.1| PREDICTED: uncharacterized protein LOC103626014 [Zea mays]
Length=215

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 103/191 (54%), Gaps = 9/191 (5%)
 Frame = +1

Query  232  FSAMEPQQSPDAFGDDYSD-------ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTS  390
             +AMEP    D       D       ++LR L  +DA+ ++ + SDD V +        +
Sbjct  22   HTAMEPAADGDDVHGQRRDGGHHAPVVSLRALGLADADAFMAWASDDRVMRHLKRPLCAT  81

Query  391  VEaaakyiaedaaaHPWYRGICVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIA  570
             E A   I +    HPW+R +C     VG V+V P+      RA +GYALA   WG+GIA
Sbjct  82   REQAVAQIRDTVLGHPWFRAVCFGDVPVGQVSVWPYADEGGRRANLGYALAHDQWGRGIA  141

Query  571  TKAVKMAAASVFVEWAHLERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLK--GNPT  744
              AV+M   +VF +   LERLEAV DV N  SQRVLEKAGF RE VLR+Y   +      
Sbjct  142  AAAVRMVVGTVFDDLPGLERLEAVTDVANVRSQRVLEKAGFHREGVLRRYIAGRRGSGAR  201

Query  745  DAVMFSLISTD  777
            DAV++S +S+D
Sbjct  202  DAVIYSFLSSD  212



>gb|AIB05867.1| GNAT transcription factor, partial [Zea mays]
Length=191

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 96/165 (58%), Gaps = 2/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ++LR L  +DA+ ++ + SDD V +        + E A   I +    HPW+R IC    
Sbjct  24   VSLRALGLADADAFMAWASDDRVMRHLKRPLCATREQAVAQIRDTVLGHPWFRAICFGDV  83

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             VG V+V P+      RA +GYALA   WG+GIA  AV+M   +VF +   LERLEAV D
Sbjct  84   PVGQVSVWPYADEGGRRANLGYALAHDQWGRGIAAAAVRMVVGTVFDDLPGLERLEAVTD  143

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLK--GNPTDAVMFSLISTD  777
            V N  SQRVLEKAGF RE VLR+Y   +      DAV++S +S+D
Sbjct  144  VANVRSQRVLEKAGFHREGVLRRYIAGRRGSGARDAVIYSFLSSD  188



>gb|AFW68045.1| hypothetical protein ZEAMMB73_370881 [Zea mays]
Length=191

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 96/165 (58%), Gaps = 2/165 (1%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ++LR L  +DA+ ++ + SDD V +        + E A   I +    HPW+R +C    
Sbjct  24   VSLRALGLADADAFMAWASDDRVMRHLKRPLCATREQAVAQIRDTVLGHPWFRAVCFGDV  83

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERLEAVVD  648
             VG V+V P+      RA +GYALA   WG+GIA  AV+M   +VF +   LERLEAV D
Sbjct  84   PVGQVSVWPYADEGGRRANLGYALAHDQWGRGIAAAAVRMVVGTVFDDLPGLERLEAVTD  143

Query  649  VENRGSQRVLEKAGFKREAVLRKYYLLK--GNPTDAVMFSLISTD  777
            V N  SQRVLEKAGF RE VLR+Y   +      DAV++S +S+D
Sbjct  144  VANVRSQRVLEKAGFHREGVLRRYIAGRRGSGARDAVIYSFLSSD  188



>gb|AFK47955.1| unknown [Medicago truncatula]
 gb|KEH21910.1| acetyltransferase (GNAT) domain protein [Medicago truncatula]
Length=177

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 105/168 (63%), Gaps = 2/168 (1%)
 Frame = +1

Query  274  DDYSDITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGI  453
            D  S ITLRP + SDA+D L + SD+ V ++   +   S E A  +I +D   +P+ + I
Sbjct  4    DHESRITLRPFKESDADDVLLWASDERVMQYTRLKLCKSREQALNFIKKDCI-YPFQQSI  62

Query  454  CVKGKAVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAHLERL  633
            C+   ++G V V P       +A++G+A+   YWG+GIATKA+K+  + VF E+  L+RL
Sbjct  63   CLDDHSIGIVFVLPISYA-KFKADLGFAIGFNYWGQGIATKALKILLSRVFQEFPDLQRL  121

Query  634  EAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLISTD  777
            +A + V+N  SQRVLEK GF RE + RK +  KGN  DA +FS +STD
Sbjct  122  QANILVDNMASQRVLEKVGFHREGLFRKVFHHKGNIVDAYIFSFLSTD  169



>tpg|DAA58807.1| TPA: hypothetical protein ZEAMMB73_892973 [Zea mays]
 gb|AIB04777.1| GNAT transcription factor, partial [Zea mays]
Length=199

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 109/169 (64%), Gaps = 8/169 (5%)
 Frame = +1

Query  286  DITLR--PLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICV  459
            +++LR   L  +DAE ++ + SD  V +F   + +  V+ A +YIA+    HPWYR IC 
Sbjct  20   EVSLREFTLSDADAEAFMSWASDPRVVRFQRRDAYEHVDQARRYIADHVLPHPWYRAICA  79

Query  460  KGKA----VGSVTVK--PFRGCDSCRAEIGYALASKYWGKGIATKAVKMAAASVFVEWAH  621
               A    VGS++VK  P       RA +GY LA  +WG+GIAT+AV+ AAA+VF  W  
Sbjct  80   GAGAPLPVVGSISVKAGPAEDGRLFRASVGYRLAHAHWGRGIATRAVRAAAAAVFTAWPW  139

Query  622  LERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYLLKGNPTDAVMFSLI  768
            L RLEAV DV+N  SQRVLEKAGF RE VLRKY LLKG P D VMFS++
Sbjct  140  LLRLEAVADVDNPASQRVLEKAGFAREGVLRKYVLLKGRPRDMVMFSIV  188



>gb|EMT23819.1| Putative N-acetyltransferase yoaA [Aegilops tauschii]
Length=204

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 102/178 (57%), Gaps = 13/178 (7%)
 Frame = +1

Query  289  ITLRPLEPSDAEDYLEFRSDDNVTKFCSWEPFTSVEaaakyiaedaaaHPWYRGICVKGK  468
            ++LRPL  +D +D++ + SDD V +        + E A   I +    HPW+R ICV G+
Sbjct  23   VSLRPLGLADVDDFMAWASDDRVMRHLKRPLCHTREQAVAQIGDTVLGHPWFRAICVTGR  82

Query  469  AVGSVTVKPFRGCDSCRAEIGYALASKYWGKGIATKAVKMAA---------ASVFVEWAH  621
             VG V+V P+      RA +GYALA ++WG+GIA+ A++M A           VF E   
Sbjct  83   PVGQVSVWPYPDDGGHRANLGYALAHEHWGRGIASAAIRMVARNAGGAPVVGRVFEELPG  142

Query  622  LERLEAVVDVENRGSQRVLEKAGFKREAVLRKYYL----LKGNPTDAVMFSLISTDPE  783
            L RLEAV DV N  SQR LEKAGF+RE VLR Y +      G   DA ++S +S+DP 
Sbjct  143  LGRLEAVTDVGNVRSQRALEKAGFQREGVLRSYIVRPGAGAGEAGDAAVYSFLSSDPR  200



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3399257179180