BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77704_g1_i1 len=2556 path=[5:0-2555]

Length=2556
                                                                      Score     E

ref|XP_009607668.1|  PREDICTED: vicilin-like antimicrobial peptid...    378   1e-117   
ref|XP_009786980.1|  PREDICTED: vicilin-like antimicrobial peptid...    374   3e-116   
ref|XP_004247186.1|  PREDICTED: vicilin-like antimicrobial peptid...    372   1e-115   
ref|XP_006349767.1|  PREDICTED: vicilin-like antimicrobial peptid...    371   4e-115   
ref|XP_010679084.1|  PREDICTED: vicilin-like antimicrobial peptid...    357   1e-108   
ref|XP_008235388.1|  PREDICTED: sucrose-binding protein-like            353   8e-108   
gb|AAL86739.1|AF441864_1  48-kDa glycoprotein precursor                 350   2e-107   Corylus avellana [European hazelnut]
ref|XP_009367697.1|  PREDICTED: sucrose-binding protein-like            350   3e-107   
ref|XP_007200965.1|  hypothetical protein PRUPE_ppa004438mg             347   2e-105   
gb|EYU23233.1|  hypothetical protein MIMGU_mgv1a024110mg                345   9e-104   
gb|AAK15089.1|AF240006_1  7S globulin                                   344   1e-103   Sesamum indicum [beniseed]
ref|XP_004292578.1|  PREDICTED: vicilin-like antimicrobial peptid...    341   2e-103   
ref|XP_009370838.1|  PREDICTED: sucrose-binding protein-like            338   8e-103   
gb|ABO36677.1|  vicilin                                                 339   2e-102   Pistacia vera [pistachio]
ref|XP_008355465.1|  PREDICTED: sucrose-binding protein-like            337   3e-102   
ref|XP_011082575.1|  PREDICTED: vicilin-like antimicrobial peptid...    340   4e-102   
ref|XP_010086607.1|  Sucrose-binding protein                            335   4e-101   
gb|EYU40904.1|  hypothetical protein MIMGU_mgv1a003248mg                337   1e-100   
ref|XP_010054529.1|  PREDICTED: sucrose-binding protein-like            334   4e-100   
ref|XP_008350065.1|  PREDICTED: sucrose-binding protein-like            325   3e-97    
gb|KDO68672.1|  hypothetical protein CISIN_1g040805mg                   321   2e-95    
ref|XP_006444033.1|  hypothetical protein CICLE_v10024281mg             320   3e-95    
ref|XP_008451293.1|  PREDICTED: sucrose-binding protein-like            319   4e-95    
gb|KDP21423.1|  hypothetical protein JCGZ_21894                         318   1e-94    
ref|XP_002524752.1|  nucleolar protein nop56, putative                  318   4e-94    Ricinus communis
emb|CBI28721.3|  unnamed protein product                                310   4e-93    
gb|KGN44776.1|  hypothetical protein Csa_7G380130                       312   1e-92    
ref|XP_008386543.1|  PREDICTED: sucrose-binding protein-like            311   1e-92    
emb|CBI28722.3|  unnamed protein product                                326   1e-91    
gb|KHG24948.1|  Vicilin-like antimicrobial peptides 2-1                 309   7e-91    
gb|AAM73730.2|AF395894_1  vicilin-like protein                          306   5e-90    Anacardium occidentale [maranon]
gb|AAM73729.1|AF395893_1  vicilin-like protein                          306   6e-90    Anacardium occidentale [maranon]
ref|XP_010256229.1|  PREDICTED: vicilin-like antimicrobial peptid...    303   1e-88    
gb|AAF05723.1|AF191299_1  sucrose binding protein homolog S-64          300   3e-88    Glycine max [soybeans]
emb|CAA41809.1|  vicilin-like embryo storage protein                    301   1e-87    Zea mays [maize]
ref|NP_001237244.1|  sucrose-binding protein 2 precursor                297   4e-87    
gb|ACN34339.1|  unknown                                                 300   4e-87    Zea mays [maize]
ref|XP_003632318.2|  PREDICTED: vicilin-like antimicrobial peptid...    306   4e-87    
ref|NP_001105887.1|  globulin-1 S allele precursor                      298   1e-86    Zea mays [maize]
gb|EYU41459.1|  hypothetical protein MIMGU_mgv1a003361mg                296   1e-85    
ref|XP_009417381.1|  PREDICTED: globulin-1 S allele-like                290   5e-85    
ref|XP_006650381.1|  PREDICTED: globulin-1 S allele-like                293   9e-85    
ref|XP_011090693.1|  PREDICTED: vicilin-like antimicrobial peptid...    294   2e-84    
ref|XP_009417380.1|  PREDICTED: globulin-1 S allele-like                290   2e-84    
gb|AAS07324.1|  putative globulin (with alternative splicing)           289   4e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006383667.1|  hypothetical protein POPTR_0005s23390g             287   1e-82    
ref|XP_010256228.1|  PREDICTED: vicilin-like antimicrobial peptid...    286   1e-82    
ref|XP_002464118.1|  hypothetical protein SORBIDRAFT_01g012640          288   2e-82    Sorghum bicolor [broomcorn]
ref|XP_003590610.1|  Vicilin-like antimicrobial peptides 2-2            284   3e-82    
ref|XP_006839012.1|  hypothetical protein AMTR_s00002p00272040          282   4e-81    
emb|CAA72090.1|  P54 protein                                            279   2e-80    Pisum sativum [garden pea]
gb|KHN18868.1|  Sucrose-binding protein                                 277   2e-80    
ref|XP_003536630.1|  PREDICTED: sucrose-binding protein-like            279   4e-80    
gb|AFM30909.1|  globulin-3A                                             280   1e-79    
gb|ACJ65514.1|  globulin 3                                              280   1e-79    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009595712.1|  PREDICTED: vicilin-like antimicrobial peptid...    284   3e-79    
ref|XP_009595711.1|  PREDICTED: vicilin-like antimicrobial peptid...    284   3e-79    
ref|XP_010911186.1|  PREDICTED: vicilin-like antimicrobial peptid...    276   2e-78    
ref|XP_010938562.1|  PREDICTED: globulin-1 S allele                     274   2e-78    
ref|XP_004495184.1|  PREDICTED: sucrose-binding protein-like            271   7e-78    
ref|XP_011032788.1|  PREDICTED: vicilin-like antimicrobial peptid...    274   8e-78    
ref|XP_009771136.1|  PREDICTED: vicilin-like antimicrobial peptid...    279   2e-77    
ref|NP_001276308.1|  sucrose-binding protein precursor                  269   3e-76    
ref|XP_007144650.1|  hypothetical protein PHAVU_007G173600g             268   3e-76    
ref|XP_004146991.1|  PREDICTED: vicilin-like antimicrobial peptid...    266   5e-76    
ref|XP_009413881.1|  PREDICTED: globulin-1 S allele-like                265   9e-76    
ref|XP_004162195.1|  PREDICTED: vicilin-like antimicrobial peptid...    265   1e-75    
gb|EMS66832.1|  Globulin-1 S allele                                     266   2e-75    
sp|Q9SPL4.1|AMP22_MACIN  RecName: Full=Vicilin-like antimicrobial...    270   3e-75    Macadamia integrifolia [macadamia nut]
ref|XP_010695493.1|  PREDICTED: vicilin-like antimicrobial peptid...    268   5e-75    
emb|CAC27161.1|  putative sucrose binding protein                       264   6e-75    Vicia faba var. minor [tick bean]
gb|AAA32936.1|  embryo globulin                                         268   9e-75    Hordeum vulgare [barley]
gb|AAF18269.1|AF066055_1  vicilin-like protein precursor                266   2e-74    Juglans regia
gb|AAM54366.1|  vicilin seed storage protein                            262   3e-74    Juglans nigra
sp|Q9SPL3.1|AMP23_MACIN  RecName: Full=Vicilin-like antimicrobial...    265   5e-74    Macadamia integrifolia [macadamia nut]
gb|KDP40207.1|  hypothetical protein JCGZ_02205                         263   2e-73    
ref|XP_009407076.1|  PREDICTED: vicilin-like antimicrobial peptid...    262   1e-72    
ref|XP_009605859.1|  PREDICTED: vicilin-like antimicrobial peptid...    256   2e-72    
sp|Q9SPL5.1|AMP21_MACIN  RecName: Full=Vicilin-like antimicrobial...    262   3e-72    Macadamia integrifolia [macadamia nut]
ref|XP_009771135.1|  PREDICTED: vicilin-like antimicrobial peptid...    254   7e-72    
ref|XP_004247580.1|  PREDICTED: vicilin GC72-A                          257   1e-71    
ref|XP_010938152.1|  PREDICTED: vicilin-like antimicrobial peptid...    257   2e-71    
ref|XP_010026941.1|  PREDICTED: vicilin C72                             260   2e-71    
ref|XP_003559611.1|  PREDICTED: globulin-1 S allele                     256   5e-71    
ref|XP_007034812.1|  Vicilin-A, putative                                255   1e-70    
gb|AAK28402.1|AF250228_1  7S globulin                                   253   4e-70    Elaeis guineensis
prf||1905429A  major storage protein                                    253   7e-70 
ref|XP_008775109.1|  PREDICTED: globulin-1 S allele                     251   2e-69    
gb|ABV49593.1|  7S vicilin                                              252   4e-68    Carya illinoinensis [pecan]
gb|ABV49590.1|  7S vicilin                                              252   4e-68    Carya illinoinensis [pecan]
gb|AGU37285.1|  7S globulin precursor isoform 2                         249   6e-68    
ref|NP_001173574.1|  Os03g0663800                                       242   6e-68    
ref|XP_002517098.1|  Vicilin GC72-A precursor, putative                 246   3e-67    Ricinus communis
ref|XP_006360765.1|  PREDICTED: vicilin-like antimicrobial peptid...    245   4e-67    
gb|EAY91281.1|  hypothetical protein OsI_12896                          241   5e-66    Oryza sativa Indica Group [Indian rice]
dbj|BAA34056.1|  PV100                                                  246   6e-66    Cucurbita maxima [Boston marrow]
ref|XP_006650713.1|  PREDICTED: globulin-1 S allele-like                238   8e-66    
gb|EMT20973.1|  Globulin-1 S allele                                     241   9e-66    
ref|XP_008439368.1|  PREDICTED: vicilin                                 243   2e-65    
gb|EEC76319.1|  hypothetical protein OsI_13867                          235   1e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_010108323.1|  Vicilin-like antimicrobial peptides 2-1            242   4e-64    
ref|XP_004134437.1|  PREDICTED: vicilin-like antimicrobial peptid...    241   5e-64    
ref|XP_004981475.1|  PREDICTED: globulin-1 S allele-like                233   6e-64    
gb|KGN56960.1|  hypothetical protein Csa_3G146460                       241   8e-64    
ref|XP_004247670.1|  PREDICTED: vicilin-like antimicrobial peptid...    230   3e-63    
gb|AEO27682.1|  seed storage protein vicilin A                          232   7e-63    
gb|AAM33459.2|  globulin-like protein                                   230   8e-63    Oryza sativa Japonica Group [Japonica rice]
gb|AEO27683.1|  seed storage protein vicilin A                          231   9e-63    
gb|AEO27684.1|  seed storage protein vicilin A                          231   1e-62    
ref|NP_001051533.1|  Os03g0793700                                       229   2e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007225266.1|  hypothetical protein PRUPE_ppa001515mg             235   3e-62    
gb|KHG06468.1|  hypothetical protein F383_32629                         231   4e-62    
gb|AEO27686.1|  seed storage protein vicilin A                          228   1e-61    
gb|AEO27685.1|  seed storage protein vicilin A                          228   1e-61    
gb|ACG48473.1|  globulin-1 S allele precursor                           223   1e-60    Zea mays [maize]
ref|XP_008224279.1|  PREDICTED: vicilin GC72-A-like                     231   1e-60    
sp|P09799.1|VCLA_GOSHI  RecName: Full=Vicilin GC72-A; AltName: Fu...    226   2e-60    Gossypium hirsutum [American cotton]
ref|XP_008665579.1|  PREDICTED: globulin-1 S allele-like                223   2e-60    
ref|XP_002466310.1|  hypothetical protein SORBIDRAFT_01g005440          222   5e-60    Sorghum bicolor [broomcorn]
gb|AEO27691.1|  seed storage protein vicilin B                          224   5e-60    
gb|AEO27690.1|  seed storage protein vicilin B                          223   6e-60    
gb|AAA72622.1|  alpha globulin B                                        224   9e-60    
gb|KFK40533.1|  hypothetical protein AALP_AA2G008100                    219   5e-59    
prf||1410330B  vicilin gene B                                           220   3e-58 
gb|KHG06467.1|  Vicilin C72                                             218   2e-57    
gb|AEO27687.1|  seed storage protein vicilin B                          216   2e-57    
prf||1306412A  storage protein C72                                      217   3e-57 
ref|XP_010551719.1|  PREDICTED: vicilin                                 214   3e-57    
sp|P09801.1|VCLB_GOSHI  RecName: Full=Vicilin C72; AltName: Full=...    217   4e-57    Gossypium hirsutum [American cotton]
sp|Q43358.1|VCL_THECC  RecName: Full=Vicilin; Flags: Precursor          214   7e-57    Theobroma cacao [chocolate]
gb|AEO27688.1|  seed storage protein vicilin B                          215   7e-57    
ref|XP_010488296.1|  PREDICTED: vicilin C72-like                        213   1e-56    
ref|XP_006419988.1|  hypothetical protein CICLE_v10006494mg             215   2e-56    
ref|XP_009335336.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin C72        216   3e-56    
tpg|DAA37931.1|  TPA: hypothetical protein ZEAMMB73_015593              213   3e-56    
ref|XP_010511540.1|  PREDICTED: vicilin C72-like                        210   9e-56    
ref|XP_010511547.1|  PREDICTED: vicilin C72-like                        210   1e-55    
ref|XP_009369870.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin-like       212   2e-55    
ref|XP_010466552.1|  PREDICTED: vicilin C72-like                        208   3e-55    
pdb|4LEJ|A  Chain A, Crystal Structure Of The Korean Pine (pinus ...    205   1e-54    
ref|XP_010228589.1|  PREDICTED: globulin-1 S allele-like                207   2e-54    
emb|CAA44873.1|  vicilin-like storage protein                           205   2e-54    Picea glauca
gb|KDP42507.1|  hypothetical protein JCGZ_00304                         204   2e-54    
ref|XP_010466550.1|  PREDICTED: vicilin C72-like                        206   3e-54    
ref|XP_008382112.1|  PREDICTED: vicilin-like                            208   5e-54    
gb|AHC94918.1|  vicilin                                                 203   1e-53    
gb|AAB01554.1|  vicilin-like storage protein                            202   2e-53    Picea glauca
ref|XP_008224282.1|  PREDICTED: vicilin C72                             205   2e-53    
ref|XP_006406142.1|  hypothetical protein EUTSA_v10021982mg             202   8e-53    
ref|XP_010652019.1|  PREDICTED: vicilin-like antimicrobial peptid...    194   9e-53    
prf||1713472A  convicilin                                               203   2e-52 
ref|XP_002885515.1|  cupin family protein                               199   4e-52    
ref|XP_009369890.1|  PREDICTED: beta-conglycinin, beta chain-like       201   8e-52    
ref|XP_006299670.1|  hypothetical protein CARUB_v10015858mg             198   1e-51    
sp|P13915.1|CVCA_PEA  RecName: Full=Convicilin; Flags: Precursor        200   1e-51    Pisum sativum [garden pea]
ref|XP_007225626.1|  hypothetical protein PRUPE_ppa003838mg             198   4e-51    
ref|XP_009108737.1|  PREDICTED: provicilin                              197   4e-51    
gb|AEB33716.1|  conglutin beta 5                                        199   5e-51    
emb|CAP06316.1|  cvc                                                    197   5e-51    Pisum fulvum
emb|CDY34239.1|  BnaA01g24560D                                          195   1e-50    
ref|XP_004496703.1|  PREDICTED: convicilin-like                         196   2e-50    
emb|CAB82855.1|  convicilin                                             197   2e-50    Pisum sativum [garden pea]
ref|XP_008390981.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin GC72-A     192   2e-50    
gb|ACJ65515.1|  globulin 3B                                             194   3e-50    Triticum aestivum [Canadian hard winter wheat]
gb|ABR21771.1|  conglutin beta                                          194   5e-50    Lupinus angustifolius
emb|CAI84850.2|  vicilin-like protein                                   194   7e-50    Lupinus albus
emb|CAP06322.1|  convicilin                                             192   1e-49    Lathyrus clymenum var. clymenum
gb|AEB33718.1|  conglutin beta 7                                        194   2e-49    
emb|CDY55260.1|  BnaCnng28630D                                          192   2e-49    
ref|NP_566714.1|  protein PAP85                                         191   4e-49    Arabidopsis thaliana [mouse-ear cress]
emb|CAA96513.1|  convicilin precursor                                   192   5e-49    Vicia narbonensis
gb|EMS62417.1|  Globulin-1 S allele                                     191   6e-49    
ref|XP_004496705.1|  PREDICTED: convicilin-like isoform X2              191   2e-48    
ref|XP_004496704.1|  PREDICTED: convicilin-like isoform X1              191   3e-48    
emb|CAR78993.1|  convicilin storage protein 1                           189   5e-48    Lotus japonicus
emb|CAR78997.1|  convicilin storage protein 1                           189   5e-48    Lotus japonicus
gb|AAS97865.1|  beta-conglutin precursor                                188   7e-48    Lupinus albus
gb|AEB33713.1|  conglutin beta 2                                        189   1e-47    
emb|CAP06323.1|  convicilin                                             187   1e-47    Lathyrus latifolius [everlasting-pea]
gb|AEB33715.1|  conglutin beta 4                                        188   2e-47    
emb|CAP06325.1|  convicilin                                             186   2e-47    Lathyrus aphaca [yellow pea]
emb|CBK38917.1|  vicilin 47k                                            184   4e-47    Pisum sativum [garden pea]
gb|KEH43849.1|  vicilin 47 kDa protein                                  188   5e-47    
emb|CAP06317.1|  cvc                                                    186   6e-47    Lathyrus hirsutus [hairy vetchling]
ref|XP_003624149.1|  Provicilin                                         184   7e-47    
ref|XP_003624145.1|  Convicilin                                         184   7e-47    
sp|P43237.1|ALL11_ARAHY  RecName: Full=Allergen Ara h 1, clone P1...    187   8e-47    Arachis hypogaea [goober]
emb|CAP06315.1|  cvc                                                    185   9e-47    Pisum sativum subsp. elatius [wild pea]
emb|CCW28760.1|  seed storage protein Ara h1                            186   9e-47    
ref|XP_010268558.1|  PREDICTED: vicilin-like antimicrobial peptid...    182   1e-46    
emb|CAP06311.1|  convicilin                                             184   1e-46    Pisum sativum var. pumilio [Syrian fodder pea]
emb|CAP06318.1|  cvc                                                    184   2e-46    Lathyrus annuus
dbj|BAF56571.1|  7S globulin-2                                          182   2e-46    Vigna angularis [azuki bean]
gb|AEB33714.1|  conglutin beta 3                                        184   3e-46    
ref|XP_002308744.2|  hypothetical protein POPTR_0006s00440g             177   4e-46    Populus trichocarpa [western balsam poplar]
dbj|BAF47690.1|  beta-conglycinin alpha' subunit                        183   5e-46    Glycine soja [wild soybean]
emb|CAP06320.1|  cvc                                                    183   6e-46    Lathyrus cicera [red pea]
emb|CAP06324.1|  convicilin                                             182   7e-46    Lathyrus ochrus
emb|CAP06326.1|  cvc                                                    182   8e-46    Vicia disperma
gb|KHN02730.1|  Beta-conglycinin, alpha' chain                          184   9e-46    
pdb|1UIK|A  Chain A, Crystal Structure Of Soybean Beta-Conglycini...    179   1e-45    
gb|AEB33717.1|  conglutin beta 6                                        183   1e-45    
gb|ABG02262.1|  8S globulin beta isoform precursor                      180   1e-45    Vigna radiata [mung bean]
pdb|2EA7|A  Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-1     179   1e-45    
gb|AAT00597.1|  conarachin                                              182   2e-45    Arachis hypogaea [goober]
emb|CAA44494.1|  vicilin                                                180   2e-45    Theobroma cacao [chocolate]
emb|CAP06310.1|  convicilin                                             181   2e-45    Pisum sativum subsp. sativum
pdb|2EAA|A  Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-3     179   3e-45    
dbj|BAA23360.2|  alpha subunit of beta conglycinin                      181   3e-45    Glycine max [soybeans]
dbj|BAE02727.1|  beta-conglycinin alpha subunit                         181   4e-45    Glycine max [soybeans]
ref|XP_003624154.1|  Convicilin                                         179   4e-45    
dbj|BAE44299.1|  beta-conglycinin alpha subunit                         181   4e-45    Glycine max [soybeans]
emb|CAP06319.1|  convicilin                                             180   4e-45    Lathyrus tingitanus
gb|ABH09130.1|  beta-conglycinin alpha'-subunit                         181   4e-45    Glycine max [soybeans]
dbj|BAK39718.1|  beta-conglycinin alpha subunit                         181   4e-45    
gb|KHN15747.1|  Beta-conglycinin, alpha chain                           181   4e-45    
ref|XP_003556051.1|  PREDICTED: beta-conglycinin, alpha chain           181   5e-45    
sp|P13916.2|GLCA_SOYBN  RecName: Full=Beta-conglycinin, alpha cha...    181   5e-45    Glycine max [soybeans]
emb|CAF25232.1|  Vicilin                                                177   6e-45    Pisum sativum [garden pea]
pdb|3SMH|A  Chain A, Crystal Structure Of Major Peanut Allergen A...    177   6e-45    
emb|CAP06312.1|  cvc                                                    179   7e-45    Pisum abyssinicum [Abyssinian pea]
emb|CAD87731.1|  allergen Len c 1.0102                                  177   7e-45    Lens culinaris
emb|CAP06328.1|  cvc                                                    181   7e-45    Vicia villosa
emb|CBK38921.1|  vicilin 47k                                            177   8e-45    Pisum sativum [garden pea]
emb|CAP06321.1|  convicilin                                             179   8e-45    Lathyrus sativus [chickling vetch]
emb|CBK38919.1|  vicilin 47k                                            177   9e-45    Pisum sativum [garden pea]
pdb|3S7E|A  Chain A, Crystal Structure Of Ara H 1                       177   1e-44    
emb|CAA47814.1|  vicilin 47kD protein                                   177   1e-44    Pisum sativum [garden pea]
dbj|BAE02726.1|  beta-conglycinin alpha prime subunit                   180   1e-44    Glycine max [soybeans]
dbj|BAC78524.1|  prepro beta-conglycinin alpha prime subunit            180   1e-44    Glycine max [soybeans]
emb|CAP06313.1|  cvc                                                    179   2e-44    Pisum sativum subsp. sativum
dbj|BAA74452.2|  alpha' subunit of beta-conglycinin                     179   2e-44    Glycine max [soybeans]
emb|CAP06331.1|  convicilin                                             178   2e-44    Vicia articulata [one-flower vetch]
emb|CBK38922.1|  vicilin 47k                                            176   2e-44    Pisum sativum [garden pea]
ref|NP_001237316.1|  beta-conglycinin alpha prime subunit precursor     179   3e-44    
emb|CBK38920.1|  vicilin 47k                                            176   3e-44    Pisum sativum [garden pea]
emb|CAF25233.1|  Vicilin                                                175   3e-44    Pisum sativum [garden pea]
emb|CAP06330.1|  convicilin                                             177   3e-44    Vicia lutea [yellow vetch]
emb|CAP06333.1|  convicilin                                             177   4e-44    Vicia narbonensis
gb|ACB05815.1|  conglutin beta                                          178   5e-44    Lupinus angustifolius
gb|AEB33712.1|  conglutin beta 1                                        178   5e-44    
ref|NP_001236856.1|  beta-conglycinin alpha-subunit precursor           179   5e-44    
emb|CAP06329.1|  convicilin                                             174   2e-43    Vicia peregrina
sp|P43238.1|ALL12_ARAHY  RecName: Full=Allergen Ara h 1, clone P4...    176   4e-43    Arachis hypogaea [goober]
ref|XP_003624150.1|  Convicilin                                         173   4e-43    
emb|CAP06327.1|  cvc                                                    175   5e-43    Vicia bithynica
emb|CAP06332.1|  convicilin                                             173   1e-42    Vicia ervilia
ref|XP_003536525.1|  PREDICTED: beta-conglycinin, alpha chain-like      173   2e-42    
ref|XP_009413946.1|  PREDICTED: globulin-1 S allele-like                168   2e-42    
emb|CAP06309.1|  convicilin                                             171   4e-42    Lens nigricans
emb|CAP06335.1|  convicilin                                             171   5e-42    Vicia faba [broad bean]
emb|CAB89812.1|  convicilin                                             171   8e-42    Lens culinaris
emb|CAA41810.1|  vicilin-like embryo storage protein                    170   1e-41    Zea mays [maize]
gb|AAO45103.1|  beta-conglycinin alpha' subunit                         167   1e-41    Glycine max [soybeans]
emb|CAP06334.1|  convicilin                                             168   2e-41    Vicia faba [broad bean]
pdb|1IPK|A  Chain A, Crystal Structures Of Recombinant And Native...    166   6e-41    
ref|XP_004492829.1|  PREDICTED: vicilin-like isoform X1                 166   8e-41    
sp|P02854.1|VCLB_PEA  RecName: Full=Provicilin; AltName: Full=Typ...    165   9e-41    Pisum sativum [garden pea]
emb|CAP19902.1|  Vicilin protein                                        166   1e-40    Vigna unguiculata
ref|XP_003624146.1|  Convicilin                                         166   1e-40    
ref|XP_004492830.1|  PREDICTED: vicilin-like isoform X2                 165   2e-40    
pdb|1IPJ|A  Chain A, Crystal Structures Of Recombinant And Native...    165   2e-40    
sp|P13918.2|VCLC_PEA  RecName: Full=Vicilin; Flags: Precursor           166   2e-40    Pisum sativum [garden pea]
emb|CAA68708.1|  vicilin precursor                                      165   2e-40    Pisum sativum [garden pea]
dbj|BAD98463.1|  beta-conglycinin beta subunit                          164   3e-40    Glycine max [soybeans]
ref|XP_003556052.1|  PREDICTED: beta-conglycinin, beta chain-like       164   4e-40    
gb|KHN15750.1|  Beta-conglycinin, beta chain                            164   5e-40    
sp|P08438.1|VCL_VICFA  RecName: Full=Vicilin; Flags: Precursor          164   6e-40    Vicia faba [broad bean]
emb|CAA68525.1|  vicilin precursor                                      164   6e-40    Vicia faba [broad bean]
ref|XP_004493035.1|  PREDICTED: vicilin-like                            164   7e-40    
emb|CAD87730.1|  allergen Len c 1.0101                                  163   7e-40    Lens culinaris
gb|EAZ28885.1|  hypothetical protein OsJ_12925                          163   1e-39    Oryza sativa Japonica Group [Japonica rice]
emb|CAA90652.1|  vicilin; 7S globulin                                   162   1e-39    Zamia furfuracea
pdb|1UIJ|A  Chain A, Crystal Structure Of Soybean Beta-Conglycini...    162   1e-39    
ref|XP_007050543.1|  Nucleolar protein nop56, putative                  160   2e-39    
sp|P25974.1|GLCB_SOYBN  RecName: Full=Beta-conglycinin, beta chai...    162   2e-39    Glycine max [soybeans]
dbj|BAK53446.1|  beta-conglycinin beta subunit                          162   2e-39    
sp|P11827.1|GLCAP_SOYBN  RecName: Full=Beta-conglycinin, alpha' c...    165   2e-39    Glycine max [soybeans]
emb|CAR78998.1|  convicilin storage protein 2                           164   3e-39    Lotus japonicus
ref|XP_004493034.1|  PREDICTED: vicilin-like                            161   6e-39    
ref|NP_001236872.1|  beta-conglycinin beta-subunit precursor            160   6e-39    
gb|AAZ06660.1|  seed storage protein A                                  160   6e-39    
gb|ACU18513.1|  unknown                                                 160   7e-39    
gb|AAZ06661.1|  seed storage protein B                                  160   9e-39    
dbj|BAK53447.1|  beta-conglycinin beta subunit                          160   1e-38    
emb|CAR78994.1|  convicilin storage protein 2                           161   2e-38    
emb|CAA33172.1|  canavalin                                              158   4e-38    
gb|ACU17936.1|  unknown                                                 154   5e-38    
sp|P50477.1|CANA_CANEN  RecName: Full=Canavalin; Flags: Precursor       158   6e-38    
emb|CAA96514.1|  vicilin precursor                                      158   7e-38    
gb|EMT09885.1|  Globulin-1 S allele                                     157   2e-37    
gb|EAZ29742.1|  hypothetical protein OsJ_13801                          157   2e-37    
gb|AAT00596.1|  conarachin                                              156   2e-37    
sp|P10562.1|CANA_CANGL  RecName: Full=Canavalin; Flags: Precursor       156   2e-37    
ref|XP_009413945.1|  PREDICTED: globulin-1 S allele-like                154   3e-37    
ref|XP_009413947.1|  PREDICTED: globulin-1 S allele-like                152   5e-37    
ref|XP_010086606.1|  Sucrose-binding protein                            153   6e-37    
gb|ABW23574.1|  8S globulin alpha subunit                               152   4e-36    
gb|ABG02260.1|  8S globulin alpha isoform precursor                     151   2e-35    
pdb|2CV6|A  Chain A, Crystal Structure Of 8salpha Globulin, The M...    149   4e-35    
gb|AAF13485.1|AF113054_1  vicilin                                       144   4e-35    
gb|AAD10375.1|  globulin-like protein                                   150   4e-35    
gb|ABG02261.1|  8S globulin alpha' isoform precursor                    149   5e-35    
gb|AAF13476.1|AF113045_1  vicilin                                       143   1e-34    
gb|AFH68056.1|  7S globulin                                             144   1e-34    
gb|AAF13470.1|AF113039_1  vicilin                                       143   2e-34    
prf||1502201A  vicilin                                                  147   2e-34 
gb|AAF13467.1|AF113036_1  vicilin                                       142   3e-34    
gb|ADQ53858.1|  Ara h 1 allergen                                        149   3e-34    
gb|AAF13487.1|AF113056_1  vicilin                                       142   4e-34    
gb|AAF13490.1|AF113059_1  vicilin                                       142   4e-34    
gb|AAF13486.1|AF113055_1  vicilin                                       141   5e-34    
ref|XP_010906851.1|  PREDICTED: globulin-1 S allele-like                141   5e-34    
gb|AAF13489.1|AF113058_1  vicilin                                       141   7e-34    
gb|AAF13469.1|AF113038_1  vicilin                                       141   7e-34    
gb|AAF13475.1|AF113044_1  vicilin                                       140   1e-33    
ref|XP_007143290.1|  hypothetical protein PHAVU_007G059800g             146   2e-33    
gb|AAF13481.1|AF113050_1  vicilin                                       139   2e-33    
gb|ABS89031.1|  globulin-1                                              139   5e-33    
gb|KHN02728.1|  Beta-conglycinin, beta chain                            141   8e-33    
gb|AAF13468.1|AF113037_1  vicilin                                       138   9e-33    
gb|ABS89073.1|  globulin-1                                              138   9e-33    
gb|ABS89064.1|  globulin-1                                              138   9e-33    
gb|ABS89092.1|  globulin-1                                              138   1e-32    
gb|AAF13482.1|AF113051_1  vicilin                                       137   1e-32    
gb|ABS89043.1|  globulin-1                                              137   2e-32    
sp|Q43617.1|PHS2_PHALU  RecName: Full=Phaseolin; Flags: Precursor       141   2e-32    
gb|ABS89077.1|  globulin-1                                              137   2e-32    
gb|ABS89047.1|  globulin-1                                              137   3e-32    
gb|AAF13463.1|AF113032_1  vicilin                                       135   6e-32    
gb|ABK24863.1|  unknown                                                 140   7e-32    
gb|ABS89057.1|  globulin-1                                              135   7e-32    
gb|ABS89078.1|  globulin-1                                              135   1e-31    
gb|ABS89030.1|  globulin-1                                              135   1e-31    
gb|AAM81249.1|AF513725_1  vicilin-like storage protein                  139   1e-31    
gb|AAK20341.1|AF329799_1  globulin 1                                    134   2e-31    
gb|AAK20344.1|AF329802_1  globulin 1                                    134   2e-31    
ref|XP_004247581.2|  PREDICTED: vicilin C72-like                        135   2e-31    
gb|ABS89028.1|  globulin-1                                              134   3e-31    
gb|ABF98040.1|  Cupin family protein, expressed                         137   3e-31    
gb|ABR16441.1|  unknown                                                 137   4e-31    
gb|AAK20334.1|AF329792_1  globulin 1                                    133   4e-31    
gb|AAK20335.1|AF329793_1  globulin 1                                    133   4e-31    
gb|AAK20351.1|AF329809_1  globulin 1                                    132   6e-31    
gb|AAF13464.1|AF113033_1  vicilin                                       132   7e-31    
sp|P80463.2|PHS1_PHALU  RecName: Full=Phaseolin; Flags: Precursor       136   9e-31    
gb|ABS89084.1|  globulin-1                                              132   1e-30    
gb|AAF13472.1|AF113041_1  vicilin                                       132   1e-30    
gb|AAF13483.1|AF113052_1  vicilin                                       131   2e-30    
gb|AAS48514.1|  vicilin-like protein                                    128   2e-30    
gb|AAF13471.1|AF113040_1  vicilin                                       131   2e-30    
gb|AAF13484.1|AF113053_1  vicilin                                       130   3e-30    
emb|CAA91188.1|  vicilin                                                132   3e-30    
gb|AAK20352.1|AF329810_1  globulin 1                                    130   4e-30    
gb|ABS89076.1|  globulin-1                                              130   6e-30    
gb|AAF13466.1|AF113035_1  vicilin                                       130   6e-30    
gb|ABS89063.1|  globulin-1                                              130   7e-30    
gb|ABR21772.1|  conglutin beta                                          134   7e-30    
gb|ABS89049.1|  globulin-1                                              130   9e-30    
gb|ABS89103.1|  globulin-1                                              129   9e-30    
emb|CAB38247.1|  unnamed protein product                                128   1e-29    
gb|AAF13488.1|AF113057_1  vicilin                                       129   1e-29    
gb|ABS89054.1|  globulin-1                                              129   1e-29    
gb|ABS89053.1|  globulin-1                                              129   2e-29    
gb|ABR67870.1|  globulin-1                                              129   2e-29    
gb|ABS89099.1|  globulin-1                                              129   2e-29    
gb|ABS89097.1|  globulin-1                                              128   3e-29    
gb|ABS89096.1|  globulin-1                                              128   3e-29    
gb|ABS89074.1|  globulin-1                                              128   3e-29    
gb|ABS89039.1|  globulin-1                                              128   3e-29    
gb|ABS89079.1|  globulin-1                                              128   3e-29    
gb|ABS89083.1|  globulin-1                                              128   3e-29    
gb|ABS89088.1|  globulin-1                                              128   3e-29    
gb|ABS89068.1|  globulin-1                                              128   4e-29    
gb|ABS89046.1|  globulin-1                                              128   4e-29    
gb|ABS89056.1|  globulin-1                                              128   4e-29    
gb|ABS89036.1|  globulin-1                                              128   4e-29    
gb|ABS89081.1|  globulin-1                                              128   4e-29    
gb|ABS89048.1|  globulin-1                                              128   4e-29    
gb|ABS89058.1|  globulin-1                                              128   4e-29    
gb|ABS89027.1|  globulin-1                                              127   4e-29    
gb|ABS89101.1|  globulin-1                                              128   4e-29    
gb|AAF13465.1|AF113034_1  vicilin                                       127   4e-29    
gb|ABS89065.1|  globulin-1                                              127   4e-29    
gb|ABB13526.1|  BLAD                                                    125   4e-29    
gb|ABS89050.1|  globulin-1                                              127   5e-29    
gb|ABS89080.1|  globulin-1                                              127   5e-29    
gb|ABS89038.1|  globulin-1                                              127   5e-29    
gb|ABS89082.1|  globulin-1                                              127   5e-29    
gb|AAF13474.1|AF113043_1  vicilin                                       127   5e-29    
gb|AAF13479.1|AF113048_1  vicilin                                       127   6e-29    
gb|ABS89026.1|  globulin-1                                              127   6e-29    
gb|ABS89062.1|  globulin-1                                              127   7e-29    
gb|ABS89055.1|  globulin-1                                              127   8e-29    
gb|AAF13477.1|AF113046_1  vicilin                                       127   8e-29    
gb|ABS89106.1|  globulin-1                                              127   9e-29    
gb|ABS89040.1|  globulin-1                                              127   9e-29    
gb|ACC97138.1|  globulin-1                                              127   9e-29    
gb|ACC97140.1|  globulin-1                                              127   9e-29    
gb|ABR67869.1|  globulin-1                                              127   1e-28    
gb|ACC97139.1|  globulin-1                                              126   1e-28    
gb|ABS89045.1|  globulin-1                                              126   1e-28    
gb|ABS89035.1|  globulin-1                                              126   1e-28    
ref|XP_010242496.1|  PREDICTED: vicilin-like antimicrobial peptid...    127   2e-28    
gb|ABS89044.1|  globulin-1                                              126   2e-28    
gb|AAF13473.1|AF113042_1  vicilin                                       125   2e-28    
gb|ABS89102.1|  globulin-1                                              125   2e-28    
gb|AAD10374.1|  globulin-like protein                                   124   2e-28    
gb|ABS89095.1|  globulin-1                                              125   2e-28    
gb|ACJ65513.1|  globulin 3C                                             127   3e-28    
gb|ABS89066.1|  globulin-1                                              125   3e-28    
gb|AAK20337.1|AF329795_1  globulin 1                                    124   4e-28    
gb|ABS89098.1|  globulin-1                                              125   4e-28    
gb|AAC31469.1|  globulin-1                                              124   5e-28    
gb|AAK20333.1|AF329791_1  globulin 1                                    124   5e-28    
gb|AAC31460.1|  globulin-1                                              124   5e-28    
gb|AAC31458.1|  globulin-1                                              124   5e-28    
gb|AAK20342.1|AF329800_1  globulin 1                                    124   5e-28    
gb|AAK20346.1|AF329804_1  globulin 1                                    124   6e-28    
gb|AAK20355.1|AF329813_1  globulin 1                                    124   6e-28    
gb|AAC31477.1|  globulin-1                                              124   6e-28    
gb|AAK20332.1|AF329790_1  globulin 1                                    124   6e-28    
gb|AAC31466.1|  globulin-1                                              124   6e-28    
gb|AAC31462.1|  globulin-1                                              124   6e-28    
gb|ABS89052.1|  globulin-1                                              124   7e-28    
gb|ABS89070.1|  globulin-1                                              124   7e-28    
gb|KDO74521.1|  hypothetical protein CISIN_1g0394412mg                  127   7e-28    
pir||T02258  globulin1 - maize                                          127   1e-27 
gb|AAK60214.1|AF377676_1  globulin 1                                    123   1e-27    
gb|KEH43848.1|  vicilin 47 kDa protein                                  128   1e-27    
ref|XP_007143289.1|  hypothetical protein PHAVU_007G059800g             128   1e-27    
gb|AAC31476.1|  globulin-1                                              123   1e-27    
sp|P13919.2|CVCB_PEA  RecName: Full=Convicilin; Flags: Precursor        126   1e-27    
gb|AAK20345.1|AF329803_1  globulin 1                                    122   2e-27    
gb|AAC31461.1|  globulin-1                                              122   2e-27    
gb|AAC31478.1|  globulin-1                                              123   2e-27    
gb|AAC31464.1|  globulin-1                                              122   2e-27    
gb|AAC31471.1|  globulin-1                                              122   2e-27    
gb|AAC31456.1|  globulin-1                                              122   3e-27    
gb|AAC31470.1|  globulin-1                                              122   3e-27    
gb|ABS89042.1|  globulin-1                                              122   3e-27    
gb|AAC31474.1|  globulin-1                                              122   3e-27    
gb|AAC31467.1|  globulin-1                                              122   4e-27    
gb|AAC31468.1|  globulin-1                                              122   5e-27    
gb|AAC31457.1|  globulin-1                                              121   5e-27    
gb|AAS07325.1|  putative globulin (with alternative splicing)           122   5e-27    
gb|AAC31459.1|  globulin-1                                              121   7e-27    
gb|AAC31455.1|  globulin-1                                              120   9e-27    
ref|XP_010276227.1|  PREDICTED: vicilin-like antimicrobial peptid...    119   1e-26    
gb|AAC31472.1|  globulin-1                                              120   1e-26    
gb|AAC31463.1|  globulin-1                                              119   2e-26    
gb|ABS89029.1|  globulin-1                                              119   3e-26    
emb|CDY15753.1|  BnaC04g15710D                                          122   5e-26    
emb|CDY04569.1|  BnaA07g13950D                                          122   5e-26    
ref|XP_008780502.1|  PREDICTED: globulin-1 S allele-like                118   7e-26    
gb|AAF13462.1|AF113031_1  vicilin                                       117   2e-25    
gb|AAK60225.1|AF377687_1  globulin 1                                    115   6e-25    
ref|XP_010244960.1|  PREDICTED: vicilin-like antimicrobial peptid...    119   6e-25    
gb|AAK60221.1|AF377683_1  globulin 1                                    115   6e-25    
gb|AAK60210.1|AF377671_1  globulin 1                                    115   6e-25    
ref|XP_009103693.1|  PREDICTED: vicilin-like antimicrobial peptid...    119   6e-25    
gb|AAK60219.1|AF377681_1  globulin 1                                    115   7e-25    
gb|AAK60217.1|AF377679_1  globulin 1                                    115   7e-25    
ref|XP_010414517.1|  PREDICTED: provicilin-like                         119   7e-25    
ref|XP_010046432.1|  PREDICTED: vicilin-like antimicrobial peptid...    118   7e-25    
gb|ACZ74209.1|  globulin 1                                              114   7e-25    
gb|ACZ74215.1|  globulin 1                                              114   8e-25    
gb|AAV33446.1|  48-kDa glycoprotein precursor                           111   8e-25    
gb|AAK60227.1|AF377689_1  globulin 1                                    114   9e-25    
gb|KCW85694.1|  hypothetical protein EUGRSUZ_B02472                     118   1e-24    
emb|CAP06314.1|  cvc                                                    118   1e-24    
gb|ACZ74228.1|  globulin 1                                              114   1e-24    
gb|AAK60232.1|AF377694_1  globulin 1                                    114   1e-24    
ref|XP_009415596.1|  PREDICTED: vicilin-like antimicrobial peptid...    117   1e-24    
ref|XP_009396660.1|  PREDICTED: vicilin-like antimicrobial peptid...    117   2e-24    
gb|AAK60211.1|AF377672_1  globulin 1                                    114   2e-24    
gb|AAK60231.1|AF377693_1  globulin 1                                    114   2e-24    
ref|NP_180416.1|  cupin domain-containing protein                       118   2e-24    
gb|ACZ74224.1|  globulin 1                                              113   2e-24    
gb|AAK60215.1|AF377677_1  globulin 1                                    113   2e-24    
gb|AAK60226.1|AF377688_1  globulin 1                                    113   2e-24    
gb|ACZ74216.1|  globulin 1                                              113   2e-24    
gb|ACZ74230.1|  globulin 1                                              113   2e-24    
gb|AAK60216.1|AF377678_1  globulin 1                                    113   2e-24    
gb|AAK60220.1|AF377682_1  globulin 1                                    113   2e-24    
gb|ACZ74243.1|  globulin 1                                              113   2e-24    
gb|ACZ74208.1|  globulin 1                                              113   2e-24    
gb|ACZ74227.1|  globulin 1                                              113   3e-24    
ref|XP_002880986.1|  cupin family protein                               117   3e-24    
gb|AAK60213.1|AF377675_1  globulin 1                                    113   3e-24    
gb|ACZ74213.1|  globulin 1                                              113   3e-24    
gb|ACZ74211.1|  globulin 1                                              113   3e-24    
gb|ACZ74222.1|  globulin 1                                              113   3e-24    
gb|ACZ74210.1|  globulin 1                                              113   3e-24    
ref|XP_010510617.1|  PREDICTED: provicilin-like                         117   3e-24    
gb|ACZ74249.1|  globulin 1                                              113   3e-24    
gb|AAK60212.1|AF377673_1  globulin 1                                    113   3e-24    
gb|ACZ74251.1|  globulin 1                                              112   4e-24    
gb|ACZ74220.1|  globulin 1                                              112   4e-24    
gb|ACZ74242.1|  globulin 1                                              112   4e-24    



>ref|XP_009607668.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nicotiana 
tomentosiformis]
Length=499

 Score =   378 bits (971),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 307/477 (64%), Gaps = 33/477 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergg---------gssgrr  273
             DPEL+ C+HQC+        QR+ C + CE+Y  EK+ ++E+                  
Sbjct  26    DPELKRCKHQCKALQQIGEHQRKECYEMCEKYDSEKQSKEEDTSTFFPYRGKEETGEEEE  85

Query  274   eeegrggeDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK  453
              ++    E +NPYVF+ +HF T  ++Q GR  VLP+FTERS   +GIEN+R  ILE   +
Sbjct  86    GQQYGEQERENPYVFEDQHFITGIKTQHGRIRVLPKFTERSKLLKGIENYRVAILEANPQ  145

Query  454   TFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNK  633
             TF+ PNH DAD +  VA+G GTL+++++ K+ S++IR G ++ + AG T+YL+N +NN K
Sbjct  146   TFIVPNHWDADAVLFVAQGRGTLNLVRRGKRNSFNIRPGDVIRVHAGTTAYLINRENNEK  205

Query  634   LVIIKLIQTISTPGRFEFFFGTGRN----SFLRAFKSSILEAAYDESKETIQRVLRGRDD  801
             LVI KL+  +STPG+FE FFG G      SF  AF S ILE+A +  ++ +QR+   + +
Sbjct  206   LVIAKLLNPVSTPGQFEHFFGPGGRENPESFYNAFSSEILESALNVRRDRLQRLFGQQRE  265

Query  802   SPFIQVSDEQLKSL-RKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF  975
                I+ S+EQ++++ + E   IWPF  +   S   V+I++ + S SN YGQL+EVD   +
Sbjct  266   GVIIRASEEQIRAMSQHEEGGIWPFGGESKGS---VNIYRQRPSQSNQYGQLYEVDGSHY  322

Query  976   KELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS-------QT  1128
             ++L   DI V+FANIT+GGMLGP++++RATK+A VVDG+G+ +MACP ++S       Q+
Sbjct  323   RQLEDLDISVSFANITQGGMLGPVYSSRATKIAVVVDGEGYFEMACPHLASESGSRGRQS  382

Query  1129  ERSE-EGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVA  1302
               SE E  I + Y+ V A+LR G + +IP G+P V++AS + NLQ+VCF+INA NNE V 
Sbjct  383   RGSERETRIGSGYQKVRARLRRGMVVIIPAGHPVVNVASNNQNLQLVCFNINARNNEIVP  442

Query  1303  LAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP---EWQQSEDRAD  1464
             LAG+NN+ S ++  A E+ FGV ++ V+++F +  + ELF +GP   +  Q   RAD
Sbjct  443   LAGRNNVMSQLEREAMELGFGVPAREVEEIFRSQQE-ELFFQGPGGRQQHQEGGRAD  498



>ref|XP_009786980.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=497

 Score =   374 bits (961),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 201/476 (42%), Positives = 305/476 (64%), Gaps = 32/476 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergg--------gssgrre  276
             DPEL+ C+HQC+        QR+ C + CERY  EK+ ++E+            +    E
Sbjct  25    DPELKQCKHQCKALQQIGEHQRKECYEMCERYHSEKQSKEEDTSTFLPYRGREETGEEEE  84

Query  277   eegrggeDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKT  456
             ++    E +NPYVF+ +HF T  ++Q GR  VLP+FTERS   +GIEN+R  ILE   +T
Sbjct  85    QQYGEQERENPYVFEDQHFITGIKTQHGRIRVLPKFTERSKLLKGIENYRVAILEANPQT  144

Query  457   FVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKL  636
             F+ PNH DAD +  VA+G GTL+++++ K+ S++IR G ++ + AG T+YL+N DNN KL
Sbjct  145   FIVPNHWDADAVLFVAQGRGTLNLVRRGKRNSFNIRAGDVIRVHAGTTAYLINRDNNEKL  204

Query  637   VIIKLIQTISTPGRFEFFFGTGRN----SFLRAFKSSILEAAYDESKETIQRVLRGRDDS  804
             VI KL+  +STPG+FE FFG G      SF  AF S ILE+A +  ++ +QR+   + + 
Sbjct  205   VIAKLLNPVSTPGQFEHFFGPGGRENPESFYNAFSSEILESALNVRRDRLQRLFGQQREG  264

Query  805   PFIQVSDEQLKSL-RKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFK  978
               I+ S+EQ++++ + E   IWPF  +   S   V++++ + + SN YGQL+EVD   ++
Sbjct  265   VIIRASEEQIRAMSQHEEGGIWPFGGESKGS---VNLYRQRPLQSNQYGQLYEVDGSHYR  321

Query  979   ELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS-------QTE  1131
             +L   DI V+ ANIT+GGM GP +++RATK+A VVDG+G+ +MACP ++S       Q+ 
Sbjct  322   QLEDLDISVSLANITQGGMFGPAYSSRATKIAVVVDGEGYFEMACPHLASESGSRGRQSR  381

Query  1132  RSE-EGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVAL  1305
              SE E  I + Y+ V A+LR G + +IP G+P V++AS + NLQ+VCF+INA NNE V L
Sbjct  382   GSERETRIGSGYQKVRARLRRGMVVIIPAGHPVVNVASNNQNLQVVCFNINARNNEIVPL  441

Query  1306  AGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP---EWQQSEDRAD  1464
             AG+NN+ S ++  A E+ FG+ ++ V+++F +  + E F +GP   +  Q   RAD
Sbjct  442   AGRNNVMSQLEREAMELGFGIPAREVEEIFRSQQE-EFFFQGPGGRQQHQEGGRAD  496



>ref|XP_004247186.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=469

 Score =   372 bits (956),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 194/452 (43%), Positives = 291/452 (64%), Gaps = 19/452 (4%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             + +L+ CRH C+V    +  QRE C D CE+    ++  +EE      GR E       +
Sbjct  23    ESDLKQCRHHCKVLQHIEEYQREKCYDICEKLYHSEKQEKEEETNSYEGREEG------E  76

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF   HF     ++ GR  VLP+F ERS   +GIEN+RF ILE   KTFV PNH D
Sbjct  77    NNPYVFNEEHFIMGIETEHGRIRVLPKFNERSKLLKGIENYRFAILEANPKTFVVPNHWD  136

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD +  VA+G GTL +++K K+ S++IR G ++ + AG T+YL+N D+N KL+I KL++ 
Sbjct  137   ADAVLFVAQGRGTLSLVRKGKRNSFNIRRGDVIKVCAGTTAYLINRDDNEKLLIAKLLRP  196

Query  661   ISTPGRFEFFFGTGRN----SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
             +STPG FE FFG G      SF  AF S ILEAA +  K+ +QR+     +   I+ S+E
Sbjct  197   VSTPGHFEHFFGPGGRQNPESFYSAFSSEILEAALNTRKDRLQRLFGQPREGVIIRASEE  256

Query  829   QLKSL-RKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA  1002
             Q++ + + E   IWPF  +   S   V+I+K + + SN YGQ ++VD  ++K+L D++++
Sbjct  257   QIRVMSQHEEGGIWPFGGESKGS---VNIYKQRPLRSNQYGQFYQVDESNYKQLEDLDIS  313

Query  1003  --FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAI-PTYETVN  1173
               FANIT GGM+GP++N+RATK+A VV G+G+ +MACP ++S+   S E  I  +Y+ V 
Sbjct  314   INFANITEGGMVGPIYNSRATKIAVVVQGEGYFEMACPHLASKFTSSHETRIGSSYQKVR  373

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             ++LR G + VIPPG+P+V + S + NLQIV F++NA +NE V LAG+NN+ S ++  A E
Sbjct  374   SKLRRGMVLVIPPGHPFVGVTSTNQNLQIVGFNVNARDNEIVPLAGRNNVMSQLEREALE  433

Query  1354  VSFGVSSKLVDKVFENDDDLELFSKGPEWQQS  1449
             + FG+ ++ V+++F +  + E F +GP  +QS
Sbjct  434   LGFGLPAREVEQIFRSQQE-EFFFQGPGGRQS  464



>ref|XP_006349767.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=474

 Score =   371 bits (952),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/458 (42%), Positives = 296/458 (65%), Gaps = 26/458 (6%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             + +L+ C+HQC+V    +  QRE C + CE+    ++  +EE                  
Sbjct  23    ESDLKQCKHQCKVLQQIEEYQREKCYEICEKLYHGEKQEKEEINFYEGREEG-------K  75

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF   HF T  +++ GR  VLP+F+ERS   +GIEN+RF ILE   KTFV PNH D
Sbjct  76    NNPYVFNEEHFITGIKTEHGRIRVLPKFSERSKLLKGIENYRFAILEANPKTFVVPNHWD  135

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD +  VA+G GTL +++K K+ S++I  G ++ + AG T+YL+N D+N KL+I KL++ 
Sbjct  136   ADAVLFVAQGRGTLSLVRKGKRNSFNIGRGDVIKVCAGTTAYLINRDDNEKLLIAKLLRP  195

Query  661   ISTPGRFEFFFGTGR----NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
             +STPG+FE FFG G      SF  AF S ILEAA +  K+ +QR+     +   I+ S+E
Sbjct  196   VSTPGQFEHFFGPGGRENPQSFYSAFSSDILEAALNTRKDRLQRLFGQPREGVIIRASEE  255

Query  829   QLKSL-RKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA  1002
             Q++ + + E   IWPF  +   S   V+I+K + + SN YGQ ++VD+  +K+L D++++
Sbjct  256   QIRVMSQHEEGGIWPFGGESKGS---VNIYKQRPLQSNQYGQFYQVDDSTYKQLEDLDIS  312

Query  1003  --FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE-------RSEEGAIP  1155
               FANIT GGMLGP++++RATK+A VV+G+G+ +MACP ++S++E       +  E  I 
Sbjct  313   LNFANITEGGMLGPIYSSRATKIAVVVEGEGYFEMACPHLASESESGKRQGSKETETRIG  372

Query  1156  TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNM  1335
              Y+ V+++LR G + VIP G+P+V++AS + NLQIV F++NA NNE V LAG+NN+ S +
Sbjct  373   RYQKVSSKLRRGMVLVIPAGHPFVAVASTNQNLQIVGFNVNARNNEIVPLAGRNNVMSQL  432

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQS  1449
             +  A E+ FG+ ++ V+++F++  + E F +GP  +QS
Sbjct  433   EREALELGFGLPAREVEQIFQSQQE-EFFFQGPGGRQS  469



>ref|XP_010679084.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Beta vulgaris 
subsp. vulgaris]
Length=551

 Score =   357 bits (915),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 188/466 (40%), Positives = 295/466 (63%), Gaps = 26/466 (6%)
 Frame = +1

Query  121   DPE--LETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgg  294
             DPE     CR +C+ ++   R++++ C  +CE+  +      E  G  S    EEE    
Sbjct  80    DPEKAYRECRERCQ-EVEEGRREQQVCESECEQRRERIRRDDEIVGRRSVEEEEEEEEEV  138

Query  295   --eDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAP  468
               +   PYVF+  HF T  +S++GR  VL +F +RS  F+GI+N+R  I E   +TFV P
Sbjct  139   GGKSGKPYVFEDHHFSTKFKSKEGRVKVLKKFNKRSKLFKGIQNYRVIIFEANPQTFVVP  198

Query  469   NHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIK  648
             NH DAD +  VA+GEGT+ ++  +++ S++I+ G ++ IPAG T+YL+N  NN+KLV++K
Sbjct  199   NHWDADSVFFVAQGEGTVSLVYTDRRDSFNIKRGHVMVIPAGVTAYLINRGNNDKLVLVK  258

Query  649   LIQTISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQV  819
             LI  +S PG+FE FFG G     SF  AF + IL AA+  S + ++R+   + +   I+ 
Sbjct  259   LINPVSNPGKFESFFGPGGENPESFFNAFSTDILGAAFKTSGDKVKRIFSQQHEGAIIRA  318

Query  820   SDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIE  996
             S+EQ+++L  E    WPF    S  S P ++ K     SN +G LFEVD++D+++L D+ 
Sbjct  319   SEEQIRALTHEKSGHWPFGGKGSKESGPFNLLKQSPRESNEFGTLFEVDSNDYRQLRDLN  378

Query  997   VA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS-------------SQTE  1131
             +A  FANIT+G M  PL+N+RATK+A V++G+G+ +MACP VS              ++ 
Sbjct  379   IALSFANITQGSMHTPLYNSRATKIAVVLNGRGYFEMACPHVSKSGHQQHRHRQHGGKSS  438

Query  1132  RSEEGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA  1308
             R EE   P  YE + ++LR G +FV+PPG+P+V++AS+++NL+++CF+INA+NN +  LA
Sbjct  439   RGEEETTPIHYEKIFSELRQGMVFVVPPGHPFVTLASENENLELICFEINAENNHKFPLA  498

Query  1309  GKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
             G+ N+  N +  AKE++F  S+++VD+VFEN ++ + F KGP  Q+
Sbjct  499   GQRNIMKNFEREAKELAFASSAEVVDQVFENQEE-DFFFKGPRQQE  543



>ref|XP_008235388.1| PREDICTED: sucrose-binding protein-like [Prunus mume]
Length=508

 Score =   353 bits (905),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 190/479 (40%), Positives = 282/479 (59%), Gaps = 33/479 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqee---------------rgg  255
             DPEL+ CRHQC  Q  FD +QRE C   C++YI++K   ++                 G 
Sbjct  29    DPELKQCRHQCEHQQGFDSKQREQCEQGCDKYIKQKREEEKHRGKSGGGGSFYPISETGR  88

Query  256   gssgrreeegrggeDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGI  435
                   E +GR  ED NPY F+  HF T  ++++GRF +L +FTERS+    IEN+R G 
Sbjct  89    AQEEEEEFQGRQQEDQNPYFFEDEHFETRVQTEEGRFQLLQKFTERSDLLRAIENYRIGF  148

Query  436   LEVESKTFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVN  615
             L  +   FVAP+H DAD +  V +G   + I++  K++++++  G +  IPAG   Y+VN
Sbjct  149   LVTKPHAFVAPSHFDADTVLFVFQGRPAVTIVRGEKRETHNLERGDLFRIPAGTPVYMVN  208

Query  616   TDNNNKLVIIKLIQTISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVL  786
              D N KL I+  ++ +S PG +E F+  G     SF +AF   +L+AA       ++R+ 
Sbjct  209   RDENEKLFIVNFMKPVSVPGEYEAFYAAGGENPESFFKAFSPQVLQAALKTEMNKLERLF  268

Query  787   RGRDDSPFIQVSDEQLKSLRKE-----SDTIWPFKTDKSSSSKPVDIFKHKSVSNNYGQL  951
               +      + S EQ+K L ++     S+  WPF   +SSS       KH S +N +G+L
Sbjct  269   GQQRQGSITRASKEQIKKLSQQHGQGGSEGFWPFHGGQSSSDAFNLFSKHPSQANKFGRL  328

Query  952   FEVDNDDFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS-  1122
             FE D +DFK+L D++  V+FANIT+G M+GP FN+RATK++FV+DG+G+ +MACP VSS 
Sbjct  329   FEADFNDFKQLQDLDLLVSFANITQGAMVGPFFNSRATKISFVLDGEGYFEMACPHVSST  388

Query  1123  ------QTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINAD  1284
                      +  + + P Y+ ++  LR G +FV P G+P  +IAS++ NLQI+CF++NA 
Sbjct  389   GRQEQQPQPQQRQKSSPRYQKISGNLRRGAVFVAPAGHPMTAIASRNSNLQIICFEVNAH  448

Query  1285  NNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             +N RV LAGK N+ S  D  AKE++F V ++ VD++F N DD E F +GP  Q    RA
Sbjct  449   DNIRVPLAGKKNVVSQFDREAKELAFNVPAREVDRIFNNQDD-EFFFEGPNEQPEHGRA  506



>gb|AAL86739.1|AF441864_1 48-kDa glycoprotein precursor [Corylus avellana]
Length=448

 Score =   350 bits (897),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/453 (40%), Positives = 279/453 (62%), Gaps = 28/453 (6%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+H+CR +  FD QQR      CE        +  ER        EE     ++
Sbjct  6     DPELKKCKHKCRDERQFDEQQRRDGKQICEE-------KARERQQEEGNSSEESYGKEQE  58

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVFQ  HF +  ++++GR  VL  FT+RS    GIENFR  ILE    TF++P H D
Sbjct  59    ENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISPAHFD  118

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+L+  VA+G  T+ ++++ K++S+++  G I+ IPAG   Y++N D N KL I+K++Q 
Sbjct  119   AELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQP  178

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             +S PG FE F+G G     SF RAF   +LEAA    +E +++V   +     ++ S E+
Sbjct  179   VSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREK  238

Query  832   LKSLRKESD---TIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGDIE-  996
             +++L +  +    IWPF  +   SS P+++  KH S SN +G+L+E   DD K+L D++ 
Sbjct  239   IRALSQHEEGPPRIWPFGGE---SSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDL  295

Query  997   -VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVN  1173
              V+FANIT+G M GP +N+RATK++ VV+G+G+ +MACP +SS +         +Y+ ++
Sbjct  296   MVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSS--------GSYQKIS  347

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             A+LR G +FV P G+P   IASQ++NLQ++CF++NA  N R  LAGK N+ +  +  AKE
Sbjct  348   ARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKE  407

Query  1354  VSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             ++F + S+ V+++F+N D    F  GP  QQ E
Sbjct  408   LAFNLPSREVERIFKNQDQA-FFFPGPNKQQEE  439



>ref|XP_009367697.1| PREDICTED: sucrose-binding protein-like [Pyrus x bretschneideri]
Length=481

 Score =   350 bits (899),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 189/454 (42%), Positives = 283/454 (62%), Gaps = 22/454 (5%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+HQC+ Q  F+  Q++ C  KCE YI++K  ++E+RG      R ++ +   D
Sbjct  29    DPELKQCKHQCKHQRGFEEWQKKQCERKCEDYIKQKREQEEQRGREEFEGRGQQQQEEGD  88

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F+ +HF T  ++++GR  VL +F ERS+   GIENFR G L  E   FVAP HLD
Sbjct  89    ENPYFFEDQHFETRVQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLD  148

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD +  V +G  T+ ++++ KK+S+++  G +  IPAG   Y++N D N +L I+KL++T
Sbjct  149   ADCVLFVFQGRPTITVVKEEKKESHNLERGDLFRIPAGTPFYILNRDENERLHIVKLLKT  208

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             +STPG +E F+  G     SF +AF   +L+AA+   +  + R+   +     I+ S EQ
Sbjct  209   VSTPGEYEAFYSAGGQDPESFFKAFSPEVLQAAFKTDRNKLDRLFGQQRRGSIIRASKEQ  268

Query  832   LKSLRKE-----SDTIW--PFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG  987
             ++ + ++     S+ IW  PF   +SSS    ++F KH S  N +G+LFE D  DFK+L 
Sbjct  269   VQRMSQQHGHGGSEGIWPLPFHGGESSSKDSFNLFKKHASQENKFGRLFEADFKDFKQLQ  328

Query  988   --DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTY  1161
               D+ V+FANITRG M GP FN+RATK++ V+DG+G  +MACP          + + PTY
Sbjct  329   EFDLLVSFANITRGAMEGPFFNSRATKISVVLDGEGHFEMACPH--------RQKSSPTY  380

Query  1162  ETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDD  1341
             + ++  LR G +FV P G+P   IAS+++NLQ++CF++NA +N R  L GKNN+ S  D 
Sbjct  381   QKMSGDLRRGAVFVAPAGHPVTIIASRNNNLQLLCFEVNARDNIRFPLVGKNNVVSQFDR  440

Query  1342  VAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQ  1443
              AKE+SF V +  V+ +F N  D ELF +GP  Q
Sbjct  441   QAKELSFNVPASEVESIFNNQKD-ELFFEGPNEQ  473



>ref|XP_007200965.1| hypothetical protein PRUPE_ppa004438mg [Prunus persica]
 gb|EMJ02164.1| hypothetical protein PRUPE_ppa004438mg [Prunus persica]
Length=510

 Score =   347 bits (889),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 187/481 (39%), Positives = 279/481 (58%), Gaps = 35/481 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergg---------------  255
             DPEL+ CRHQC  Q  FD +QRE C   C++YI++K   ++ R                 
Sbjct  29    DPELKQCRHQCEHQQGFDSKQREQCEQGCDKYIKQKREEEKHRRKSEGGGSFYPIPETGR  88

Query  256   gssgrreeegrggeDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGI  435
                   E +GR  +D NPY F+  HF T  ++++GRF +L +FTERS+    IEN+R G 
Sbjct  89    AQEEEEEFQGRQQQDQNPYFFEDEHFETRVQTEEGRFQLLQKFTERSDLLRAIENYRIGF  148

Query  436   LEVESKTFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVN  615
             L  +   FVAP H DAD +  V +G   + I++  K++++++  G +  IPAG   Y+VN
Sbjct  149   LVTKPHAFVAPCHFDADTVLFVFQGRPAVTIVRGEKRETHNLEHGDLFRIPAGTPVYMVN  208

Query  616   TDNNNKLVIIKLIQTISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVL  786
              D N KL I+  ++ +S PG +E F+  G     SF +AF   +L+AA       ++R+ 
Sbjct  209   RDENEKLFIVNFMKPVSVPGEYEAFYAAGGENPESFFKAFSPQVLQAALKTEINKLERLF  268

Query  787   RGRDDSPFIQVSDEQLKSLRKE-----SDTIWPFKTDKSSSSKPVDIFKHKSVSNNYGQL  951
               +      + S EQ+K L ++     S+  WPF   +SSS       KH S +N +G+L
Sbjct  269   GQQRQGSITRASKEQIKKLSQQHGQGGSEGFWPFHGGQSSSDAFNLFSKHPSQANKFGRL  328

Query  952   FEVDNDDFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS-  1122
             FE D +DFK+L D++  V+FANIT+G M+GP FN+RATK++FV+DG+G+ +MACP VSS 
Sbjct  329   FEADFNDFKQLQDLDLLVSFANITQGAMVGPYFNSRATKISFVLDGEGYFEMACPHVSST  388

Query  1123  --------QTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
                        +    + P Y+ ++  LR G +FV P G+P  +IAS++ NLQI+CF++N
Sbjct  389   GRQEPQPQPQPQQRRKSSPRYQKISGNLRRGAVFVAPAGHPMTAIASRNSNLQIICFEVN  448

Query  1279  ADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
             A +N RV L GK N+ S  D  AK+++F V ++ VD++F N DD E F +GP  Q    R
Sbjct  449   AHDNIRVPLVGKKNVVSQFDREAKQLAFNVPAREVDRIFNNQDD-EFFFEGPNEQPEHGR  507

Query  1459  A  1461
             A
Sbjct  508   A  508



>gb|EYU23233.1| hypothetical protein MIMGU_mgv1a024110mg [Erythranthe guttata]
Length=592

 Score =   345 bits (885),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 166/388 (43%), Positives = 262/388 (68%), Gaps = 12/388 (3%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPYVF+ RHF T   +Q GR  +LP+FT+RS   +GIEN+R  ILE E +TF+ PNH 
Sbjct  205   ENNPYVFEERHFFTGMETQHGRLRILPKFTDRSKLLKGIENYRVAILEAEPQTFIVPNHW  264

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD +  VA G G + ++++ +++S++I+ G I  I AG T+YL+N D+N KLV+ KL+Q
Sbjct  265   DADTLIFVANGRGAVSLMRQERRESFNIKQGDIFRINAGTTAYLINRDSNQKLVLAKLLQ  324

Query  658   TISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++TPG+FE FFG G     SF  AF + ILEAA++  ++ +QR+   +     I+ S+E
Sbjct  325   PVNTPGQFEAFFGAGGENPESFYTAFSNEILEAAFNTRRDRLQRLFGQQKQGVIIKASEE  384

Query  829   QLKSL-RKESDTIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELGDIEVA-  1002
             Q++++   E   IWPF  +   +    D  +  S SN YGQLFEVD+  F++L D+++A 
Sbjct  385   QVRAMSHHEEGGIWPFGGESKGTFNLYD--QRPSHSNEYGQLFEVDSSQFRQLRDLDIAV  442

Query  1003  -FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQ  1179
               ANIT+G M+ P +N+++TK+  VVDG+G+ +MACP +S Q + +       YE V+++
Sbjct  443   SLANITQGAMIAPSYNSKSTKITVVVDGEGYFEMACPHISQQQQGA---GQRGYEKVSSR  499

Query  1180  LRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVS  1359
             L+ GT+ V+P G+P+V++AS + NLQ++CF++NA NNE+  LAG+ N+ + ++  AKE++
Sbjct  500   LKRGTVVVVPAGHPFVAVASNNQNLQLLCFEVNAYNNEKFTLAGRRNVMNQLEREAKELA  559

Query  1360  FGVSSKLVDKVFENDDDLELFSKGPEWQ  1443
             FG+ ++ VD++F N  + E F KGP  Q
Sbjct  560   FGMPAREVDEIFRNQKE-EFFFKGPRQQ  586



>gb|AAK15089.1|AF240006_1 7S globulin [Sesamum indicum]
Length=585

 Score =   344 bits (883),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/395 (42%), Positives = 267/395 (68%), Gaps = 14/395 (4%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF+ +HF T  R+Q GR  VL +FT+RS    GIEN+R  ILE E +TF+ PNH DA+
Sbjct  195   PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAE  254

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  VA+G GT+ ++++++++S +I+ G I+ I AG T+YL+N DNN +LV+ KL+Q +S
Sbjct  255   SVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVS  314

Query  667   TPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLK  837
             TPG FE FFG G     SF ++F   ILEAA++  ++ +QR+   +     ++ S+EQ++
Sbjct  315   TPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQQRQGVIVKASEEQVR  374

Query  838   SL-RKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIE--VAF  1005
             ++ R E   IWPF  +   S   ++I++ +   SN YGQL EVD   +++L D++  V+ 
Sbjct  375   AMSRHEEGGIWPFGGE---SKGTINIYQQRPTHSNQYGQLHEVDASQYRQLRDLDLTVSL  431

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ--TERSEEGAIPTYETVNAQ  1179
             ANIT+G M  P +N++ATK+A VVDG+G+ +MACP +S    + + E    P+Y+ V ++
Sbjct  432   ANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQRVASR  491

Query  1180  LRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVS  1359
             L  GT+ +IP G+P+V++AS + NLQ++CF++NA+NNE+  LAG+ N+ + ++  AKE++
Sbjct  492   LTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLEREAKELA  551

Query  1360  FGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRAD  1464
             FG+ ++ V++V  +  + E F KGP  QQ + RAD
Sbjct  552   FGMPAREVEEVSRSQQE-EFFFKGPR-QQQQGRAD  584



>ref|XP_004292578.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Fragaria 
vesca subsp. vesca]
Length=512

 Score =   341 bits (875),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/476 (37%), Positives = 290/476 (61%), Gaps = 35/476 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DP L  C HQC+ Q  +D QQ++ C  +C+ YI++K   + +R  G             +
Sbjct  30    DPGLRQCMHQCQHQEGYDEQQKQICEQRCDDYIKQKRQEERQRRRGGGDTSFVRYDENME  89

Query  301   D------------NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEV  444
                          NPY+F+ + F T   + QGR  +L +FTE+S+   GI NFR G L  
Sbjct  90    QYQGGQQHQQFDQNPYLFEDQDFDTIVETDQGRVQILQKFTEKSDLLRGIANFRIGALIT  149

Query  445   ESKTFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDN  624
             +  +FVAP+H DAD +  V  G  T+ +++ +K++S+++  G I+ +PAG   Y++N D 
Sbjct  150   KPHSFVAPHHFDADCVFFVFHGRPTISMVRGDKRESHNLERGDILRVPAGTPVYIINRDE  209

Query  625   NNKLVIIKLIQTISTPGRFEFFF-GTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGR  795
             N KL ++KL+  ++ P +FE F+ G G N  SF +AF   +LEAA+   ++ ++R+   +
Sbjct  210   NEKLFVVKLLHPVNLPDQFEAFYEGGGENPQSFFKAFSPEVLEAAFKTERDELRRLFGQQ  269

Query  796   DDSPFIQVSDEQLKSL---RKESDTIWPFKTDK-------SSSSKPVDIFKHK-SVSNNY  942
                  ++ S EQ++ +    + S+ +WPF  D+       SS S P ++ + + S SN +
Sbjct  270   RQGSIMKASREQIEKMSHSSRSSEGLWPFHGDQPSTPFSTSSKSGPFNLLRKRPSQSNRH  329

Query  943   GQLFEVDNDDFKELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             G+LFE D+ D+K+L   D++++FANITRG M+ P FN+RATK++FV+DG+G+ +MACP +
Sbjct  330   GRLFEADSSDYKQLEELDLQISFANITRGSMIAPFFNSRATKISFVLDGEGFFEMACPHL  389

Query  1117  SSQ------TERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
             +SQ      ++R +  + P+Y+ V   LR GT+F++P G+P  +IAS+++NLQI+CF++N
Sbjct  390   ASQESSQGGSQRQQRSSSPSYQNVRGDLRRGTVFIVPAGHPATAIASRNNNLQILCFEVN  449

Query  1279  ADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
             A +N R+ L GK N+ S  +  AKE++FGV  + VD++F N  D E F +GP  QQ
Sbjct  450   AKDNVRLPLTGKKNVVSQFEREAKELAFGVPGREVDRIF-NKQDGEFFLEGPNNQQ  504



>ref|XP_009370838.1| PREDICTED: sucrose-binding protein-like [Pyrus x bretschneideri]
Length=476

 Score =   338 bits (868),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 186/461 (40%), Positives = 275/461 (60%), Gaps = 30/461 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+HQC+ Q  FD +Q++ C  KCE Y  E+E  +         ++        D
Sbjct  30    DPELKQCQHQCKHQRGFDERQKQQCERKCEDYTGEREEFEGRGQQQHQQQQG-------D  82

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F+ +HF T  ++++G   VL +F ERS+   GIENFR G L  E   FV+P HLD
Sbjct  83    ENPYFFEDQHFETRIQTEEGSVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVSPTHLD  142

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I  V +G  T+ +++  KK+S+++  G +  IPAG   Y++N D N KL I++L +T
Sbjct  143   ADSILFVFQGGPTITMVRGEKKESHNLERGDLFRIPAGTPFYVLNRDENEKLHIVELFKT  202

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             +STPG +  F  +G     SF RAF   +L+AA+   +  + R+   +     I+ S EQ
Sbjct  203   VSTPGEYASFHSSGGQDPESFFRAFSPEVLQAAFKTDRNKLDRLFGQQRRGSIIRASKEQ  262

Query  832   LKSL-----RKESDTIWPFK---TDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKEL  984
             ++ +         + IWP      D+SSS    ++F KH S  N +G+LFE D +DFK+L
Sbjct  263   VQRMSQQHGHGGGEGIWPLPFHGGDESSSKDSFNLFKKHPSHENKFGRLFEADFNDFKQL  322

Query  985   GD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT  1158
              +  + V+FANITRGGM GP FN+RATK++ V+DG+G+ +MACP          + + PT
Sbjct  323   QEFNLVVSFANITRGGMAGPYFNSRATKISVVLDGEGYFEMACPH--------RQKSSPT  374

Query  1159  YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMD  1338
             Y+ ++  LR G +FV P G+P  +IAS+++NLQ++CF++NA +N R  L GKNN+ S  D
Sbjct  375   YQKMSGDLRRGAVFVAPAGHPVTTIASRNNNLQVLCFEVNAHDNIRFPLVGKNNVVSQFD  434

Query  1339  DVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
               AKE+SF V +  V+ +F N  D ELF +GP  Q    RA
Sbjct  435   RQAKELSFNVPASEVESIFNNQKD-ELFFEGPNDQLEHGRA  474



>gb|ABO36677.1| vicilin [Pistacia vera]
Length=519

 Score =   339 bits (870),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/455 (40%), Positives = 282/455 (62%), Gaps = 15/455 (3%)
 Frame = +1

Query  130   LETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeDDNP  309
             L  C  QC  Q     QQ++ C  +C+   +++                +E +  ED+NP
Sbjct  71    LSQCMKQCERQDG--GQQKQLCRFRCQEKYKKERREHSYSRDEEEEEEGDEEQEEEDENP  128

Query  310   YVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADL  489
             YVF+  HF T  +++QG+  VLP+FT+RS    G+E +R   L    + FV PNH+DAD 
Sbjct  129   YVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADS  188

Query  490   IGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIST  669
             I  V+ G GT+  I++NK++S +++ G I+ I AG   Y+VNTD N KL I+KL+Q ++ 
Sbjct  189   IFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQPVNL  248

Query  670   PGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKS  840
             PG +E F G G     SF RAF   +LEAA    ++ ++++   +D+   ++ S EQ+++
Sbjct  249   PGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEGAIVKASKEQIRA  308

Query  841   L--RKESDTIWPFKTDKSSSSKPVDIFKH-KSVSNNYGQLFEVDNDDFKELG--DIEVAF  1005
             +  R E  +IWPF T KS+ +   ++FK   S SNNYGQLFE +  D+  L   DI V++
Sbjct  309   MSRRGEGPSIWPF-TGKSTGT--FNLFKKDPSQSNNYGQLFESEFKDYPPLQELDIMVSY  365

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQLR  1185
              NIT+GGM GP +N+RATK+A VV G+G  ++ACP +SS     +E + P+Y+ +++ +R
Sbjct  366   VNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQEKSGPSYKKLSSSIR  425

Query  1186  PGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFG  1365
               ++FV+P G+P+V++AS + NL+I+CF++NA+ N R  LAGK N+   M+  AKE++F 
Sbjct  426   TDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEGNIRYTLAGKKNIIEVMEKEAKELAFK  485

Query  1366  VSSKLVDKVFENDDDLELFSKGPEWQQSED-RADQ  1467
                + VDKVF   D+ E F +GP+W+Q +  RAD+
Sbjct  486   TKGEEVDKVFGKQDE-EFFFQGPKWRQHQQGRADE  519



>ref|XP_008355465.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=490

 Score =   337 bits (865),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 272/469 (58%), Gaps = 32/469 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+HQC+ Q  FD +Q++ C  KC+ Y +E+E  +                   D
Sbjct  30    DPELKQCQHQCKHQRGFDERQKQQCERKCKDYTREREEFEGRGQQQQQQG---------D  80

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F+ +HF T  ++++GR  VL +F ERS+   GIENFR G L  E   FVAP HLD
Sbjct  81    ENPYFFEDQHFETRIQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLD  140

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I  V +G  T+  ++  KK+S ++  G +  IPAG   Y++N D N KL I++L +T
Sbjct  141   ADSILFVFQGRPTIXTVRGEKKESXNLERGDLFRIPAGTPFYVLNRDENEKLHIVELFKT  200

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             +STPG +  F   G     SF RAF   +L+AA+   +  + R+         I+ S EQ
Sbjct  201   VSTPGEYAAFHSAGGQDPESFFRAFSPEVLQAAFKTDRNKLDRLFGQXRRGSIIRASKEQ  260

Query  832   LKSL-----RKESDTIWPFK---TDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKEL  984
             ++ +           IWP      D+SSS    ++F KH S  N +G+LFE D +DFK+L
Sbjct  261   VQRMSQQHGHGGGKGIWPLPFHGGDESSSKDSFNLFKKHPSHENKFGRLFEADFNDFKQL  320

Query  985   GD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV--------SSQTER  1134
              +  + V+FANITRGGM GP FN+RATK++ V+DG+G+ +MACP          SS   +
Sbjct  321   QEFNLVVSFANITRGGMAGPYFNSRATKISVVLDGEGYFEMACPHXDSRGRQRQSSGRSQ  380

Query  1135  SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK  1314
               + + PTY+ ++  LR G +FV P G+P  +IAS+++ LQ++CF++NA +N R  L GK
Sbjct  381   QRQKSSPTYQXMSGDLRRGAVFVAPAGHPXTTIASRNNXLQVLCFEVNAHDNIRFPLVGK  440

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             NN+ S  D  AKE+SF V +  V+ +F N  D ELF +GP  Q    RA
Sbjct  441   NNVVSQFDRQAKELSFNVPASEVESIFNNQKD-ELFFEGPNDQLEHGRA  488



>ref|XP_011082575.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Sesamum indicum]
Length=580

 Score =   340 bits (872),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 191/460 (42%), Positives = 294/460 (64%), Gaps = 21/460 (5%)
 Frame = +1

Query  121   DPE--LETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgg  294
             DPE   + CR QCR Q       RE C  +CE   +E++GR+  RG    GR  EE +  
Sbjct  129   DPEKQYQQCRLQCRRQGEGGGFSREHCERRCEEKYREQQGREGGRGEMYEGREREEEQEE  188

Query  295   eDDN--PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAP  468
             +     PYVF+ +HF T  R+Q GR  VL +FT+RS    GIEN+R  ILE E +TF+ P
Sbjct  189   QGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVP  248

Query  469   NHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIK  648
             NH DA+ +  VA+G GT+ ++++++++S +I+ G I+ I AG T+YL+N DNN +LV+ K
Sbjct  249   NHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAK  308

Query  649   LIQTISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQV  819
             L+Q +STPG FE FFG G     SF ++F   ILEAA++  ++ +QR+  G+     I V
Sbjct  309   LLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIF-GQQRQGVI-V  366

Query  820   SDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIE  996
                 +   R E   IWPF  +   S   ++I++ +   SN YGQL+EVD   +++L D++
Sbjct  367   XXXXMS--RHEEGGIWPFGGE---SKGTINIYQQRPTHSNQYGQLYEVDASQYRQLRDLD  421

Query  997   --VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ--TERSEEGAIPTYE  1164
               V+ ANIT+G M  P +N++ATK+A VVDG+G+ +MACP +S    + + E    P+Y+
Sbjct  422   LTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSYQGETRGRPSYQ  481

Query  1165  TVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDV  1344
              V ++L  GT+ +IP G+P+V++AS + NLQ++CF++NA+NNE+  LAG+ N+ + ++  
Sbjct  482   RVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNNEKFPLAGRRNVMNQLERE  541

Query  1345  AKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRAD  1464
             AKE++FG+ ++ V++VF +  + E F KGP  QQ + RAD
Sbjct  542   AKELAFGMPAREVEEVFRSQQE-EFFFKGPR-QQQQGRAD  579



>ref|XP_010086607.1| Sucrose-binding protein [Morus notabilis]
 gb|EXB22118.1| Sucrose-binding protein [Morus notabilis]
Length=501

 Score =   335 bits (858),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 189/471 (40%), Positives = 289/471 (61%), Gaps = 33/471 (7%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgg--  294
             DPEL+ CRHQC+ Q  F+ +QR+ C  +CE YI+EK+ R+ E  G S   RE        
Sbjct  27    DPELKQCRHQCKHQRGFEEEQRQQCEQRCEEYIREKKHREREEEGYSRRSRESREEEEEK  86

Query  295   -------eDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK  453
                    E +NPY+F+  HF T+ R+++GR  +L +FTERS   +GIEN+R G LE    
Sbjct  87    EESGERIEQNNPYLFEAEHFDTSVRTEEGRVHILKKFTERSKLLKGIENYRVGFLEANPH  146

Query  454   TFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNK  633
              FVAP H DAD+I  VA G  T+ ++++ K++++++  G +V IPAG  +Y+VN D   K
Sbjct  147   AFVAPVHFDADVIFFVASGRPTVTLLREEKRETFNLERGDVVHIPAGTPAYIVNRDEREK  206

Query  634   LVIIKLIQTISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDS  804
             L I+ LI  +  PG FE F G G     SF +AF   +L+AA+   ++ I+R+   +   
Sbjct  207   LFIVNLINPVYLPGEFESFHGPGGEDPESFYKAFSWKVLKAAFKRDRDEIERLFGQQKRG  266

Query  805   PFIQVSDEQLKSLRKESDT------IWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVD  963
                + S EQ++ L + ++       IWPFK +   +  P ++F KH   SN YG LFE +
Sbjct  267   GITKASREQVEELSRHAEGGGGGGPIWPFKGE---TKGPFNLFRKHPVSSNRYGSLFEAN  323

Query  964   NDDFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS  1137
              +D K+L D+   ++FANIT+G M+ P +N++ATK++FVVDG+GW +MACP   S+  R 
Sbjct  324   TEDCKDLEDLNLMISFANITKGAMIAPNYNSKATKMSFVVDGEGWFEMACPHTPSEQGRQ  383

Query  1138  EEGAIP--------TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNE  1293
               G            ++ +  +LR G +FV+P G+P  +IASQ+ NLQI+CF++NA  N 
Sbjct  384   RGGGSAWQGEKSGKKFKRITGRLRRGMVFVVPAGHPVTAIASQNTNLQILCFEVNAKGNT  443

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
             R  LAG+ N+ +NMD+VAKE++FGV ++ V+++F++ ++ E F  GP  Q+
Sbjct  444   RYPLAGRKNIVNNMDNVAKELAFGVPAREVERIFKSQNE-EFFFPGPTQQE  493



>gb|EYU40904.1| hypothetical protein MIMGU_mgv1a003248mg [Erythranthe guttata]
Length=597

 Score =   337 bits (863),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 259/393 (66%), Gaps = 16/393 (4%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPYVF+ RHF T   +Q GR  +LP+FT+RS   +GIEN+R  ILE E +TF+ PNH DA
Sbjct  202   NPYVFEERHFFTGMETQHGRLRILPKFTDRSKLLKGIENYRVAILEAEPQTFIVPNHWDA  261

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D +  VA G G + ++++ +++S++I+ G I  I AG T+YL+N D+N KLV+ KL+Q +
Sbjct  262   DTLIFVANGRGAVSLMRQERRESFNIKQGDIFRINAGTTAYLINRDSNQKLVLAKLLQPV  321

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             +TPG+FE FFG G     SF  AF + ILEAA++  ++ +QR+   +     I+ S+EQ+
Sbjct  322   NTPGQFEAFFGAGGENPESFYTAFSNDILEAAFNTRRDRLQRLFGQQKQGVIIKASEEQV  381

Query  835   KSL-RKESDTIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELGDIEVA--F  1005
             +++   E   IWPF  +   +    D  +  S SN YGQLFEVD+  F++L D+++A   
Sbjct  382   RAMSHHEEGGIWPFGGESKGTFNLYD--QRPSHSNEYGQLFEVDSSQFRQLRDLDIAISL  439

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-------SSQTERSEEGAIPTYE  1164
             ANIT+G M+ P +N+++TK+  VVDG+G+ +MACP +         Q  + +      YE
Sbjct  440   ANITQGAMIAPSYNSKSTKITVVVDGEGYFEMACPHISQSQSQGGRQQRQQQGAGQRGYE  499

Query  1165  TVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDV  1344
              V+++L+ GT+ V+P G+P+V++AS + NLQ++CF++NA NNE+  LAG+ N+ + ++  
Sbjct  500   KVSSRLKRGTVVVVPAGHPFVAVASNNQNLQLLCFEVNAYNNEKFTLAGRRNVMNQLERE  559

Query  1345  AKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQ  1443
             AKE++FG+ ++ VD++F +  + E F KGP  Q
Sbjct  560   AKELAFGMPAREVDEIFRSQKE-EFFFKGPRQQ  591



>ref|XP_010054529.1| PREDICTED: sucrose-binding protein-like [Eucalyptus grandis]
 gb|KCW76785.1| hypothetical protein EUGRSUZ_D01140 [Eucalyptus grandis]
Length=566

 Score =   334 bits (857),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 171/403 (42%), Positives = 251/403 (62%), Gaps = 20/403 (5%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             DNPYVF   HF+    ++ GR SVLP+FT+RS    GIENFR  +LE E  TF  P+H D
Sbjct  159   DNPYVFDREHFKAIVETEHGRVSVLPKFTKRSKLLRGIENFRLALLEAEPNTFEVPSHWD  218

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
              D +  + EG GT+ ++++NK++S +I  G IV + AG   Y++N D N KL+I +L++ 
Sbjct  219   TDAVLFIVEGRGTITLVRQNKRQSINIEEGDIVRVEAGTPVYMINRDQNQKLIIAQLLRP  278

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ++ P +FE F+GTG     SF  AF   +LEAA    +  ++R+   +     ++ S EQ
Sbjct  279   VNLPSQFEAFYGTGGQNPESFYTAFSWEVLEAALKTDRNKLERLFGQQQQGAIVKASREQ  338

Query  832   LKSLR-KESDTIWPFKTDKSSSSKPVDIF----KHKSVSNNYGQLFEVDNDDFKELGDIE  996
             +++L   E    WPF   +S  SK    F    KH S +N +GQL+  D DDFKEL D++
Sbjct  339   IEALSGHEEGGRWPFGGGESHGSKGSRSFNLFNKHPSHANQHGQLYIADRDDFKELEDMD  398

Query  997   V--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV--------SSQTERSEEG  1146
             V  +FANIT+G M+GP +N+RATK++FV +G+G+ +M CP +          Q ++   G
Sbjct  399   VMISFANITQGSMIGPYYNSRATKISFVTEGEGYLEMGCPHLSSSRSKHSRHQKQQGGGG  458

Query  1147  AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLY  1326
                TY+ V AQLR GT F++P G+P  +IAS++ NLQI CF++NA+NN R  LAGK N+ 
Sbjct  459   GGRTYQKVRAQLRRGTAFIVPAGHPVAAIASKNSNLQIACFEVNAENNVRYPLAGKRNII  518

Query  1327  SNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP-EWQQSE  1452
               M+  AKE++F   S+ VD++F++ D+ E F  GP EWQ+ E
Sbjct  519   DLMEREAKELAFNFPSRDVDRIFKSQDE-EFFFAGPEEWQEQE  560



>ref|XP_008350065.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=524

 Score =   325 bits (834),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 179/441 (41%), Positives = 269/441 (61%), Gaps = 23/441 (5%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgge-  297
             DPEL+ C+HQC+ Q  FD +Q++ C  KCE YI++K  ++E+R       R ++ +  + 
Sbjct  33    DPELKQCQHQCKHQRGFDERQKQQCERKCEDYIKQKREQEEQRRREEFEGRGQQQQQQQG  92

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             D+NPY F+ +HF T  ++++GR  VL +F ERS+   GIENFR G L  E   FVAP HL
Sbjct  93    DENPYFFEDQHFETRIQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHL  152

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I  V +G  T+  ++  KK+S ++  G +  IPAG   Y++N D N KL I++L +
Sbjct  153   DADSILFVFQGRPTIXTVRGEKKESXNLERGDLFRIPAGTPFYVLNRDENEKLHIVELFK  212

Query  658   TISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
             T+STPG +  F   G     SF RAF   +L+AA+   +  + R+         I+ S E
Sbjct  213   TVSTPGEYAAFHSAGGQDPESFFRAFSPEVLQAAFKTDRNKLDRLFGQXRRGSIIRASKE  272

Query  829   QLKSLRKE-----SDTIWPFK---TDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKE  981
             Q++ + ++        IWP      D+SSS    ++F KH S  N +G+LFE D +DFK+
Sbjct  273   QVQRMSQQHGHGGGXGIWPLPFHGGDESSSKDSFNLFKKHPSHENKFGRLFEADFNDFKQ  332

Query  982   LGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV--------SSQTE  1131
             L +  + V+FANITRGGM GP FN+RATK++ V+DG+G+ +MACP +        SS   
Sbjct  333   LQEFNLVVSFANITRGGMAGPYFNSRATKISVVLDGEGYFEMACPHIDSRGRQRQSSGRS  392

Query  1132  RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
             +  + + PTY+ ++  LR G +FV P G+P  +IAS++++LQ++CF++NA +N R  L G
Sbjct  393   QQRQKSSPTYQKMSGDLRRGAVFVAPAGHPVTTIASRNNHLQVLCFEVNAHDNIRFPLVG  452

Query  1312  KNNLYSNMDDVAKEVSFGVSS  1374
             KNN+ S  D  AKE+S  V +
Sbjct  453   KNNVVSQFDRQAKELSXNVPA  473



>gb|KDO68672.1| hypothetical protein CISIN_1g040805mg [Citrus sinensis]
Length=540

 Score =   321 bits (823),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 259/388 (67%), Gaps = 21/388 (5%)
 Frame = +1

Query  349   SQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEGEGTLDI  528
             SQ GR + LP+FT+RS    G+E +R GIL    +TFV P HLDAD +  V+ G+GT+ +
Sbjct  155   SQHGRVAFLPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITV  214

Query  529   IQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFFFGTGR-  705
             I++N ++SY+++ G I+ +P+G T Y+ NTD++ KL I+K I++I+ PG++E F+G G  
Sbjct  215   IRENNRESYNVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYEAFYGAGGE  274

Query  706   --NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLRK--ESDTIWPF  873
                SFLRAF   ILE+A+   +++++RVL  +D    ++ S +Q+++L +  E  +IWPF
Sbjct  275   NPESFLRAFSWEILESAFKTKRDSLERVLFQQDQGAMVKASKQQIRALSRSQEGPSIWPF  334

Query  874   KTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG--DIEVAFANITRGGMLGPLF  1044
               +   S    ++F K  S SNN+G+LFE D++DF+ L   DI V++ANI++G M  P +
Sbjct  335   AGE---SRGTFNLFGKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFY  391

Query  1045  NTRATKLAFVVDGKGWAQMACPQVS-SQTERSEEGA------IPTYETVNAQLRPGTLFV  1203
             N+R+TK+A VV G G+ ++ACP VS S +ER  +G+        TY  V++++R  + ++
Sbjct  392   NSRSTKVAVVVAGDGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYI  451

Query  1204  IPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLV  1383
             +P G+P V++ASQ++NL++VCF+INA+ N R  LAG+N ++  M+  AKE++F   +  V
Sbjct  452   VPAGHPVVTVASQNNNLEVVCFEINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADEV  511

Query  1384  DKVFENDDDLELFSKGP-EW-QQSEDRA  1461
             ++VF N D  + F KGP  W QQ + RA
Sbjct  512   ERVFGNQDQ-DWFFKGPSRWHQQQQGRA  538



>ref|XP_006444033.1| hypothetical protein CICLE_v10024281mg [Citrus clementina]
 gb|ESR57273.1| hypothetical protein CICLE_v10024281mg [Citrus clementina]
Length=540

 Score =   320 bits (821),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/388 (42%), Positives = 258/388 (66%), Gaps = 21/388 (5%)
 Frame = +1

Query  349   SQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEGEGTLDI  528
             SQ GR + LP+FT+RS    G+E +R GIL    +TFV P HLDAD +  V+ G+GT+ +
Sbjct  155   SQHGRVAFLPKFTQRSKLLRGLEKYRLGILIANPQTFVTPTHLDADAVFFVSWGQGTITV  214

Query  529   IQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFFFGTGR-  705
             I++N ++SY+++ G I+ +P+G T Y+ NTD++ KL I+K I++I+ PG++E F+G G  
Sbjct  215   IRENNRESYNVKRGDIIRVPSGNTFYVTNTDDDEKLYIVKFIKSINLPGQYEAFYGAGGE  274

Query  706   --NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLRK--ESDTIWPF  873
                SFLRAF   ILE+A+   +++++RVL  +D    ++ S +Q+++L +  E  +IWPF
Sbjct  275   NPESFLRAFSWEILESAFKTKRDSLERVLFQQDQGAMVKASKQQIRALSRSQEGPSIWPF  334

Query  874   KTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG--DIEVAFANITRGGMLGPLF  1044
               +   S    ++F K  S SNN+G+LFE D++DF+ L   DI V++ANI++G M  P +
Sbjct  335   AGE---SRGTFNLFGKRPSHSNNFGELFEADSNDFRPLEDLDITVSYANISKGAMAAPFY  391

Query  1045  NTRATKLAFVVDGKGWAQMACPQVS-SQTERSEEGA------IPTYETVNAQLRPGTLFV  1203
             N+R+TK A VV G G+ ++ACP VS S +ER  +G+        TY  V++++R  + ++
Sbjct  392   NSRSTKAAVVVAGDGYIEIACPHVSRSSSERRHQGSSTREEGSATYHKVSSRIRTDSAYI  451

Query  1204  IPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLV  1383
             +P G+P V++ASQ++NL++VCF+INA+ N R  LAG+N ++  M+  AKE++F   +  V
Sbjct  452   VPAGHPVVTVASQNNNLEVVCFEINAEGNIRFPLAGRNKIFKVMESEAKELAFNTRADEV  511

Query  1384  DKVFENDDDLELFSKGP-EW-QQSEDRA  1461
             ++VF N D  + F KGP  W QQ + RA
Sbjct  512   ERVFGNQDQ-DWFFKGPSRWHQQQQGRA  538



>ref|XP_008451293.1| PREDICTED: sucrose-binding protein-like [Cucumis melo]
Length=515

 Score =   319 bits (818),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 176/461 (38%), Positives = 270/461 (59%), Gaps = 21/461 (5%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+HQC+VQ  FD QQ+  C   C+ Y + K+ +            EEE    E+
Sbjct  55    DPELKQCKHQCKVQRQFDEQQKRDCERSCDEYYKMKKEKGRNYESEEEEEEEEEEEEEEE  114

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF   HF     + +G+  VL +FT+RS    GIENFR  I+E    TFV P H D
Sbjct  115   ENPYVFDDEHFVGKVETGEGKIKVLQKFTQRSQLLRGIENFRVSIVEANPSTFVVPTHFD  174

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A++I  VA+G GT+ +I K K+ S+D++ G +  IP+GA  Y +N D + KL I+KL+Q+
Sbjct  175   AEIIMFVAQGRGTITVI-KEKRGSFDLKCGDVFRIPSGAPFYFINKDEHQKLKIVKLLQS  233

Query  661   ISTPGRFEFF---FGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
              S PG F+ F    G    SF  AF   +LEAA+   ++ ++R  + +     I+ S EQ
Sbjct  234   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQRPGTIIKASREQ  293

Query  832   LKSLRKESDT---IWPFKTDKSSSSKPVDIFK-HKSVSNNYGQLFEVDNDDFKELGD--I  993
             ++SL +  +    IWPF   +  + +P ++ K H   SN +G+LFE   D+F +L D  +
Sbjct  294   IRSLSQHEEIIPKIWPF--SEGETERPFNLLKQHPWQSNKFGRLFEAYPDEFSQLRDLGV  351

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV------SSQTERSEEG--A  1149
              +AFANIT+G M+ P +N+++ K+A V+DG+G  QMACP +      S +    EEG   
Sbjct  352   AIAFANITKGSMMTPHYNSKSMKIAVVLDGEGGFQMACPHLSSSSGRSGRWSEREEGRKG  411

Query  1150  IPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYS  1329
               TY+ +  +L  G +FV+P G+P+   AS + +LQIVCF++NA  N +  LAGK N+ +
Sbjct  412   ERTYQKIRGRLSRGVVFVVPAGHPFSVFASPNHSLQIVCFEVNAYGNTKYFLAGKENIVN  471

Query  1330  NMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
              M+ +A+E+ F    + V+++F+  ++ E F  GP  Q+ E
Sbjct  472   KMESIARELGFNTPGREVERMFKQQEE-EFFFPGPNQQEHE  511



>gb|KDP21423.1| hypothetical protein JCGZ_21894 [Jatropha curcas]
Length=514

 Score =   318 bits (815),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 178/480 (37%), Positives = 276/480 (58%), Gaps = 47/480 (10%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDK--------------------------------  204
             DPELE C+HQCRVQ  +D  +++ C+ +                                
Sbjct  29    DPELEQCQHQCRVQRHYDEGEKKRCIQQCEDYYKEKKGREHGEEGREEEEEAERRVGQCQ  88

Query  205   --CERYIqekegrqeergggssgrreeegrggeDDNPYVFQPRHFRTAHRSQQGRFSVLP  378
               CER   E+      R     GR E E   GE+ NPYVF+  HF +  +++ GR  VL 
Sbjct  89    SQCERQKGEERALCRFRCQQKFGRDEGEHSWGEEKNPYVFEEEHFTSIIKTEHGRARVLQ  148

Query  379   RFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYD  558
             +FT+RS    GI+N+R GILE   +TFV+  H DAD +  VA G GT+ +I + K++S++
Sbjct  149   KFTKRSELLRGIKNYRVGILEANPQTFVSQGHWDADGVLYVARGRGTISMIIEEKRQSFN  208

Query  559   IRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFFFGTG---RNSFLRAFK  729
             ++ G ++ I AG   YL+N D   KL ++ ++  ++ PG FE F  +G     SF  AF 
Sbjct  209   VQRGDVLRIRAGTPLYLINRDEKEKLYVVSVMVPVNIPGEFEIFSASGTEDSESFYEAFS  268

Query  730   SSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSL--RKESDTIWPFKTDKSSSSKP  903
               +LEAA    +  ++ + R +  +  ++ S EQ++++  R+E   +WPF T+   S  P
Sbjct  269   WELLEAALKTERRRLEHIFRQKQGA-IVKASREQIQAMSHREEGGGVWPFGTE---SIGP  324

Query  904   VDIFKHKSVSNNYGQLFEVDNDDFKELG---DIEVAFANITRGGMLGPLFNTRATKLAFV  1074
             + I K+    NNYGQLFEV + DFK+     D+ V+ ANI+RG M GP +N+R TK++ V
Sbjct  325   ISILKNPVFRNNYGQLFEVGSRDFKQQLRDLDLSVSVANISRGAMSGPYYNSRVTKISVV  384

Query  1075  VDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNL  1254
             +DG+G+ +MACP +S     +   +  TY+ V+++L+ GT  V+P G+P   +AS+++NL
Sbjct  385   LDGEGYFEMACPHLSGSRGDTTGESQKTYQKVSSRLKRGTAVVVPAGHPAAFVASRNNNL  444

Query  1255  QIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             ++VCF+IN + N R  LAGKNN+ + M+  AKE++FGVS + VD+ F   ++ E F  GP
Sbjct  445   EVVCFEINEEGNTRHLLAGKNNIVNKMEKQAKELAFGVSEREVDQAFGRQNE-EWFFPGP  503



>ref|XP_002524752.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF37595.1| nucleolar protein nop56, putative [Ricinus communis]
Length=560

 Score =   318 bits (815),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 166/396 (42%), Positives = 256/396 (65%), Gaps = 16/396 (4%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF    F    R++ G  SVLPRFT++S    GIEN+R GIL+   +TFVAP+H DAD
Sbjct  168   PYVFDTDQFTEKVRTEHGSISVLPRFTKKSKLLRGIENYRVGILKANPQTFVAPSHWDAD  227

Query  487   LIGLVAEGEGTLDII-QKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
              + +VA+G GT+ +I ++ +K+S++I VG ++ + AG   Y++N D+N KL II  IQ +
Sbjct  228   AVLVVAKGRGTVTLIHEEGEKRSFNIEVGDVMRVRAGTPVYVINRDDNEKLYIINFIQPV  287

Query  664   STPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             + PG FE F   G     SF  AF   +LEAA+   +  I++++  + ++  ++ S EQ+
Sbjct  288   NLPGEFEAFRAAGGREDESFYNAFSWELLEAAFKTDRRRIEQLITQKQEA-IVKASKEQI  346

Query  835   KSLR---KESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKE-LGDIE-  996
             +++    +E  TIWPF  +  SS  P ++   + V SNN+GQLFE   +D KE L D++ 
Sbjct  347   QAMTHRDQEGGTIWPFGGE--SSGAPFNLLHKRPVQSNNHGQLFEARPNDHKEQLQDLDL  404

Query  997   -VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVN  1173
              ++FANITRG M GPL+N+RATK+A V  G+G+ +MACP +S  +E        TY  V 
Sbjct  405   MISFANITRGSMAGPLYNSRATKIAIVTQGEGYMEMACPHLSGGSEHQGRKG-QTYGRVR  463

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             ++LRPGT+F++P G+P  ++AS ++NL ++CF++NA  N R  LAG+NN+    +  AKE
Sbjct  464   SRLRPGTVFIVPAGHPVATVASPNNNLAVLCFEVNAQGNIRYTLAGRNNIVRRWEREAKE  523

Query  1354  VSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             ++FGV ++ VD+VFE+ +++  F  GP  Q+ + RA
Sbjct  524   LAFGVRAREVDEVFESQNEV-FFFPGPRRQEWQGRA  558



>emb|CBI28721.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   310 bits (794),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/386 (40%), Positives = 249/386 (65%), Gaps = 14/386 (4%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             + NPYVFQ +H+  +  + +GR  +L RF +RS    G++N+RF  LE   +TFV P HL
Sbjct  14    EQNPYVFQDQHYTASLETNEGRIKILQRFHQRSRLLRGLKNYRFVYLEANPQTFVLPAHL  73

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ +  VA G GTL ++ + K++S++I+ G IV I AG T Y++N D N KL I KL+Q
Sbjct  74    DAEAVVYVASGRGTLSLVSQGKRESFNIKQGDIVRIRAGTTIYMINRDKNKKLRIAKLLQ  133

Query  658   TISTPGRFEFFFG-TGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++ P  F+ F+G  G N  SF RAF   +L +A    ++ +QRV++ ++    ++ S++
Sbjct  134   PVALPDEFQPFYGPAGENPQSFYRAFSEELLSSALKVEQDRVQRVIKQQNKGVIVKASEQ  193

Query  829   QLKSL-RKESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGDIEVA  1002
             Q+++L ++E   ++PF    + S +  ++  K  S+SN YG+L E D ++F++L D+++A
Sbjct  194   QIQALSQREESGMFPFPFGSTESKRVFNLLSKEPSISNRYGRLHEADANEFQQLQDMDIA  253

Query  1003  --FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNA  1176
               ++NIT+G M GP FNTRATK+A VV G+G+ +MACP    Q+      A P Y+ +++
Sbjct  254   VSYSNITKGSMEGPFFNTRATKIAVVVKGEGYMEMACPHQQQQS------ASPHYQRLSS  307

Query  1177  QLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEV  1356
              L+ G LFV+P G+P + +A  + NL+IVCFD+NA+NN R +LAG  N+ + ++  AKE+
Sbjct  308   PLKRGMLFVVPAGHPLIVVAGNNRNLEIVCFDVNAENNRRESLAGDKNIVNALEKEAKEL  367

Query  1357  SFGVSSKLVDKVFENDDDLELFSKGP  1434
             +F + ++ VD+VF   ++   F  GP
Sbjct  368   AFSIPAREVDEVFAKQNEWWFFP-GP  392



>gb|KGN44776.1| hypothetical protein Csa_7G380130 [Cucumis sativus]
Length=485

 Score =   312 bits (799),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 171/461 (37%), Positives = 264/461 (57%), Gaps = 26/461 (6%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+HQC+VQ  FD QQ+  C   C+ Y + K+ +            EEE      
Sbjct  30    DPELKQCKHQCKVQRQFDEQQKRDCERSCDEYYKMKKEKGRNYESEEEEEEEEE-----V  84

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF   HF     + +G+  VL +FT+RS+   GIENFR  I+E    TFV P H D
Sbjct  85    ENPYVFDDEHFVGQIETGEGKIKVLQKFTQRSHLLRGIENFRVSIVEANPSTFVVPTHFD  144

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A++I  VA+G GT+ +I K K+ S++++ G +  IP+GA  Y +N D + KL I+KL+Q+
Sbjct  145   AEIILFVAQGRGTITVI-KEKRGSFELKCGDVFRIPSGAPFYFINKDEHRKLKIVKLLQS  203

Query  661   ISTPGRFEFF---FGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
              S PG F+ F    G    SF  AF   +LEAA+   ++ ++R  + +     I+ S EQ
Sbjct  204   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQKPGTIIKASREQ  263

Query  832   LKSLRKESDT---IWPFKTDKSSSSKPVDIFK-HKSVSNNYGQLFEVDNDDFKELGD--I  993
             ++SL +  +    IWPF   +  + +P ++ K H   SN +G+LFE   D+F +L D  +
Sbjct  264   IRSLSRHEEIIPKIWPF--SEGETERPFNLLKQHPCQSNKFGRLFEAYPDEFSQLRDLGV  321

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV--------SSQTERSEEGA  1149
              +AFANIT G M+ P +N+++ K+A V+DG+G  QMACP +               E   
Sbjct  322   AIAFANITEGSMVAPHYNSKSMKIAVVLDGQGGFQMACPHLSSSSRRSGRWSEREEERKG  381

Query  1150  IPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYS  1329
               TY+ +  +L  G +FV+P G+P+   AS + +LQIVCF++NA  N +  LAGK N+ +
Sbjct  382   ERTYQKIRGRLSRGVVFVVPAGHPFSVFASPNHSLQIVCFEVNAYGNTKYFLAGKENIVN  441

Query  1330  NMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
              M+ +A+E+ F    + V+++F+  ++ E F  GP  Q+ E
Sbjct  442   KMESIARELGFNTPGREVERMFKQQEE-EFFFPGPNQQEHE  481



>ref|XP_008386543.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=485

 Score =   311 bits (798),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 176/456 (39%), Positives = 267/456 (59%), Gaps = 24/456 (5%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFD--RQQREACLDKCERYIqekegrqeergggssgrreeegrgg  294
             DPEL+ C+HQC+ Q      R       ++ E     + G    R       R ++ +  
Sbjct  30    DPELKQCKHQCKHQRGRGNRRTSGGGGKEEEEEEEGGEGGSFYIREREEFEGRGQQQQQQ  89

Query  295   eDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNH  474
              D+NPY F+ +HF T  ++++GR  VL +F ERS+   GIENFR G L  E   FVAP H
Sbjct  90    GDENPYFFEDQHFETRVQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTH  149

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
             LDAD +  V +G  T+ ++++ KK+S+++  G +  IPAG   Y++N D+N +L I++L+
Sbjct  150   LDADCVLFVCQGRPTITLVREEKKESHNLERGDLFRIPAGTPFYILNRDDNERLHIVQLL  209

Query  655   QTISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSD  825
             + +STPG +E F   G     SF +AF   +L+AA+   +  + R+   +     I+ S 
Sbjct  210   KAVSTPGEYEAFHSAGGQDPESFFKAFSPEVLQAAFKTDRNKLDRLFGQQTRGSIIRASK  269

Query  826   EQLKSLRKE-----SDTIW--PFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKE  981
             EQ++ + ++     S+ IW  PF   + +S    ++F KH S  N +G+LFE D  DFK+
Sbjct  270   EQVQRMSQQHGHGGSEGIWPLPFHGGELTSKDSFNLFKKHPSQENKFGRLFEADFKDFKQ  329

Query  982   LG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP  1155
             L   D+ V+FANITRG M GP FN+RATK++ V+DG+G  +MACP          + + P
Sbjct  330   LQEFDLLVSFANITRGAMEGPFFNSRATKISVVLDGEGHFEMACPH--------RQKSSP  381

Query  1156  TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNM  1335
             TY+ +   LR G +FV P G+P  +IAS+++NLQ++CF++NA +N    L GKNN+ S  
Sbjct  382   TYQKMRGDLRRGAVFVAPAGHPVTTIASRNNNLQLLCFEVNARDNIMFPLVGKNNVVSQF  441

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQ  1443
             D  AKE+SF V +  V+ +F N  D ELF +GP  Q
Sbjct  442   DRQAKELSFDVPASEVESIFNNQKD-ELFFEGPNEQ  476



>emb|CBI28722.3| unnamed protein product [Vitis vinifera]
Length=1361

 Score =   326 bits (835),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 188/477 (39%), Positives = 281/477 (59%), Gaps = 44/477 (9%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREAC---------------------LDKCERYI------  219
             DPEL+ C+HQCRVQ     +Q   C                     L +C +        
Sbjct  89    DPELQQCKHQCRVQQQVSERQSGECEHKCEDYYREHHGPVVDPEKQLQQCRKQCELLQPG  148

Query  220   -qekegrqeergggssgrreeegrggeDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERS  396
              Q ++  QE +      + EE G   E++NPYVF+ +HF    R+ QG   +L  F  RS
Sbjct  149   RQREQCHQECQEKYDQQQLEEGGEEEEENNPYVFRDQHFAFL-RTNQGEVKILEMFDRRS  207

Query  397   NQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSI  576
                 G++N+RF  LE   +TFV P H DA+++G V  G+GT+ ++ + K+ S+ IR+G I
Sbjct  208   RLLRGLKNYRFICLEANPQTFVVPTHYDAEIVGFVCSGQGTITMVCQGKRISFRIRIGDI  267

Query  577   VFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFFFG-TGRN--SFLRAFKSSILEA  747
             V IPAG T +L+N+  N KL I   +  +  PGRFE F G  G N  SF RAF   +L +
Sbjct  268   VRIPAGITLHLINSHKNQKLRIAYFLLPVGIPGRFEPFHGAAGENPQSFYRAFSPKLLSS  327

Query  748   AYDESKETIQRVLRGRDDSPFIQVSDEQLKSL----RKESDTIWPFKTDKSSSSKPV--D  909
             A+   + T++RV + +    FI+ S EQ+++L      E+  IWPF + +  S +PV   
Sbjct  328   AFKVEEGTLERVFQQQTKGHFIKASGEQIQALSGGQHGEAAGIWPFTSGE--SKRPVFNL  385

Query  910   IFKHKSVSNNYGQLFEVDNDDFKELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDG  1083
             + K  SV NNYG+L E D +DF++L   DIE+++ANIT+ GM+GP FN+R+T +A V++G
Sbjct  386   LNKDPSVCNNYGRLHEADAEDFRQLKDMDIEISYANITQEGMMGPFFNSRSTMVAAVLEG  445

Query  1084  KGWAQMACPQVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIV  1263
             +G+ +M CP +S + ++ ++GA P Y+ V++ LR GTLFV+P G+P   +A    NL+IV
Sbjct  446   EGYLEMVCPHLSGEKQQ-QQGASPIYQKVSSSLRRGTLFVVPAGHPIAIVAGTSWNLEIV  504

Query  1264  CFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             CF INA+NN R  LAGK N+ + ++  AKE++F + ++ VDKVF    + ELF  GP
Sbjct  505   CFGINAENNRREPLAGKGNVVNGLEKEAKELAFALPAREVDKVFRKQKE-ELFFPGP  560



>gb|KHG24948.1| Vicilin-like antimicrobial peptides 2-1 [Gossypium arboreum]
Length=542

 Score =   309 bits (791),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 169/458 (37%), Positives = 276/458 (60%), Gaps = 21/458 (5%)
 Frame = +1

Query  130   LETCRHQCRVQMAFDRQQREACLDKCE-RYIqekegrqeergggssgrreeegrggeDDN  306
             L  CR +C        + R+ CL +C+ ++ ++   R EE G   S    E+    E  N
Sbjct  88    LSECRSRC---AGLAGEVRQLCLFRCQQKWRRDYASRWEEEGKKQSKEDAEDEGEEEKHN  144

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF+ +HF TA ++ +GR  +L +FT  S+   GIEN+R  +L    K+FV PNH DA+
Sbjct  145   PYVFEDKHFSTAIKTGKGRVDLLTKFTHNSDILRGIENYRLALLVASPKSFVVPNHFDAN  204

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              I +V +G GTL +I ++K++S++I  G I+++ AG   YL+N D++ KL I+KL+Q I+
Sbjct  205   AIFVVTQGRGTLTLIHEDKRESFNIETGDIIYVRAGTPLYLINRDDDEKLFIVKLLQPIN  264

Query  667   TPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLK  837
              P  +E F+G G     SF   F + ILEAA   S++ +++    +   PF++ S EQ++
Sbjct  265   QPDHYEVFYGAGGAKPESFYETFSTEILEAALKTSRDKLEKFFDKQGKGPFLEASKEQIE  324

Query  838   SLRKESD-----TIWPFKTDKSSSSKPVDIFKHK--SVSNNYGQLFEVDNDDFKELG--D  990
             ++    +      +WPF ++ S S    ++F+ +  S  N YGQLFEV+ D+FK L   D
Sbjct  325   AMSSHEEGSKGGGLWPFGSE-SKSESAFNLFRKRQPSHCNRYGQLFEVEEDEFKRLKDFD  383

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV---SSQTERSEEGAIPTY  1161
             + V++ NIT+G M  P +N+RA K+A VV G+G+ +M  P V   SSQ + +   +   Y
Sbjct  384   LRVSYVNITKGCMSAPFYNSRAIKIAIVVKGEGYFEMVSPPVSPKSSQEDSAGRKSGSRY  443

Query  1162  ETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDD  1341
             + ++++LR  T+FV+P G+P+V++AS+++NL+I+CF++N +NN R  LAG+ N     + 
Sbjct  444   QKISSRLRSDTVFVVPAGHPFVTVASRNNNLEILCFEVNIENNVRYLLAGEGNYVQQFEK  503

Query  1342  VAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
              AKE++F    + VD++F N D+ E F  GP  Q+  +
Sbjct  504   EAKELAFKSKEEEVDRIFGNQDE-EFFFPGPRQQRGRN  540



>gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occidentale]
Length=538

 Score =   306 bits (785),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 179/459 (39%), Positives = 275/459 (60%), Gaps = 23/459 (5%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKC-ERYIqekegrqeergggssgrreeegrgge  297
             +  L  C  QC  Q     QQ++ C  +C ERY  +KE  Q           +E+    E
Sbjct  93    EKHLSQCMRQCERQEG--GQQKQLCRFRCQERY--KKERGQHNYKREDDEDEDEDEAEEE  148

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             D+NPYVF+   F T  +++QG+  +LP+FT++S     +E +R  +L    + FV P+H+
Sbjct  149   DENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHM  208

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I  V+ G GT+  I +NK++S ++R G IV I +G   Y+ N D N KL +++ ++
Sbjct  209   DADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLR  268

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++ PG FE F G G     SF RAF   ILEAA   SK+T++++   +D    ++ S E
Sbjct  269   PVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIMKASKE  328

Query  829   QLKSL--RKESDTIWPFKTDKSSSSKPVDIFKH-KSVSNNYGQLFEVDNDDFKELG--DI  993
             Q++++  R E   IWPF  + + S K   +FK   S SN YGQLFE +  D+  L   D+
Sbjct  329   QIRAMSRRGEGPKIWPFTEESTGSFK---LFKKDPSQSNKYGQLFEAERIDYPPLEKLDM  385

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVN  1173
              V++ANIT+GGM  P +N+RATK+A VV G+G  ++ACP +SS           +Y+ + 
Sbjct  386   VVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHP-----SYKKLR  440

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             A++R  T+F++P G+P+ ++AS ++NL+IVCF++NA+ N R  LAGK N+   M+  AKE
Sbjct  441   ARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKE  500

Query  1354  VSFGVSSKLVDKVFENDDDLELFSKGPEW-QQSEDRADQ  1467
             ++F +  + VDKVF   D+ E F +GPEW ++ E RAD+
Sbjct  501   LAFKMEGEEVDKVFGKQDE-EFFFQGPEWRKEKEGRADE  538



>gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occidentale]
Length=536

 Score =   306 bits (784),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 179/459 (39%), Positives = 275/459 (60%), Gaps = 23/459 (5%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKC-ERYIqekegrqeergggssgrreeegrgge  297
             +  L  C  QC  Q     QQ++ C  +C ERY  +KE  Q           +E+    E
Sbjct  91    EKHLSQCMRQCERQEG--GQQKQLCRFRCQERY--KKERGQHNYKREDDEDEDEDEAEEE  146

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             D+NPYVF+   F T  +++QG+  +LP+FT++S     +E +R  +L    + FV P+H+
Sbjct  147   DENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSHM  206

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I  V+ G GT+  I +NK++S ++R G IV I +G   Y+ N D N KL +++ ++
Sbjct  207   DADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLR  266

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++ PG FE F G G     SF RAF   ILEAA   SK+T++++   +D    ++ S E
Sbjct  267   PVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIMKASKE  326

Query  829   QLKSL--RKESDTIWPFKTDKSSSSKPVDIFKH-KSVSNNYGQLFEVDNDDFKELG--DI  993
             Q++++  R E   IWPF  + + S K   +FK   S SN YGQLFE +  D+  L   D+
Sbjct  327   QVRAMSRRGEGPKIWPFTEESTGSFK---LFKKDPSQSNKYGQLFEAERIDYPPLEKLDM  383

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVN  1173
              V++ANIT+GGM  P +N+RATK+A VV G+G  ++ACP +SS           +Y+ + 
Sbjct  384   VVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSSSKSSHP-----SYKKLR  438

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             A++R  T+F++P G+P+ ++AS ++NL+IVCF++NA+ N R  LAGK N+   M+  AKE
Sbjct  439   ARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIRYTLAGKKNIIKVMEKEAKE  498

Query  1354  VSFGVSSKLVDKVFENDDDLELFSKGPEW-QQSEDRADQ  1467
             ++F +  + VDKVF   D+ E F +GPEW ++ E RAD+
Sbjct  499   LAFKMEGEEVDKVFGKQDE-EFFFQGPEWRKEKEGRADE  536



>ref|XP_010256229.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nelumbo nucifera]
Length=542

 Score =   303 bits (775),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 163/416 (39%), Positives = 250/416 (60%), Gaps = 31/416 (7%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY+F  + F+T  ++++G   VL RF+ER     GIE++R  I++    TFV P H D
Sbjct  131   NNPYLFDEKSFKTRFQTEEGNIKVLERFSERLEFLRGIESYRLAIIKASPNTFVTPCHED  190

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD++  V  G G + +++ + ++S+ I+ G ++ IPAG   Y +N DN+ KL I KL+  
Sbjct  191   ADVVFFVTWGRGVITLVRNDNRESFKIQKGDVMMIPAGTVVYFINNDNHEKLFIAKLLLP  250

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ISTPG FE FFG G     SF RAF + +LEAA +  K+ ++R+L  +D    I+ SDEQ
Sbjct  251   ISTPGHFEAFFGPGGENPESFYRAFSTEVLEAALNVRKDKLKRLLGRQDKGVIIKASDEQ  310

Query  832   LKSLRKESDT----IWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG--D  990
             +KSL + + +     WPF  DK  +  P ++F K  S SNNYGQ +EV   +FK+L   D
Sbjct  311   IKSLSQHASSRGGQFWPF--DKRETKGPFNLFNKRPSQSNNYGQFYEVKPGEFKQLQGLD  368

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT--------------  1128
             I V+F NI+ G M GP +N+RATK+A V++G G+ +MACP  SS +              
Sbjct  369   IAVSFLNISSGAMSGPYYNSRATKVAVVIEGNGYYEMACPHSSSSSGGRHGGSEGGSSSR  428

Query  1129  --ERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVA  1302
                  ++G +  Y  ++  L P ++F++P G+P V++AS   NLQIVCF+I  + NE+  
Sbjct  429   FHHHQDQGGV-RYRKMSGFLAPESVFLVPAGHPVVTVASSGQNLQIVCFEIKGEKNEKYM  487

Query  1303  LAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQS-EDRADQ  1467
             +AG+NN+   ++  AKE+S+ + +K VD++     +  LF  GPE +Q    RAD+
Sbjct  488   VAGENNIIKYLEKEAKELSYNIPAKEVDEILSKQSE-SLFFPGPERRQEWGGRADE  542



>gb|AAF05723.1|AF191299_1 sucrose binding protein homolog S-64 [Glycine max]
Length=489

 Score =   300 bits (768),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 161/440 (37%), Positives = 267/440 (61%), Gaps = 12/440 (3%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL TC+HQC+ Q  +    +  CL +C+   QE+E + EE         +E+    +D
Sbjct  36    DPELVTCKHQCQQQRQYTESDKRTCLQQCDSMKQEREKQVEEETREKEEEHQEQHEEEQD  95

Query  301   DNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
              NPYVF+  + F T   ++ G   VL +FTE+S   +G ENFR  ILE  + TFV+P H 
Sbjct  96    QNPYVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGNENFRLAILEARAHTFVSPRHF  155

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             D++++    +G   L ++++++ +   +  G ++ IPAG   Y+VN D N KL++  L  
Sbjct  156   DSEVVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKLLLAMLHI  215

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              +STPG+FE FFG G     S L AF  ++L+AA    K  ++R+   +++    ++S E
Sbjct  216   PVSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLERLFNQQNEGSIFKISRE  275

Query  829   QLKSLR-KESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFK---ELGDI  993
             ++++L   +  + WPF  +   S    +IF K  + SN YG+L EV  DD K   +  ++
Sbjct  276   RVRALAPTKKSSWWPFGGE---SKAQFNIFSKRPTFSNGYGRLTEVGPDDEKSWLQRLNL  332

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVN  1173
              + F NIT+  M    +N+ ATK+A V+DG+G  Q++CP +SS+++   + + P+Y  ++
Sbjct  333   MLTFTNITQRSMSTIHYNSHATKIALVMDGRGHLQISCPHMSSRSDSKHDKSSPSYHRIS  392

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             A L+PG +FV+PPG+P+V+IAS  +NL I+CF++N  +N++   AGK+N+ S++D+VAKE
Sbjct  393   ADLKPGMVFVVPPGHPFVTIASNKENLLIICFEVNVRDNKKFTFAGKDNIVSSLDNVAKE  452

Query  1354  VSFGVSSKLVDKVFENDDDL  1413
             ++F   S++V+ VFE  + L
Sbjct  453   LAFNYPSEMVNGVFERKESL  472



>emb|CAA41809.1| vicilin-like embryo storage protein [Zea mays]
Length=582

 Score =   301 bits (771),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 170/412 (41%), Positives = 239/412 (58%), Gaps = 33/412 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             D  PYVF  R FR   RS+QG   VL  F E S    GI ++R  +LE   ++FV P+H 
Sbjct  97    DRRPYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHT  156

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA  I  VAEGEG +  I+  +++SY I+ G +   PAGA +YL NTD   KLVI K++ 
Sbjct  157   DAHCICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVITKILH  216

Query  658   TISTPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVL--RGRDDSPFIQVS  822
             TIS PG F+FFFG  GRN  SFL +F  SI  AAY  S + ++R+    G+D    ++ +
Sbjct  217   TISVPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGRHGQDKGIIVRAT  276

Query  823   DEQLKSLRKESD-----TIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELG  987
             +EQ + LR+ +        WP      S      + +  S++N +GQL+E D   F +L 
Sbjct  277   EEQTRELRRHASEGGHGPHWPLPPFGESRGPYSLLDQRPSIANQHGQLYEADARSFHDLA  336

Query  988   --DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE------  1143
               D+ V+FANIT G M  PLFNTR+ K+A+V +GKG+A++ CP   SQ   SE       
Sbjct  337   EHDVSVSFANITAGSMSAPLFNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESERERDKGR  396

Query  1144  --------------GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINA  1281
                            A   Y T+ A+L PGT FV+P G+P+V++AS+D NLQIVCF+++A
Sbjct  397   RSEEEEEESSEEQEEAGQGYHTIRARLSPGTAFVVPAGHPFVAVASRDSNLQIVCFEVHA  456

Query  1282  DNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
             D NE+V LAG +N+   +D VAK +SF   ++ VD+V  +  + + F  GPE
Sbjct  457   DRNEKVFLAGADNVLQKLDRVAKALSFASKAEEVDEVLGSRRE-KGFLPGPE  507



>ref|NP_001237244.1| sucrose-binding protein 2 precursor [Glycine max]
 gb|AAO48716.1| sucrose-binding protein 2 [Glycine max]
Length=489

 Score =   297 bits (761),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 162/440 (37%), Positives = 268/440 (61%), Gaps = 12/440 (3%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL TC+HQC+ Q  +    +  CL +C+   QE+E + EE         +E+    ED
Sbjct  36    DPELVTCKHQCQQQRQYTESDKRTCLQQCDSMKQEREKQVEEETREKEEEHQEQHEEEED  95

Query  301   DNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             +NPYVF+  + F T   ++ G   VL +FTE+S   +GIENFR  ILE  + TFV+P H 
Sbjct  96    ENPYVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHF  155

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             D++++    +G   L ++++++ +   +  G ++ IPAG   Y+VN D N KL++  L  
Sbjct  156   DSEVVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKLLLAMLHI  215

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              +STPG+FE FFG G     S L AF  ++L+AA    K  ++R+   +++    ++S E
Sbjct  216   PVSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLERLFNQQNEGSIFKISRE  275

Query  829   QLKSLR-KESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFK---ELGDI  993
             ++++L   +  + WPF  +   S    +IF K  + SN YG+L EV  DD K   +  ++
Sbjct  276   RVRALAPTKKSSWWPFGGE---SKAQFNIFSKRPTFSNGYGRLTEVGPDDEKSWLQRLNL  332

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVN  1173
              + F NIT+  M    +N+ ATK+A V+DG+G  Q++CP +SS+++   + + P+Y  ++
Sbjct  333   MLTFTNITQRSMSTIHYNSHATKIALVMDGRGHLQISCPHMSSRSDSKHDKSSPSYHRIS  392

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             A L+PG +FV+PPG+P+V+IAS  +NL I+CF++N  +N++   AGK+N+ S++D+VAKE
Sbjct  393   ADLKPGMVFVVPPGHPFVTIASNKENLLIICFEVNVRDNKKFTFAGKDNIVSSLDNVAKE  452

Query  1354  VSFGVSSKLVDKVFENDDDL  1413
             ++F   S++V+ V E  + L
Sbjct  453   LAFNYPSEMVNGVSERKESL  472



>gb|ACN34339.1| unknown [Zea mays]
 tpg|DAA50577.1| TPA: LOW QUALITY PROTEIN: globulin1 [Zea mays]
Length=572

 Score =   300 bits (767),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 166/398 (42%), Positives = 232/398 (58%), Gaps = 32/398 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             D  PYVF  R FR   RS+QG   VL  F E S    GI ++R  +LE   ++FV P+H 
Sbjct  97    DRRPYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHT  156

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA  I  VAEGEG +  I+  +++SY I+ G +   PAGA +YL NTD   KLVI K++ 
Sbjct  157   DAHCICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVIAKILH  216

Query  658   TISTPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVL--RGRDDSPFIQVS  822
             TIS PG F+FFFG  GRN  SFL +F  SI  AAY  S + ++R+    G+D    ++ +
Sbjct  217   TISVPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGRHGQDKGIIVRAT  276

Query  823   DEQLKSLRKESD-----TIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELG  987
             +EQ + LR+ +        WP      S      + +  S++N +GQL+E D   F +L 
Sbjct  277   EEQTRELRRHASEGGHGPHWPLPPFGESRGPYSLLDQRPSIANQHGQLYEADARSFHDLA  336

Query  988   --DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE------  1143
               D+ V+FANIT G M  PLFNTR+ K+A+V +GKG+A++ CP   SQ   SE       
Sbjct  337   EHDVSVSFANITAGSMSAPLFNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESERERDKGR  396

Query  1144  --------------GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINA  1281
                            A   Y T+ A+L PGT FV+P G+P+V++AS+D NLQIVCF+++A
Sbjct  397   RSEEEEEESSEEQEEAGQGYHTIRARLSPGTAFVVPAGHPFVAVASRDSNLQIVCFEVHA  456

Query  1282  DNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVF  1395
             D NE+V LAG +N+   +D VAK +SF   ++ VD+V 
Sbjct  457   DRNEKVFLAGADNVLQKLDRVAKALSFASKAEEVDEVL  494



>ref|XP_003632318.2| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Vitis vinifera]
Length=843

 Score =   306 bits (785),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/396 (39%), Positives = 253/396 (64%), Gaps = 20/396 (5%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPYVFQ +H+  +  + +GR  +L RF +RS    G++N+RF  LE   +TFV P HLDA
Sbjct  161   NPYVFQDQHYTASLETNEGRIKILQRFHQRSRLLRGLKNYRFVYLEANPQTFVLPAHLDA  220

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + +  VA G GTL ++ + K++S++I+ G IV I AG T Y++N D N KL I KL+Q +
Sbjct  221   EAVVYVASGRGTLSLVSQGKRESFNIKQGDIVRIRAGTTIYMINRDKNKKLRIAKLLQPV  280

Query  664   STPGRFEFFFG-TGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             + P  F+ F+G  G N  SF RAF   +L +A    ++ +QRV++ ++    ++ S++Q+
Sbjct  281   ALPDEFQPFYGPAGENPQSFYRAFSEELLSSALKVEQDRVQRVIKQQNKGVIVKASEQQI  340

Query  835   KSL-RKESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGDIEVA--  1002
             ++L ++E   ++PF    + S +  ++  K  S+SN YG+L E D ++F++L D+++A  
Sbjct  341   QALSQREESGMFPFPFGSTESKRVFNLLSKEPSISNRYGRLHEADANEFQQLQDMDIAVS  400

Query  1003  FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS------------SQTERSEEG  1146
             ++NIT+G M GP FNTRATK+A VV G+G+ +MACP VS             + E+ ++ 
Sbjct  401   YSNITKGSMEGPFFNTRATKIAVVVKGEGYMEMACPHVSQQQQGQGQSTGEQRREQQQQS  460

Query  1147  AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLY  1326
             A P Y+ +++ L+ G LFV+P G+P + +A  + NL+IVCFD+NA+NN R +LAG  N+ 
Sbjct  461   ASPHYQRLSSPLKRGMLFVVPAGHPLIVVAGNNRNLEIVCFDVNAENNRRESLAGDKNIV  520

Query  1327  SNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             + ++  AKE++F + ++ VD+VF   ++   F  GP
Sbjct  521   NALEKEAKELAFSIPAREVDEVFAKQNEWWFFP-GP  555


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 75/162 (46%), Gaps = 29/162 (18%)
 Frame = +1

Query  121  DPELETCRHQCRVQMAFDRQQREAC---------------------LDKCERYI------  219
            DPEL+ C+HQCRVQ     +Q   C                     L +C +        
Sbjct  648  DPELQQCKHQCRVQQQVSERQSGECEHKCEDYYREHHGPVVDPEKQLQQCRKQCELLQPG  707

Query  220  -qekegrqeergggssgrreeegrggeDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERS  396
             Q ++  QE +      + EE G   E++NPYVF+ +HF    R+ QG   +L  F  RS
Sbjct  708  RQREQCHQECQEKYDQQQLEEGGEEEEENNPYVFRDQHFAFL-RTNQGEVKILEMFDRRS  766

Query  397  NQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEGEGTL  522
                G++N+RF  LE   +TFV P H DA+++G V  G   L
Sbjct  767  RLLRGLKNYRFICLEANPQTFVVPTHYDAEIVGFVCSGTSPL  808



>ref|NP_001105887.1| globulin-1 S allele precursor [Zea mays]
 sp|P15590.2|GLB1_MAIZE RecName: Full=Globulin-1 S allele; Short=GLB1-S; AltName: Full=7S-like; 
Flags: Precursor [Zea mays]
 gb|AAA33467.1| globulin precursor [Zea mays]
Length=573

 Score =   298 bits (764),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 164/394 (42%), Positives = 231/394 (59%), Gaps = 31/394 (8%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF  R FR   RS+QG   VL  F E S    GI ++R  +LE   ++FV P+H DA 
Sbjct  103   PYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHTDAH  162

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              IG VAEGEG +  I+  +++SY I+ G +   PAGA +YL NTD   KLVI K++ TIS
Sbjct  163   CIGYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVITKILHTIS  222

Query  667   TPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVL--RGRDDSPFIQVSDEQ  831
              PG F+FFFG  GRN  SFL +F  SI  AAY  S + ++R+    G+D    ++ ++EQ
Sbjct  223   VPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGRHGQDKGIIVRATEEQ  282

Query  832   LKSLRKESD-----TIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELG--D  990
              + LR+ +        WP      S      + +  S++N +GQL+E D   F +L   D
Sbjct  283   TRELRRHASEGGHGPHWPLPPFGESRGPYSLLDQRPSIANQHGQLYEADARSFHDLAEHD  342

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE---------  1143
             + V+FANIT G M  PL+NTR+ K+A+V +GKG+A++ CP   SQ   SE          
Sbjct  343   VSVSFANITAGSMSAPLYNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESERERGKGRRSE  402

Query  1144  ----------GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNE  1293
                            Y T+ A+L PGT FV+P G+P+V++AS+D NLQIVCF+++AD NE
Sbjct  403   EEEESSEEQEEVGQGYHTIRARLSPGTAFVVPAGHPFVAVASRDSNLQIVCFEVHADRNE  462

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVF  1395
             +V LAG +N+   +D VAK +SF   ++ VD+V 
Sbjct  463   KVFLAGADNVLQKLDRVAKALSFASKAEEVDEVL  496



>gb|EYU41459.1| hypothetical protein MIMGU_mgv1a003361mg [Erythranthe guttata]
Length=590

 Score =   296 bits (758),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/394 (38%), Positives = 248/394 (63%), Gaps = 18/394 (5%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F  + F + +R++QG   +L RF++ S+  +GIEN+R  ILE    TFV P+H DA
Sbjct  179   NPYFFDSQRFDSKYRTEQGHIKILERFSKNSDLLQGIENYRLAILEANPNTFVLPHHCDA  238

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + + LV  G GT+  + + ++KSY+++ G ++++PAG+  YL N D+N +L I+KL+Q +
Sbjct  239   ESVFLVVGGRGTISYVWEKQRKSYNLKSGGVLWVPAGSIVYLTNNDDNERLYILKLLQPV  298

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             +TPG+F+ +FG G     SF  +F + ILEAA++   E +QR+   +     I+ S EQ+
Sbjct  299   NTPGKFKEYFGVGGENPESFYSSFSNEILEAAFNTQSEKLQRLFGQQSKGVIIKASKEQI  358

Query  835   KSLRKESDTIWPFKTDKSSSS-KPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA--  1002
             ++L +ES++    + +K SSS  P+D+   + V SN +GQ FE   + +++L D++V+  
Sbjct  359   RALSQESESSPRGRREKESSSWGPIDLLNERPVFSNEFGQYFEASPNHYQQLRDLDVSVL  418

Query  1003  FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS-------SQTERSEEGAIPT-  1158
               NIT+G M+ P +N+++T+L FVV G G+ +MACP ++       SQ  +  +G I T 
Sbjct  419   LVNITKGAMVAPYYNSKSTRLVFVVGGSGYFEMACPHLANAKGKHGSQGRKERQGEIITD  478

Query  1159  --YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSN  1332
               Y+ V+A+L  G  FV+P G+P   +ASQD NLQ+  F I A +N++  LAG+ N+++ 
Sbjct  479   VHYQKVSARLSVGDAFVVPAGHPIAIVASQDSNLQLAGFGIKASHNQKYFLAGQENIWNE  538

Query  1333  MDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             +   AKE++F V ++ V+++F + +    F  GP
Sbjct  539   VQSEAKELAFRVPAREVEEIFRSQEQ-SYFMPGP  571



>ref|XP_009417381.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=437

 Score =   290 bits (742),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/400 (38%), Positives = 245/400 (61%), Gaps = 15/400 (4%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F  R +    RS+ GRF VL RF+ RS    GIEN+R  I+E E +TF+ P+H DA
Sbjct  29    NPYYFGERSYEHWSRSEHGRFKVLERFSRRSELLIGIENYRLAIMEAEPETFIMPSHWDA  88

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + +  V EG GT+ ++ +  ++S++I+ G I+ IPAG   Y +N   N +L I  L+  I
Sbjct  89    EEVFYVMEGRGTITLLHEENRESHEIKRGDIMRIPAGVIVYAINKAKNERLHIAMLLHPI  148

Query  664   STPGRFEFFFG-TGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             STPG FE FFG  G N  SF  +F + +LEAA++  ++ ++R+   +     I++++EQ+
Sbjct  149   STPGHFEEFFGAAGSNPESFYNSFSNGVLEAAFNTPRDRLERLFERQKKGEIIKITEEQI  208

Query  835   KSLRKESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG--DIEVAF  1005
             ++L +   T +      + S++P ++  K  S +N YG+L+E  + D+  L   D++V+ 
Sbjct  209   RALSQ--TTGFGGGRHSARSNEPYNLLQKRPSHANEYGELYEARSSDYHRLQDLDVDVSI  266

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP------TYET  1167
             ANI+   M+ P +N+RATKLA VV+G+G  +M CP+ S  + RSE+   P       Y T
Sbjct  267   ANISERSMMAPSYNSRATKLAMVVEGRGHFEMVCPRRSGDSRRSEDATEPEGQQRVRYRT  326

Query  1168  VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVA  1347
             V +++  G++FVIPPG+P  ++A+ ++NL+++CF I A  N +  LAGKNN+ + +D  A
Sbjct  327   VRSEVSRGSVFVIPPGHPVTAVAAANENLEVLCFGIRAGRNRKCYLAGKNNVMNLLDREA  386

Query  1348  KEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRADQ  1467
             K++SFG  ++ V +VF+   +  +F  GP  ++ E +  Q
Sbjct  387   KQLSFGAPAEEVQEVFDAQPE-SVFLPGPGRRRGEAKRRQ  425



>ref|XP_006650381.1| PREDICTED: globulin-1 S allele-like [Oryza brachyantha]
Length=549

 Score =   293 bits (749),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 161/420 (38%), Positives = 237/420 (56%), Gaps = 36/420 (9%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF  R FR    S QG   +LP F + S    GI+N+R  +LE   ++FV P+H DA 
Sbjct  108   PYVFGRRSFRQVVSSDQGSVRLLPPFHQASRLLRGIKNYRVAVLEANPRSFVVPSHTDAH  167

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  VA+GEG + +I+  +++SY IR G I   PAG  +YL NTD   KL++ K++ TIS
Sbjct  168   CVCYVAQGEGVVAMIENGERRSYAIRQGDIFVAPAGTINYLANTDGRRKLIVTKILHTIS  227

Query  667   TPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLK  837
              PG+ +FFFG  GRN  SFL +F   +  AA+  S E ++++L  +D    I+ S+EQ++
Sbjct  228   VPGKIQFFFGAGGRNPESFLSSFSKRVQRAAFKISDERLEKLLGKQDKGVIIRASEEQVR  287

Query  838   SLRKESD-----TIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--DI  993
              LR+ +      + WP      SS  P +I + +   +N +G+L+E D   F +L   DI
Sbjct  288   ELRRHASEGGHGSHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDI  347

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE-----------  1140
              VA  NIT G M  P +NTR+ K+A+V+DG+G A++ CP +S   E SE           
Sbjct  348   RVALVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGGEESEGRRGKGKWREE  407

Query  1141  -----------EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADN  1287
                        E     YET+  +L  G + V P G+P V  +S+D  LQIVCFD++A+N
Sbjct  408   EEEEGQQQEEEEQVGKGYETIRGRLSRGWVIVAPAGHPIVVSSSRDSTLQIVCFDVHAEN  467

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRADQ  1467
             NER+ LAG N++   +D  AKE++F  S++ VD++  N      F  GPE  +S  R +Q
Sbjct  468   NERMYLAGTNSVLKKLDAQAKELAFATSAREVDELL-NAQQESAFVAGPE--ESGRRGEQ  524



>ref|XP_011090693.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Sesamum indicum]
Length=626

 Score =   294 bits (753),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/399 (37%), Positives = 252/399 (63%), Gaps = 16/399 (4%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F+ + F + +R+++G   VL RF+++S   +G++N+R  +LE    TFV P+H DA
Sbjct  221   NPYFFESQRFDSKYRTEEGNVKVLERFSKKSELLQGVDNYRLAVLEANPNTFVLPHHFDA  280

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + + +VA G+GT+  + +N++KSY++++G ++ +PAG+  YLVN D+N KL ++KL+Q +
Sbjct  281   ESVLVVAGGKGTISYVWQNRRKSYNVKLGDVMRVPAGSIVYLVNRDDNEKLYVLKLLQPV  340

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             +TPGRF+ +FG G     SF R F + ILEAA++   + ++R+   +     I+ S EQ+
Sbjct  341   NTPGRFKEYFGVGGENPESFYRTFSNEILEAAFNVPSDRLKRLFGQQKKGVIIRASKEQI  400

Query  835   KSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA--F  1005
             ++L +ES+     +  +  S  P ++ + + + SN YGQ FE   +D+++L D++V+  F
Sbjct  401   RALSQESEE--SSRGRREESWGPFNLLEGRPLFSNRYGQYFEASPNDYQQLKDLDVSVGF  458

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT-----ERSEEGAIPTYETV  1170
              NI +GGM+ P +N+R+TKL  VV G G  +MACP  S+++     ER  E     Y+ V
Sbjct  459   MNINKGGMVAPYYNSRSTKLVLVVGGNGRFEMACPHRSARSKQGRKERQGETTDVRYQRV  518

Query  1171  NAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAK  1350
             +A+L  G  F++P G+P   IASQD NLQ+V F I    N++  LAG++N+++ ++  AK
Sbjct  519   SARLSIGDAFIVPAGHPIAMIASQDSNLQLVSFGIKGSYNQKYFLAGQDNIWNQVESEAK  578

Query  1351  EVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRADQ  1467
             E+SF + ++ V+++F   +    F  GP   Q E+R  +
Sbjct  579   ELSFKMPAREVEEIFRRQEQ-SYFLPGP--GQGEERGKE  614



>ref|XP_009417380.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=483

 Score =   290 bits (742),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 244/392 (62%), Gaps = 18/392 (5%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             + NPY F  R +    RS+ GRF VL RF  RS    G+EN+R  ++E E +TF+ P H 
Sbjct  74    ERNPYFFGDRSYEQWSRSEHGRFEVLERFARRSELLVGVENYRLAVMEAEPETFIMPRHW  133

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ +  V EG GT+ ++ +N ++++DI+ G I++IPAGA  Y +N   N KL +  L+ 
Sbjct  134   DAEEVFYVMEGRGTITLLHENNRETHDIKRGDIIWIPAGAIVYAINKARNEKLRVAILLH  193

Query  658   TISTPGRFEFFFG-TGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ISTPG  E F+G  GRN  +F  +F   +LEAA+D   E ++R+   +    FI++++E
Sbjct  194   PISTPGHVEEFYGAAGRNPETFFASFSDEVLEAAFDTPSEKLERLFEKQRRGEFIKMTEE  253

Query  829   QLKSLRKES-DTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--DIE  996
             Q+++L + + +  WP     + S++P ++ +++ S SN +GQL EV  +++++L   D++
Sbjct  254   QMRALSQSTGEGGWPL----ARSTEPYNLLQNRPSHSNEHGQLHEVGANEYQQLQDLDVD  309

Query  997   VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP------T  1158
             V+ ANI+   M+ P +N+ +TKLA VV G+G+ +MACP  S ++ RSEE           
Sbjct  310   VSIANISERSMMAPNYNSLSTKLAMVVQGRGYIEMACPSRSGESRRSEETTESEPQQRVL  369

Query  1159  YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMD  1338
             Y TV +++  G++FVIP G+P  ++A++++NL+++ F + A  N    LAG+NN+ + +D
Sbjct  370   YRTVRSRVSRGSVFVIPAGHPVAAVAARNENLEVLFFGVRAAQNRNYYLAGRNNVLNRLD  429

Query  1339  DVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
               AKE++FGV ++ VD+V     +  +F  GP
Sbjct  430   REAKELAFGVPAEEVDEVLHAQPE-SVFLPGP  460



>gb|AAS07324.1| putative globulin (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|ABF98039.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
Length=562

 Score =   289 bits (739),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 162/420 (39%), Positives = 234/420 (56%), Gaps = 44/420 (10%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF  R FR   RS QG   +LP F + S+   GI+N+R  +LE   ++FV P H DA 
Sbjct  105   PYVFGRRSFRQVVRSDQGSVRLLPPFHQASSLLRGIKNYRVAVLEANPRSFVMPTHTDAH  164

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              I  VA+GEG + II+  +K SY IR G +   PAG  +YL NTD   KL++ K++ TIS
Sbjct  165   CICYVAQGEGVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANTDGRRKLIVTKILHTIS  224

Query  667   TPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLK  837
              PG+ +FFF   GRN  SFL +F   +  AA+  S+E ++++L  +D    I+ S+EQ++
Sbjct  225   VPGQIQFFFAPGGRNPESFLSSFSKGVQRAAFKISEEKLEKLLGKQDKGVIIRASEEQVR  284

Query  838   SLRKESD-----TIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQLFEVDNDDFKELG--DI  993
              LR+ +        WP      SS  P +I + +   +N +G+L+E D   F +L   DI
Sbjct  285   ELRRHASEGGHGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDI  344

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-------------------  1116
              VA  NIT G M  P +NTR+ K+A+V+DG+G A++ CP +                   
Sbjct  345   RVAVVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGGRGGESEERRRERGKG  404

Query  1117  -------------SSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQ  1257
                            Q E  EE     YET+ A+L  GT+FV+P G+P V  +S+D  LQ
Sbjct  405   KWREEEEEEEEQQKGQEEEEEEQVGQGYETIRARLSRGTVFVVPSGHPIVVTSSRDSTLQ  464

Query  1258  IVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
             IVCFD++A+NNER+ LAG N++   +D  AKE++F  S++ VD++  N      F  GPE
Sbjct  465   IVCFDVHANNNERMYLAGMNSVLKKLDPQAKELAFAASAREVDELL-NAQQESAFLAGPE  523



>ref|XP_006383667.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 ref|XP_002306784.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
Length=544

 Score =   287 bits (734),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/407 (38%), Positives = 243/407 (60%), Gaps = 27/407 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPYVF+ RH ++   ++ GR  VL +FT++S    G+EN R  I+E   +TF+AP HLDA
Sbjct  142   NPYVFEDRHLKSEVETEHGRVRVLQKFTKKSKLLRGLENIRVAIIEANPQTFIAPTHLDA  201

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
               +  VA+G G + +I +  K+++++  G +  +PAG T Y+VN D N KL + K++  +
Sbjct  202   GFVLFVAKGRGAITLIHEEDKQTFNLERGDVFGVPAGTTFYMVNKDENEKLRVAKILWPV  261

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             + PG F+ F G G     SF RAF   +LEAA    +  ++R+ + +     ++ S EQ+
Sbjct  262   NLPGNFKAFHGAGGEDAESFFRAFSWELLEAALKVRR--LERIFK-QQQGGIVKASKEQI  318

Query  835   KSL------RKESDTIWPFKTDKSSSSKPVDIFKHKSVS-NNYGQLFEVDNDDFKELGDI  993
             ++L            +WPF T    SS P +IF    V  NNYGQLFE    D ++L D+
Sbjct  319   QALGHGEEGGHGGGGLWPFPT--GGSSGPFNIFDKDPVKRNNYGQLFEAKPKDSEQLRDL  376

Query  994   E--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS--------QTERSEE  1143
             +  V+ ANITRG M GP +N++AT ++ V++G+G+ +MACP+ SS        ++E S  
Sbjct  377   DLIVSLANITRGSMAGPYYNSKATMISIVLEGEGYFEMACPRDSSSGSSMGYIESEGSRR  436

Query  1144  G-AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
             G    TY+  +++L   ++F++P G+P  ++AS++ NL+++CF++ A  N R  LAGK N
Sbjct  437   GKGGQTYQKTSSRLSRNSVFIVPAGHPVATVASENSNLEVLCFEVYAKGNVRYPLAGKWN  496

Query  1321  LYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             +   MD  AKE+++GV +K VD++F    + E F  GP  Q+ E RA
Sbjct  497   VIGEMDREAKELAYGVPAKEVDQIFGKQQE-EFFFPGPRRQRREGRA  542



>ref|XP_010256228.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nelumbo nucifera]
Length=523

 Score =   286 bits (732),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 246/390 (63%), Gaps = 13/390 (3%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F  + F +  +S++G   +L RF+ RS+   G++N+R  IL+VE  TF+ P+H DA
Sbjct  108   NPYFFDEQRFSSRFKSEKGHLKILERFSTRSDLLSGLDNYRLAILKVEPNTFLIPHHWDA  167

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D + +V +G+ T++++  + ++SY++  G +  IPAG   YL+N D+N  L I+ L +TI
Sbjct  168   DAVVVVVKGKATINLVHNDNRESYNLECGDVARIPAGTMVYLMNRDDNENLQIVTLFRTI  227

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             STPG    FF        SF  AF + ILEAA +  K+ ++R+L  +      + S EQ+
Sbjct  228   STPGYVSEFFSASSEDGESFYTAFSNEILEAALNTPKDKLKRMLEEKRKGVMREASKEQI  287

Query  835   KSLRKE----SDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEV  999
             K++ ++    S+    +   KS +  P ++FK + + SN+YGQ++E   +D+++L D++V
Sbjct  288   KAMSEQASSSSEGGRRWSIHKSETRGPFNLFKKRPIYSNSYGQIYEAQPNDYQQLKDLDV  347

Query  1000  A--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP--TYET  1167
             +  F+NI++G ML PL+NTR+T++AFVV G GW +MACP +SSQ++R  EG      YE 
Sbjct  348   SVIFSNISQGAMLAPLYNTRSTRIAFVVKGNGWWEMACPHISSQSQRGREGEGDGVQYEK  407

Query  1168  VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLYSNMDDV  1344
              ++ + P T F+IP G+ +  +AS+ +NLQI+ F INA +N+R  +AGK +N+   MD  
Sbjct  408   ASSPVSPNTGFIIPLGHVFTVVASEKENLQIIVFGINAQDNKRNFVAGKEHNVMKQMDKE  467

Query  1345  AKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             AKE++F +S + VD++  N+ +   F  GP
Sbjct  468   AKELAFDMSEEEVDEILLNNQEESFFVPGP  497



>ref|XP_002464118.1| hypothetical protein SORBIDRAFT_01g012640 [Sorghum bicolor]
 gb|EER91116.1| hypothetical protein SORBIDRAFT_01g012640 [Sorghum bicolor]
Length=615

 Score =   288 bits (738),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 230/396 (58%), Gaps = 33/396 (8%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF  R FR   RS+QG    L  F E S    GI N+R  +LE   ++FV P+H DA 
Sbjct  129   PYVFDRRSFRRVVRSEQGSVRALRPFHEASKLLRGIRNYRVAVLEANPRSFVVPSHTDAH  188

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              IG V +GEG +  I+  +++SY I+ G I   PAGA +YL NTD   KLVI K++ TIS
Sbjct  189   CIGYVVQGEGVVTTIENGERRSYTIKEGHIFVAPAGAITYLANTDGRKKLVIAKILHTIS  248

Query  667   TPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVL--RGRDDSPFIQVSDEQ  831
              PG F+FFFG  GRN  SFL +F  SI  AAY  S + ++R+   RG+D    ++ ++EQ
Sbjct  249   VPGEFQFFFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFGKRGQDKGVIVRATEEQ  308

Query  832   LKSLRKESDT------IWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELG--  987
             ++ LR ++ +       WP      S      + +  S+ N +GQL+E D   F++L   
Sbjct  309   IRELRHQASSEGGHGPHWPLPPFGESHGPYSLLDQRPSIGNQHGQLYEADARSFRDLADH  368

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEG-------  1146
             D+ V+FANIT G M  PLFNTRA K+A+V  G+G A++ CP    Q++    G       
Sbjct  369   DVSVSFANITAGSMSAPLFNTRAFKIAYVARGQGNAEIVCPHQQQQSQSQRGGKGRRRSE  428

Query  1147  -------------AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADN  1287
                          A   Y T+ A+L  GT+FV+P G+P+V++A++D NL+IVCF++ A+ 
Sbjct  429   EEEEEGGSSEEEEAGQGYRTIRARLSQGTVFVVPVGHPFVAVAARDSNLEIVCFELRAEK  488

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVF  1395
             NE+V LAG +N+   +D VAK +SF   ++ VD+V 
Sbjct  489   NEKVFLAGADNVLKKLDRVAKALSFAAKAEEVDEVL  524



>ref|XP_003590610.1| Vicilin-like antimicrobial peptides 2-2 [Medicago truncatula]
 gb|AES60861.1| sucrose-binding protein-like protein [Medicago truncatula]
Length=494

 Score =   284 bits (727),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 168/465 (36%), Positives = 269/465 (58%), Gaps = 20/465 (4%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgge-  297
             DPEL+TC HQC+ Q  +D + +  C+DKCE Y + K+ R++ +         +  R  E 
Sbjct  34    DPELKTCIHQCKQQRQYDEEDKGICMDKCEDYHRMKQEREKRQHQHQREHEHQHEREHEH  93

Query  298   --DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPN  471
               D+NPYVF+ R F T   +  GR   L  F ++S      EN+   ILE +   FV+P+
Sbjct  94    EEDENPYVFEDRDFETKIDTDDGRVMALNMFDQKSKLLRNFENYGLTILEAKGHAFVSPH  153

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H D+++I    +G G + ++ ++K + +++  G I+ +PAG   YLVN D N KL +  L
Sbjct  154   HFDSEVIFFNVKGRGIIGLVMEDKTERFNLEAGDIMRVPAGTPMYLVNRDENEKLFVAAL  213

Query  652   IQ---TISTPGRFEFFFG-TGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFI  813
                  + S P   E FFG  GR+  S L AF S +L+AA+   K  ++  L  ++     
Sbjct  214   HMPPSSASAPVNLEAFFGPAGRDPESVLTAFSSKVLQAAFKSPKGKLESFLDEQNKGRIF  273

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELGD  990
             ++  E L  L  +  +IWPF         P +IF +  + SN +G LFEV   +     D
Sbjct  274   KIQKEDLSGLAPKK-SIWPFG---GQFKNPFNIFSNNPAFSNQFGSLFEVGPSEITSGLD  329

Query  991   ---IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAI--P  1155
                + + FANIT+G M    +NT A K+A V+DG+G  +MACP +SS +  S++      
Sbjct  330   GLNLMLTFANITKGSMSTIYYNTNANKIALVIDGEGEFEMACPHMSSSSSHSKQRRSSST  389

Query  1156  TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNM  1335
             +Y+ +NA+LRPGT+FV+P G+P+V+IAS+++NL+IVCF++NA  N+++A AGKNN+ S +
Sbjct  390   SYQKINARLRPGTVFVVPAGHPFVTIASKNNNLKIVCFEVNAQRNKKLAFAGKNNIVSAL  449

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDLEL-FSKGPEWQQSEDRADQ  1467
             D  AK+++F  S++ VD++F+ D++    +    E ++   RAD+
Sbjct  450   DKTAKKLAFDKSAEKVDEIFKRDEEFFFPYDVEDESKEEHGRADE  494



>ref|XP_006839012.1| hypothetical protein AMTR_s00002p00272040 [Amborella trichopoda]
 gb|ERN01581.1| hypothetical protein AMTR_s00002p00272040 [Amborella trichopoda]
Length=523

 Score =   282 bits (721),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 160/426 (38%), Positives = 242/426 (57%), Gaps = 44/426 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F+   F     ++ G F  LP FTERS  F GIEN R  I+E++   FV P+H DA
Sbjct  93    NPYAFERDRFVRDISTEHGSFRTLPPFTERSELFRGIENNRICIMELKPNAFVLPHHKDA  152

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D+I  VA G+  L  I + ++ S++++ G    IPAG T+Y++N D+  +L I+ L+QTI
Sbjct  153   DIIYYVANGDARLVTIGEERQDSHNLKKGDTATIPAGKTTYIINKDSQRELKIVALLQTI  212

Query  664   STPGRFEFFFG-TGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             STPG++E FFG TG+N  S+LRAF   ILEA+++  +  + R+L  +   P ++ S EQL
Sbjct  213   STPGQYEIFFGATGQNPPSYLRAFSDEILEASFNVDRSRLSRLLEQKGQGPIVRPSSEQL  272

Query  835   KSL--RKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--DIEV  999
             + L         WPF  +   S +P ++F  +  +SN++G+L+E+D  ++  L   DI +
Sbjct  273   QGLIHGGSGGGKWPF-GESEESERPFNLFSRRPRISNDHGELYELDETEYSPLREFDIAI  331

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE----------------  1131
             +FANI+RG +  P +N+RAT++  +++G+   +MACP VS   E                
Sbjct  332   SFANISRGSLEVPFYNSRATEIYVILEGRARIEMACPHVSGGREQEGSRRGQGEQEGSRR  391

Query  1132  --RSEEGAIP---------------TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQI  1260
               R +EG+                  Y  + + L P  LFV PP +P    ASQ++NLQI
Sbjct  392   GQREQEGSRREQEQEERGKGQGQEIKYHKIRSDLNPEDLFVAPPSHPIAIRASQEENLQI  451

Query  1261  VCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEW  1440
             +CF+INA  N +  LAGKN++ + ++  AKEVSF V S+  ++V     D  +F  GP  
Sbjct  452   ICFEINARRNRKYFLAGKNSILNQIERAAKEVSFNVPSREAEEVLRAQSD-SVFVVGPR-  509

Query  1441  QQSEDR  1458
             QQ E R
Sbjct  510   QQREGR  515



>emb|CAA72090.1| P54 protein [Pisum sativum]
Length=483

 Score =   279 bits (714),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 163/459 (36%), Positives = 267/459 (58%), Gaps = 21/459 (5%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL TC+ QC +Q  +D + +  C+++C+ YI++K+ RQ+ +       +E+E     D
Sbjct  32    DPELTTCKDQCDMQRQYDEEDKRICMERCDDYIKKKQERQKHKEHEEEEEQEQEE----D  87

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF+   F T   ++ GR  +L +F E+S   + IEN+   +LE+++  F++P+H D
Sbjct  88    ENPYVFEDNDFETKIDTKDGRVLILNKFNEKSKLLKNIENYGLAVLEIKANAFLSPHHYD  147

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ-  657
             ++ I    +G G + ++ +++ + +++  G I+ +PAG   YLVN D N KL I      
Sbjct  148   SEAILFNIKGRGIIGLVAEDRTERFNLEEGDIMRVPAGTPMYLVNRDENEKLYIAAFHMP  207

Query  658   --TISTPGRFE-FFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVS  822
               + S P   E FF   GR   S L  F S +L+AA   SK  ++ VL  +      ++ 
Sbjct  208   PSSGSAPVNLEPFFESAGRKPESVLNTFSSKVLQAALKSSKGELETVLDEQKKGRIFKIE  267

Query  823   DEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFK---ELGD  990
              E ++ L  +  ++WPF     S   P +IF +  + SN +G LFEV     K   E  +
Sbjct  268   KEDVRGLAPKK-SLWPFGGPFKS---PFNIFSNNPAFSNKFGSLFEVGPSQEKSGLEGLN  323

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV--SSQTERSEEGAIPTYE  1164
             + +  ANIT+G M    +NT A K+A V+DG+G  +MACP +  SS   R ++ +I +Y 
Sbjct  324   LMLTLANITKGSMSTIHYNTNANKIALVIDGEGELEMACPHMPSSSSNSRQKKSSI-SYH  382

Query  1165  TVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDV  1344
              +NA+LRPG +FV+P G+P+V+IAS+  NL +VCF++NA  N+++ALAGK N+ S +D  
Sbjct  383   NINAKLRPGVMFVVPAGHPFVNIASKKKNLIVVCFEVNAQRNKKLALAGKKNIVSALDKA  442

Query  1345  AKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             AKEV+F ++++ VD+VFE  ++        E ++   RA
Sbjct  443   AKEVAFDIAAEKVDEVFERKEEFFFPYDNEERKEEHGRA  481



>gb|KHN18868.1| Sucrose-binding protein [Glycine soja]
Length=423

 Score =   277 bits (709),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/379 (37%), Positives = 236/379 (62%), Gaps = 12/379 (3%)
 Frame = +1

Query  304   NPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             NPYVF+  + F T   ++ G   VL +FTE+S   +GIENFR  ILE  + TFV+P H D
Sbjct  31    NPYVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFD  90

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             ++++    +G   L ++++++ +   +  G ++ IPAG   Y+VN D N KL++  L   
Sbjct  91    SEVVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKLLLAMLHIP  150

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             +STPG+FE FFG G     S L AF  ++L+AA    K  ++R+   +++    ++S E+
Sbjct  151   VSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLERLFNQQNEGSIFKISRER  210

Query  832   LKSLR-KESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFK---ELGDIE  996
             +++L   +  + WPF  +   S    +IF K  + SN YG+L EV  DD K   +  ++ 
Sbjct  211   VRALAPTKKSSWWPFGGE---SKAQFNIFSKRPTFSNGYGRLTEVGPDDEKSWLQRLNLM  267

Query  997   VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNA  1176
             + F NIT+  M    +N+ ATK+A V+DG+G  Q++CP +SS++    + + P+Y  ++A
Sbjct  268   LTFTNITQRSMSTIHYNSHATKIALVMDGRGHLQISCPHMSSRSHSKHDKSSPSYHRISA  327

Query  1177  QLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEV  1356
              L+PG +FV+PPG+P+V+IAS  +NL I+CF++N  +N++   AGK+N+ S++D+VAKE+
Sbjct  328   DLKPGMVFVVPPGHPFVTIASNKENLLIICFEVNVRDNKKFTFAGKDNIVSSLDNVAKEL  387

Query  1357  SFGVSSKLVDKVFENDDDL  1413
             +F   S++V+ VFE  + L
Sbjct  388   AFNYPSEMVNGVFERKESL  406



>ref|XP_003536630.1| PREDICTED: sucrose-binding protein-like [Glycine max]
 gb|KHN03813.1| Sucrose-binding protein [Glycine soja]
Length=504

 Score =   279 bits (713),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/452 (35%), Positives = 269/452 (60%), Gaps = 28/452 (6%)
 Frame = +1

Query  130   LETCRHQCRVQMAFDRQQREACLDKCERY----------Iqekegrqeergggssgrree  279
             L TC+HQC+    +    +  CL +C+RY          IQE+   ++E         ++
Sbjct  40    LVTCKHQCQQPQQYTEGDKRVCLQRCDRYHRMKQEREKQIQEETREKKEEESREREEEQQ  99

Query  280   egrggeDDNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKT  456
             E    +D+NPY+F+  + F T   ++ GR  VL +FTE+S   +GIENFR  ILE  + T
Sbjct  100   EQHEEQDENPYIFEEDKDFETRVETEGGRIRVLKKFTEKSKLLQGIENFRLAILEARAHT  159

Query  457   FVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKL  636
             FV+P H D++++    +G   L ++ +++ +   +  G ++ IPAG   Y+VN D N+KL
Sbjct  160   FVSPRHFDSEVVFFNIKGRAVLGLVSESETEKITLEPGDMIHIPAGTPLYIVNRDENDKL  219

Query  637   --VIIKLIQTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDD  801
                ++ +  ++STPG+FE FFG G     S L AF  ++L+AA    K  ++++   +++
Sbjct  220   FLAMLHIPVSVSTPGKFEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLEKLFDQQNE  279

Query  802   SPFIQVSDEQLKSLR-KESDTIWPFKTDKSSSSKP-VDIF-KHKSVSNNYGQLFEVDNDD  972
                  +S EQ+++L   +  + WPF       SKP  +IF K  ++SN YG+L EV  DD
Sbjct  280   GSIFAISREQVRALAPTKKSSWWPF----GGESKPQFNIFSKRPTISNGYGRLTEVGPDD  335

Query  973   ----FKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
                 + +  ++ + F NIT+  M    +N+ ATK+A V+DG+G  Q++CP +SS++  S+
Sbjct  336   DEKSWLQRLNLMLTFTNITQRSMSTIHYNSHATKIALVIDGRGHLQISCPHMSSRSSHSK  395

Query  1141  EGAI-PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKN  1317
                  P+Y  +++ L+PG +FV+PPG+P+V+IAS  +NL ++CF++NA +N++   AGK+
Sbjct  396   HDKSSPSYHRISSDLKPGMVFVVPPGHPFVTIASNKENLLMICFEVNARDNKKFTFAGKD  455

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFENDDDL  1413
             N+ S++D+VAKE++F   S++V+ VF+  +  
Sbjct  456   NIVSSLDNVAKELAFNYPSEMVNGVFDRKESF  487



>gb|AFM30909.1| globulin-3A [Triticum aestivum]
Length=588

 Score =   280 bits (716),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/432 (37%), Positives = 228/432 (53%), Gaps = 52/432 (12%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF PR FR   RS  G    L  F E S    GI N+R  I+EV  + FV P   DAD
Sbjct  133   PYVFGPRSFRRIIRSDHGFVKALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTDAD  192

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +G VA+GEG L +I+  +K+SY +R G ++  PAG+  +L NTD   KLVI K++ TIS
Sbjct  193   GVGYVAQGEGVLTVIENGEKRSYTVRQGDVIVAPAGSIMHLANTDGRRKLVIAKILHTIS  252

Query  667   TPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDS-------PFIQVSD  825
              PG+F++F        L +    +L AA   S E +  +L  R            ++ S+
Sbjct  253   VPGKFQYFSA---KPLLASLSKRVLTAALKTSDERLGSLLGSRQGKEEEEKSISIVRASE  309

Query  826   EQLKSLRKESDT-----IWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG  987
             EQL+ LR+++        WP    +  S    ++ + +  ++N +G+L+E D   F  L 
Sbjct  310   EQLRELRRQASEGDQGHHWPLPPFRGDSRDTFNLLEQRPKIANRHGRLYEADARSFHALA  369

Query  988   --DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER---------  1134
               D+ VA ANIT G M  P  NT++ KLA V++G+G  ++ CP +   +ER         
Sbjct  370   QHDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVEIVCPHLGRDSERREQEHGKGR  429

Query  1135  ----------------------SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQ--  1242
                                    EE     YETV A++  G+ FV+PPG+P V IAS   
Sbjct  430   WRSEEEEDDRRQQRRRGSGSESEEEQDQQRYETVRARVSRGSAFVVPPGHPVVEIASSRG  489

Query  1243  DDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDL-EL  1419
               NLQ+VCF+INA+ NERV LAG+NN+ + +DD A+E++FG  ++ V +VF   D   E 
Sbjct  490   SSNLQVVCFEINAERNERVWLAGRNNVIAKLDDPAQELAFGRPAREVQEVFRAKDQQDEG  549

Query  1420  FSKGPEWQQSED  1455
             F  GPE QQ  +
Sbjct  550   FVAGPEQQQEHE  561



>gb|ACJ65514.1| globulin 3 [Triticum aestivum]
Length=588

 Score =   280 bits (715),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/432 (37%), Positives = 228/432 (53%), Gaps = 52/432 (12%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF PR FR   RS  G    L  F E S    GI N+R  I+EV  + FV P   DAD
Sbjct  133   PYVFGPRSFRRIIRSDHGFVKALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTDAD  192

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +G VA+GEG L +I+  +K+SY +R G ++  PAG+  +L NTD   KLVI K++ TIS
Sbjct  193   GVGYVAQGEGVLTVIENGEKRSYTVRQGDVIVAPAGSIMHLANTDGRRKLVIAKILHTIS  252

Query  667   TPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDS-------PFIQVSD  825
              PG+F++F        L +    +L AA   S E +  +L  R            ++ S+
Sbjct  253   VPGKFQYFSA---KPLLASLSKRVLTAALKTSDERLGSLLGSRQGKEEEEKSISIVRASE  309

Query  826   EQLKSLRKESDT-----IWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG  987
             EQL+ LR+++        WP    +  S    ++ + +  ++N +G+L+E D   F  L 
Sbjct  310   EQLRELRRQASEGDQGHHWPLPPFRGDSRDTFNLLEQRPKIANRHGRLYEADARSFHALA  369

Query  988   --DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER---------  1134
               D+ VA ANIT G M  P  NT++ KLA V++G+G  ++ CP +   +ER         
Sbjct  370   QHDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVEIVCPHLGRDSERREQEHGKGR  429

Query  1135  ----------------------SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQ--  1242
                                    EE     YETV A++  G+ FV+PPG+P V IAS   
Sbjct  430   WRSEEEEDDRRQQRRRGSGSESEEEQDQQRYETVRARVSRGSAFVVPPGHPVVEIASSRG  489

Query  1243  DDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDL-EL  1419
               NLQ+VCF+INA+ NERV LAG+NN+ + +DD A+E++FG  ++ V +VF   D   E 
Sbjct  490   SSNLQVVCFEINAERNERVWLAGRNNVIAKLDDPAQELTFGRPAREVQEVFRAKDQQDEG  549

Query  1420  FSKGPEWQQSED  1455
             F  GPE QQ  +
Sbjct  550   FVAGPEQQQEHE  561



>ref|XP_009595712.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 isoform X2 
[Nicotiana tomentosiformis]
Length=797

 Score =   284 bits (726),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/405 (37%), Positives = 243/405 (60%), Gaps = 20/405 (5%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPY+F+ + FR+  R+  G F VL +FTERS    GIEN+R  ++E E  +F+ P+H 
Sbjct  375   ENNPYLFESQRFRSRFRATHGDFRVLEKFTERSELLRGIENYRVAVVEFEPLSFMLPHHC  434

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I +V  G GT+ I ++++K S+++  G ++ + AG+T Y++N DNN +  +  L Q
Sbjct  435   DAEAIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTVYMLNRDNNERFFVYVLAQ  494

Query  658   TISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++TPG+F E+F   G+N  SF RAF S ILE A++  ++ ++R+   +     I+ S+E
Sbjct  495   AVNTPGQFQEYFSAGGQNPESFYRAFSSDILETAFNTPRDRLERLFGQQKQGIVIKASEE  554

Query  829   QLKSLRKESDTIWPFKTDKSSSSKPVDIFK-HKSVSNNYGQLFEVDNDDFKELGDIE--V  999
             Q++++ + +      +T K  ++ P ++ K H   S+ +GQ FE   D F++L D++  V
Sbjct  555   QIRAISEHASRSTKQQT-KGRTTGPFNLLKEHPLFSSRFGQFFEASPDRFEQLRDMDAAV  613

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT------------ERSEE  1143
             AF NI +GGM+ P +NTR+T+LA VV+G G  +MACP + SQ+            ER +E
Sbjct  614   AFMNINQGGMVLPYYNTRSTRLAMVVEGNGRFEMACPHLGSQSQRQGSRGGRREQEREQE  673

Query  1144  GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNL  1323
             G    Y+ V   L  G + V+P G+P   IA+   NL+IV F +NA N+ +  LAG+ N+
Sbjct  674   GGDVHYQKVRGTLSVGDVLVVPAGHPITFIATGGSNLRIVGFGVNAHNSRKNFLAGQQNI  733

Query  1324  YSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
             + N+D  AKE+SF +  K V+++ +  D    F  GPE      R
Sbjct  734   WRNVDREAKELSFNMPGKEVEEILQRQDQ-SYFVAGPEQHGQRQR  777



>ref|XP_009595711.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 isoform X1 
[Nicotiana tomentosiformis]
Length=798

 Score =   284 bits (726),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/405 (37%), Positives = 243/405 (60%), Gaps = 20/405 (5%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPY+F+ + FR+  R+  G F VL +FTERS    GIEN+R  ++E E  +F+ P+H 
Sbjct  376   ENNPYLFESQRFRSRFRATHGDFRVLEKFTERSELLRGIENYRVAVVEFEPLSFMLPHHC  435

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I +V  G GT+ I ++++K S+++  G ++ + AG+T Y++N DNN +  +  L Q
Sbjct  436   DAEAIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTVYMLNRDNNERFFVYVLAQ  495

Query  658   TISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++TPG+F E+F   G+N  SF RAF S ILE A++  ++ ++R+   +     I+ S+E
Sbjct  496   AVNTPGQFQEYFSAGGQNPESFYRAFSSDILETAFNTPRDRLERLFGQQKQGIVIKASEE  555

Query  829   QLKSLRKESDTIWPFKTDKSSSSKPVDIFK-HKSVSNNYGQLFEVDNDDFKELGDIE--V  999
             Q++++ + +      +T K  ++ P ++ K H   S+ +GQ FE   D F++L D++  V
Sbjct  556   QIRAISEHASRSTKQQT-KGRTTGPFNLLKEHPLFSSRFGQFFEASPDRFEQLRDMDAAV  614

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT------------ERSEE  1143
             AF NI +GGM+ P +NTR+T+LA VV+G G  +MACP + SQ+            ER +E
Sbjct  615   AFMNINQGGMVLPYYNTRSTRLAMVVEGNGRFEMACPHLGSQSQRQGSRGGRREQEREQE  674

Query  1144  GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNL  1323
             G    Y+ V   L  G + V+P G+P   IA+   NL+IV F +NA N+ +  LAG+ N+
Sbjct  675   GGDVHYQKVRGTLSVGDVLVVPAGHPITFIATGGSNLRIVGFGVNAHNSRKNFLAGQQNI  734

Query  1324  YSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
             + N+D  AKE+SF +  K V+++ +  D    F  GPE      R
Sbjct  735   WRNVDREAKELSFNMPGKEVEEILQRQDQ-SYFVAGPEQHGQRQR  778



>ref|XP_010911186.1| PREDICTED: vicilin-like antimicrobial peptides 2-2, partial [Elaeis 
guineensis]
Length=555

 Score =   276 bits (706),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 236/404 (58%), Gaps = 20/404 (5%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             + +PY F    F    R++ G+  V   F E+S    G+ N+R  I+E    TFV P+H 
Sbjct  146   EGHPYFFDKESFMRQVRTEHGQIRVFRNFFEKSKLLLGVANYRVAIIETNPNTFVLPSHF  205

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ +  VA G G L ++ ++ K+++++R G I+ + AGA + L+N D N KLVI+ L+Q
Sbjct  206   DAEALLFVARGNGILTLMCQDNKEAHELRRGDIMRVRAGAIASLMNKDRNEKLVIVCLLQ  265

Query  658   TISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++TPG FE F G G     SF R+F   +L AA++  ++ ++R+   +   P IQ S E
Sbjct  266   PVATPGMFEAFVGAGGQNPESFYRSFSKQVLRAAFNTREDKLKRLFEKQQKGPIIQASQE  325

Query  829   QLKSLRKE--SDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGD--I  993
             Q++ + ++       P       S +P ++  K  S SN +G+L E D  D+ EL D  I
Sbjct  326   QIREMSRQISEGRSRPL----GGSRRPFNLLEKRPSHSNRHGELREADRTDYPELMDLNI  381

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT-----  1158
             +V+ ANI+RG M+ P +NT ATK+A VV GKG  Q+ CP +S Q E              
Sbjct  382   QVSLANISRGSMIAPNYNTEATKIAIVVGGKGDVQIVCPHLSRQQEEGRGREEEEQQRGR  441

Query  1159  -YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNM  1335
              Y+ V +++  GT+F++P G+P V+++S+++NL+++CF INA NN R  LAG+NN+   M
Sbjct  442   HYQRVQSEVSRGTVFIVPAGHPSVAVSSRNENLEVLCFGINAKNNHRTWLAGRNNVLKQM  501

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP-EWQQSEDRAD  1464
             D V KE+SF   ++ VD+V  N    E+F +GP E +Q  +R +
Sbjct  502   DRVTKELSFDQPAREVDEVL-NAPREEVFMEGPKESEQERERGE  544



>ref|XP_010938562.1| PREDICTED: globulin-1 S allele [Elaeis guineensis]
Length=477

 Score =   274 bits (700),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 151/398 (38%), Positives = 239/398 (60%), Gaps = 20/398 (5%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             N Y +   +F    +S+ G F VL RFTER    +GI NFR  ILE   +TFV P+H+DA
Sbjct  85    NRYCYGEENFEYWMKSELGHFKVLERFTERFKLLQGIGNFRLAILEANPRTFVLPSHMDA  144

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + +  V EG G L++++ + + SYDI  G I    AG+ +YL+N D+N KL I  L+  +
Sbjct  145   EELFYVMEGRGVLNVLEISGRNSYDIEQGQIFSFDAGSQAYLINKDDNKKLRIAMLLHPV  204

Query  664   STPGRF-EFFFGTGR--NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             S+PGRF EFF   GR   SF R+F + +LEAA++ +K+ ++++  G+     I  ++EQ+
Sbjct  205   SSPGRFKEFFDAGGRAPESFYRSFSTKVLEAAFNTTKDRLEKLF-GQQRGETINATEEQI  263

Query  835   KSLRKESDT-----IWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELGD--I  993
             K+L +         I P K  + S             SN +G+L+++   D+ +L D  +
Sbjct  264   KALTEPPTAPGGWFIGPSKQCRRSGVSLTSRQNRVWYSNEHGELYKIYACDYSDLCDLGV  323

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVN  1173
             E++FANI+RG M+ P +N+ AT  A VV+G+G+ +MACP +       E+G    Y+ V 
Sbjct  324   EISFANISRGSMMAPHYNSMATLAALVVEGEGYFEMACPHI-------EQGGT-HYQAVR  375

Query  1174  AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKE  1353
             +Q+ PG++F+IP G+P V++AS+D+NLQ++   +NA +N    LAG NN+ ++M+ VAKE
Sbjct  376   SQVSPGSVFMIPAGHPVVAVASRDENLQVLFLGMNAKHNRVHFLAGGNNVLNHMERVAKE  435

Query  1354  VSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRADQ  1467
             +SF   +++VD+VF N      F  GP+    E+R  +
Sbjct  436   LSFNAPARVVDEVF-NAQKRAGFLPGPDEIHKEERGTR  472



>ref|XP_004495184.1| PREDICTED: sucrose-binding protein-like [Cicer arietinum]
Length=470

 Score =   271 bits (694),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 154/438 (35%), Positives = 250/438 (57%), Gaps = 27/438 (6%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPE++TC+HQCR Q+ +  + +  C+++C+ Y                 R+E++    E+
Sbjct  32    DPEIKTCKHQCRQQLQYSEEDKNVCMEECDEY--------HRMKKEREKRKEQDQDEDEN  83

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF+ + F T   ++ GR  VL +F ++S     IEN+   +LEV+   FV+P+H D
Sbjct  84    ENPYVFKSKDFDTRIDTEDGRVLVLNKFNDKSKLLRNIENYGLAVLEVKGHAFVSPHHFD  143

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ-  657
             +++I    +G+  + ++ ++K + +++  G I+ +PAG   YLVN D N KL I  L   
Sbjct  144   SEVIIFNVKGKAIIGLVMEDKTERFNLESGDIMRVPAGTPMYLVNRDENEKLFIAALHMP  203

Query  658   --TISTPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVS  822
               + S P   E FF   GRN  S L AF S +L+AA    KE ++R    +      ++S
Sbjct  204   PLSASAPVNLEAFFEPGGRNPESVLTAFSSKVLQAALKTPKEKLERFFDYQRRERIFKIS  263

Query  823   DEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELGD---  990
              E +  L  +  +IWPF         P +IF ++ S SN YG LFEV   + K   D   
Sbjct  264   KEDVHGLAPKR-SIWPF---GGQFKGPFNIFTNRPSFSNQYGSLFEVGPSEEKSGLDELN  319

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETV  1170
             + +  ANIT+G M    +NT A K+AFV +G+G  +MACP +  +   S      +Y  +
Sbjct  320   LMLTLANITKGCMSTIYYNTNANKIAFVTEGEGDFEMACPHLKEKKSSS-----TSYHKI  374

Query  1171  NAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAK  1350
             + +L+ G +FV+P G+P+V++AS+ +NL IVCF++NA+ N+++A AGK N+ S +D  AK
Sbjct  375   SGRLKAGMVFVVPAGHPFVTMASKKNNLVIVCFEVNAERNKKLAFAGKRNIVSALDKRAK  434

Query  1351  EVSFGVSSKLVDKVFEND  1404
             EV++   ++ VD++FE D
Sbjct  435   EVAYEYPAEKVDEIFERD  452



>ref|XP_011032788.1| PREDICTED: vicilin-like antimicrobial peptides 2-1 [Populus euphratica]
Length=546

 Score =   274 bits (700),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 150/406 (37%), Positives = 237/406 (58%), Gaps = 25/406 (6%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF+ RH +T   ++ GR  VL +FT++S    G+EN R  I+E   + F+AP HLDA 
Sbjct  143   PYVFEDRHLKTEVETEHGRVRVLQKFTKKSKLLRGLENIRVAIIEANPQAFIAPTHLDAG  202

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  VA+G G + +I +  K++Y +  G +  +PAG T Y+VN D N KL + K++  ++
Sbjct  203   FVLFVAKGRGAITLIHEEDKQTYSLERGDVFRVPAGTTFYMVNKDENEKLRVAKILWPVN  262

Query  667   TPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLK  837
              P  F  F G G     SF +AF   +LEAA    +  ++R+ + +     ++ S EQ++
Sbjct  263   LPDNFNAFHGAGGEDAESFFKAFSWELLEAALKTDRGRLERIFK-QQQGGIVKASKEQIQ  321

Query  838   SL------RKESDTIWPFKTDKSSSSKPVDIFKHKSVS-NNYGQLFEVDNDDFKELGDIE  996
             +L            +WPF T    SS P +IF    V  NNYGQLFE    D ++L D++
Sbjct  322   ALGQGEEGGHGGGGLWPFPT--GGSSGPFNIFDKGPVKRNNYGQLFEARPKDSEQLRDLD  379

Query  997   --VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS--------QTERSEEG  1146
               V+ ANITRG M GP +N++AT ++ V++G+G+ +MACP+ SS        ++E S  G
Sbjct  380   LIVSSANITRGSMAGPYYNSKATMISIVMEGEGYFEMACPRDSSSGSSMGYIESEGSRRG  439

Query  1147  -AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNL  1323
                 TY+  +++L   ++F++P G+P  ++AS++ NL+++ F++ A  N R  LAGK N+
Sbjct  440   KGGQTYQRTSSRLSRSSVFIVPAGHPVATMASENSNLEVLSFEVYAKGNVRYPLAGKWNV  499

Query  1324  YSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
                MD  AKE+++GV +K VD++F    + E F  GP  Q+ E RA
Sbjct  500   IGEMDREAKELAYGVPAKEVDQIFGKQQE-EFFFPGPRRQRREGRA  544



>ref|XP_009771136.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=796

 Score =   279 bits (713),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/399 (37%), Positives = 240/399 (60%), Gaps = 21/399 (5%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPY+F+ + FR+  R+  G F VL +FTERS    GIEN+R  ++E E  +F+ P+H 
Sbjct  373   ENNPYLFESQRFRSRFRATHGDFRVLQKFTERSELLRGIENYRVAVIEFEPLSFMLPHHC  432

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I +V  G GT+ I ++++K S+++  G ++ + AG+T Y++N DNN +  +  L Q
Sbjct  433   DAEAIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTIYMLNRDNNERFFVYVLAQ  492

Query  658   TISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ++TPG+F EFF   G+N  SF RAF S ILE A++  ++ ++R+   +     I+ S+E
Sbjct  493   AVNTPGQFQEFFSAGGQNPESFYRAFSSDILETAFNTPRDRLERLFGQQKQGIVIKASEE  552

Query  829   QLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQLFEVDNDDFKELGDIE--V  999
             Q++++ + +      +T K  ++ P +  K +  +SN +G+ FE   D F++L D++  V
Sbjct  553   QIRAISEHASRSTKQQT-KGQTTGPFNPLKERPLISNKFGKFFEASPDRFEQLRDLDAAV  611

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER--SEEGAIPT-----  1158
             AF NI  GGM+ P +NTR+T+LA VV+G G  +MACP + +Q++R  S  G         
Sbjct  612   AFMNINHGGMVLPYYNTRSTRLAMVVEGTGRFEMACPHLGTQSQRQGSRGGRREQESEEQ  671

Query  1159  ------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
                   Y+ V   L  G + V+P G+P   IA+   NL+IV F +NA NN +  LAG+ N
Sbjct  672   EGGDVHYQKVRGTLSAGDVLVVPAGHPITFIATGGSNLRIVGFGVNAHNNRKNFLAGQQN  731

Query  1321  LYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
             ++ N+D  AKE+SF +  K V+++ +  D    F  GPE
Sbjct  732   IWRNVDREAKEISFNMPGKEVEEILQRQDQ-SFFVAGPE  769



>ref|NP_001276308.1| sucrose-binding protein precursor [Glycine max]
 sp|Q04672.1|SBP_SOYBN RecName: Full=Sucrose-binding protein; Short=SBP; Flags: Precursor 
[Glycine max]
 gb|AAB03894.1| glucose binding protein [Glycine max]
Length=524

 Score =   269 bits (687),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 158/446 (35%), Positives = 266/446 (60%), Gaps = 28/446 (6%)
 Frame = +1

Query  130   LETCRHQCRVQMAFDRQQREACLDKCERY----------Iqekegrqeergggssgrree  279
             L TC+HQC+ Q  +    +  CL  C+RY          IQE+   ++E         ++
Sbjct  40    LVTCKHQCQQQQQYTEGDKRVCLQSCDRYHRMKQEREKQIQEETREKKEEESREREEEQQ  99

Query  280   egrggeDDNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKT  456
             E    +D+NPY+F+  + F T   ++ GR  VL +FTE+S   +GIENFR  ILE  + T
Sbjct  100   EQHEEQDENPYIFEEDKDFETRVETEGGRIRVLKKFTEKSKLLQGIENFRLAILEARAHT  159

Query  457   FVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKL  636
             FV+P H D++++    +G   L ++ +++ +   +  G ++ IPAG   Y+VN D N+KL
Sbjct  160   FVSPRHFDSEVVFFNIKGRAVLGLVSESETEKITLEPGDMIHIPAGTPLYIVNRDENDKL  219

Query  637   --VIIKLIQTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDD  801
                ++ +  ++STPG+FE FF  G     S L AF  ++L+AA    K  ++ V   +++
Sbjct  220   FLAMLHIPVSVSTPGKFEEFFAPGGRDPESVLSAFSWNVLQAALQTPKGKLENVFDQQNE  279

Query  802   SPFIQVSDEQLKSLR-KESDTIWPFKTDKSSSSKP-VDIF-KHKSVSNNYGQLFEVDNDD  972
                 ++S EQ+++L   +  + WPF       SKP  +IF K  ++SN YG+L EV  DD
Sbjct  280   GSIFRISREQVRALAPTKKSSWWPF----GGESKPQFNIFSKRPTISNGYGRLTEVGPDD  335

Query  973   ----FKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
                 + +  ++ + F NIT+  M    +N+ ATK+A V+DG+G  Q++CP +SS++  S+
Sbjct  336   DEKSWLQRLNLMLTFTNITQRSMSTIHYNSHATKIALVIDGRGHLQISCPHMSSRSSHSK  395

Query  1141  EGAI-PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKN  1317
                  P+Y  +++ L+PG +FV+PPG+P+V+IAS  +NL ++CF++NA +N++   AGK+
Sbjct  396   HDKSSPSYHRISSDLKPGMVFVVPPGHPFVTIASNKENLLMICFEVNARDNKKFTFAGKD  455

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVF  1395
             N+ S++D+VAKE++F   S++V+ VF
Sbjct  456   NIVSSLDNVAKELAFNYPSEMVNGVF  481



>ref|XP_007144650.1| hypothetical protein PHAVU_007G173600g [Phaseolus vulgaris]
 gb|ESW16644.1| hypothetical protein PHAVU_007G173600g [Phaseolus vulgaris]
Length=502

 Score =   268 bits (685),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 143/387 (37%), Positives = 234/387 (60%), Gaps = 13/387 (3%)
 Frame = +1

Query  325   RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVA  504
             R F T   ++ GR  +L +FTE+S   +GIEN R  I+E +  TFVAP H D+D++    
Sbjct  121   RDFDTKFETEDGRIRLLKKFTEKSELLKGIENIRLTIVEAKPHTFVAPRHFDSDVVLFNI  180

Query  505   EGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFE  684
             +G   L  +++++ + + +  G ++ IPAG   Y+VN D N KL +  L   +STPG+F+
Sbjct  181   KGRAVLGWVKESETEKFILESGDMLAIPAGTPLYIVNRDENEKLFLAMLHVPVSTPGKFQ  240

Query  685   FFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLRKES  855
              FFG G     SFL AF  ++L+AA    K  ++++   ++     ++S ++++ +  + 
Sbjct  241   EFFGPGGRDPESFLSAFGWNVLQAALQSPKGQLEKLFNQQNGGSIFEISRKKVQEMAPKK  300

Query  856   DTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGD---IEVAFANITRG  1023
              + WPF      S+   ++F K  + SN +G+L EV   D + L +   I ++F NIT  
Sbjct  301   TSWWPFG---GPSTAEFNLFTKPPTFSNRHGRLTEVGPPDSRSLLEKLNIMLSFTNITMK  357

Query  1024  GMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQLRPGTLFV  1203
              M    +N+ ATK+A V+DGKG  Q+ CP +SS++    E + P+   ++A L+PG LFV
Sbjct  358   SMSTIHYNSHATKIALVIDGKGHLQIVCPHISSRSNSKHEKSSPSNHRISADLKPGMLFV  417

Query  1204  IPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLV  1383
             +PPG+P+V+ +S+ +NLQI+ F+INA +N++   AGK+N+ S+MDD+AKE++F   S++V
Sbjct  418   VPPGHPFVTFSSRKENLQIISFEINARDNKKFTFAGKDNIVSSMDDLAKELAFNYPSEIV  477

Query  1384  DKVFENDDDLELFSKGPEWQQSEDRAD  1464
             +K+F   D  E F    E  QS+ RAD
Sbjct  478   NKIF---DRKESFFFPFELPQSDPRAD  501



>ref|XP_004146991.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=453

 Score =   266 bits (680),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 157/461 (34%), Positives = 243/461 (53%), Gaps = 58/461 (13%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+HQC+VQ  FD QQ+  C   C+ Y + K+ +            EEE      
Sbjct  30    DPELKQCKHQCKVQRQFDEQQKRDCERSCDEYYKMKKEKGRNYESEEEEEEEEE-----V  84

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF   HF     + +G+  VL +FT+RS+   GIENFR  I+E    TFV P H D
Sbjct  85    ENPYVFDDEHFVGQIETGEGKIKVLQKFTQRSHLLRGIENFRVSIVEANPSTFVVPTHFD  144

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A++I  VA+G GT+ +I K K+ S++++ G +  IP+GA  Y +N D + KL I+KL+Q+
Sbjct  145   AEIILFVAQGRGTITVI-KEKRGSFELKCGDVFRIPSGAPFYFINKDEHRKLKIVKLLQS  203

Query  661   ISTPGRFEFF---FGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
              S PG F+ F    G    SF  AF   +LEAA+   ++ ++R  + +     I+ S EQ
Sbjct  204   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQKPGTIIKASREQ  263

Query  832   LKSLRKESDT---IWPFKTDKSSSSKPVDIFK-HKSVSNNYGQLFEVDNDDFKELGD--I  993
             ++SL +  +    IWPF   +  + +P ++ K H   SN +G+LFE   D+F +L D  +
Sbjct  264   IRSLSRHEEIIPKIWPF--SEGETERPFNLLKQHPCQSNKFGRLFEAYPDEFSQLRDLGV  321

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV--------SSQTERSEEGA  1149
              +AFANIT G M+ P +N+++ K+A V+DG+G  QMACP +               E   
Sbjct  322   AIAFANITEGSMVAPHYNSKSMKIAVVLDGQGGFQMACPHLSSSSRRSGRWSEREEERKG  381

Query  1150  IPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYS  1329
               TY+ +  +L  G +FV+P                                AGK N+ +
Sbjct  382   ERTYQKIRGRLSRGVVFVVP--------------------------------AGKENIVN  409

Query  1330  NMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
              M+ +A+E+ F    + V+++F+  ++ E F  GP  Q+ E
Sbjct  410   KMESIARELGFNTPGREVERMFKQQEE-EFFFPGPNQQEHE  449



>ref|XP_009413881.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=433

 Score =   265 bits (676),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 138/391 (35%), Positives = 241/391 (62%), Gaps = 20/391 (5%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             + NPY F  R ++   R++ G   VL RF   S+Q  G++N+R  +LE E +TF+ P H 
Sbjct  31    EHNPYYFGRRSYQQWSRTEHGSLEVLERFARTSDQLLGVDNYRLAVLEAEPQTFIMPCHW  90

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ +  V +G GT+ ++ + +++S+DI+ G I+ +PAG   Y +N  +N +L +  L+ 
Sbjct  91    DAEQVVYVMQGRGTITLLHEERRESHDIKRGDIMRVPAGVIVYAINKASNERLRVAMLLH  150

Query  658   TISTPGRFEFFFG-TGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              ISTPG  E + G  GRN  +F  +F + +LEAA++   + ++RV R +     I+++++
Sbjct  151   PISTPGHIEEYHGAAGRNPQTFYTSFSNEVLEAAFNTPWDKLERVFRSQRKGGIIKITED  210

Query  829   QLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELGD--IEV  999
             Q+++L  ES+      T+   S++P ++ ++  S SN +GQL E   ++ + L D  ++V
Sbjct  211   QIRAL-SESN------TESGLSNEPYNLLENSPSHSNEHGQLHEATGNECEMLQDLNVDV  263

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS--EEGAIP----TY  1161
             + ANI+   M+ P ++TR+TKLA VV+G+G+ +MACP  S++  R+  E G+       Y
Sbjct  264   SIANISERSMMAPNYDTRSTKLAMVVEGRGYIEMACPHRSAERRRTQVETGSQGEQRVRY  323

Query  1162  ETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDD  1341
              TV +++  G++FVIP G+P   +A+ ++NLQ++CF   ++NN R  LAG+NN+ + +D 
Sbjct  324   RTVRSRVSRGSVFVIPAGHPAAVVAAANENLQVLCFGTRSENNRRYYLAGRNNVLNRLDR  383

Query  1342  VAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
              AK ++FGV ++ V++V  N     +F  GP
Sbjct  384   AAKAMAFGVPAEEVEEVL-NAQPESVFMPGP  413



>ref|XP_004162195.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=453

 Score =   265 bits (676),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 157/461 (34%), Positives = 242/461 (52%), Gaps = 58/461 (13%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL+ C+HQC+VQ  FD QQ+  C   C+ Y + K+ +            EEE      
Sbjct  30    DPELKQCKHQCKVQRQFDEQQKRDCERSCDEYYKMKKEKGRNYESEEEEEEEEE-----V  84

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPYVF   HF     + +G+  VL +FT+RS    GIENFR  I+E    TFV P H D
Sbjct  85    ENPYVFDDEHFVGQVETGEGKIKVLQKFTQRSQLLRGIENFRVSIVEANPSTFVVPTHFD  144

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A++I  VA+G GT+ +I K K+ S++++ G +  IP+GA  Y +N D + KL I+KL+Q+
Sbjct  145   AEIILFVAQGRGTITVI-KEKRGSFELKCGDVFRIPSGAPFYFINKDEHRKLKIVKLLQS  203

Query  661   ISTPGRFEFF---FGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
              S PG F+ F    G    SF  AF   +LEAA+   ++ ++R  + +     I+ S EQ
Sbjct  204   TSVPGHFQTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQKPGTIIKASREQ  263

Query  832   LKSLRKESDT---IWPFKTDKSSSSKPVDIFK-HKSVSNNYGQLFEVDNDDFKELGD--I  993
             ++SL +  +    IWPF   +  + +P ++ K H   SN +G+LFE   D+F +L D  +
Sbjct  264   IRSLSRHEEIIPKIWPF--SEGETDRPFNLLKQHPCQSNKFGRLFEAYPDEFSQLRDLGV  321

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV--------SSQTERSEEGA  1149
              +AFANIT G M+ P +N+++ K+A V+DG+G  QMACP +               E   
Sbjct  322   AIAFANITEGSMVAPHYNSKSMKIAVVLDGQGGFQMACPHLSSSSRRSGRWSEREEERKG  381

Query  1150  IPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYS  1329
               TY+ +  +L  G +FV+P                                AGK N+ +
Sbjct  382   ERTYQKIRGRLSRGVVFVVP--------------------------------AGKENIVN  409

Query  1330  NMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
              M+ +A+E+ F    + V+++F+  ++ E F  GP  Q+ E
Sbjct  410   KMESIARELGFNTPGREVERMFKQQEE-EFFFPGPNQQEHE  449



>gb|EMS66832.1| Globulin-1 S allele [Triticum urartu]
Length=509

 Score =   266 bits (680),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 155/436 (36%), Positives = 225/436 (52%), Gaps = 56/436 (13%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             D P     R FR   RS  G    L  F E S    GI N+R  I+EV  + FV P   D
Sbjct  51    DRPRYSHAR-FRRIIRSDHGFVKALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTD  109

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD +G VA+GEG L +I+  +K+SY +R G ++  PAG+  +L NTD   KLVI K++ T
Sbjct  110   ADGVGYVAQGEGVLTVIENGEKRSYTVRQGDVIVAPAGSIMHLANTDGRRKLVIAKILHT  169

Query  661   ISTPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDS-------PFIQV  819
             IS PG+F++F        L +    +L AA   S E +  +L  R            ++ 
Sbjct  170   ISLPGKFQYFSA---KPLLASLSKRVLRAALKTSDERLGSLLGSRQGKEEEEKSISIVRA  226

Query  820   SDEQLKSLRKESDTI-----WPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKE  981
             S+EQ++ LR+E+        WP    +  S    ++ + +  ++N +G+L+E D   F  
Sbjct  227   SEEQVRELRREASESGQGHHWPLPPVRGDSRDTYNLLEQRPKIANRHGRLYEADARSFHA  286

Query  982   LG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE----  1143
             L   D+ VA ANIT G M  P  NT++ KLA V++G+G  ++ CP +   +ER E+    
Sbjct  287   LAQHDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVEIVCPHLGRDSERREQEHGK  346

Query  1144  ------------------------------GAIPTYETVNAQLRPGTLFVIPPGNPYVSI  1233
                                                YETV A++  G+ FV+PPG+P V I
Sbjct  347   GRWGEEEEDDRRQQRRRGSGSGSESESEEQQDQQRYETVRARVSRGSAFVVPPGHPVVEI  406

Query  1234  ASQ--DDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDD  1407
             AS     NLQ+VCF+INA+ NERV LAG+NN+ + +DD A+E++FG  ++ V +VF   D
Sbjct  407   ASSRGSSNLQVVCFEINAERNERVWLAGRNNVIAKLDDPAQELTFGRPAREVQEVFRAKD  466

Query  1408  DL-ELFSKGPEWQQSE  1452
                E F  GPE Q+ E
Sbjct  467   QQDEGFVAGPEQQEQE  482



>sp|Q9SPL4.1|AMP22_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-2; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor 
[Macadamia integrifolia]
 gb|AAD54245.1|AF161884_1 vicilin precursor [Macadamia integrifolia]
Length=666

 Score =   270 bits (690),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 228/399 (57%), Gaps = 16/399 (4%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             DNPY F  R   T  R+++G  SVL  F  RS     ++N+R  +LE     FV P HLD
Sbjct  249   DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD  308

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I LV  G G L +I ++ ++SY++  G ++ IPAG T YL+N DNN +L I K +QT
Sbjct  309   ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT  368

Query  661   ISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ISTPG++ EFF   G+N   +L  F   ILEAA +   E ++ VL  + +   I  S EQ
Sbjct  369   ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGVIISASQEQ  428

Query  832   LKSL-RKESDT-IWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA  1002
             ++ L R +S++  W  +    SS  P ++F  + + SN YGQ +EV  +D+++L D++V+
Sbjct  429   IRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVS  488

Query  1003  --FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS------SQTERSEEGAIPT  1158
                ANIT+G M+GP FNTR+TK+  V  G+   +MACP +S         +R EE     
Sbjct  489   VFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRRGGKRHEEEEDVH  548

Query  1159  YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLYSNM  1335
             YE V A+L      V+P G+P V ++S ++NL +  F INA NN    LAG+  N+   +
Sbjct  549   YEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQI  608

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             +  A E++F    K V+++F N  D  +F  GP   Q +
Sbjct  609   EPQAMELAFAAPRKEVEELF-NSQDESIFFPGPRQHQQQ  646



>ref|XP_010695493.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Beta vulgaris 
subsp. vulgaris]
Length=607

 Score =   268 bits (685),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/389 (33%), Positives = 241/389 (62%), Gaps = 12/389 (3%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             DNPY F  + F + + +Q+G+  VL RF+E+S+   G++ FR GI E   KTF+ P+H D
Sbjct  214   DNPYYFDSQSFESRYSTQEGQMRVLQRFSEKSDLLLGMDKFRVGIYEANPKTFMLPHHWD  273

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD +  V +G   + ++++  +K+ ++  G ++ IPAG T+YL+N+ N+ KL I +L++ 
Sbjct  274   ADSVVFVMKGNAVVTLLKQENRKTLNLERGDVLMIPAGTTTYLINSHNDEKLEIAELLRP  333

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ++TPGR++ FFG G     SF  +F + IL+AA +  +E +Q++L  + +   I+ S EQ
Sbjct  334   VNTPGRYQQFFGVGGEQSKSFFTSFSTEILQAALNIPREQLQKLLAQQKEGAIIKASHEQ  393

Query  832   LKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--DIEVA  1002
             +++L  ++      +     S   +++   +  +SN +G+ FEV  +++++L   DI VA
Sbjct  394   VRALAHKTS-----RRQFGDSRGQINLLDGRPQLSNKHGEFFEVTPNEYQQLEDLDISVA  448

Query  1003  FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQL  1182
             + +I +G M+ P +N+R + +  V +G G+ ++ACP ++S+  + + G   +YE V + L
Sbjct  449   YLDIKQGSMMAPHYNSRTSYVVLVEEGSGYFEIACPHLASERNKKQRGGSQSYEKVRSHL  508

Query  1183  RPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSF  1362
               G +FV+P G+P   +AS++ NL+ + F INA NN+R  LAG++N+ + +D+ A E+SF
Sbjct  509   SKGDVFVVPAGHPVAIVASENKNLRAIGFGINALNNQRNFLAGQDNIVNQLDEEAMEMSF  568

Query  1363  GVSSKLVDKVFENDDDLELFSKGPEWQQS  1449
              + ++ V+++F+       F  GP+ Q++
Sbjct  569   NLPAREVEEMFQKQRR-SYFMAGPQRQRN  596



>emb|CAC27161.1| putative sucrose binding protein [Vicia faba var. minor]
Length=482

 Score =   264 bits (675),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 158/458 (34%), Positives = 270/458 (59%), Gaps = 20/458 (4%)
 Frame = +1

Query  121   DPELETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrggeD  300
             DPEL TC+ +C +Q  +D + +  C++KCE Y+++K+ RQ+ +        EEE      
Sbjct  32    DPELTTCKDKCDLQGQYDEEDKRICMEKCEDYVRKKQERQKHKEHEKEEHEEEEENEN--  89

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
               PYVF+ + F T   ++ GR  +L +F E+S   + IEN+   +LE+++  F++P+H D
Sbjct  90    --PYVFENKDFETKIDTKDGRILILNKFHEKSKLLKNIENYGLAVLEIKANAFLSPHHYD  147

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL---  651
             ++ I    +G+G + ++ +++ + +++  G ++ +PAG  +YLVN D N KL+I      
Sbjct  148   SEAILFNIKGKGIIGLVAEDQTERFNLEEGDLIRVPAGTPTYLVNRDENEKLLIAAFHLP  207

Query  652   IQTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVS  822
               + S P   E FF +G     S L  F S +L+AA   S+  ++ VL  +      +++
Sbjct  208   PSSGSAPVNLEPFFESGGRRPESVLSTFSSKVLQAALKSSERELETVLDEQQKGRIFKIA  267

Query  823   DEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFK---ELGD  990
              E + SL  +  ++WPF     +   P +I  +  + SN +G LFEV     K   E  +
Sbjct  268   KEDVLSLAPKR-SLWPFG---GTFKGPFNIRNNNPAFSNQFGTLFEVGPSLEKTGLEGLN  323

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-SSQTERSEEGAIPTYET  1167
             + + FANIT+G M    +NT A K+AFVV+G+G  +MACP + SS +   ++ +  +Y  
Sbjct  324   LMLTFANITKGSMSTIHYNTNANKIAFVVNGEGDFEMACPHMPSSSSNSKQKKSSISYHN  383

Query  1168  VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVA  1347
             +NA+L+PG +FV+P G+PYV+IAS+ +NL I+CF++NA  N+++A AGK N+ S +D  A
Sbjct  384   INAKLKPGMVFVVPAGHPYVNIASKKNNLLILCFEVNAQRNKKLAFAGKKNIMSALDKTA  443

Query  1348  KEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             KE++F ++++ VDK+FE  ++L  F    E ++   RA
Sbjct  444   KELAFDLAAQKVDKIFERKEEL-FFPYDEERKEERGRA  480



>gb|AAA32936.1| embryo globulin [Hordeum vulgare subsp. vulgare]
 gb|AAA34269.1| storage protein [Triticum aestivum]
 prf||1916404A barley embryo globulin 1
Length=637

 Score =   268 bits (684),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 151/421 (36%), Positives = 223/421 (53%), Gaps = 48/421 (11%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF PR FR   +S  G    L  F + S    GI ++R  I+EV  + FV P   DAD
Sbjct  182   PYVFGPRSFRRIIQSDHGFVRALRPFDQVSRLLRGIRDYRVAIMEVNPRAFVVPGFTDAD  241

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +G VA+GEG L +I+  +K+SY ++ G ++  PAG+  +L NTD   KLVI K++ TIS
Sbjct  242   GVGYVAQGEGVLTVIENGEKRSYTVKEGDVIVAPAGSIMHLANTDGRRKLVIAKILHTIS  301

Query  667   TPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDS------PFIQVSDE  828
              PG+F+F         L +    +L AA+  S E ++R+   R           ++ S+E
Sbjct  302   VPGKFQFL---SVKPLLASLSKRVLRAAFKTSDERLERLFNQRQGQEKTRSVSIVRASEE  358

Query  829   QLKSLRKES-----DTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG-  987
             QL+ LR+E+        WP    +  S    ++ + +  ++N +G+L+E D   F  L  
Sbjct  359   QLRELRREAAEGGQGHRWPLPPFRGDSRDTFNLLEQRPKIANRHGRLYEADARSFHALAN  418

Query  988   -DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE----------R  1134
              D+ VA ANIT G M  P  NT++ KLA V++G+G  Q+ CP +  ++E          R
Sbjct  419   QDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVQIVCPHLGRESESEREHGKGRRR  478

Query  1135  SEE-------------------GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQD--DN  1251
              EE                        YETV A++  G+ FV+PPG+P V I+S     N
Sbjct  479   EEEEDDQRQQRRRGSESESEEEEEQQRYETVRARVSRGSAFVVPPGHPVVEISSSQGSSN  538

Query  1252  LQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             LQ+VCF+INA+ NERV LAG+NN+   +   A+E++FG  ++ V +VF   D  E F  G
Sbjct  539   LQVVCFEINAERNERVWLAGRNNVIGKLGSPAQELTFGRPAREVQEVFRAQDQDEGFVAG  598

Query  1432  P  1434
             P
Sbjct  599   P  599



>gb|AAF18269.1|AF066055_1 vicilin-like protein precursor [Juglans regia]
Length=593

 Score =   266 bits (679),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/445 (33%), Positives = 261/445 (59%), Gaps = 19/445 (4%)
 Frame = +1

Query  121   DPELE--TCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgg  294
             DP+ +   C+ +C++Q     +QR+ C  +CER  +E++GR+                  
Sbjct  118   DPQQQYHRCQRRCQIQEQSPERQRQ-CQQRCERQYKEQQGRERGPEASPRRESRGREEEQ  176

Query  295   eDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNH  474
             +  NPY F  +  R+ H S++G    L RFTER+    GIEN+R  IL+    T + P+H
Sbjct  177   QRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHH  236

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DA+ + +V  G  TL ++ +  ++S+++  G ++ +PAGAT Y++N D+N +L ++KL+
Sbjct  237   KDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLL  296

Query  655   QTISTPGRFEFFFGTGR----NSFLRAFKSSILEAAYDESKETIQRVLRGRD--DSPFIQ  816
             Q ++ PG+F  ++  G      S+LR F + IL AA +  ++ ++R    ++  +   I+
Sbjct  297   QPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIR  356

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVDNDDFKELG--  987
              S E+L++L + + +       + SS  P+ +  +  S SN +GQ FE   ++ ++L   
Sbjct  357   ASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQEM  416

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT-------ERSEEG  1146
             D+ V +A I RG M+ P +N++AT + +VV+G G  +MACP VSSQ+       E+ EE 
Sbjct  417   DVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEE  476

Query  1147  AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLY  1326
             +   ++ V A+L  G +FVIP G+P    ASQ++NL+++ FDIN +NN+R  LAG+NN+ 
Sbjct  477   STGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNNII  536

Query  1327  SNMDDVAKEVSFGVSSKLVDKVFEN  1401
             + ++  AKE+SF +  + ++++FE+
Sbjct  537   NQLEREAKELSFNMPREEIEEIFES  561



>gb|AAM54366.1| vicilin seed storage protein [Juglans nigra]
Length=481

 Score =   262 bits (670),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 145/446 (33%), Positives = 259/446 (58%), Gaps = 19/446 (4%)
 Frame = +1

Query  121   DPELE--TCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgg  294
             DP+ +   C+ +C++Q     +QR+ C  +CER  +E++GR+           +      
Sbjct  6     DPQQQYHRCQRRCQIQEQSPERQRQ-CQQRCERQYKEQQGRERGPEASPRRESKGREEEQ  64

Query  295   eDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNH  474
             +  NPY F  +  R+ H S++G    L RF ER+    GIEN+R  IL+    TF+ P+H
Sbjct  65    QRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPHH  124

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DA+ + +V  G  TL ++ +  ++S+++  G ++ +PAGAT Y++N D+N +L ++KL+
Sbjct  125   KDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLL  184

Query  655   QTISTPGRFEFFFGTGR----NSFLRAFKSSILEAAYDESKETIQRVLRGRD--DSPFIQ  816
             Q ++ PG+   ++  G      S+LR F + IL AA +  ++ ++R    ++  +   I+
Sbjct  185   QPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIR  244

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--  987
              S E+L++L + + +       + SS  P+ +   + S SN +GQ FE   ++ ++L   
Sbjct  245   ASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFGQFFEACPEEHRQLQEM  304

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT-----ERSEEGAI  1152
             D+ V +A I RG M+ P +N++AT + +VV+G G  +MACP VSSQ+      R +E   
Sbjct  305   DVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEEE  364

Query  1153  PT--YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLY  1326
              T  ++ V A+L  G +FVIP G+P    ASQ++NL+++ F IN +NN+R  LAG+N++ 
Sbjct  365   STGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQRNFLAGQNSII  424

Query  1327  SNMDDVAKEVSFGVSSKLVDKVFEND  1404
             + ++  AKE+SF +  + ++++FE+ 
Sbjct  425   NQLEREAKELSFNMPREEIEEIFESQ  450



>sp|Q9SPL3.1|AMP23_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-3; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor, 
partial [Macadamia integrifolia]
 gb|AAD54246.1| vicilin precursor [Macadamia integrifolia]
Length=625

 Score =   265 bits (678),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 153/399 (38%), Positives = 227/399 (57%), Gaps = 16/399 (4%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             DNPY F  R   T  R+++G  SVL  F  RS     ++N+R  +LE     FV P HLD
Sbjct  208   DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD  267

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I LV  G G L +I ++ ++SY++  G ++ IPAG T YL+N DNN +L I K +QT
Sbjct  268   ADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT  327

Query  661   ISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ISTPG++ EFF   G+N   +L  F   ILEAA +   E ++ VL  + +   I+ S EQ
Sbjct  328   ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVLGQQREGVIIRASQEQ  387

Query  832   LKSL-RKESDT-IWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA  1002
             ++ L R +S++  W  +    SS  P ++F  + + SN YGQ +EV  +D+++L D++V+
Sbjct  388   IRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDVS  447

Query  1003  --FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT------  1158
                ANIT+G M+GP FNTR+TK+  V  G+   +MACP +S +      G          
Sbjct  448   VFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGKRHEEEEEVH  507

Query  1159  YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLYSNM  1335
             YE V A+L      V+  G+P V ++S ++NL +  F INA NN    LAG+  N+   +
Sbjct  508   YEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQI  567

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             +  A E++F  S K V+++F N  D  +F  GP   Q +
Sbjct  568   EPQAMELAFAASRKEVEELF-NSQDESIFFPGPRQHQQQ  605



>gb|KDP40207.1| hypothetical protein JCGZ_02205 [Jatropha curcas]
Length=572

 Score =   263 bits (671),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 157/444 (35%), Positives = 253/444 (57%), Gaps = 30/444 (7%)
 Frame = +1

Query  154   RVQMAFDRQ---QREACLDKCERYIqekegrqeergggssgrreeegrggeDDNPYVFQP  324
             R Q   DRQ   Q+  C  +CER  +EK+  +EERG     +  E  +    DNPY F  
Sbjct  136   RCQELCDRQPERQKSQCRGRCERQFEEKQKEREERGSDRGTKSREMEKQR--DNPYYFHA  193

Query  325   RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVA  504
             +  ++ H++Q+G  SVL +F++RS    GIEN+R   LE    TFV P+H DA+ I +V 
Sbjct  194   QRLQSRHKTQEGHISVLEKFSDRSELLRGIENYRLSTLEANPNTFVVPHHCDAESIIVVL  253

Query  505   EGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFE  684
              G+GT+  + +++++SY++  G ++ IPAGAT YL+N DNN KL ++KL+Q +++PG   
Sbjct  254   RGKGTITCVLRDERRSYNLEKGDVIRIPAGATLYLINRDNNEKLNMVKLMQPVNSPG---  310

Query  685   FFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLRKESDTI  864
                     +F   F + +LEAA D  ++ + R+   +     ++ S E LK+L   S  I
Sbjct  311   --------NFRTVFINDVLEAALDTPRDQLDRLFGQQRQGVILKASQEHLKAL---SQHI  359

Query  865   WPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVAFANITRGGMLGPL  1041
                K     S +P ++   + + SN +G   E    D     DI V++A I RG ++ P 
Sbjct  360   SSTKQKGHESERPFNLLNRQPLYSNRFGNFIEASLQDV----DISVSYAEIKRGALMVPH  415

Query  1042  FNTRATKLAFVVDGKGWAQMACPQVSSQ-TERSEEGAIPT--YETVNAQLRPGTLFVIPP  1212
             +N++AT +A VV+G G  +MACP ++SQ  E  EE    T  Y+ +++ L PG +F+ P 
Sbjct  416   YNSKATMIALVVEGAGRFEMACPHLASQRMEPREEPPEGTRQYQKISSDLSPGDVFITPA  475

Query  1213  GNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKV  1392
             G+P   +ASQ+ NL ++ F INA +N+R  LAG++N+ + ++  AKE+SF   ++L++K+
Sbjct  476   GHPVAVLASQNQNLILIGFAINARDNQRNFLAGRDNIMNQIEREAKELSFNSPAELIEKI  535

Query  1393  FENDDDLELFSKGPEWQQSEDRAD  1464
             F N  +    +     QQS  R +
Sbjct  536   FRNQKESHFVAA---RQQSHGREE  556



>ref|XP_009407076.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   262 bits (670),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 156/487 (32%), Positives = 262/487 (54%), Gaps = 61/487 (13%)
 Frame = +1

Query  121   DPE--LETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgg  294
             DPE     CR +C  Q A D++Q + C  +CE      E  +E+R    + R+++E    
Sbjct  139   DPERRYRQCRQEC-TQRAQDKRQLQQCEHRCE------EEYKEQRHREGNPRQKKEETTT  191

Query  295   eDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNH  474
              + NPY F    F    R++ G   VL  F E+S    GI N+R  I+ +  + F+ P+H
Sbjct  192   GERNPYFFDRDSFYEQVRTEHGHVMVLENFLEKSEFLLGIANYRIAIVGLNPRAFLVPHH  251

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
             LDAD I  VA G G L ++ + KK+++++R G I+  PAGA  Y++N D+N + ++IKL+
Sbjct  252   LDADAIYYVARGCGVLTLVCEEKKETHELRRGDILEAPAGAIIYMINKDSNEEFLLIKLL  311

Query  655   QTISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSD  825
               +STPGRFE F+G G     SF  +F   ILEAA++  ++ + R+   +     ++ S+
Sbjct  312   HPVSTPGRFEVFYGAGGQNPKSFFPSFSDEILEAAFNTRRDRLSRIFGQQRKGGIVEASE  371

Query  826   EQLKSLRKESDT--IWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELG--D  990
             EQ+++L + +     WPF   K     P ++ + + + S+  GQ+ E D DD++ L   D
Sbjct  372   EQVRALSRHASEGGQWPFGESKG----PFNLLEKRPIYSSRRGQMHEADGDDYRPLKQLD  427

Query  991   IEVAFANIT-------------------------------RGGMLGPLFNTRATKLAFVV  1077
             + V+  N+T                               +G M+ P +++R+TK+A ++
Sbjct  428   LRVSHFNLTEVYMSYADPVPRAYHGHSFSPWWGMMLGSLLQGSMVAPFYDSRSTKIAVIL  487

Query  1078  DGKGWAQMACPQVSSQTERSEEG--------AIPTYETVNAQLRPGTLFVIPPGNPYVSI  1233
             +G G+ +  CP +S +    EEG            Y+ V +Q+  GT+ +IPPG+P V++
Sbjct  488   EGSGYVETICPHLSERGRSREEGGERHEGREGGQRYQKVRSQVSRGTVAIIPPGHPSVTV  547

Query  1234  ASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDL  1413
             AS+  NL++VCF+I A+ N R  LAG+NN+   +D  AKE++F + ++ V++V     D 
Sbjct  548   ASRGRNLEVVCFEIRAERNVRNFLAGRNNVLKQLDREAKELAFDMPAREVEEVLNAQGD-  606

Query  1414  ELFSKGP  1434
             ++   GP
Sbjct  607   QIIVAGP  613



>ref|XP_009605859.1| PREDICTED: vicilin-like antimicrobial peptides 2-1 [Nicotiana 
tomentosiformis]
Length=440

 Score =   256 bits (654),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/395 (34%), Positives = 232/395 (59%), Gaps = 16/395 (4%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPY+F+ + FR+  +S+ G F VL +FTERS    G+E +   +LE E  +F+ P+H 
Sbjct  40    ENNPYLFESQRFRSRFKSKHGEFRVLEKFTERSELLGGLEKYGVAVLEFEPLSFMFPHHC  99

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA++I  V  G GT+ I ++ +K S+++  G ++ + AG+T Y++N +NN +  +  L +
Sbjct  100   DAEIILFVVRGRGTISIAEQEEKNSFNLENGDVIRVNAGSTIYMINRNNNERFFVYVLAK  159

Query  658   TISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
             T++ PG+F E+F G G N  SF RAF S ILE A++  ++TI+ +   +    F++ S+E
Sbjct  160   TVNIPGQFQEYFSGGGENPESFYRAFSSEILETAFNIPRDTIEGLFGQQRKGIFVKASEE  219

Query  829   QLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQLFEVDNDDFKELGDIEVA-  1002
             Q++++ + +      ++ K  +  P ++   +  + N +GQ FE   + F++L D++ A 
Sbjct  220   QIRAISEHAS-----RSTKQQTRGPFNLLNERPLLGNRFGQYFEATPERFEQLRDLDAAA  274

Query  1003  -FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQ  1179
                NI +GGML P++ TR T    VV+G G  +MACP + SQ++R        Y+ V   
Sbjct  275   GIMNINQGGMLLPVYCTRTTWFVMVVEGNGRFEMACPHLGSQSQRQGR----HYQKVQGS  330

Query  1180  LRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVS  1359
             L  G + +I  G+P   +A+ D +L++V    NA NN    LAG+ +++ N+D  AKEVS
Sbjct  331   LSVGDVLIIRAGHPITVVATGDSDLRMVGIGFNAHNNRMNFLAGRQSIWRNIDREAKEVS  390

Query  1360  FGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRAD  1464
             F + +  V+++ +  D    F  GPE +Q + R +
Sbjct  391   FNMPASEVEEILQKQDQ-SYFVAGPEQRQQQMREE  424



>sp|Q9SPL5.1|AMP21_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-1; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor 
[Macadamia integrifolia]
 gb|AAD54244.1|AF161883_1 vicilin precursor [Macadamia integrifolia]
Length=666

 Score =   262 bits (669),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 151/399 (38%), Positives = 225/399 (56%), Gaps = 16/399 (4%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             DNPY F  R   T  R+++G  SVL  F  RS     ++N+R  +LE     FV P HLD
Sbjct  249   DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD  308

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I LV  G G L +I  + ++SY++  G ++ IPAG T YL+N DNN +L I K +QT
Sbjct  309   ADAILLVIGGRGALKMIHHDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT  368

Query  661   ISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ISTPG++ EFF   G+N   +L  F   ILEAA +   E ++ V   + +   I+ S EQ
Sbjct  369   ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTEKLRGVFGQQREGVIIRASQEQ  428

Query  832   LKSL-RKESDT-IWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA  1002
             ++ L R +S++  W  +    SS  P ++F  + + SN YGQ +EV  +D+++L D++++
Sbjct  429   IRELTRDDSESRHWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYRQLQDMDLS  488

Query  1003  --FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS------SQTERSEEGAIPT  1158
                AN+T+G M+GP FNTR+TK+  V  G+   +MACP +S         +R EE     
Sbjct  489   VFIANVTQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSGRHGGRGGGKRHEEEEDVH  548

Query  1159  YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLYSNM  1335
             YE V A+L      V+  G+P V ++S ++NL +  F INA NN    LAG+  N+   +
Sbjct  549   YEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQI  608

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             +  A E++F    K V++ F N  D  +F  GP   Q +
Sbjct  609   EPQAMELAFAAPRKEVEESF-NSQDQSIFFPGPRQHQQQ  646



>ref|XP_009771135.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nicotiana 
sylvestris]
Length=431

 Score =   254 bits (649),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 138/396 (35%), Positives = 234/396 (59%), Gaps = 14/396 (4%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPY+F+   FR+   S+ G F VL +FTERS    G+E +R  +LE E  +F+ P+H 
Sbjct  29    ENNPYLFKSHRFRSRFTSKHGEFRVLEKFTERSELLGGLEKYRVAVLEFEPLSFMLPHHC  88

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA++I  V  G GT+ I +++++ S+++  G ++ + AG+T Y++N DNN +  +  L +
Sbjct  89    DAEVIFFVVRGRGTISIAEQDEQNSFNLEHGDVIRVNAGSTIYMINRDNNERFFVYVLAK  148

Query  658   TISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
             T++ PG+F E+F G G N  SF RAF S ILE A++ S +TI+ +L  +    F++ S+E
Sbjct  149   TVNIPGQFQEYFSGGGENPESFYRAFSSEILETAFNTSIDTIEGLLGQQRKGIFVKASEE  208

Query  829   QLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQLFEVDNDDFKELGDIEVA-  1002
             Q++++ + +       + K  +  P ++   +  + N +G  FE   + F++L D++ A 
Sbjct  209   QIRAISEHASL-----STKQQTRGPFNLLNERPLLGNKFGHYFEATPERFEQLRDLDAAA  263

Query  1003  -FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQ  1179
                NI +GGML P++ TR T    VV+G G  +MACP +SSQ++   +G    Y+ V   
Sbjct  264   GIMNINQGGMLLPVYCTRTTWFVMVVEGNGRFEMACPHLSSQSQSQRQGR--HYQKVQGS  321

Query  1180  LRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVS  1359
             L  G + +I  G+P   IA+ D  L++V    NA NN    LAG+ +++ N+D  AKEVS
Sbjct  322   LSVGDVMIIRAGHPITVIATGDSELRMVGIGFNAHNNRMNFLAGRQSIWRNVDREAKEVS  381

Query  1360  FGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRADQ  1467
             F + ++ V+++ +  D    F  GPE +Q + R ++
Sbjct  382   FNMPAREVEEILQKQDQ-SYFVAGPEQRQQQMREER  416



>ref|XP_004247580.1| PREDICTED: vicilin GC72-A [Solanum lycopersicum]
 emb|CAP69670.1| vicilin [Solanum lycopersicum]
Length=569

 Score =   257 bits (657),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/401 (33%), Positives = 236/401 (59%), Gaps = 25/401 (6%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY+F+ + FR+  R+  G F +L RF +RS   +GIE +R  ILE+E ++FV P+H D
Sbjct  145   NNPYLFESQRFRSRFRASHGDFRILERFNQRSQLLKGIEKYRVAILELEPQSFVLPHHCD  204

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
              + I +V +G+G ++I +++ K S++++ G ++ + AG+  YL+N DNN KL +  L ++
Sbjct  205   GEAIYVVVKGQGVINIAEQDNKNSFNLQKGDVIRLFAGSNVYLLNKDNNEKLFVYVLAKS  264

Query  661   ISTPGRF-EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ++ PG   E+F   G+N  SF RAF S ILE+A++  ++ ++R+     +   I+ S+EQ
Sbjct  265   VNAPGNLQEYFSAGGQNPESFYRAFSSDILESAFNNPRDKLERLFGQHKEGIIIKASEEQ  324

Query  832   LKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIE--VA  1002
             ++++ + +      +  +  +  P ++ K + V  + +GQ FE   + +++L D++  V 
Sbjct  325   IRAISEHASR--STQQTRGRTQGPFNLMKERPVFESRFGQFFEARPERYEQLRDLDAAVG  382

Query  1003  FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT--------  1158
             F NI +GGM+ P +NT++TKL  V++G    +MACP +  Q++                 
Sbjct  383   FMNINQGGMVLPYYNTKSTKLVMVIEGNARFEMACPHLGRQSQSPWSRGQGREQEREQEQ  442

Query  1159  --------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK  1314
                     Y+ +   L  G + VIP G+P   +A+ + NL+IV F ++A+NN++  LAGK
Sbjct  443   EQEEGDVHYQKIRGNLNVGDVLVIPAGHPITFVATGNSNLRIVGFGVDAENNKKNFLAGK  502

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
              N++ N+D  AKE+SF +  + V+++F+  D    F  GPE
Sbjct  503   QNIWRNIDREAKELSFSMPGREVEEIFQRQDQ-SYFVAGPE  542



>ref|XP_010938152.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Elaeis guineensis]
Length=574

 Score =   257 bits (657),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/410 (36%), Positives = 228/410 (56%), Gaps = 38/410 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             +PY F    F    R++ G   VL  F E+S    G+ N+R  ILE    TFV P+H DA
Sbjct  144   DPYFFDEESFLHRVRTEHGHVRVLRNFLEKSKLLLGVANYRVAILETNPNTFVLPSHWDA  203

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTD-NNNKLVIIKLIQT  660
             + +  VA G G + +  ++ K ++++R G I+ + AG      N+   N KLVI+ L+  
Sbjct  204   EALLFVARGHGHITLQCQDNKATHELRRGDIMRVRAGTIVSFANSGVGNEKLVIVILLHP  263

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ++TPG FE F G G     SF R+F   +L AA++  ++ ++R+ + ++    IQ S EQ
Sbjct  264   VATPGMFEAFVGAGGQNPESFYRSFSKRVLSAAFNTREDKLERLFQKQNKGAIIQASQEQ  323

Query  832   LKSLRKESD-TIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGD--IEV  999
             +K + + S+   WPF      S +P ++F K  + SN +G+L E D+DD+ EL D  I V
Sbjct  324   IKEMSRGSEGRSWPF----GESRRPFNLFHKRPAHSNRHGELREADSDDYPELRDLNIHV  379

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT-------  1158
             ++ANI++G M+ P +NT ATK++ VV G G  Q+ CP +S Q E    G           
Sbjct  380   SYANISKGSMIAPNYNTEATKISVVVGGNGDVQIVCPHISRQQEEGRRGREEEEGRGRQE  439

Query  1159  ------------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINAD  1284
                               Y  V +++  GT F++P G+P VS++S+++NL+++CF+INA 
Sbjct  440   GREEEEEEEEEQQQRGQHYRRVESKVSCGTTFIVPAGHPSVSVSSRNENLEVLCFEINAK  499

Query  1285  NNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             NN+R  LAG+NN+   MD V KE++F +  + VD+V  N    E+F  GP
Sbjct  500   NNQRTWLAGRNNVLKQMDRVTKELAFDLPEREVDEVL-NAPREEVFMAGP  548



>ref|XP_010026941.1| PREDICTED: vicilin C72 [Eucalyptus grandis]
Length=730

 Score =   260 bits (665),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/431 (34%), Positives = 242/431 (56%), Gaps = 31/431 (7%)
 Frame = +1

Query  181   QREACLDKCERYIqekegrqeergggssgrreeegrggeDDNPYVFQPRHFRTAHRSQQG  360
             QR  CL +CER  QE++  +           EEE  G   DNPY F  R   +  R+++G
Sbjct  246   QRRQCLQECERQFQEQQRGKRRSTNPREQEEEEEEVGESGDNPYYFHSRMLHSRFRAEEG  305

Query  361   RFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEGEGTLDIIQKN  540
             +  VL RF +RS    G++N+R  I E    TFV P+H+DAD I +V +GEGT+ ++ ++
Sbjct  306   QIRVLERFDKRSRLLRGLKNYRLEIFEANPNTFVLPHHVDADCILIVLKGEGTISLVWQD  365

Query  541   KKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFFFGTGR---NS  711
             KK+SY +  G ++ +PAG T Y +++  + ++ I KLIQ ++ PG F+ F+  G     S
Sbjct  366   KKQSYHLEGGDVMRVPAGTTVYFISSGRDGQVQIAKLIQPVNIPGTFKEFYPVGTENPES  425

Query  712   FLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSS  891
             + + F S ILE++   S++ I+R+   +     I+ S+EQ ++L + S   W  K     
Sbjct  426   YYKVFSSEILESSLKTSRDQIERLFGQQRQGVMIRASEEQRQALSEHSG--W-LKNKGHG  482

Query  892   SSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVAFANITRGGMLGPLFNTRATKLA  1068
                P ++   + + SN +G+ F+    +FK+L D+ V+      G  + P +N+++  + 
Sbjct  483   LRGPFNLLGREPIYSNEFGRFFQASPGEFKQLLDLGVS------GSTMVPHYNSKSMTVV  536

Query  1069  FVVDGKGWAQMACPQVSSQTER------------------SEEGAIPTYETVNAQLRPGT  1194
              VV+G GW +MACP ++   +R                  +E+G    Y+ V +QL PG 
Sbjct  537   LVVEGNGWFEMACPHLAQAQQRWGSGGEREEEEEEEEEQETEQGGSARYQKVTSQLSPGD  596

Query  1195  LFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSS  1374
             +FVIP G+P   +A Q+++L++V F INA  NER+ LAGK N+ + MD  AKE+SF + +
Sbjct  597   IFVIPAGHPIAIVAGQNEDLRMVGFGINAHKNERIFLAGKENIINRMDTEAKELSFDLPA  656

Query  1375  KLVDKVFENDD  1407
             + VD+VF N +
Sbjct  657   REVDRVFRNQE  667



>ref|XP_003559611.1| PREDICTED: globulin-1 S allele [Brachypodium distachyon]
Length=580

 Score =   256 bits (654),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 165/515 (32%), Positives = 259/515 (50%), Gaps = 85/515 (17%)
 Frame = +1

Query  130   LETCRHQCRVQMAFDRQQREACLDKC--------ERYIqekegrqeergggssgrreeeg  285
             LE C+ +C+   +   QQ E CL +C        E   +  EG    R G     ++++ 
Sbjct  37    LEQCQQRCQEGQSTRHQQAE-CLQQCKDRQQQEQEGRGRHGEGSSSGREGRREDEKQQQQ  95

Query  286   rggeDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVA  465
             +  E   PYVF PR F++  +++QG    LP F+E S    GI+N+R  +LE   ++FV 
Sbjct  96    QQQESRRPYVFGPRSFQSIVQNEQGFIKSLPPFSEASRLLRGIKNYRVAVLEANPRSFVV  155

Query  466   PNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVII  645
             P   DAD IG VA+GEG L +IQ  +++SY +R G ++  PAG   YL NTD   KLV++
Sbjct  156   PGFADADGIGYVAQGEGVLTLIQNGERQSYTVREGDVIVAPAGTLMYLANTDGRRKLVVV  215

Query  646   KLIQTISTPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP------  807
             K++ TIS PG F++F     +S + +    I  AA+  S E +++V   +          
Sbjct  216   KILHTISVPGEFQYFRA---DSLVSSLSKPIQRAAFKASDEQLEKVFGRQRQQQQQEGEE  272

Query  808   ---FIQVSDEQLKSLRKES------DTIWPFKT-DKSSSSKPVDIFKHK-SVSNNYGQLF  954
                 I+ S+EQL+ LR+++       + WP       SS+   ++ + +  +SN +G+L+
Sbjct  273   EGFIIRASEEQLRELRRQASSGSSHGSHWPLPPFGGESSAATFNLLEQRPKISNQHGRLY  332

Query  955   EVDNDDFKELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ-----  1113
             E D   F+ L   D+ VA  NIT G M  P +N+R+ K A VV G G  ++ CP      
Sbjct  333   EADARSFRPLADHDVRVALVNITAGSMTAPFYNSRSVKFAVVVQGSGEVEIVCPHQSSSS  392

Query  1114  --VSSQTER----SEEG-----------------------------------AIPTYETV  1170
                  + ER    SE+G                                       YE +
Sbjct  393   SSSQDEPERRRGQSEQGRESRRGQSERQQQEEQSSEDEREERQQGRGQQQQQQQGRYERI  452

Query  1171  NAQLRPGTLFVIPPGNPYVSIASQ-------DDNLQIVCFDINADNNERVALAGKNNLYS  1329
              A++  G+ FV+PPG+P V IAS        ++NLQI CF+I A+ N+RV LAG NN++S
Sbjct  453   RARVSVGSAFVVPPGHPVVEIASSSRGGGDDNNNLQIACFEIRAEKNDRVYLAGANNVFS  512

Query  1330  NMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
              +D ++K+++FG  ++ VD++   +   + F  GP
Sbjct  513   QLDRISKDLAFG-DARAVDEMVRGNQKKKGFLPGP  546



>ref|XP_007034812.1| Vicilin-A, putative [Theobroma cacao]
 pir||S22477 vicilin precursor - cacao
 gb|EOY05738.1| Vicilin-A, putative [Theobroma cacao]
Length=566

 Score =   255 bits (651),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/415 (34%), Positives = 226/415 (54%), Gaps = 33/415 (8%)
 Frame = +1

Query  301   DNPYVF-QPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             +NPY F + R F+T  R ++G F +L RF E S   +GI ++R  + E    TF+ P+H 
Sbjct  141   NNPYYFPKRRSFQTRFRDEEGNFKILQRFAENSPPLKGINDYRLAMFEANPNTFILPHHC  200

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I  V  G+GT+  +    K+SY+++ G++V +PAG+T Y+V+ DN  KL I  L  
Sbjct  201   DAEAIYFVTNGKGTITFVTHENKESYNVQRGTVVSVPAGSTVYVVSQDNQEKLTIAVLAL  260

Query  658   TISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLR--------GRDDS  804
              +++PG++E FF  G N   S+  AF   +LE  ++  +E ++ +L              
Sbjct  261   PVNSPGKYELFFPAGNNKPESYYGAFSYEVLETVFNTQREKLEEILEEQRGQKRQQGQQG  320

Query  805   PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKE  981
              F +   EQ++++ +++ +       +      +++     V SN  G+ FE   +DF +
Sbjct  321   MFRKAKPEQIRAISQQATS----PRHRGGERLAINLLSQSPVYSNQNGRFFEACPEDFSQ  376

Query  982   LGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEG---  1146
               +++VA +   + +G +  P +N++AT + FV DG G+AQMACP +S Q++ S+ G   
Sbjct  377   FQNMDVAVSAFKLNQGAIFVPHYNSKATFVVFVTDGYGYAQMACPHLSRQSQGSQSGRQD  436

Query  1147  -----------AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNE  1293
                            ++ V A L PG +FV P G+     AS+D  L  V F +NA NN+
Sbjct  437   RREQEEESEEETFGEFQQVKAPLSPGDVFVAPAGHAVTFFASKDQPLNAVAFGLNAQNNQ  496

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
             R+ LAGK NL   MD  AKE+SFGV SKLVD +F N D+    S   + Q+ ++R
Sbjct  497   RIFLAGKKNLVRQMDSEAKELSFGVPSKLVDNIFNNPDESYFMSFSQQRQRGDER  551



>gb|AAK28402.1|AF250228_1 7S globulin [Elaeis guineensis]
Length=572

 Score =   253 bits (647),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/395 (36%), Positives = 221/395 (56%), Gaps = 35/395 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             +PY F    F    R++ G   VL  F E+S    G+ N+R  ILE    TFV P+H DA
Sbjct  144   DPYFFDEESFLHRVRTEHGHVRVLRNFLEKSKLLLGVANYRVAILETNPNTFVLPSHWDA  203

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTD-NNNKLVIIKLIQT  660
             + +  VA G G + +  ++ K ++++R G I+ + AG      N    N KLVI+ L+  
Sbjct  204   EALLFVARGHGHITLQCQDNKATHELRRGDIMRVRAGTIVSFANRGVGNEKLVIVILLHP  263

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ++TPG FE F G G     SF R+F   +L AA++  ++ ++R+ + ++    IQ S EQ
Sbjct  264   VATPGMFEAFVGAGGQNPESFYRSFSKRVLSAAFNTREDKLERLFQKQNKGAIIQASQEQ  323

Query  832   LKSLRKESD-TIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGD--IEV  999
             +K + + S+   WPF      S +P ++F K  + SN +G+L E D+DD+ EL D  I V
Sbjct  324   IKEMSRGSEGRSWPF----GESRRPFNLFHKRPAHSNRHGELREADSDDYPELRDLNIHV  379

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT-------  1158
             ++ANI++G M+ P +NT ATK++ VV G G  Q+ CP +S Q E    G           
Sbjct  380   SYANISKGSMIAPNYNTEATKISVVVGGNGDVQIVCPHISRQQEEGRRGREEEEGRGRQE  439

Query  1159  ----------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNN  1290
                             Y  V +++  GT F++P G+P VS++S+++NL+++CF+INA NN
Sbjct  440   GREEEEEEEQQQRGQHYRRVESKVSCGTTFIVPAGHPSVSVSSRNENLEVLCFEINAKNN  499

Query  1291  ERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVF  1395
             +R  LAG+NN+   MD V KE++F +  + VD+V 
Sbjct  500   QRTWLAGRNNVLKQMDRVTKELAFDLPEREVDEVL  534



>prf||1905429A major storage protein
Length=566

 Score =   253 bits (645),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 220/404 (54%), Gaps = 33/404 (8%)
 Frame = +1

Query  301   DNPYVF-QPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             +NPY F + R F+T  R ++G F +L RF E S   +GI ++R  + E    TF+ P+H 
Sbjct  141   NNPYYFPKRRSFQTRFRDEEGNFKILQRFAENSPPLKGINDYRLAMFEANPNTFILPHHC  200

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I  V  G+GT+  +    K+SY+++ G++V +PAG+T Y+V+ DN  KL I  L  
Sbjct  201   DAEAIYFVTNGKGTITFVTHENKESYNVQRGTVVSVPAGSTVYVVSQDNQEKLTIAVLAL  260

Query  658   TISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLR--------GRDDS  804
              +++PG++E FF  G N   S+  AF   +LE  ++  +E ++ +L              
Sbjct  261   PVNSPGKYELFFPAGNNKPESYYGAFSYEVLETVFNTQREKLEEILEEQRGQKRQQGQQG  320

Query  805   PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKE  981
              F +   EQ++++ +++ +       +      +++     V SN  G+ FE   +DF +
Sbjct  321   MFRKAKPEQIRAISQQATS----PRHRGGERLAINLLSQSPVYSNQNGRFFEACPEDFSQ  376

Query  982   LGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEG---  1146
               +++VA +   + +G +  P +N++AT + FV DG G+AQMACP +S Q++ S+ G   
Sbjct  377   FQNMDVAVSAFKLNQGAIFVPHYNSKATFVVFVTDGYGYAQMACPHLSRQSQGSQSGRQD  436

Query  1147  -----------AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNE  1293
                            ++ V A L PG +FV P G+     AS+D  L  V F +NA NN+
Sbjct  437   RREQEEESEEETFGEFQQVKAPLSPGDVFVAPAGHAVTFFASKDQPLNAVAFGLNAQNNQ  496

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFS  1425
             R+ LAGK NL   MD  AKE+SFGV SKLVD +F N D+    S
Sbjct  497   RIFLAGKKNLVRQMDSEAKELSFGVPSKLVDNIFNNPDESYFMS  540



>ref|XP_008775109.1| PREDICTED: globulin-1 S allele [Phoenix dactylifera]
Length=564

 Score =   251 bits (642),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/406 (35%), Positives = 225/406 (55%), Gaps = 33/406 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             +PY F+   F    R++ G   VL  F ERS    G+ N+R  ILE    TFV P+H DA
Sbjct  139   DPYFFEEESFLHRVRTEHGNVRVLRNFLERSKLLLGVANYRVAILEANPNTFVLPSHWDA  198

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + +  VA G G +    ++ K++ ++R G I+ + AG     VN D N KLVI+ L QT+
Sbjct  199   EALLFVARGNGLITRQCQDNKETQELRRGHIIRVRAGTIVSFVNKDRNEKLVIVMLFQTV  258

Query  664   STPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             +TPG  E F G  GRN  SF R+F   +L AA++   + ++R+   +     I+ S EQ+
Sbjct  259   ATPGMLEAFVGAGGRNPESFYRSFSKPVLRAAFNTGVDKLERLFGRQKKGAMIEASQEQI  318

Query  835   KSLRKESDT---IWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELGD--IE  996
             + L + + +    WPF      S +P ++  K  S SN +G+L E D DD+ EL D  I+
Sbjct  319   RELSRRAGSEGLPWPF----GESRRPFNLLDKRPSHSNRHGELREADRDDYPELRDLNIQ  374

Query  997   VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS-------------------  1119
             VA A I +G M+ P +NT AT ++ VV G G  Q+ CP VS                   
Sbjct  375   VALARINKGSMMSPNYNTEATTISIVVGGNGQVQIVCPHVSRQQEEGRGREGEEGRGQQE  434

Query  1120  SQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERV  1299
              + E  ++     Y+ V +++  GT +++P G+P V+++S++++L+++CF+INA NN+R 
Sbjct  435   GKEEEEQQQRGQRYQRVESEVSRGTTYIVPAGHPSVAVSSRNESLEVLCFEINAMNNQRT  494

Query  1300  ALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
              LAG NN+   MD + KE++F   ++ VD+V  N    E+F  GP+
Sbjct  495   WLAGSNNILKQMDRMTKELAFDQPAREVDEVL-NAPREEVFMAGPQ  539



>gb|ABV49593.1| 7S vicilin [Carya illinoinensis]
Length=784

 Score =   252 bits (644),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 146/436 (33%), Positives = 245/436 (56%), Gaps = 21/436 (5%)
 Frame = +1

Query  121   DPELE--TCRHQCRVQMAFDRQQREACLDKCER-YIqekegrqeergggssgrreeegrg  291
             DP+ +   C+ +C+ Q     +QR+ C  +CER Y +++                     
Sbjct  306   DPQQQYHRCQRRCQTQEQSPERQRQ-CQQRCERQYKEQQGREWGPDQASPRRESRGREEE  364

Query  292   geDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPN  471
              +  NPY F  +  R+ H S +G    L RFTER+    GIEN+R  ILE    TFV P 
Sbjct  365   QQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPY  424

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DA+ + +V  G  TL  + + +++S+++  G ++ +PAGAT Y++N D+N +L ++KL
Sbjct  425   HKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKL  484

Query  652   IQTISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRD--DSPFIQ  816
             +Q ++ PG+F  ++  G     S+LR F + IL AA +  ++ ++R    ++  +   I+
Sbjct  485   LQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIR  544

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--  987
              S E+L++L + + +       + SS  P+ +   + S SN +GQ FE   ++ ++L   
Sbjct  545   ASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEM  604

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ-VSSQT--------ERSE  1140
             D+ V +A I RG M+ P +N++AT + +VV+G G  +MACP  VSSQ+        +  E
Sbjct  605   DVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEE  664

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
             E +   ++ V A+L  G +FVIP G+P    ASQ++NL++V F IN  NN+R  LAG+NN
Sbjct  665   ESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAGQNN  724

Query  1321  LYSNMDDVAKEVSFGV  1368
             + + ++  AKE+SF +
Sbjct  725   IINQLEREAKELSFNM  740



>gb|ABV49590.1| 7S vicilin [Carya illinoinensis]
 gb|ABV49591.1| 7S vicilin [Carya illinoinensis]
 gb|ABV49592.1| 7S vicilin [Carya illinoinensis]
Length=792

 Score =   252 bits (644),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 146/436 (33%), Positives = 245/436 (56%), Gaps = 21/436 (5%)
 Frame = +1

Query  121   DPELE--TCRHQCRVQMAFDRQQREACLDKCER-YIqekegrqeergggssgrreeegrg  291
             DP+ +   C+ +C+ Q     +QR+ C  +CER Y +++                     
Sbjct  314   DPQQQYHRCQRRCQTQEQSPERQRQ-CQQRCERQYKEQQGREWGPDQASPRRESRGREEE  372

Query  292   geDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPN  471
              +  NPY F  +  R+ H S +G    L RFTER+    GIEN+R  ILE    TFV P 
Sbjct  373   QQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPY  432

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DA+ + +V  G  TL  + + +++S+++  G ++ +PAGAT Y++N D+N +L ++KL
Sbjct  433   HKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKL  492

Query  652   IQTISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRD--DSPFIQ  816
             +Q ++ PG+F  ++  G     S+LR F + IL AA +  ++ ++R    ++  +   I+
Sbjct  493   LQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIR  552

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--  987
              S E+L++L + + +       + SS  P+ +   + S SN +GQ FE   ++ ++L   
Sbjct  553   ASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQFFEACPEEHRQLQEM  612

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ-VSSQT--------ERSE  1140
             D+ V +A I RG M+ P +N++AT + +VV+G G  +MACP  VSSQ+        +  E
Sbjct  613   DVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEE  672

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
             E +   ++ V A+L  G +FVIP G+P    ASQ++NL++V F IN  NN+R  LAG+NN
Sbjct  673   ESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAGQNN  732

Query  1321  LYSNMDDVAKEVSFGV  1368
             + + ++  AKE+SF +
Sbjct  733   IINQLEREAKELSFNM  748



>gb|AGU37285.1| 7S globulin precursor isoform 2, partial [Ficus pumila var. awkeotsang]
Length=676

 Score =   249 bits (637),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 137/410 (33%), Positives = 238/410 (58%), Gaps = 30/410 (7%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY  + +  ++ +R+ +G   VL + + RS   +G+EN+R  +LE    TFV P+H D
Sbjct  253   ENPYHIRSQRLQSRYRTDEGHLKVLEKLSSRSELLKGLENYRIVVLEANPNTFVVPHHCD  312

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD + +V  G GT+ I+++N K+SY+I    ++ + AG+T YLVN D+N +L I KL+ +
Sbjct  313   ADSVLVVTRGRGTISIVRQNNKESYNIECADVITVRAGSTVYLVNDDDNERLQITKLVTS  372

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVL----RGR---DDSPF  810
             ++ PG+FE +F  G +   S+ +AF ++IL+     +++ I+R++    +GR       F
Sbjct  373   VNIPGQFEEYFAAGGDNPQSYFKAFSTNILKRTLSATEDQIERLIGQQSQGRRQLQRPGF  432

Query  811   IQ-VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKEL  984
             I+  S EQL++L + + +  P +  + S+  P+ +     + SNNYG+ +E   +D K+L
Sbjct  433   IKRASQEQLRALTQHASS--PRRRGRESTG-PISLRNQSPLYSNNYGKFYEASPEDNKQL  489

Query  985   G--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAI--  1152
                D+ V++ ++ +G +  P +N+R T L  VV+G+G  +MACP +S Q  + E G    
Sbjct  490   HDMDVHVSWTDLEQGSIFVPHYNSRTTVLCMVVEGEGEMEMACPHLSRQRRQREWGQEEE  549

Query  1153  ----------PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVA  1302
                         Y+ V A+L  G +F+IP G+P   +AS + NL++V F +NA NNER  
Sbjct  550   EEEEMQTSTGSRYQKVTARLSQGDVFIIPAGHPISVVASGNRNLKMVGFGVNAKNNERYF  609

Query  1303  LAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             +AGK+N+   ++  AKE++F +  + V+++F N   L  F      Q+ E
Sbjct  610   IAGKDNMIKQLEREAKELAFNMPGREVEQIF-NQPRLSFFVPQERSQEEE  658



>ref|NP_001173574.1| Os03g0663800 [Oryza sativa Japonica Group]
 dbj|BAH92302.1| Os03g0663800 [Oryza sativa Japonica Group]
Length=406

 Score =   242 bits (618),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 203/367 (55%), Gaps = 44/367 (12%)
 Frame = +1

Query  466   PNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVII  645
             P H DA  I  VA+GEG + II+  +K SY IR G +   PAG  +YL NTD   KL++ 
Sbjct  2     PTHTDAHCICYVAQGEGVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANTDGRRKLIVT  61

Query  646   KLIQTISTPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQ  816
             K++ TIS PG+ +FFF   GRN  SFL +F   +  AA+  S+E ++++L  +D    I+
Sbjct  62    KILHTISVPGQIQFFFAPGGRNPESFLSSFSKGVQRAAFKISEEKLEKLLGKQDKGVIIR  121

Query  817   VSDEQLKSLRKESD-----TIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQLFEVDNDDFK  978
              S+EQ++ LR+ +        WP      SS  P +I + +   +N +G+L+E D   F 
Sbjct  122   ASEEQVRELRRHASEGGHGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFH  181

Query  979   ELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV------------  1116
             +L   DI VA  NIT G M  P +NTR+ K+A+V+DG+G A++ CP +            
Sbjct  182   DLAEHDIRVAVVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGGRGGESEER  241

Query  1117  --------------------SSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIA  1236
                                   Q E  EE     YET+ A+L  GT+FV+P G+P V  +
Sbjct  242   RRERGKGKWREEEEEEEEQQKGQEEEEEEQVGQGYETIRARLSRGTVFVVPSGHPIVVTS  301

Query  1237  SQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLE  1416
             S+D  LQIVCFD++A+NNER+ LAG N++   +D  AKE++F  S++ VD++  N     
Sbjct  302   SRDSTLQIVCFDVHANNNERMYLAGMNSVLKKLDPQAKELAFAASAREVDELL-NAQQES  360

Query  1417  LFSKGPE  1437
              F  GPE
Sbjct  361   AFLAGPE  367



>ref|XP_002517098.1| Vicilin GC72-A precursor, putative [Ricinus communis]
 gb|EEF45261.1| Vicilin GC72-A precursor, putative [Ricinus communis]
Length=613

 Score =   246 bits (628),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/391 (34%), Positives = 222/391 (57%), Gaps = 20/391 (5%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  +  R+  ++ +G   VL +F+E S    GIEN+R  +L+    TF+ PNH D
Sbjct  204   NNPYYFHAQRLRSPFKTDEGHIRVLEKFSESSELLRGIENYRLLLLDAVPNTFIVPNHFD  263

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ + +V  G+ T+  + + K+ SY++  G ++ IPAGAT Y+ N DNN  L +  LIQ 
Sbjct  264   AESLVVVLNGKCTISYVLREKRVSYNLETGDVIKIPAGATVYMSNHDNNEMLRLATLIQP  323

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ++ PG F  F   G     SF   F + +LEAA D  ++ + ++   +     ++   +Q
Sbjct  324   VNIPGEFSSFSAAGGGNLESFYTVFSNDVLEAALDTPRDQLDKLFGQQRQGVIVKAPQKQ  383

Query  832   LKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIE--VA  1002
             LK+L +         + +     P+++   + + SN YG L+E   +D K+L D++  V+
Sbjct  384   LKALSQR------VSSTRQKGQAPLNLRNQQPLYSNRYGNLWEASPNDHKQLQDMDVSVS  437

Query  1003  FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE------EGAIPTYE  1164
             +A I RG ++ P +N+R T +  V++G G  +MACP V+SQ ++        +G    Y 
Sbjct  438   YAEIKRGSLMVPHYNSRTTTIGLVLEGSGRVEMACPHVASQKQKESQQEQETKGGAEHYR  497

Query  1165  TVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KNNLYSNMDD  1341
              +++ L PG +F++P G+P   +ASQ++NL  + F INA NN R  LAG ++N+ + ++ 
Sbjct  498   KISSNLSPGGVFIMPAGHPTALLASQNENLLTLWFGINASNNHRNFLAGQRDNVMNQIEI  557

Query  1342  VAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
              AKE+SF V ++L++K+F N  +   F  GP
Sbjct  558   EAKELSFNVPAELIEKIFRNQKESH-FVAGP  587



>ref|XP_006360765.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Solanum 
tuberosum]
Length=567

 Score =   245 bits (625),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 234/399 (59%), Gaps = 23/399 (6%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY+F+ + FR+ +R+  G F +L +F +RS   +GIE +R  +LE+E ++FV P+H D
Sbjct  145   NNPYLFESQRFRSRYRASHGDFRILEKFNQRSQLLKGIEKYRVSVLELEPQSFVLPHHCD  204

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
              + I +V +G+G + I +++ K S++++ G ++ + AG+  Y++N DNN KL +  L ++
Sbjct  205   GEAIFVVVKGQGIISIAEQDNKNSFNLQKGDVIRVFAGSNVYMLNKDNNEKLFVYVLAKS  264

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ++ PG  + +F  G     +F +AF S ILE+A++  ++ ++R+     +   I+ S+EQ
Sbjct  265   VNAPGNLQQYFSAGGQNPETFYKAFSSDILESAFNNPRDKLERLFGQHKEGIIIKASEEQ  324

Query  832   LKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIE--VA  1002
             ++++ + +      +  K  +  P ++ K + +  + +GQ FE   + F++L D++  V 
Sbjct  325   IRAISEHASR--STQQTKGRTQGPFNLLKERPLFESKFGQFFEACPERFEQLRDLDAAVG  382

Query  1003  FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE--------------RSE  1140
             F NI +GGM+ P +NT++TKL  VV+G    +MACP +  Q +              + +
Sbjct  383   FMNINQGGMVLPYYNTKSTKLVMVVEGNARFEMACPHLGRQGQSPWSRGQGREHEQEQEQ  442

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
             E     Y+ +   L  G + VIP G+P   +A+ + N++IV F ++A N+++  LAGK +
Sbjct  443   EEGEVHYQKIRGNLNVGDVLVIPAGHPITFVATGNSNVRIVGFGVDAQNSKKNFLAGKQS  502

Query  1321  LYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
             ++ N+D  AKE+SF +  + V+++ +  D    F  GPE
Sbjct  503   IWRNVDREAKELSFSMPGREVEEILQKQDQ-SYFVAGPE  540



>gb|EAY91281.1| hypothetical protein OsI_12896 [Oryza sativa Indica Group]
Length=520

 Score =   241 bits (614),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 145/417 (35%), Positives = 209/417 (50%), Gaps = 80/417 (19%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF  R FR   RS QG   +LP F + S+   GI+N+R  +LE   ++FV P H DA 
Sbjct  105   PYVFGRRSFRQVVRSDQGSVRLLPPFHQASSLLRGIKNYRVAVLEANPRSFVMPTHTDAH  164

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              I  VA+GEG + II+  +K SY IR G +   PAG  +YL NTD   KL+I        
Sbjct  165   CICYVAQGEGVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANTDGRRKLII--------  216

Query  667   TPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLR  846
                                            S+E ++++L  +D    I+ S+EQ++ LR
Sbjct  217   -------------------------------SEEKLEKLLGKQDKGVIIRASEEQVRELR  245

Query  847   KESD-----TIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--DIEVA  1002
             + +        WP      SS  P +I + +   +N +G+L+E D   F +L   DI VA
Sbjct  246   RHASEGGHGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDIRVA  305

Query  1003  FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV----------------------  1116
               NIT G M  P +NTR+ K+A+V+DG+G A++ CP +                      
Sbjct  306   VVNITAGSMNAPFYNTRSVKVAYVLDGEGEAEIVCPHLSRGGRGGESEERRRERGKGKWR  365

Query  1117  ----------SSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVC  1266
                         Q E  EE     YET+ A+L  GT+FV+P G+P V  +S+D  LQIVC
Sbjct  366   EEEEEEEEQQKGQEEEEEEQVGQGYETIRARLSRGTVFVVPSGHPIVVTSSRDSTLQIVC  425

Query  1267  FDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
             FD++A+NNER+ LAG N++   +D  AKE++F  S++ VD++  N      F  GPE
Sbjct  426   FDVHANNNERMYLAGMNSVLKKLDPQAKELAFAASAREVDELL-NAQQESAFLAGPE  481



>dbj|BAA34056.1| PV100 [Cucurbita maxima]
Length=810

 Score =   246 bits (629),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 141/406 (35%), Positives = 232/406 (57%), Gaps = 32/406 (8%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY FQ + F++ +RS +G + VL RF+ERS   +GI+N R  +LE    TF+ P+HLD
Sbjct  388   NNPYYFQEQRFQSRYRSDEGHWRVLERFSERSELLKGIKNQRLALLEARPHTFIVPHHLD  447

Query  481   ADLIGLVAEGEGTLDII----QKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIK  648
             A+ + LV  G  T+  +    ++ +K+SY++  G ++ IPAG T YL N +N + L I+K
Sbjct  448   AECVLLVVRGRATITTVVQEKRETRKESYNVESGDVMTIPAGTTLYLANQENED-LQIVK  506

Query  649   LIQTISTPGRFEFFFGTGRNS--FLRAFKSSILEAAYDESKETIQRVLRGRDD--SPFIQ  816
             L+Q ++ PG F+ +   G  S  +   F + +LEAA +  ++ ++R+ + R +     ++
Sbjct  507   LVQPVNNPGEFKDYLSAGGESQAYYSVFSNDVLEAALNIPRDKLERIFKQRRERGGKIVR  566

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVSNN-YGQLFEVDNDDFKEL--G  987
              S EQL++L + + ++   +        P+ +     V NN YGQ+FE   D+F +L   
Sbjct  567   ASQEQLRALSQRATSV---RKGSRGVRAPIKLESQTPVYNNQYGQMFEACPDEFPQLRRT  623

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-SSQTE-----------  1131
             D+  +  +I +GGM+ P FN+RAT + FV +G G  +MACP + SSQ +           
Sbjct  624   DVATSVVDIKQGGMMVPHFNSRATWVVFVSEGAGSFEMACPHIQSSQWQRGRREEERHWR  683

Query  1132  ----RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERV  1299
                    E     +E V  +L  G + VIP G+P   +AS ++NL++V F INA+NN R 
Sbjct  684   REEEEEREERSGRFERVAGRLSEGGVLVIPAGHPIAIMASPNENLRLVGFGINAENNHRN  743

Query  1300  ALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
              LAG+ N+ + +D  AKE++F V  K  D++F +  +   F++GPE
Sbjct  744   FLAGRENIMNELDREAKELAFNVEGKQADEIFRSQRE-SFFTEGPE  788



>ref|XP_006650713.1| PREDICTED: globulin-1 S allele-like [Oryza brachyantha]
Length=475

 Score =   238 bits (608),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 223/419 (53%), Gaps = 51/419 (12%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY F    FR   R++ GRFSVL RF++       + ++R  +LE   + F+ P+H DAD
Sbjct  58    PYHFGEESFRHWTRTRHGRFSVLERFSDEP-LVGAVWDYRVAVLEAAPRAFLQPSHYDAD  116

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  V EGEG + ++++ +++S+ +R G  + IPAGA  Y  NT ++    ++ L+  +S
Sbjct  117   EVFYVKEGEGVIVLLREGRRESFCVREGDAMVIPAGAIVYSANTHSSKWFRVVMLLNPVS  176

Query  667   TPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVL-RGRDDSPFIQVSDEQL  834
             TPGRFE +F  G +   SF  AF   +L+AA++  +E +++V  R R+        +EQ+
Sbjct  177   TPGRFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKVFERQREGGEITTAPEEQV  236

Query  835   KSLRKESDTI------WPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELG--D  990
             + L K           W  K    +  +P       + SNN+G++FE+D D+ + L   D
Sbjct  237   RELSKSCSRGGGSGSEWEIKPSSLTGKRP-------TYSNNHGKMFEIDGDECRHLRKLD  289

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV------------------  1116
             + V  ANITRG M+ P ++TRATK+A V+ G G+ +MACP V                  
Sbjct  290   MLVGLANITRGSMMAPSYSTRATKVAMVLHGSGYFEMACPHVSGGRSSERREREREQGRR  349

Query  1117  ----------SSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVC  1266
                         +     +     Y  V AQ+R G++ VIP  +P   +A  D+NL ++C
Sbjct  350   EEWGREEEEQEEEQHGGRQQKARRYHKVRAQVREGSVIVIPAAHPATFVAGDDENLSVLC  409

Query  1267  FDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSS--KLVDKVFENDDDLELFSKGPE  1437
             F + A+ +++V LAG+N+L   +DD AK + FG S+  ++VD+V     + ++F +GP 
Sbjct  410   FGVGANYDDKVFLAGRNSLLRQLDDPAKALVFGGSAAREMVDRVLAAQPE-QIFLRGPH  467



>gb|EMT20973.1| Globulin-1 S allele [Aegilops tauschii]
Length=569

 Score =   241 bits (615),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 145/413 (35%), Positives = 222/413 (54%), Gaps = 39/413 (9%)
 Frame = +1

Query  331   FRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEG  510
             F +  R+  G    L  F E S    GI N+R  I+EV  + FV P   DAD +G VA+G
Sbjct  144   FGSIIRTDHGFVKALRPFDEVSRLLRGIRNYRVAIMEVNPRAFVVPGLTDADGVGYVAQG  203

Query  511   EGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFF  690
             EG L +I+  +K+SY +R G ++  PAG+  +L NTD   KL+I K++ TIS PG F++F
Sbjct  204   EGVLTVIENGEKRSYTVREGDVIVAPAGSIMHLANTDGRRKLIIAKILHTISVPGMFQYF  263

Query  691   FGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDS-------PFIQVSDEQLKSLRK  849
                     L +    +L AA   S E ++R+L  R            ++ S+EQL  L +
Sbjct  264   SA---KPLLASLSKRVLRAALKTSDERLERLLDPRQGQEKTGGSMSIVRASEEQLHELSR  320

Query  850   ESD-----TIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--DIEVAF  1005
             ++        WP    +  S    ++ + +  ++N +G+L+E D   F  L   D+ VA 
Sbjct  321   QASEGSQGHHWPLPPFRGDSRDTYNLLEQRPKIANRHGRLYEADARSFHALAQHDVRVAV  380

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKG------WA----------QMACPQVSSQTERS  1137
             ANIT G M  P  NT++ KLA V++G+G      W+          +       S++E  
Sbjct  381   ANITPGSMTAPYLNTQSFKLAVVLEGEGEQGKGRWSEEEDDDQRQQRRRGSGSESESESE  440

Query  1138  EEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQ--DDNLQIVCFDINADNNERVALAG  1311
             E+     Y+T+ A++  G+ FV+PPG+P V IAS     NLQ+VCF+INA+ NERV LAG
Sbjct  441   EQQDQQRYQTIRARVSRGSAFVVPPGHPVVEIASSQGSSNLQVVCFEINAERNERVWLAG  500

Query  1312  KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDL-ELFSKGPEWQQSEDRADQ  1467
             +NN+   +D+ A+E++FG  ++ V +VF   D   E F  GPE  Q ++R ++
Sbjct  501   RNNVIGKLDNPAQELTFGRPAREVQEVFRAKDQQDEGFVAGPE--QDQERGER  551


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = +1

Query  436  LEVESKTFVAPNHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVN  615
            +EV  + FV P   DAD +G VA+GEG L +I+  +K+SY +R G ++  PAG+  +L N
Sbjct  1    MEVNPRAFVVPGFTDADGVGYVAQGEGVLTVIESGEKRSYTVRQGDVIVAPAGSIMHLAN  60

Query  616  TDNNNKLVIIKLIQTISTPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKET  771
            TD   KLVI K++ TIS PGRF++F        L +    +L AA  +   T
Sbjct  61   TDARRKLVIAKILHTISVPGRFQYFSA---KPLLASLSKRVLRAALKKKLGT  109



>ref|XP_008439368.1| PREDICTED: vicilin [Cucumis melo]
Length=735

 Score =   243 bits (621),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 230/407 (57%), Gaps = 35/407 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY FQ R F++  RS QG++ VL RF+ERS    G++N R  ILE   +TF+ P+H+DA
Sbjct  311   NPYYFQERQFQSRFRSDQGQWRVLERFSERSELLRGLKNQRLAILEARPQTFIIPHHIDA  370

Query  484   DLIGLVAEGEGTLDII----QKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             + +  V +G  T+  I    ++ +K+SY++  G +V IPAG T YL N +N + L I+KL
Sbjct  371   ESVLFVVKGRATITTIVQERKETRKESYNVERGDVVTIPAGTTVYLANQENED-LQIVKL  429

Query  652   IQTISTPGRFEFFFGTG--RNSFLRAFKSSILEAAYDESKETIQRVL--RGRDDSPFIQV  819
             IQ ++ PG F+ +   G    S+   F + +LEAA +  ++ ++R+   RG      I+ 
Sbjct  430   IQPVNNPGEFKDYLSGGGEAQSYYSVFSNDVLEAALNIPRDRLERIFKQRGERRGKIIRA  489

Query  820   SDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVSNN-YGQLFEVDNDDFKEL--GD  990
             S EQLK+L + + ++   K     +   + +     V NN YGQ++E   D+F +L   D
Sbjct  490   SQEQLKALSQRATSV---KKGGRGARSLIKLESQSPVYNNQYGQMYEACPDEFPQLRRTD  546

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS----------------  1122
             +  +  +I +GGM+ P FN+RAT + FV +G G  +M CP V                  
Sbjct  547   VATSVLDIKQGGMMVPHFNSRATWVVFVSEGTGSFEMGCPHVQGSQWQRGRREEERQWRR  606

Query  1123  --QTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
               + E S+E +    E +  +L  G + VIP G+P   +AS ++NL++V F INA+NN+R
Sbjct  607   EEEKELSDERS-GRIERIAGRLSQGGVLVIPAGHPIAIMASPNENLRLVGFGINAENNKR  665

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
               LAG+ N+ + +D  AKE++F V  K  ++ F++  +   F++GPE
Sbjct  666   NFLAGRENIMNEVDREAKELTFNVEGKQAEETFKSQKE-SFFTEGPE  711



>gb|EEC76319.1| hypothetical protein OsI_13867 [Oryza sativa Indica Group]
Length=470

 Score =   235 bits (600),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 219/412 (53%), Gaps = 32/412 (8%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY F    FR   R++ GRFSVL RF +       +  +R  +LE   + F+ P+H DAD
Sbjct  56    PYHFGEESFRHWTRTRHGRFSVLERFPDEQVVGAAVGGYRVAVLEAAPRAFLQPSHYDAD  115

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  V EGEG + ++++ +K+S+ +R G  + IPAGA  Y  NT ++    ++ L+  +S
Sbjct  116   EVFYVKEGEGVIVLLREGRKESFCVREGDAMVIPAGAIVYSANTHSSKWFRVVMLLNPVS  175

Query  667   TPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVL-RGRDDSPFIQVSDEQL  834
             TPG FE +F  G +   SF  AF   +L+AA++  +E +++V  R R+        +EQ+
Sbjct  176   TPGHFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKVFERQREGGEITTAPEEQI  235

Query  835   KSLRKESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG--DIEVAF  1005
             + L K         +      KP  +  K    SNN+G+LFE+  D+ + L   D+++  
Sbjct  236   RELSKSCSRGGGGGSGSEWEIKPSSLTGKSPYFSNNHGKLFELTGDECRHLKKLDLQIGL  295

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT---------  1158
             ANITRG M+ P +NTRATKLA V+ G G+ +MACP VS                      
Sbjct  296   ANITRGSMIAPNYNTRATKLAVVLQGSGYFEMACPHVSGGGSSERREREREHGRRREEEQ  355

Query  1159  --------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
                           Y  V AQ+R G++ VIP  +P   +AS+ ++L +VCF + A+++E+
Sbjct  356   GEEEHGERGEKARRYHKVRAQVREGSVIVIPASHPATIVASEGESLAVVCFFVGANHDEK  415

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVS-SKLVDKVFENDDDLELFSKGPEWQQS  1449
             V LAG+N+    +DD AK++ FG S ++  D+V     + ++  +GP  + S
Sbjct  416   VFLAGRNSPLRQLDDPAKKLVFGGSAAREADRVLAAQPE-QILLRGPHGRGS  466



>ref|XP_010108323.1| Vicilin-like antimicrobial peptides 2-1 [Morus notabilis]
 gb|EXC18944.1| Vicilin-like antimicrobial peptides 2-1 [Morus notabilis]
Length=914

 Score =   242 bits (618),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 137/409 (33%), Positives = 238/409 (58%), Gaps = 30/409 (7%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F+    ++ +R+++G   VL   + RS   +G++N+R  +LE    TFV P+H D
Sbjct  495   ENPYHFRSHRLQSRYRTEEGHLKVLEMLSRRSELLKGLKNYRIVVLEANPNTFVVPHHCD  554

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD + +V  G+GT+ I+++N K+SY+I    ++ + AG+T YLVN D N  L I KL+  
Sbjct  555   ADSVLVVTRGKGTISIVRQNNKESYNIERADVITVLAGSTVYLVN-DQNEPLQITKLVTP  613

Query  661   ISTPGRFEFFF-GTGRN--SFLRAFKSSILEAAYDESKETIQRVL------RGRDDSP-F  810
             ++ PG+FE ++ G G N  S+ +AF ++IL++    ++E I+R++      R +   P F
Sbjct  614   VNIPGQFEEYYPGGGENPQSYFKAFSTNILKSTLSATEEQIERLIGEQREGRRQLQRPGF  673

Query  811   IQ-VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFK-HKSVSNNYGQLFEVDNDDFKEL  984
             I+  S EQL++L + + +  P +     ++ P+ +     + SNNYG+ +E   +D K+L
Sbjct  674   IKRASQEQLQALTQHASS--PRRKGGRQTTGPISLHSLSPTYSNNYGKFYEATPEDNKQL  731

Query  985   G--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEG----  1146
                D+ VA+ ++ +G +  P FN++ T L  VV+G+G  +MACP ++ Q  +   G    
Sbjct  732   EEMDVLVAWTDLKQGSIFVPHFNSKTTVLVMVVEGEGRMEMACPHLARQKRQQWGGREEE  791

Query  1147  ------AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA  1308
                   +   Y+ V + L  G +F+IP G+P   +AS + NL++V F +NA NNER  +A
Sbjct  792   EKERQTSTWQYQKVTSHLSAGDVFIIPAGHPISVVASSNQNLRMVGFGVNARNNERTFIA  851

Query  1309  GKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             GK+N+   ++  AKE++F +  + V+++F N   L  F   P+  Q E+
Sbjct  852   GKDNVIKQLEREAKELAFNMPGREVEQIF-NKPKLSYFV--PQESQEEE  897



>ref|XP_004134437.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=863

 Score =   241 bits (616),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 233/407 (57%), Gaps = 34/407 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY FQ R F++  RS QG + VL RF+ERS   +G++N R  ILE   +TF+ P+H+DA
Sbjct  257   NPYYFQERQFQSRFRSDQGEWRVLERFSERSELLKGLKNQRLAILEARPQTFIIPHHIDA  316

Query  484   DLIGLVAEGEGTLDII----QKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             + + LV +G  T+  I    ++ +K+SY++  G ++ IPAG T YL N + N +L I+KL
Sbjct  317   ESVLLVVKGRATITTIVQEKKETRKESYNVECGDVITIPAGTTVYLANQE-NEELQIVKL  375

Query  652   IQTISTPGRFEFFFGTGRNS--FLRAFKSSILEAAYDESKETIQRVLRGRDD--SPFIQV  819
             IQ I+ PG F+ +   G  S  +   F + +LEAA +  ++ ++R+ + + +     I+ 
Sbjct  376   IQPINNPGEFKDYLSGGGESQAYYSVFSNDVLEAALNIPRDRLERIFKQKSERRGKIIRA  435

Query  820   SDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVSNN-YGQLFEVDNDDFKEL--GD  990
             S EQLK+L + + ++   K     +   + +     V NN YGQ++E   D+F +L   D
Sbjct  436   SREQLKALSQRATSV---KKGGQGARAVIKLESQSPVYNNQYGQMYEACPDEFPQLRRTD  492

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-SSQTE------------  1131
             +  +  +I +GGM+ P FN+RAT + FV  G G  +M CP +  SQ +            
Sbjct  493   VATSVLDIKQGGMMVPHFNSRATWVVFVSKGTGSYEMGCPHIQGSQWQRGRREEERQWRR  552

Query  1132  -----RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
                  RS+E +    E +  +L  G + VIP G+P   +AS ++NL++V F INA+NN+R
Sbjct  553   EEERERSDERSSSRIERIAGRLSQGGVLVIPAGHPIAIMASPNENLRLVGFGINAENNKR  612

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
               LAG+ N+ + +D  AKE++F V  K  ++ F++  +   F++GPE
Sbjct  613   NFLAGRENIMNEVDREAKELAFNVEGKQAEETFKSQKE-SFFTEGPE  658



>ref|XP_004981475.1| PREDICTED: globulin-1 S allele-like [Setaria italica]
Length=455

 Score =   233 bits (593),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 134/414 (32%), Positives = 214/414 (52%), Gaps = 47/414 (11%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY F    FR   +S+QGRF VL RFT    + + + N+R   LE   + F+ P+H DAD
Sbjct  43    PYHFGEERFRQWAQSRQGRFRVLERFTHELLE-DAVGNYRVAELEAAPRAFLQPSHYDAD  101

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  V EGEG + ++ + K++S+ ++ G ++ IPAGA  Y  NT  +    ++ L+  +S
Sbjct  102   EVMFVKEGEGVVALLARGKRESFCVKEGDVLVIPAGAVVYSANTHGSKWFRVVMLLNPVS  161

Query  667   TPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLK  837
             T GRFE FF   G    SF   F   +L+AA++  +E  ++V   +        S+EQ++
Sbjct  162   TKGRFEEFFPIGGESPESFFSVFSDDVLQAAFNTRREEWEQVFEKQSKGEITTASEEQIR  221

Query  838   SLRKE----------SDTIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELG  987
              L +            +++W  K    +S +P+        SNN+G+ +E+  DD  +L 
Sbjct  222   ELSRSCSRTGRSHGGGESMWDIKLCSLTSKRPLH-------SNNHGRHYEITGDDCPQLR  274

Query  988   --DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT-  1158
               DIEV   N++RG M  P ++T A KL  V+DG G+ +MACP +SS    S        
Sbjct  275   ALDIEVGLTNLSRGSMTAPSYSTHADKLFVVLDGSGYFEMACPHLSSGRSSSPRRERGHG  334

Query  1159  ----------------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFD  1272
                                   Y+ V +++R G++ VIP G+P   +A +D+NL ++ F 
Sbjct  335   SREWGKEEEEEAEQEGGQKSRGYKQVKSRIREGSVIVIPAGHPMTLVAGEDNNLAVLYFS  394

Query  1273  INADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             +NA ++E+V L G N L   MD+ AK ++FG   + VD+V     D  +F +GP
Sbjct  395   VNARHDEKVFLVGSNGLLRQMDEAAKALAFGAEKEKVDRVIGAQSD-AVFLRGP  447



>gb|KGN56960.1| hypothetical protein Csa_3G146460 [Cucumis sativus]
Length=927

 Score =   241 bits (616),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 233/407 (57%), Gaps = 34/407 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY FQ R F++  RS QG + VL RF+ERS   +G++N R  ILE   +TF+ P+H+DA
Sbjct  504   NPYYFQERQFQSRFRSDQGEWRVLERFSERSELLKGLKNQRLAILEARPQTFIIPHHIDA  563

Query  484   DLIGLVAEGEGTLDII----QKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             + + LV +G  T+  I    ++ +K+SY++  G ++ IPAG T YL N + N +L I+KL
Sbjct  564   ESVLLVVKGRATITTIVQEKKETRKESYNVECGDVITIPAGTTVYLANQE-NEELQIVKL  622

Query  652   IQTISTPGRFEFFFGTGRNS--FLRAFKSSILEAAYDESKETIQRVLRGRDD--SPFIQV  819
             IQ I+ PG F+ +   G  S  +   F + +LEAA +  ++ ++R+ + + +     I+ 
Sbjct  623   IQPINNPGEFKDYLSGGGESQAYYSVFSNDVLEAALNIPRDRLERIFKQKSERRGKIIRA  682

Query  820   SDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVSNN-YGQLFEVDNDDFKEL--GD  990
             S EQLK+L + + ++   K     +   + +     V NN YGQ++E   D+F +L   D
Sbjct  683   SREQLKALSQRATSV---KKGGQGARAVIKLESQSPVYNNQYGQMYEACPDEFPQLRRTD  739

Query  991   IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-SSQTE------------  1131
             +  +  +I +GGM+ P FN+RAT + FV  G G  +M CP +  SQ +            
Sbjct  740   VATSVLDIKQGGMMVPHFNSRATWVVFVSKGTGSYEMGCPHIQGSQWQRGRREEERQWRR  799

Query  1132  -----RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
                  RS+E +    E +  +L  G + VIP G+P   +AS ++NL++V F INA+NN+R
Sbjct  800   EEERERSDERSSSRIERIAGRLSQGGVLVIPAGHPIAIMASPNENLRLVGFGINAENNKR  859

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
               LAG+ N+ + +D  AKE++F V  K  ++ F++  +   F++GPE
Sbjct  860   NFLAGRENIMNEVDREAKELAFNVEGKQAEETFKSQKE-SFFTEGPE  905



>ref|XP_004247670.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=424

 Score =   230 bits (586),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 215/377 (57%), Gaps = 22/377 (6%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPY+F+   F++   S+ G F VL +FT+      GIEN+R G+LE E ++F+ P+H 
Sbjct  37    NNNPYLFESHMFKSRFESKHGEFRVLDKFTQL---LLGIENYRIGVLEFEPRSFLLPHHF  93

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA L+ L+  G G++ I ++++K S+++  G ++ + AG+T Y  NTDN  K  +  L +
Sbjct  94    DAQLLLLIVRGRGSISIAEEDEKNSFNLEYGDVLSVSAGSTIYFTNTDNKEKFSVYVLAK  153

Query  658   TISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
              I+ PG+F+ FF  G     +F RAF S ILE A++  +  ++R+   +     I+ S+E
Sbjct  154   AINVPGQFQEFFSAGSENPETFYRAFSSDILETAFNTPRSRLERLFGLQKQGIIIKASEE  213

Query  829   QLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQLFEVDNDDFKELGDIEVAF  1005
             +++++ + +      ++ +  +  P ++   +  + N +GQ FE   + F+ L D++VA 
Sbjct  214   KIRAISQHAS-----RSTRGETRGPFNVLNQRPLIGNRFGQYFEAAPESFQHLMDLDVAV  268

Query  1006  A--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQ  1179
                NI +GGM+ P+++TR T L  V  G G  +M   Q  SQ  R    A+    +V   
Sbjct  269   GIMNINQGGMILPVYSTRTTWLVMVAQGNGRFEMVSSQ--SQERRGHRKAVRDCLSV---  323

Query  1180  LRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVS  1359
                G  FVIP G+P   IA+ D NL +V F IN  N+    LAG+ +++ N++   KE+S
Sbjct  324   ---GDFFVIPAGHPITVIANADSNLSMVGFGINGHNSMLNFLAGQESIWRNVNRETKELS  380

Query  1360  FGVSSKLVDKVFENDDD  1410
             F + ++ V+++ +N ++
Sbjct  381   FNMPAREVEEILQNQNE  397



>gb|AEO27682.1| seed storage protein vicilin A, partial [Gossypium herbaceum]
Length=537

 Score =   232 bits (591),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 141/408 (35%), Positives = 213/408 (52%), Gaps = 36/408 (9%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  R F+   R + G F VL RF ++ +   GI  FR  ILE    TFV P+H D
Sbjct  125   NNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCD  184

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G GT+  +    K+SY++  G +V IPAG+T YL N DN  KL I  L + 
Sbjct  185   AEKIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP  244

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------F  810
             ++ PG+F+ FF  G+    S+LR F   ILEA ++   E +  +  GR           F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  811   IQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF-KEL  984
              + S EQ+++L +E+ +       K S     ++       SN  G+ +E    +F ++L
Sbjct  305   RKASQEQIRALSQEATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL  360

Query  985   GDIE---VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER-------  1134
              +++   VAF  I +G +  P +N++AT +  V DG G  +M CP +S Q+         
Sbjct  361   QEVDSSVVAF-EINKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREEE  419

Query  1135  --------SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI-NADN  1287
                      +E     Y+ V AQL  G +FV+P G+P   +ASQ+ NL ++ F + N  +
Sbjct  420   EQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGLLGFGLYNGQD  479

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             N+R+ +AGK N     D  AKE++FGV S+LVD+VF N+     F  G
Sbjct  480   NKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG  527



>gb|AAM33459.2| globulin-like protein [Oryza sativa Japonica Group]
Length=470

 Score =   230 bits (586),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 132/394 (34%), Positives = 210/394 (53%), Gaps = 31/394 (8%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY      FR   R++ GRFSVL RF +       +  +R  +LE   + F+ P+H DAD
Sbjct  56    PYHLGEESFRHWTRTRHGRFSVLERFPDEQVVGAAVGGYRVAVLEAAPRAFLQPSHYDAD  115

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  V EGEG + ++++ +++S+ +R G  + IPAGA  Y  NT ++    ++ L+  +S
Sbjct  116   EVFYVKEGEGVIVLLREGRRESFCVREGDAMVIPAGAIVYSANTHSSKWFRVVMLLNPVS  175

Query  667   TPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVL-RGRDDSPFIQVSDEQL  834
             TPG FE +F  G +   SF  AF   +L+AA++  +E +++V  R R+        +EQ+
Sbjct  176   TPGHFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKVFERQREGGEITTAPEEQI  235

Query  835   KSLRKESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG--DIEVAF  1005
             + L K         +      KP  +  K    SNN+G+LFE+  D+ + L   D+++  
Sbjct  236   RELSKSCSRGGGGGSGSEWEIKPPSLTGKSPYFSNNHGKLFELTGDECRHLKKLDLQIGL  295

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT---------  1158
             ANITRG M+ P +NTRATKLA V+ G G+ +MACP VS                      
Sbjct  296   ANITRGSMIAPNYNTRATKLAVVLQGSGYFEMACPHVSGGGSSERREREREHGRRREEEQ  355

Query  1159  --------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
                           Y  V AQ+R G++ VIP  +P   +AS+ ++L +VCF + A+++E+
Sbjct  356   GEEEHGERGEKARRYHKVRAQVREGSVIVIPASHPATIVASEGESLAVVCFFVGANHDEK  415

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVS-SKLVDKVF  1395
             V LAG+N+    +DD AK++ FG S ++  D+V 
Sbjct  416   VFLAGRNSPLRQLDDPAKKLVFGGSAAREADRVL  449



>gb|AEO27683.1| seed storage protein vicilin A, partial [Gossypium arboreum]
Length=537

 Score =   231 bits (590),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 141/408 (35%), Positives = 213/408 (52%), Gaps = 36/408 (9%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  R F+   R + G F VL RF ++ +   GI  FR  ILE    TFV P+H D
Sbjct  125   NNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCD  184

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G GT+  +    K+SY++  G +V IPAG+T YL N DN  KL I  L + 
Sbjct  185   AEKIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP  244

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------F  810
             ++ PG+F+ FF  G+    S+LR F   ILEA ++   E +  +  GR           F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  811   IQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF-KEL  984
              + S EQ+++L +E+ +       K S     ++       SN  G+ +E    +F ++L
Sbjct  305   RKASQEQIRALSQEATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL  360

Query  985   GDIE---VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER-------  1134
              +++   VAF  I +G +  P +N++AT +  V DG G  +M CP +S Q+         
Sbjct  361   QEVDSSVVAF-EINKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREEE  419

Query  1135  --------SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI-NADN  1287
                      +E     Y+ V AQL  G +FV+P G+P   +ASQ+ NL ++ F + N  +
Sbjct  420   EQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGLLGFGLYNGQD  479

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             N+R+ +AGK N     D  AKE++FGV S+LVD+VF N+     F  G
Sbjct  480   NKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG  527



>gb|AEO27684.1| seed storage protein vicilin A, partial [Gossypium hirsutum]
Length=537

 Score =   231 bits (589),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/408 (34%), Positives = 211/408 (52%), Gaps = 36/408 (9%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  R F+   R + G F VL RF  + +   GI  FR  ILE    TFV P+H D
Sbjct  125   NNPYYFHRRSFQERFREEHGNFRVLQRFAAKHHLLRGINEFRIAILEANPNTFVLPHHCD  184

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G GT+  +    K+SY++  G +V IPAG+T YL N DN  KL I  L + 
Sbjct  185   AEKIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP  244

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------F  810
             ++ PG+F+ FF +G+    S+LR F   ILEA ++   E +  +  GR           F
Sbjct  245   VNNPGQFQKFFPSGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  811   IQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF-KEL  984
              + S EQ+++L +E+ +       K S     ++       SN  G+ +E    +F ++L
Sbjct  305   RKASQEQIRALSQEATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL  360

Query  985   GDIE---VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP  1155
              +++   VAF  I +G +  P +N++AT +  V DG G  +M CP +S Q+         
Sbjct  361   QEVDSSVVAFE-INKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREQE  419

Query  1156  T---------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI-NADN  1287
                             Y+ V AQL  G +FV+P G+P   +ASQ+ NL ++ F + N  +
Sbjct  420   EQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGLLGFGLYNGQD  479

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             N+R+ +AGK N     D  AKE++FGV S+LVD+VF N+     F  G
Sbjct  480   NKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG  527



>ref|NP_001051533.1| Os03g0793700 [Oryza sativa Japonica Group]
 gb|AAO37963.2| putative globulin [Oryza sativa Japonica Group]
 gb|ABF99314.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF13447.1| Os03g0793700 [Oryza sativa Japonica Group]
 dbj|BAH00598.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADR66992.1| globulin protein [Oryza sativa Japonica Group]
Length=470

 Score =   229 bits (583),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/412 (33%), Positives = 217/412 (53%), Gaps = 32/412 (8%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY      FR   R++ GRFSVL RF +       +  +R  +LE   + F+ P+H DAD
Sbjct  56    PYHLGEESFRHWTRTRHGRFSVLERFPDEQVVGAAVGGYRVAVLEAAPRAFLQPSHYDAD  115

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  V EGEG + ++++ +++S+ +R G  + IPAGA  Y  NT ++    ++ L+  +S
Sbjct  116   EVFYVKEGEGVIVLLREGRRESFCVREGDAMVIPAGAIVYSANTHSSKWFRVVMLLNPVS  175

Query  667   TPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVL-RGRDDSPFIQVSDEQL  834
             TPG FE +F  G +   SF  AF   +L+AA++  +E +++V  R R+        +EQ+
Sbjct  176   TPGHFEEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKVFERQREGGEITTAPEEQI  235

Query  835   KSLRKESDTIWPFKTDKSSSSKPVDIF-KHKSVSNNYGQLFEVDNDDFKELG--DIEVAF  1005
             + L K         +      KP  +  K    SNN+G+LFE+  D+ + L   D+++  
Sbjct  236   RELSKSCSRGGGGGSGSEWEIKPSSLTGKSPYFSNNHGKLFELTGDECRHLKKLDLQIGL  295

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT---------  1158
             ANITRG M+ P +NTRATKLA V+ G G+ +MACP VS                      
Sbjct  296   ANITRGSMIAPNYNTRATKLAVVLQGSGYFEMACPHVSGGGSSERREREREHGRRREEEQ  355

Query  1159  --------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
                           Y  V AQ+R  ++ VIP  +P   +AS+ ++L +VCF + A+++E+
Sbjct  356   GEEEHGERGEKARRYHKVRAQVREESVIVIPASHPATIVASEGESLAVVCFFVGANHDEK  415

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVS-SKLVDKVFENDDDLELFSKGPEWQQS  1449
             V LAG+N+    +DD AK++ FG S ++  D+V     + ++  +GP  + S
Sbjct  416   VFLAGRNSPLRQLDDPAKKLVFGGSAAREADRVLAAQPE-QILLRGPHGRGS  466



>ref|XP_007225266.1| hypothetical protein PRUPE_ppa001515mg [Prunus persica]
 gb|EMJ26465.1| hypothetical protein PRUPE_ppa001515mg [Prunus persica]
Length=810

 Score =   235 bits (600),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 135/373 (36%), Positives = 228/373 (61%), Gaps = 22/373 (6%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHL  477
             +NPY F    F+   +S +G   VL RFT+R ++   GI+N+R  I E +  TFV P+H 
Sbjct  404   NNPYYFPSHRFQPRFQSNEGGLYVLERFTQRQSEVLRGIKNYRLAIFEAKPNTFVLPHHC  463

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I +V  G+ T  ++ +++K+S+++  G ++ +PAGAT+YLVN +++  L I KL+Q
Sbjct  464   DAEAIYVVLSGQCTCTLLMQDRKESFNMEHGDVIRVPAGATTYLVNNNSDETLRIAKLLQ  523

Query  658   TISTPGRFEFFFGTG-RN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSP----FIQ  816
              ++ PGRFE FF  G RN  S+   F + ILE+A++  +E ++   +           ++
Sbjct  524   PVNNPGRFEEFFPAGSRNPESYFSVFSNDILESAFNTPREQLEHGFKQGQQQQGQGIVMR  583

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDI  993
                EQL++L + + +    + D+ S   P ++ + + V SNNYGQ FE   ++F +L D+
Sbjct  584   APREQLQALSQAASSRR--RGDRQSQG-PFNLRQQRPVHSNNYGQFFEARPEEFNQLQDM  640

Query  994   E--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE----RSEEGAIP  1155
             +  V+   I +  M+ P FN++AT L  VV+G G  +MACP ++SQ++    + E+   P
Sbjct  641   DASVSCIEINQQAMMVPHFNSKATHLIMVVEGNGLVEMACPYLASQSQEIMGQQEQQGEP  700

Query  1156  T--YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLY  1326
             +  Y  V AQL  G +FVIP G+P V++ +Q+ +L+I+ F +NA NN+R  LAG+ +N+ 
Sbjct  701   SGRYMKVTAQLSRGDVFVIPAGHP-VALVAQNQSLRILGFGLNAQNNKRNFLAGQEDNII  759

Query  1327  SNMDDVAKEVSFG  1365
              +MD  A++++FG
Sbjct  760   MHMDREARQLAFG  772



>gb|KHG06468.1| hypothetical protein F383_32629 [Gossypium arboreum]
Length=608

 Score =   231 bits (590),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 141/408 (35%), Positives = 213/408 (52%), Gaps = 36/408 (9%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  R F+   R + G F VL RF ++ +   GI  FR  ILE    TFV P+H D
Sbjct  180   NNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCD  239

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G GT+  +    K+SY++  G +V IPAG+T YL N DN  KL I  L + 
Sbjct  240   AEKIYVVTNGRGTITFVTHENKESYNVAPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP  299

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRD-------DSPF  810
             ++ PG+F+ FF  G+    S+LR F   ILEA ++   E +  +  GR           F
Sbjct  300   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  359

Query  811   IQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF-KEL  984
              + S EQ+++L +E+ +       K S     ++       SN  G+ +E    +F ++L
Sbjct  360   RKASQEQIRALSQEATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL  415

Query  985   GDIE---VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER-------  1134
              +++   VAF  I +G +  P +N++AT +  V DG G  +M CP +S Q+         
Sbjct  416   QEVDSSVVAF-EINKGSIFVPHYNSKATFVVLVTDGNGHVEMVCPHLSRQSSHWSSREEE  474

Query  1135  --------SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI-NADN  1287
                      +E     Y+ V AQL  G +FV+P G+P   +ASQ+ NL ++ F + N  +
Sbjct  475   EQEEQEEQEDERRSGQYKRVRAQLSTGDIFVVPAGHPVTFVASQNKNLGLLGFGLYNGQD  534

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             N+R+ +AGK N     D  AKE++FGV S+LVD+VF N+     F  G
Sbjct  535   NKRIFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG  582



>gb|AEO27686.1| seed storage protein vicilin A, partial [Gossypium raimondii]
Length=534

 Score =   228 bits (582),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 210/405 (52%), Gaps = 33/405 (8%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  R F+   R + G F VL RF ++ +   GI  FR  ILE    TFV P+H D
Sbjct  125   NNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCD  184

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G GT+  +    K+SY++  G +V IPAG+T YL N DN  KL I  L + 
Sbjct  185   AEKIYVVTNGRGTITFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP  244

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------F  810
             ++ PG+F+ FF  G+    S+LR F   ILEA ++   E +  +  GR           F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSELLDELFGGRQSHRRQQGQGMF  304

Query  811   IQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF----  975
              + S EQ+++L + + +       K S     ++       SN  G+ +E    +F    
Sbjct  305   RKASQEQIRALSQGATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL  360

Query  976   KELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER-------  1134
             +E+    VAF  I +G +  P +N++AT +  V +G G  +M CP +S Q+         
Sbjct  361   REVDSSVVAF-EINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSHWSSREEE  419

Query  1135  -----SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI-NADNNER  1296
                   +E     Y+ V AQL  G LFV+P G+P   +ASQ+++L ++ F + N  +N+R
Sbjct  420   EQEEQEDERRSGQYKRVRAQLSTGDLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKR  479

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             + +AGK N     D  AKE++FGV S+LVD+VF N+     F  G
Sbjct  480   IFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG  524



>gb|AEO27685.1| seed storage protein vicilin A, partial [Gossypium hirsutum]
Length=534

 Score =   228 bits (582),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 209/405 (52%), Gaps = 33/405 (8%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  R F+   R + G F VL RF ++ +   GI  FR  ILE    TFV P+H D
Sbjct  125   NNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCD  184

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G GT+  +    K+SY++  G +V IPAG+T YL N DN  KL I  L + 
Sbjct  185   AEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP  244

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------F  810
             ++ PG+F+ FF  G+    S+LR F   ILEA ++   E +  +  GR           F
Sbjct  245   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELFGGRQSHRRQQGQGMF  304

Query  811   IQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF----  975
              + S EQ+++L + + +       K S     ++       SN  G+ +E    +F    
Sbjct  305   RKASQEQIRALSQGATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL  360

Query  976   KELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER-------  1134
             +E+    VAF  I +G +  P +N++AT +  V +G G  +M CP +S Q+         
Sbjct  361   REVDSSVVAF-EINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSHWSSREEE  419

Query  1135  -----SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI-NADNNER  1296
                    E     Y+ V AQL  G LFV+P G+P   +ASQ+++L ++ F + N  +N+R
Sbjct  420   EQEEQEVERRSGQYKRVRAQLSTGDLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKR  479

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             + +AGK N     D  AKE++FGV S+LVD+VF N+     F  G
Sbjct  480   IFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG  524



>gb|ACG48473.1| globulin-1 S allele precursor [Zea mays]
Length=451

 Score =   223 bits (569),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 213/423 (50%), Gaps = 55/423 (13%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY +    FR   RS+QGRF VL RFT    + + + N+R   LE   +TF+ P+H DAD
Sbjct  31    PYHYGEESFRHWTRSRQGRFRVLERFTHELLE-DAVGNYRVAELEAAPRTFLQPSHYDAD  89

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ-TI  663
              +  V EGEG + +++  K++S+ +R G ++ IPAGA  Y  NT  +    ++ L+   +
Sbjct  90    EVMFVKEGEGVIVLLRGGKRESFCVREGDVMVIPAGAVVYSANTHQSEWFRVVMLLSPVV  149

Query  664   STPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             ST GRFE FF   G    SFL  F   +++A+++  +E  ++V   +        S+EQ+
Sbjct  150   STSGRFEEFFPIGGESPESFLSVFSDDVIQASFNTRREEWEKVFEKQSKGEITTASEEQI  209

Query  835   KSLRKESDTI------------------WPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEV  960
             + L +                       W  K    +  KP         SN++G+ +E+
Sbjct  210   RELSRSCSRGGRGSRGEGGDSGSSSSSKWEIKPSSLTDKKPTH-------SNSHGRHYEI  262

Query  961   DNDDFKELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS----  1122
               D+   L   D++V  ANI RG M+ P +NTRA K+A V+ G+G+ +MACP VS     
Sbjct  263   TGDECPHLRLLDMDVGLANIARGSMMAPSYNTRANKIAIVLKGQGYFEMACPHVSGGRSS  322

Query  1123  -----------------QTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDN  1251
                              +          +Y  V +++R G++ VIP G+P   +A +D N
Sbjct  323   PRRERGHGREEEEEREEEQGGGGGQKARSYRQVKSRIREGSVIVIPAGHPTALVAGEDKN  382

Query  1252  LQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGV-SSKLVDKVFENDDDLELFSK  1428
             L ++CF++NA  +++V LAG N+    MD  AK ++FG    + VD+V     D  +F +
Sbjct  383   LAVLCFEVNASFDDKVFLAGTNSALQKMDRPAKLLAFGADEEQQVDRVIGAQKDA-VFLR  441

Query  1429  GPE  1437
             GP+
Sbjct  442   GPQ  444



>ref|XP_008224279.1| PREDICTED: vicilin GC72-A-like [Prunus mume]
Length=809

 Score =   231 bits (588),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/373 (35%), Positives = 221/373 (59%), Gaps = 22/373 (6%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHL  477
             +NP+ F    F+   +S +G   VL RFT+R ++   GI+N+R  I E    TFV P+H 
Sbjct  403   NNPFYFPSHRFQPRFQSNEGGLYVLERFTQRQSEVLRGIKNYRLAIFEARPNTFVLPHHC  462

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I +V  G+ T  ++ +++K+S+++  G ++ +PAGAT+YLVN +++N L I KL+Q
Sbjct  463   DAEAIYVVLSGQCTCTLLMQDRKESFNMEHGDVIRVPAGATTYLVNNNSDNTLRIAKLLQ  522

Query  658   TISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSP----FIQ  816
             T++ PGRFE FF  G     S+   F + ILE+A++  +E ++   +           ++
Sbjct  523   TVNNPGRFEEFFPAGSGNPESYFSVFSNDILESAFNTPREQLEHGFKQGQQQQGQGIVMR  582

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDI  993
                EQL++L + + +    + D+ S   P ++ + + V SNNYGQL E   +++ +L D+
Sbjct  583   APREQLQALSQAASSRR--RGDRQSQG-PFNLRQQRPVHSNNYGQLCEARPEEYNQLQDM  639

Query  994   E--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER------SEEGA  1149
             +  V+   I +  M+ P FN++AT L  VV+G G  +MA P ++SQ++        +   
Sbjct  640   DASVSCIEINQQAMMVPHFNSKATHLIMVVEGNGLVEMAYPYLASQSQEIMGQQEQQGEQ  699

Query  1150  IPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLY  1326
                Y  V AQL PG +FVIP G+P V++ +Q+ NL+I+ F +NA NN R  LAG+ +N+ 
Sbjct  700   SGRYMKVTAQLSPGDVFVIPAGHP-VALVAQNQNLRILGFGLNAQNNTRNFLAGQEDNII  758

Query  1327  SNMDDVAKEVSFG  1365
               MD  A++++FG
Sbjct  759   MQMDREARQLAFG  771



>sp|P09799.1|VCLA_GOSHI RecName: Full=Vicilin GC72-A; AltName: Full=Alpha-globulin A; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA33069.1| vicilin precursor [Gossypium hirsutum]
 gb|AAA72623.1| alpha globulin A [synthetic construct]
 prf||1410330A vicilin gene A
Length=605

 Score =   226 bits (577),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 210/405 (52%), Gaps = 33/405 (8%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NPY F  R F+   R + G F VL RF ++ +   GI  FR  ILE    TFV P+H D
Sbjct  180   NNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLPHHCD  239

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G GT+  +    K+SY++  G +V IPAG+T YL N DN  KL I  L + 
Sbjct  240   AEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAVLHRP  299

Query  661   ISTPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------F  810
             ++ PG+F+ FF  G+    S+LR F   ILEA ++   E +  +  GR           F
Sbjct  300   VNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELPGGRQSHRRQQGQGMF  359

Query  811   IQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDF----  975
              + S EQ+++L + + +       K S     ++       SN  G+ +E    +F    
Sbjct  360   RKASQEQIRALSQGATS----PRGKGSEGYAFNLLSQTPRYSNQNGRFYEACPRNFQQQL  415

Query  976   KELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE--------  1131
             +E+    VAF  I +G +  P +N++AT +  V +G G  +M CP +S Q+         
Sbjct  416   REVDSSVVAF-EINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHLSRQSSDWSSREEE  474

Query  1132  ----RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI-NADNNER  1296
                 +  E     Y+ V AQL  G LFV+P G+P   +ASQ+++L ++ F + N  +N+R
Sbjct  475   EQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGLLGFGLYNGQDNKR  534

Query  1297  VALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKG  1431
             + +AGK N     D  AKE++FGV S+LVD+VF N+     F  G
Sbjct  535   IFVAGKTNNVRQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSG  579



>ref|XP_008665579.1| PREDICTED: globulin-1 S allele-like [Zea mays]
 tpg|DAA51858.1| TPA: globulin2 [Zea mays]
 prf||1802402A globulin 2
Length=450

 Score =   223 bits (567),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/429 (31%), Positives = 214/429 (50%), Gaps = 68/429 (16%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY +    FR   RS+QGRF VL RFT    + + + N+R   LE   + F+ P+H DAD
Sbjct  31    PYHYGEESFRHWTRSRQGRFRVLERFTHELLE-DAVGNYRVAELEAAPRAFLQPSHYDAD  89

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ-TI  663
              +  V EGEG + +++  K++S+ +R G ++ IPAGA  Y  NT  +    ++ L+   +
Sbjct  90    EVMFVKEGEGVIVLLRGGKRESFCVREGDVMVIPAGAVVYSANTHQSEWFRVVMLLSPVV  149

Query  664   STPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             ST GRFE FF   G    SFL  F   +++A+++  +E  ++V   +        S+EQ+
Sbjct  150   STSGRFEEFFPIGGESPESFLSVFSDDVIQASFNTRREEWEKVFEKQSKGEITTASEEQI  209

Query  835   KSLRKESD-----------------TIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVD  963
             + L +                    + W  K    +  KP         SN++G+ +E+ 
Sbjct  210   RELSRSCSRGGRSSRSEGGDSGSSSSKWEIKPSSLTDKKPTH-------SNSHGRHYEIT  262

Query  964   NDDFKELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS-----  1122
              D+   L   D++V  ANI RG M+ P +NTRA K+A V+ G+G+ +MACP VS      
Sbjct  263   GDECPHLRLLDMDVGLANIARGSMMAPSYNTRANKIAIVLKGQGYFEMACPHVSGGRSSP  322

Query  1123  -----------------------QTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSI  1233
                                    Q  RS       Y  V +++R G++ VIP G+P   +
Sbjct  323   RRERGHGREEEEEREEEQGGGGGQKSRS-------YRQVKSRIREGSVIVIPAGHPTALV  375

Query  1234  ASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGV-SSKLVDKVFENDDD  1410
             A +D NL ++CF++NA  +++V LAG N+    MD  AK ++FG    + VD+V     D
Sbjct  376   AGEDKNLAVLCFEVNASFDDKVFLAGTNSALQKMDRPAKLLAFGADEEQQVDRVIGAQKD  435

Query  1411  LELFSKGPE  1437
               +F +GP+
Sbjct  436   A-VFLRGPQ  443



>ref|XP_002466310.1| hypothetical protein SORBIDRAFT_01g005440 [Sorghum bicolor]
 gb|EER93308.1| hypothetical protein SORBIDRAFT_01g005440 [Sorghum bicolor]
Length=466

 Score =   222 bits (565),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 131/426 (31%), Positives = 219/426 (51%), Gaps = 58/426 (14%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY F    FR   RS+QGRF VL +FT    + + + N+R   LE   + F+ P+H DAD
Sbjct  43    PYHFGEESFRHWTRSRQGRFRVLEQFTHELLE-DAVGNYRVAELEAAPRAFLQPSHYDAD  101

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  V EGEG + +++  +K+S+ +R G ++ IPAGA  Y  NT ++    ++ L+  +S
Sbjct  102   EVMFVKEGEGVVVLLRGERKESFCVREGDVLVIPAGAVVYSANTHHSEWFRVVMLLSPVS  161

Query  667   TPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLK  837
             T G FE F+   G    SFL  F   +++A+++  +E  ++V   +        S+EQ++
Sbjct  162   TSGHFEEFYPIGGESPESFLSVFSDDVIQASFNTRREEWEKVFEKQSKGEITTASEEQIR  221

Query  838   SLRK-------------------ESDTIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEV  960
              L +                    S + W  K    +  +P         SN++G+ +E+
Sbjct  222   ELSRSCSRGGGRSSREEGGDTGSRSSSKWEIKPSSLTGKRPTH-------SNSHGKHYEI  274

Query  961   DNDDFKELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVD-GKGWAQMACPQVSSQTE  1131
               D+   L   D++V  ANI+RG M+   ++TRA K+A VVD G+G+ +MACP VS    
Sbjct  275   TGDECPHLRVLDMKVGLANISRGSMMALSYSTRAHKIAIVVDGGEGYFEMACPHVSGGRS  334

Query  1132  RSEEGAIP-----------------------TYETVNAQLRPGTLFVIPPGNPYVSIASQ  1242
              S+                            +Y  V +++R G++ VIP G+P   +A +
Sbjct  335   SSQRREREHGRREWGGREEEEEEGGRGHKSRSYRQVKSRVREGSVIVIPAGHPTALVAGE  394

Query  1243  DDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGV-SSKLVDKVFENDDDLEL  1419
             + NL ++CF++NA+ +E+V LAG+N+    MD  AK ++FG    ++VD+V     D  +
Sbjct  395   NSNLAVLCFEVNANFDEKVFLAGRNSALKQMDGPAKLLAFGADEEEVVDRVIGAQKDA-V  453

Query  1420  FSKGPE  1437
             F +GP+
Sbjct  454   FLRGPQ  459



>gb|AEO27691.1| seed storage protein vicilin B, partial [Gossypium raimondii]
Length=540

 Score =   224 bits (571),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 139/399 (35%), Positives = 209/399 (52%), Gaps = 36/399 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  143   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  202

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY+I  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  203   EKIYLVTNGRGTLTFLTHENKESYNIVPGVVVSVPAGSTVYLANQDNKEKLIIAVLHRPV  262

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + PG+FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  263   NNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMFR  322

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      ++       SN  G+ FE    +F++L D
Sbjct  323   KASQEQIRALSQEATS----PREKSGERFAFNLLSQTPRYSNQNGRFFEACPREFRQLRD  378

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT--  1158
             I V  +   + +G +  P +N++AT +  V +G G+A+M  P +  Q+   EE       
Sbjct  379   INVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEQEEEQ  438

Query  1159  ------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADN  1287
                         Y  + ++L  G +FV+P   P   +ASQ+ NL++  F     +IN D+
Sbjct  439   EQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  498

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFEND  1404
             N+R+ +AGK N     D  AKE++FGVSS+LVD++F ++
Sbjct  499   NQRIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNSN  537



>gb|AEO27690.1| seed storage protein vicilin B, partial [Gossypium hirsutum]
Length=540

 Score =   223 bits (569),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 139/399 (35%), Positives = 209/399 (52%), Gaps = 36/399 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  143   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  202

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY+I  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  203   EKIYLVTNGRGTLTFLTHENKESYNIVPGVVVKVPAGSTVYLANQDNKEKLIIAVLHRPV  262

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + PG+FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  263   NNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMFR  322

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      ++       SN  G+ FE    +F++L D
Sbjct  323   KASQEQIRALSQEATS----PREKSGERFAFNLLSQTPRYSNQNGRFFEACPREFRQLRD  378

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT--  1158
             I V  +   + +G +  P +N++AT +  V +G G+A+M  P +  Q+   EE       
Sbjct  379   INVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEEDEEE  438

Query  1159  ------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADN  1287
                         Y  + ++L  G +FV+P   P   +ASQ+ NL++  F     +IN D+
Sbjct  439   EQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  498

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFEND  1404
             N+R+ +AGK N     D  AKE++FGVSS+LVD++F ++
Sbjct  499   NQRIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNSN  537



>gb|AAA72622.1| alpha globulin B [synthetic construct]
Length=590

 Score =   224 bits (572),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 140/405 (35%), Positives = 210/405 (52%), Gaps = 36/405 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  180   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  239

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY+I  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  240   EKIYLVTNGRGTLTFLTHENKESYNIVPGVVVKVPAGSTVYLANQDNKEKLIIAVLHRPV  299

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + PG+FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  300   NNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMFR  359

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      ++       SN  G+ FE    +F++L D
Sbjct  360   KASQEQIRALSQEATS----PREKSGERFAFNLLSQTPRYSNQNGRFFEACPPEFRQLRD  415

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT--  1158
             I V  +   + +G +  P +N++AT +  V +G G+A+M  P +  Q+   EE       
Sbjct  416   INVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEEDEEE  475

Query  1159  ------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADN  1287
                         Y  + ++L  G +FV+P   P   +ASQ+ NL++  F     +IN D+
Sbjct  476   EQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  535

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELF  1422
             N+R+ +AGK N     D  AKE++FGVSS+LVD++F ++     F
Sbjct  536   NQRIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNSNPQESYF  580



>gb|KFK40533.1| hypothetical protein AALP_AA2G008100 [Arabis alpina]
Length=486

 Score =   219 bits (559),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 140/410 (34%), Positives = 223/410 (54%), Gaps = 27/410 (7%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHL  477
             +NP+ F  R F    +S +G   +LP+FT+RS+  F GIEN+RF  +E+E  TF+ P+H 
Sbjct  66    ENPFHFAKRSFENVFKSNEGFVKLLPKFTKRSSTLFRGIENYRFSFMEMEPSTFLVPHHW  125

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD + LV +G+G +  +  + K+S+ IR G ++ +P+G T +L NT++   L I K++ 
Sbjct  126   DADSVFLVLQGKGVIAFVTDSTKESFHIRRGDVLRVPSGVTHFLTNTNDTVPLRIAKILV  185

Query  658   TISTPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVL-RGRDDSPFI--QV  819
              ++ PGRF+ FF        S+   F   +L A+++  +E ++R++ R +     I  +V
Sbjct  186   PVNIPGRFQDFFPARSQFHQSYFTGFSKQVLSASFNIPEELLERLISRSQQMGQGIIRRV  245

Query  820   SDEQLKSLRKESDTIWPFK----TDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKEL  984
             S +Q+K L +++ +  P      +D S    P  IFK   V SN++G   EVD   F +L
Sbjct  246   SPDQIKELAEQATS--PSNKHKDSDMSKFWTPFSIFKQDPVYSNDFGHFHEVDPTSFSQL  303

Query  985   GD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP---QVSSQTERSEEGA  1149
              D  I VA+ N+T+G +  P FN++ T + FV +G    +MA P   Q   Q        
Sbjct  304   QDLHIAVAWVNMTQGSLFLPQFNSKTTFVTFVENGCAHFEMASPYKFQSKQQQWFGPREE  363

Query  1150  IPTYETVNAQLR-------PGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA  1308
                 E +  Q++        G  FVIP G+P+ +I SQD N   + F I A NN R  LA
Sbjct  364   EEEEEEIGGQVQKIVSRVCKGDAFVIPAGHPF-TILSQDQNFVGIGFGIFASNNIRTFLA  422

Query  1309  GKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
             G+ N+ +N+D VA  +SFGV SK+ +K+F + +        P  Q  E++
Sbjct  423   GQENMLNNLDTVATRLSFGVGSKMAEKLFTSQNYSYFAPSNPSRQFPEEK  472



>prf||1410330B vicilin gene B
Length=592

 Score =   220 bits (560),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 140/406 (34%), Positives = 210/406 (52%), Gaps = 37/406 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  181   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  240

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY+I  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  241   EKIYLVTNGRGTLTFLTHENKESYNIVPGVVVKVPAGSTVYLANQDNKEKLIIAVLHRPV  300

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + PG+FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  301   NNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSRRRQQGQGMFR  360

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFK-ELG  987
             + S EQ+++L +E+ +      +KS      ++       SN  G+ FE    +F+ +L 
Sbjct  361   KASQEQIRALSQEATS----PREKSGERFAFNLLSQTPRYSNQNGRFFEACPPEFRQQLR  416

Query  988   DIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT-  1158
             DI V  +   + +G +  P +N++AT +  V +G G+A+M  P +  Q+   EE      
Sbjct  417   DINVTVSALQLNQGSIFVPHYNSKATFVILVTEGNGYAEMVSPHLPRQSSYEEEEEEDEE  476

Query  1159  -------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINAD  1284
                          Y  + ++L  G +FV+P   P   +ASQ+ NL++  F     +IN D
Sbjct  477   EEQEQEEERRSGQYRKIRSRLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPD  536

Query  1285  NNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELF  1422
             +N+R+ +AGK N     D  AKE++FGVSS+LVD++F ++     F
Sbjct  537   HNQRIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNSNPQESYF  582



>gb|KHG06467.1| Vicilin C72 [Gossypium arboreum]
Length=590

 Score =   218 bits (554),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/405 (34%), Positives = 211/405 (52%), Gaps = 36/405 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  180   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  239

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY++  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  240   EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV  299

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + PG+FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  300   NNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMFR  359

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVD-IFKHKSVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      + +++    SN  G+ +E    +F++L D
Sbjct  360   KASQEQIRALSQEATS----PREKSGERFAFNLLYQTPRYSNQNGRFYEACPREFRQLRD  415

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT--  1158
             I V  +   + +G +  P +N++AT +  V +G G+ +M  P +  Q+   EE       
Sbjct  416   INVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSYEEEEEQEQEQ  475

Query  1159  ------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADN  1287
                         Y  + +QL  G +FV+P   P   +ASQ+ NL++  F     +IN D+
Sbjct  476   EQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  535

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELF  1422
             N+R+ +AGK N     D  AKE++FG+SS+LVD++F N+     F
Sbjct  536   NQRIFVAGKINHVRQWDSQAKELAFGLSSRLVDEIFNNNPQESYF  580



>gb|AEO27687.1| seed storage protein vicilin B, partial [Gossypium herbaceum]
 gb|AEO27689.1| seed storage protein vicilin B, partial [Gossypium hirsutum]
Length=538

 Score =   216 bits (551),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 137/397 (35%), Positives = 210/397 (53%), Gaps = 34/397 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  143   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  202

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY++  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  203   EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV  262

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + PG+FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  263   NNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMFR  322

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVD-IFKHKSVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      + +++    SN  G+ +E    +F++L D
Sbjct  323   KASQEQIRALSQEATS----PREKSGERFAFNLLYQTPRYSNQNGRFYEACPREFRQLRD  378

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT--  1158
             I V  +   + +G +  P +N++AT +  V +G G+ +M  P +  Q+   EE       
Sbjct  379   INVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSYEEEEEQQQEQ  438

Query  1159  ----------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADNNE  1293
                       Y  + +QL  G +FV+P   P   +ASQ+ NL++  F     +IN D+N+
Sbjct  439   EQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHNQ  498

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFEND  1404
             R+ +AGK N     D  AKE++FGVSS+LVD++F ++
Sbjct  499   RIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNSN  535



>prf||1306412A storage protein C72
Length=586

 Score =   217 bits (552),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 211/403 (52%), Gaps = 34/403 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  178   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  237

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY++  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  238   EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV  297

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + P +FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  298   NNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMFR  357

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVD-IFKHKSVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      + +++    SN  G+ +E    +F++L D
Sbjct  358   KASQEQIRALSQEATS----PREKSGERFAFNLLYRTPRYSNQNGRFYEACPREFRQLSD  413

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE-----------  1131
             I V  +   + +G +  P +N++AT +  V +G G+ +M  P +  Q+            
Sbjct  414   INVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQEQ  473

Query  1132  -RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADNNE  1293
              + EE     Y  + +QL  G +FV+P   P   +ASQ+ NL++  F     +IN D+N+
Sbjct  474   EQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHNQ  533

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELF  1422
             R+ +AGK N     D  AKE++FGVSS+LVD++F N+     F
Sbjct  534   RIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYF  576



>ref|XP_010551719.1| PREDICTED: vicilin [Tarenaya hassleriana]
Length=469

 Score =   214 bits (544),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 133/406 (33%), Positives = 215/406 (53%), Gaps = 51/406 (13%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             ++P+ F  R F+T  RS++G   +LP FT RS  F GIEN+RF  L++  +TFV P+H D
Sbjct  52    EHPFYFGQRSFQTLLRSKEGFMKLLPSFTSRSWLFRGIENYRFAFLKMAPRTFVQPHHPD  111

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD++ +V +G+G    + + +K+++ I  G +V +PAG T Y+ NT ++  L +  +   
Sbjct  112   ADVVFVVLQGKGVAMFLTQEEKETFHIEKGHVVRMPAGTTHYVANTGDDEPLRLAAIFVP  171

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG-RDDSPFIQ-VSD  825
             ++ PG F+ FF      + S+   F S +L A+++ S+E + R LRG +     IQ +S 
Sbjct  172   VNIPGSFQVFFPAAAEFQQSYFDGFSSKVLSASFNVSEELLGRFLRGPQTGRKAIQTISP  231

Query  826   EQLKSLRKESDT--------IWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFK  978
             E++K LRK   +        +W           P DI   + V SN +G+ +E   + F+
Sbjct  232   EEIKELRKHVSSEKHKHQGRLW----------SPFDIHSQEPVYSNEFGRFYEAHPERFR  281

Query  979   ELGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE---  1143
             +L D  I V   N+T+G +  P F+++AT + FV  G    +MA P + S   + ++   
Sbjct  282   QLRDLGISVTCINMTQGSIFVPHFSSKATFIVFVESGCARFEMAKPHIGSGQWQQQQQEG  341

Query  1144  ------------------GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF  1269
                               G I     V +Q+  G LFVIP  +P V+I +QD N   V F
Sbjct  342   PQWGGQGQEQQWGEQEMTGKI---HRVVSQVCKGELFVIPASHP-VAIITQDQNFTAVGF  397

Query  1270  DINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDD  1407
              INA N+ R  LAG+ N+ S +D   K ++FGV  ++ ++VF + D
Sbjct  398   GINAHNSSRTFLAGQGNILSKLDTAEKRLTFGVGKEVSERVFTSQD  443



>sp|P09801.1|VCLB_GOSHI RecName: Full=Vicilin C72; AltName: Full=Alpha-globulin B; Flags: 
Precursor [Gossypium hirsutum]
 gb|AAA33071.1| vicilin precursor [Gossypium hirsutum]
Length=588

 Score =   217 bits (552),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 211/403 (52%), Gaps = 34/403 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  180   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  239

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY++  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  240   EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV  299

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + P +FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  300   NNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMFR  359

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVD-IFKHKSVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      + +++    SN  G+ +E    +F++L D
Sbjct  360   KASQEQIRALSQEATS----PREKSGERFAFNLLYRTPRYSNQNGRFYEACPREFRQLSD  415

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE-----------  1131
             I V  +   + +G +  P +N++AT +  V +G G+ +M  P +  Q+            
Sbjct  416   INVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSFEEEEEQQQEQ  475

Query  1132  -RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADNNE  1293
              + EE     Y  + +QL  G +FV+P   P   +ASQ+ NL++  F     +IN D+N+
Sbjct  476   EQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDHNQ  535

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELF  1422
             R+ +AGK N     D  AKE++FGVSS+LVD++F N+     F
Sbjct  536   RIFVAGKINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYF  578



>sp|Q43358.1|VCL_THECC RecName: Full=Vicilin; Flags: Precursor [Theobroma cacao]
 emb|CAA44493.1| vicilin [Theobroma cacao]
Length=525

 Score =   214 bits (546),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 117/367 (32%), Positives = 197/367 (54%), Gaps = 33/367 (9%)
 Frame = +1

Query  301   DNPYVF-QPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             +NPY F + R F+T  R ++G F +L RF E S   +GI ++R  + E    TF+ P+H 
Sbjct  141   NNPYYFPKRRSFQTRFRDEEGNFKILQRFAENSPPLKGINDYRLAMFEANPNTFILPHHC  200

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I  V  G+GT+  +    K+SY+++ G++V +PAG+T Y+V+ DN  KL I  L  
Sbjct  201   DAEAIYFVTNGKGTITFVTHENKESYNVQRGTVVSVPAGSTVYVVSQDNQEKLTIAVLAL  260

Query  658   TISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLR--------GRDDS  804
              +++PG++E FF  G N   S+  AF   +LE  ++  +E ++ +L              
Sbjct  261   PVNSPGKYELFFPAGNNKPESYYGAFSYEVLETVFNTQREKLEEILEEQRGQKRQQGQQG  320

Query  805   PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKE  981
              F +   EQ++++ +++ +       +      +++     V SN  G+ FE   +DF +
Sbjct  321   MFRKAKPEQIRAISQQATS----PRHRGGERLAINLLSQSPVYSNQNGRFFEACPEDFSQ  376

Query  982   LGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEG---  1146
               +++VA +   + +G +  P +N++AT + FV DG G+AQMACP +S Q++ S+ G   
Sbjct  377   FQNMDVAVSAFKLNQGAIFVPHYNSKATFVVFVTDGYGYAQMACPHLSRQSQGSQSGRQD  436

Query  1147  -----------AIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNE  1293
                            ++ V A L PG +FV P G+     AS+D  L  V F +NA NN+
Sbjct  437   RREQEEESEEETFGEFQQVKAPLSPGDVFVAPAGHAVTFFASKDQPLNAVAFGLNAQNNQ  496

Query  1294  RVALAGK  1314
             R+ LAG+
Sbjct  497   RIFLAGR  503



>gb|AEO27688.1| seed storage protein vicilin B, partial [Gossypium arboreum]
Length=540

 Score =   215 bits (547),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 136/399 (34%), Positives = 210/399 (53%), Gaps = 36/399 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F  R F++  R + G F VL RF  R     GI  FR  ILE    TFV P+H DA
Sbjct  143   NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA  202

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I LV  G GTL  +    K+SY++  G +V +PAG+T YL N DN  KL+I  L + +
Sbjct  203   EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV  262

Query  664   STPGRFEFFFGTGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------FI  813
             + PG+FE FF  G     S+LRAF   ILE A++   E +  +  GR           F 
Sbjct  263   NNPGQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQSHRRQQGQGMFR  322

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVD-IFKHKSVSNNYGQLFEVDNDDFKELGD  990
             + S EQ+++L +E+ +      +KS      + +++    SN  G+ +E    +F++L D
Sbjct  323   KASQEQIRALSQEATS----PREKSGERFAFNLLYQTPRYSNQNGRFYEACPREFRQLRD  378

Query  991   IEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT--  1158
             I V  +   + +G +  P +N++AT +  V +G G+ +M  P +  Q+   EE       
Sbjct  379   INVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSYEEEEEQEQEQ  438

Query  1159  ------------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF-----DINADN  1287
                         Y  + +QL  G +FV+P   P   +ASQ+ NL++  F     +IN D+
Sbjct  439   EQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLYNQNINPDH  498

Query  1288  NERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFEND  1404
             N+R+ +AGK N     D  AKE++FG+SS+LVD++F ++
Sbjct  499   NQRIFVAGKINHVRQWDSQAKELAFGLSSRLVDEIFNSN  537



>ref|XP_010488296.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=489

 Score =   213 bits (542),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 131/417 (31%), Positives = 224/417 (54%), Gaps = 33/417 (8%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERS-NQFEGIENFRFGILEVESKTFVAPNHLDA  483
             PY F  R F+   +S +G   +LP+FT+R+ N F GIEN+RF + E+E  TF+ P+HLDA
Sbjct  63    PYHFGKRSFKNWFQSNEGFVKMLPKFTKRAPNLFRGIENYRFAVFEMEPNTFLVPHHLDA  122

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D + LV +G G ++ +    K+S+ +  G +V +P+G T +  NT+    L  +K+I  +
Sbjct  123   DSVVLVLQGHGVVEFVTDKTKESFQVTKGDVVRLPSGITHFATNTNQTVPLRFVKIIVPV  182

Query  664   STPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP---FIQVSD  825
             + PGRF+ +F      + S+   F   +L A+++  +E + R+  G   +      +VS 
Sbjct  183   NNPGRFKDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRLFSGSQQTGQGIMRRVSP  242

Query  826   EQLKSLRKESDT-------IWPFKTDKSSSSKPVDIFKHKSVS---NNYGQLFEVDNDDF  975
             +Q+K L K + +             D S+  +P ++F   SVS   N++G   E   + F
Sbjct  243   DQIKKLTKHATSPSNKHKESKSKHKDISTKLRPFNLFTQDSVSTYTNDFGHFHEAHPESF  302

Query  976   KELGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGA  1149
              +L D  I VA+ N+++G +  P +N++ T + FV +G    +MA P  S Q E+ ++  
Sbjct  303   DQLQDLRIAVAWTNMSQGSLFLPHYNSKTTFVTFVENGCARYEMASP-YSFQGEQQQKQW  361

Query  1150  IPTY-----ETVNAQLR-------PGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNE  1293
              P       E ++ Q+         G +F+IP G+P V++ S ++N   V F I+A N  
Sbjct  362   WPEQGGEEEEDMSGQVHKIVSRVCKGDVFIIPAGHP-VTLVSHNENFVSVGFGIHASNCT  420

Query  1294  RVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRAD  1464
             R  LAG+ N+ SN+D VA  V+FGV SK+ +K+F + +           QQ++++ +
Sbjct  421   RTFLAGQENVLSNLDTVATRVTFGVGSKVAEKLFTSQNHSYFAPTTRSHQQTQEKRE  477



>ref|XP_006419988.1| hypothetical protein CICLE_v10006494mg, partial [Citrus clementina]
 gb|ESR33228.1| hypothetical protein CICLE_v10006494mg, partial [Citrus clementina]
Length=610

 Score =   215 bits (548),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 250/463 (54%), Gaps = 36/463 (8%)
 Frame = +1

Query  121   DPEL--ETCRHQCRVQMAFDRQQREACLDKCERYIqekegrqeergggssgrreeegrgg  294
             DP+   E C  QC  + + ++QQ++ C   CE++ Q+ + R+E+ G  +     +     
Sbjct  161   DPKWQHEQCLKQCERRESGEQQQQQ-CKSWCEKHRQKGQRRREKEGKFNPSSNWQGSEEE  219

Query  295   eDDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNH  474
             E++NPY F  + FR   RS  G   VL RF+++S+   GI+N+R  ILE    T V P+H
Sbjct  220   EENNPYYFHSQRFRYRVRSDSGHMRVLQRFSQKSHLLRGIDNYRLAILEANPSTLVVPHH  279

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DA+ I ++ +G+G + ++   +++S+++  G ++ +PAG T YL N DN ++L + KL+
Sbjct  280   SDAETILVLLKGKGVITLVSHERRESFNMEHGDVIRVPAGTTYYLSNQDNVDRLHVAKLL  339

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRV--LRGRDDSPFIQV  819
             Q ++TPG+F  ++  G     S+ + F   ILE A +  +E +  +  ++ R      + 
Sbjct  340   QPVNTPGQFREYYAAGGGFPESYYKVFSYDILERALNTPREQLHSLFEVQQRQQGTIKRA  399

Query  820   SDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIE  996
             S EQLK+L   + +    +     S+ P ++   K + +NN+G+ FE    D+++L +I+
Sbjct  400   SQEQLKALSHHASS---RRRHGRGSTAPFNLLSRKPIYNNNFGRFFEATPKDYQQLQEID  456

Query  997   --VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETV  1170
               V +  I +    GPL +              W+Q +  Q   + E  EE +    + +
Sbjct  457   AGVTYVEINQ----GPLSSR-------------WSQES--QREQEEEEEEEESSRELQKI  497

Query  1171  NAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAK  1350
             +A L PG +F+IPPG+P   +AS ++ L  V F +NA NN+R  LAGK N+ + ++    
Sbjct  498   SANLSPGVVFIIPPGHPIALVASPNEKLLTVGFSLNARNNQRNFLAGKINIMNQVERETM  557

Query  1351  EVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRADQ*GSG  1479
             EV+F V ++L+++VF  +     F  GPE QQ  D A   GSG
Sbjct  558   EVAFNVPARLIERVFGTNPKESYFVAGPEEQQQRDEA---GSG  597



>ref|XP_009335336.1| PREDICTED: LOW QUALITY PROTEIN: vicilin C72 [Pyrus x bretschneideri]
Length=711

 Score =   216 bits (551),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/379 (35%), Positives = 219/379 (58%), Gaps = 27/379 (7%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  + F++  +S +G   VL RF +R     GI+N+R  ILE    TFV P+H D
Sbjct  299   NNPFYFPSQMFQSRFQSNEGSLHVLERFGKRE-LLRGIKNYRLAILEAMPNTFVLPHHCD  357

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G+    ++ K++K+S+++  G ++ +PAGAT+YL+N +N+  L I KLI++
Sbjct  358   AEAIFVVLNGQCICTLLMKDRKESFNMEHGDVIRVPAGATTYLINNNNDEPLQIAKLIRS  417

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-----FIQ  816
             +++PGRFE FF  G     S+   F + ILE+A++  +E +++  R +          ++
Sbjct  418   VNSPGRFEEFFPAGSGNPESYFSVFSNDILESAFNTPREQLKQGFRQQRGQQGGQGIVMR  477

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDI  993
                EQL++L +   +    +  +  S  P ++ +   V SNNYGQ FE   ++F +  D+
Sbjct  478   APKEQLEALSQRPSSAR--REGRRQSQGPFNLRQQTPVHSNNYGQFFEARPEEFNQFQDM  535

Query  994   EVAFANI--TRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ------TERSEEGA  1149
             +V+ + I   +  M+ P FN+ AT L +VV+G    +MACP ++SQ       E+ E+G 
Sbjct  536   DVSVSCIEMNQQTMMVPHFNSEATLLMYVVEGHVRVEMACPHLASQMQGQEMMEQQEQGE  595

Query  1150  IP-TYETVNAQLRPGTLFVIPPGNPYVSIA-----SQDDNLQIVCFDINADNNERVALAG  1311
                 +  V AQL PG  FV+P G+P   +A     +Q+ N++I+ F +NA NN R  LAG
Sbjct  596   HSGRFTKVAAQLSPGDAFVVPAGHPVAFVAQNNNGNQNQNIRILGFGLNAQNNMRNFLAG  655

Query  1312  -KNNLYSNMDDVAKEVSFG  1365
              K+N+   MD  AK+++FG
Sbjct  656   QKDNIMQQMDREAKQLAFG  674



>tpg|DAA37931.1| TPA: hypothetical protein ZEAMMB73_015593 [Zea mays]
Length=562

 Score =   213 bits (543),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 140/393 (36%), Positives = 196/393 (50%), Gaps = 58/393 (15%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             D  PYVF  R FR   RS+QG   VL  F E S    GI ++R  +LE   ++FV P+H 
Sbjct  151   DRRPYVFDRRSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHT  210

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             +   I  VAEGEG +  I+  +++SY I+ G I    AGA +YL NTD   KLVI K++ 
Sbjct  211   NVHCICYVAEGEGVVTTIENGERRSYTIKQGHIFVASAGAVTYLANTDGQKKLVIAKILH  270

Query  658   TISTPGRFEFFFGT-GRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDE  828
             TIS PG F+FFFG  GRN  SFL +F  SI  AAY             +D    ++ ++E
Sbjct  271   TISVPGEFQFFFGPGGRNPESFLSSFSKSIQRAAY-------------KDKGIIVRATEE  317

Query  829   QLKSLRKESD-----TIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELG--  987
             Q   LR+ +        WP  +   S      + +  S++N +GQL+E D   F +L   
Sbjct  318   QTHELRRHASEGGHGPHWPLPSFGESRGPYSLLDQRPSIANQHGQLYEADARSFHDLAEY  377

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYET  1167
             D+ V+FANIT G M  PLFNTR+ K+A+V +GKG+A++ CP   SQ   SE         
Sbjct  378   DVSVSFANITTGSMSAPLFNTRSFKIAYVPNGKGYAEIVCPHRQSQGGESER--------  429

Query  1168  VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINAD---NNERVALAGKNNLYSNMD  1338
                                     +D   +             NE+V LAG +N+   +D
Sbjct  430   -----------------------ERDKGRRSEEESSEEQEEAGNEKVFLAGADNVLQKLD  466

Query  1339  DVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
              VAK +SF   ++ VD+V  +  + + F  GPE
Sbjct  467   RVAKALSFAAKAEEVDEVLGSRHE-KGFLPGPE  498



>ref|XP_010511540.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=491

 Score =   210 bits (535),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 129/420 (31%), Positives = 220/420 (52%), Gaps = 37/420 (9%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERS-NQFEGIENFRFGILEVESKTFVAPNHLDA  483
             PY F+ R F+   +S +G   +LP+FT+R+ N F GIEN+RF + E+E  TF+ P+HLDA
Sbjct  63    PYHFRKRSFKNWFQSNEGFVKMLPKFTKRARNLFRGIENYRFALFEMEPNTFLVPHHLDA  122

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D + LV +G G ++ +    K+S+ +  G +V +P+G T +  NT+    L  +K+I  +
Sbjct  123   DSVVLVLQGHGVVEFVTDKTKESFHVTKGDVVRLPSGVTHFATNTNQTVPLRFVKIIVPV  182

Query  664   STPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP---FIQVSD  825
             + PG+F+ +F      + S+   F   +L A+++  +E + R+  G   +      +VS 
Sbjct  183   NNPGQFKDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRLFSGSQQTGQGIMRRVSP  242

Query  826   EQLKSLRKESDTIWPFKTDKSSSSK---------PVDIFKHKSVS---NNYGQLFEVDND  969
             +Q+K L K + +  P    K + SK         P ++F   SVS   N++G   E   +
Sbjct  243   DQIKELTKHATS--PSNKHKETKSKHKDISTKLRPFNLFTQDSVSSYTNDFGHFHEAHPE  300

Query  970   DFKELGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP-----------  1110
              F +L D  I VA+ N+++G +  P +N++ T + FV +G    +MA P           
Sbjct  301   SFDQLQDLRIAVAWTNMSQGSLFLPHYNSKTTFITFVENGCARYEMASPYSFQGEQQQQE  360

Query  1111  --QVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINAD  1284
                   Q    EE        + +++  G +F+IP G+P+ ++ S D+N   V F I+A 
Sbjct  361   QQWWPQQGGEEEEDMSGQVHKIVSRVCKGDVFIIPAGHPF-TLVSHDENFVSVGFGIHAS  419

Query  1285  NNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRAD  1464
             N  R  LAG+ N+ SN+D VA  V+FGV SK+ +K+F + +           QQ+ ++ +
Sbjct  420   NCTRTFLAGQENVLSNLDTVATRVTFGVGSKVAEKLFTSQNHSYFAPTTRSHQQTREKRE  479



>ref|XP_010511547.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=487

 Score =   210 bits (534),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/404 (31%), Positives = 215/404 (53%), Gaps = 24/404 (6%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERS-NQFEGIENFRFGILEVESKTFVAPNHLDA  483
             PY F+ R F+   +S++G   +LP+FT+R+ N F GIEN+RF + ++E  +F+ P HLDA
Sbjct  85    PYHFRKRSFKNWFQSKEGFVKMLPKFTKRAPNLFRGIENYRFSLYDMEPNSFLVPLHLDA  144

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D + ++ +G G  + +    K+ + +  G +V +P+G T + +NT+    L   K+   +
Sbjct  145   DSVVIILQGHGVAEFVTAKTKELFHLTKGDVVRLPSGITHFAINTNQTVPLRFAKITIPV  204

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG---RDDSPFIQVSD  825
             + PG+F+ +F      + S+   F   +L A+++  +E + R+  G          +++ 
Sbjct  205   NNPGQFQNYFSAPSQFQQSYFTGFSKEVLSASFNIPEELVGRIFFGPQQMGQGIMRRITP  264

Query  826   EQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVS---NNYGQLFEVDNDDFKELGDIE  996
             +Q+K L + S +      DKS+   P  +F H SVS   N++G   E   + F +L D++
Sbjct  265   DQIKELTENSTSPSNKHKDKSTKFSPFSLFTHDSVSSYTNDFGHFHEAHPESFDQLQDLQ  324

Query  997   VA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP-----------QVSSQTERS  1137
             +A  + N+T+G +  P +N++AT + FV +G    +MA P               Q E  
Sbjct  325   IAVTWTNMTQGSVFLPQYNSKATFVTFVENGCARYEMASPYSFQGEQQQQQWWPEQGEEK  384

Query  1138  EEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKN  1317
             EE        + +++    +F+IP G+P+ +I S D+N   V F I A N+ R  LAG+ 
Sbjct  385   EEDMSGQVHKIVSRVCKSDVFIIPAGHPF-TIVSHDENFVSVGFGIYASNSIRTFLAGQG  443

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQS  1449
             N+ SN+D VA  V+FGV SK+ +K+F + +        P  QQS
Sbjct  444   NVLSNLDTVATRVAFGVGSKVAEKLFTSQNYSHFAPTTPSHQQS  487



>ref|XP_009369870.1| PREDICTED: LOW QUALITY PROTEIN: vicilin-like [Pyrus x bretschneideri]
Length=595

 Score =   212 bits (539),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 131/387 (34%), Positives = 222/387 (57%), Gaps = 28/387 (7%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  + F++  +S +G   VL RF  +S    GI+N+R  I E    TFV P+H D
Sbjct  185   NNPFYFPSQMFQSRFQSNEGGLQVLERFG-KSELLRGIKNYRLAIFEAMPNTFVLPHHCD  243

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G+ T  ++ K++++S+++  G ++ + AG T YL N +N+  L I KLI++
Sbjct  244   AEAIFVVLNGQCTCTLLLKDRRESFNMEHGDVIRVRAGTTIYLTNNNNDEPLHIAKLIRS  303

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-----FIQ  816
             +++PGRFE FF  G     S+   F + ILE+A++  ++ +++  R +          ++
Sbjct  304   VNSPGRFEEFFPAGSGNPESYFSVFSNDILESAFNTPRKELEQGFRQQRGQQGGQGIVMR  363

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDI  993
                EQL++L + + +    +  +  S  P ++ + K V SNNYGQLFE   ++F +  D+
Sbjct  364   APKEQLEALSQRASSAR--REGRRQSEGPFNLRQLKPVHSNNYGQLFEARPEEFNQFQDM  421

Query  994   EVAFANI--TRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ------TERSEEGA  1149
             +V+ + I   +  M+ P FN++AT L +VV+G    +M CP ++SQ       E+ E+G 
Sbjct  422   DVSVSCIEMNQQTMMVPHFNSKATFLIYVVEGNVRVEMGCPHLASQMHGQETMEQQEQGE  481

Query  1150  IP-TYETVNAQLRPGTLFVIPPGNPYVSI---ASQDDNLQIVCFDINADNNERVALAG-K  1314
                 +  VNAQL PG  FVIP G+P   +    +Q+ N++I+ F +NA  N R  LAG K
Sbjct  482   QSGRFMKVNAQLSPGDAFVIPAGHPVAFVTQSGNQNQNIRILGFGLNAQYNTRNFLAGQK  541

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVF  1395
             +N+   MD  AK+++FG     ++K+F
Sbjct  542   DNIMLQMDREAKQLAFGQD---MEKIF  565



>ref|XP_010466552.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=462

 Score =   208 bits (529),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 213/390 (55%), Gaps = 24/390 (6%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERS-NQFEGIENFRFGILEVESKTFVAPNHLDA  483
             PY F+ + F+   +S++G   +LP+FT+R+ N F GIEN+RF + E+E  TF+ P HLDA
Sbjct  60    PYHFKKQSFKNWFQSKEGFVKMLPKFTKRAPNLFRGIENYRFSLYEMEPNTFLVPLHLDA  119

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D + ++ +G+G  + +    K+ + +  G +V +P+G T + +NT+    L   K+   +
Sbjct  120   DSVVIILQGQGVAEFVTAKTKELFHLTKGDVVRLPSGITHFAINTNQTVPLRFAKITIPV  179

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRD---DSPFIQVSD  825
             + PG+F+ +F      + S+   F   +L A+++  +E + R+  G          +++ 
Sbjct  180   NIPGQFQNYFSAPSQFQQSYFTGFSKEVLSASFNIPEELVGRIFFGSQQMGQGILRRITP  239

Query  826   EQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVS---NNYGQLFEVDNDDFKELGDIE  996
             EQ+K + + S +      DKS+   P ++F H SVS   N++G   E   D F ++ D++
Sbjct  240   EQIKEITENSTSRSNKDKDKSTKFSPFNLFTHDSVSSYTNDFGHFHEAQPDSFDQIQDLQ  299

Query  997   VA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP-----------QVSSQTERS  1137
             +A  + N+T+G +  P +N++AT + FV +G    +MA P               Q    
Sbjct  300   IAVTWTNMTQGSVFLPQYNSKATFVTFVENGCARYEMASPYSFQREQQQQQWWPEQGGEE  359

Query  1138  EEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKN  1317
             EE        + +++  G +F+IP G+P+ +I S D+N   V F I A N+ R  LAG+ 
Sbjct  360   EEDMSGQVHKIVSRVCKGDVFIIPAGHPF-TIVSHDENFVSVGFGIYASNSIRTFLAGQG  418

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFENDD  1407
             N+ SN+D VA  V+FGV SK+ +K+F + +
Sbjct  419   NVLSNLDTVATRVAFGVRSKVAEKLFTSQN  448



>pdb|4LEJ|A Chain A, Crystal Structure Of The Korean Pine (pinus Koraiensis) 
Vicilin
Length=407

 Score =   205 bits (521),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 130/410 (32%), Positives = 210/410 (51%), Gaps = 38/410 (9%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             ++NPYVF    FR    S+ G    LP F E S   EGI  +R   +E++  T + P+++
Sbjct  7     EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI  66

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA  I  V  G G +  +Q+N+     +  G +  +P+G T YLVN D++N L I  L++
Sbjct  67    DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR  126

Query  658   TIST-PGRFE-FFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSD  825
             T ST  G +E F+   GRN  +   AF   +LEAA++   + ++ +            ++
Sbjct  127   TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANE  186

Query  826   EQLKSLRKESDTIWPFKTDKSSSS---KPVDIFKHKSVSNNYGQLFEVDNDDFKELG---  987
             EQ++ + +       F  + +S+S   KP ++   K         FE DN  F   G   
Sbjct  187   EQIREMMRRGG----FSAESTSASEQPKPFNLRNQKPD-------FENDNGRFTRAGPKD  235

Query  988   -------DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV------SSQT  1128
                    D+ V F  +  G M  P  NT+AT +A V++G+G  +MACP +      SS  
Sbjct  236   NPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPR  295

Query  1129  ERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA  1308
             ER  +     YE V A+LR GT++V+P G+P   IAS +  L+I+ FDIN   NER  LA
Sbjct  296   ERGHQDI--NYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLA  353

Query  1309  GKNNLYSNMDDVAKEVSFGV-SSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             GKNN+   ++   + +SF +   + +++V +   D ++  +GP+ Q+ ++
Sbjct  354   GKNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKD-QVILRGPQRQRRDE  402



>ref|XP_010228589.1| PREDICTED: globulin-1 S allele-like [Brachypodium distachyon]
Length=500

 Score =   207 bits (526),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 135/436 (31%), Positives = 219/436 (50%), Gaps = 56/436 (13%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY +    F+    ++ GRF VL RFT    +   + + R  +LE   + F+ P+H DAD
Sbjct  61    PYHYGEESFKYRTTTRHGRFRVLERFTHELLRDSPVGDRRVAVLEAAPRAFLQPSHYDAD  120

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              +  V EGEG + ++ K K++S+ +R G ++ IPAGAT Y  NT ++    ++ L+  +S
Sbjct  121   EVFYVREGEGVVVMLWKGKRQSFCVREGDVMVIPAGATVYSANTHDSRWFRVVMLLNPVS  180

Query  667   TPGRFEFFFGTG----RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQL  834
             TPGRF  FF  G    + SF  AF   IL+A+++  KE +++V     +    Q  +EQ+
Sbjct  181   TPGRFGEFFPVGSGERQESFFGAFSDDILQASFNARKEEVEKVFEESSEGEITQAPEEQI  240

Query  835   KSLRKESDTIWPFKTDKSSSS--KPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--DIEV  999
             ++L K   +     +   S    KP  I   K   SNN+G+L E+  D+   L   D+EV
Sbjct  241   RALSKSCSSSRGSGSGSRSEQDFKPTSIASKKPRYSNNHGRLSEITGDECPHLRRLDMEV  300

Query  1000  AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS---------QTERSEEGAI  1152
               ANITRG M+   ++TRATK+A VV+G G+ +MACP +S          +    E G+ 
Sbjct  301   GLANITRGSMMAMSYSTRATKIAVVVEGNGYFEMACPHMSGSSSRRSERRREREQEHGSE  360

Query  1153  PT----------------------------------YETVNAQLRPGTLFVIPPGNPYVS  1230
                                                 Y  V A ++ G++ V+P  +P   
Sbjct  361   QERRERQEREHEQSSEEERRREREQGQREGGQKSRGYRQVGANIKEGSVIVLPAAHPATF  420

Query  1231  IASQDDNLQIVCFDINADNNERVALAGKNNLYSNM---DDVAKEVSFGVSSKLVDKVFEN  1401
             +A  D NL ++CF + A+ +E+V L GKN+    +   D+ A+++ FG  ++  +K+   
Sbjct  421   VAGGDGNLAVLCFGVGAERDEKVFLTGKNSPLRQLVEEDEAARKLVFGERAQEAEKLVRG  480

Query  1402  DDDLELFSKGPEWQQS  1449
               D ++F +GP  +QS
Sbjct  481   QSD-DVFVRGPRQRQS  495



>emb|CAA44873.1| vicilin-like storage protein [Picea glauca]
Length=448

 Score =   205 bits (522),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/402 (32%), Positives = 214/402 (53%), Gaps = 24/402 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPYVF    FRT   S+ G    LP F E S   EGI  FR   +E++  T + P+++DA
Sbjct  51    NPYVFHSDSFRTRASSEAGEIRALPNFGEVSELLEGIRKFRVTCIEMKPNTVMLPHYIDA  110

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
               I  V  G G +  + +N+     +  G +  +P+G T YLVN D++N L I  L++ +
Sbjct  111   TWILYVTRGRGYIAYVHQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNTLRIASLVRPV  170

Query  664   ST-PGRFE-FFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ST  G ++ F+   GRN  +   AF   +LEAA++ + + ++R+  G      I  ++EQ
Sbjct  171   STVRGEYQPFYVAGGRNPQTVYSAFSDDVLEAAFNTNVQQLERIFGGHKSGVIIHANEEQ  230

Query  832   LKSLRKESDTIWPFKTDKSSS---SKPVDIFKHKSVSNNYGQLFEV---DNDDFKELGDI  993
             ++ + ++      F     S+    KP ++   K    N    F +    N  F +  D+
Sbjct  231   IREMMRKRG----FSAGSMSAPEHPKPFNLRNQKPDFENENGRFTIAGPKNYPFLDALDV  286

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-----SSQTERSEEGAIPT  1158
              V  A++  G M  P  N+++T +  V +G+G  +MACP +     SS  ER ++    T
Sbjct  287   SVGLADLNPGSMTAPSLNSKSTSIGIVTNGEGRIEMACPHLGQHGWSSPRERGDQDI--T  344

Query  1159  YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMD  1338
             Y+ V A+LR G+++++P G+P   IAS +  LQI+ FD+N   NER  LAGKNN+ + ++
Sbjct  345   YQRVWAKLRTGSVYIVPAGHPITEIASTNSRLQILWFDLNTRGNERQFLAGKNNVLNTLE  404

Query  1339  DVAKEVSFGVS-SKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
                +++SF V   + +++V +   D ++  +GP+ ++S D A
Sbjct  405   REIRQLSFNVPRGEEIEEVLQAQKD-QVILRGPQ-RRSRDEA  444



>gb|KDP42507.1| hypothetical protein JCGZ_00304 [Jatropha curcas]
Length=426

 Score =   204 bits (520),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 196/380 (52%), Gaps = 15/380 (4%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             D PY F    F    ++Q+G    L +F+  S    GIEN+R   LE    TFV P H +
Sbjct  53    DIPYYFSAERFEYLQKTQEGNIRALEKFS--SEHLRGIENYRLLTLEANPSTFVVPQHNN  110

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A  I +V  G+ T+  +   K++SY++  G ++ IPAGA  YL+N D N KL +I L Q 
Sbjct  111   AKSIVVVLRGKATITYVLGEKRQSYNLEKGDVIEIPAGAVIYLINPDKNEKLNMIILTQP  170

Query  661   ISTPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKS  840
             +++PG    +F  G  SF   F + +LEAA + ++E + ++   +     ++   EQL +
Sbjct  171   VTSPGNLANYFVAGGVSFYEVFSNDVLEAALNITREKLDQLFAEQRQGVILKAPQEQLMA  230

Query  841   LRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVAFANIT  1017
             L   +  I   K     S+ P +I     +  N +G   +          DI V++A I 
Sbjct  231   L---NSNISATKQKGQKSAGPFNILDQLPLYYNQFGHFLQASLKG----EDISVSYAEIK  283

Query  1018  RGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE----EGAIPTYETVNAQLR  1185
              G ++ P +N++AT + FVV+G G+ +M  P VSSQ    +    EG  P Y+ +N+ + 
Sbjct  284   SGALMVPFYNSKATAIIFVVEGDGYFEMVSPCVSSQAMEGKGEETEGNEP-YQQINSNVS  342

Query  1186  PGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFG  1365
              G + V+P G+P+  +AS + NL    F +N  +N+R  LAG  N+ + +D  A ++ F 
Sbjct  343   AGDVIVLPAGSPFAILASGNQNLIAASFTVNDKHNQRNFLAGAGNVMTQLDREAIKLCFT  402

Query  1366  VSSKLVDKVFENDDDLELFS  1425
              S++ ++ +F N  +    S
Sbjct  403   GSAESIESLFRNQQEAHFVS  422



>ref|XP_010466550.1| PREDICTED: vicilin C72-like [Camelina sativa]
Length=494

 Score =   206 bits (523),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 130/422 (31%), Positives = 222/422 (53%), Gaps = 42/422 (10%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERS-NQFEGIENFRFGILEVESKTFVAPNHLDA  483
             PY F  R F+   +S +G   +LP+FT+R+ N F GIEN+RF + E+E  TF+ P+HLDA
Sbjct  67    PYHFGKRSFKNWFQSNEGFVKMLPKFTKRAPNLFRGIENYRFALFEMEPNTFLVPHHLDA  126

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D + LV +G G ++ +    K+S+ +  G +V +P+G T Y  NT+    L  +K+I  +
Sbjct  127   DSVVLVLQGHGVVEFVTDKTKESFHVTKGDVVRLPSGVTHYATNTNQTVPLRFVKIIVPV  186

Query  664   STPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP---FIQVSD  825
             + PG+F+ +F      + S+   F   +L A+++  +E + R+  G   +      +VS 
Sbjct  187   NNPGQFKDYFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRLFSGSQQTGQGIMRRVSP  246

Query  826   EQLKSLRKESDTIWPFKTDKSSSSK---------PVDIFKHKSVS---NNYGQLFEVDND  969
             +Q+K L K + +  P    K + SK         P ++F   SVS   N++G   E   +
Sbjct  247   DQIKELTKHATS--PSNKHKETKSKHKDTSTKLRPFNLFTQDSVSTYTNDFGHFHEARPE  304

Query  970   DFKELGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP-----------  1110
              F +L D  I VA+ N+++G +  P +N++ T + FV +G    +MA P           
Sbjct  305   SFDQLQDLRIAVAWTNMSQGSLFLPHYNSKTTFVTFVENGCARYEMASPYSFQGEQQQQQ  364

Query  1111  ----QVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
                 Q   + E    G +     + +++  G +F+IP G+P V++ S ++N   V F I+
Sbjct  365   WWPEQGGEEEEEDMSGQV---HKIVSRVCKGDVFIIPAGHP-VTLVSHNENFVSVGFGIH  420

Query  1279  ADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
             A N  R  LAG+ N+ SN+D VA  V+FGV SK+ +K+F + +           QQ++++
Sbjct  421   ASNCTRTFLAGQENVLSNLDTVATRVTFGVGSKVAEKLFTSQNYSYFAPTTRSHQQTQEK  480

Query  1459  AD  1464
              +
Sbjct  481   RE  482



>ref|XP_008382112.1| PREDICTED: vicilin-like [Malus domestica]
 ref|XP_008382113.1| PREDICTED: vicilin-like [Malus domestica]
Length=612

 Score =   208 bits (529),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 131/389 (34%), Positives = 221/389 (57%), Gaps = 30/389 (8%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  + F++  +S +G   VL RF  +S    GI+N+R  I E    TFV P+H D
Sbjct  200   NNPFYFPSQMFQSRFQSDEGSLQVLVRFG-KSELLRGIKNYRLAIFEAMPNTFVLPHHCD  258

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+ I +V  G+ T  ++ K++K+S++   G ++ + AG T YL N +N+  L I KLI++
Sbjct  259   AEAIFVVLNGQCTCTLLLKDRKESFNXEHGDVIRVRAGTTIYLTNNNNDEPLHIAKLIRS  318

Query  661   ISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-----FIQ  816
             +++PGRFE FF  G     S+   F + ILE+A+   ++ +++  R +          ++
Sbjct  319   VNSPGRFEEFFPAGSGNPESYFSVFSNDILESAFSTPRKELEQGFRQQRGQQGGQGIVMR  378

Query  817   VSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDI  993
                EQL++L + + +    +  +  S  P ++ + K V SNNYGQLFE   ++F +  D+
Sbjct  379   APKEQLEALSQRASSAR--REGRRQSEGPFNLRQLKPVHSNNYGQLFEARPEEFSQFQDM  436

Query  994   EVAFANI--TRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ------TERSEEGA  1149
             +V+ + I   +  M+ P FN++AT L +VV+G    +M CP ++SQ      TE+ E+G 
Sbjct  437   DVSVSCIEMNQQTMMVPHFNSKATFLIYVVEGNVRVEMVCPHLASQMQGQETTEQQEQGE  496

Query  1150  IP-TYETVNAQLRPGTLFVIPPGNPYVSI-----ASQDDNLQIVCFDINADNNERVALAG  1311
                 +  VNAQL PG  FVIP G+P   +      +Q+ N++I+ F +NA  + R  LAG
Sbjct  497   HSGRFMKVNAQLSPGDAFVIPAGHPVAFVTHSNNGNQNQNIRILGFGLNAQYSMRNFLAG  556

Query  1312  -KNNLYSNMDDVAKEVSFGVSSKLVDKVF  1395
              K+N+   M+  AK+++FG     ++K+F
Sbjct  557   QKDNIMLQMNREAKQLAFGQD---MEKIF  582



>gb|AHC94918.1| vicilin [Pinus koraiensis]
Length=463

 Score =   203 bits (517),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/408 (32%), Positives = 208/408 (51%), Gaps = 38/408 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPYVF    FR    S+ G    LP F E S   EGI  +R   +E++  T + P+++DA
Sbjct  65    NPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYIDA  124

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
               I  V  G G +  +Q+N+     +  G +  +P+G T YLVN D++N L I  L++T 
Sbjct  125   KWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLRTE  184

Query  664   STP-GRFE-FFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ST  G +E F+   GRN  +   AF   +LEAA++   + ++ +            ++EQ
Sbjct  185   STMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIFGAHRRGVIFYANEEQ  244

Query  832   LKSLRKESDTIWPFKTDKSSSS---KPVDIFKHKSVSNNYGQLFEVDNDDFKELG-----  987
             ++ + +       F  + +S+S   KP ++   K         FE DN  F   G     
Sbjct  245   IREMMRRGG----FSAESTSASEQPKPFNLRNQKPD-------FENDNGRFTRAGPKDNP  293

Query  988   -----DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV------SSQTER  1134
                  D+ V F  +  G M  P  NT+AT +A V++G+G  +MACP +      SS  ER
Sbjct  294   FLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRER  353

Query  1135  SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK  1314
               +     YE V A+LR GT++V+P G+P   IAS +  L+I+ FDIN   NER  LAGK
Sbjct  354   GHQDI--NYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAGK  411

Query  1315  NNLYSNMDDVAKEVSFGVS-SKLVDKVFENDDDLELFSKGPEWQQSED  1455
             NN+   ++   + +SF +   + +++V +   D ++  +GP+ Q+ ++
Sbjct  412   NNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKD-QVILRGPQRQRRDE  458



>gb|AAB01554.1| vicilin-like storage protein [Picea glauca]
Length=450

 Score =   202 bits (515),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/402 (31%), Positives = 215/402 (53%), Gaps = 24/402 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPYVF    FRT   S+ G    LP F E S    GI  FR   +E++ KT + P+++DA
Sbjct  53    NPYVFHSDSFRTRASSEAGEIRALPNFGEVSELLGGIRKFRVTFIEMKPKTVMLPHYIDA  112

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
               I  V  G G +  + +N+     +  G +  +P+G T YLVN+D++N L I  L++ +
Sbjct  113   TWILYVTRGRGYITYVHQNELVKRKLEEGDVFGVPSGHTFYLVNSDDHNTLRIASLLRPV  172

Query  664   ST-PGRFE-FFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQ  831
             ST  G ++ F+   GRN  +   AF   +LEAA++ + + ++R+  G      I  ++EQ
Sbjct  173   STVRGEYQPFYVAGGRNPQTVYSAFSDDVLEAAFNTNVQQLERIFGGHKSGVIIHPNEEQ  232

Query  832   LKSLRKESDTIWPFKTDKSSS---SKPVDIFKHKSVSNNYGQLFEV---DNDDFKELGDI  993
             ++ + ++      F     S+    KP ++   K    N    F +    N  F +  D+
Sbjct  233   IREMIRKRG----FSAGSMSAPEHPKPFNLRNQKPDFENENGRFTIAGPQNYPFLDALDV  288

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV-----SSQTERSEEGAIPT  1158
              V  A++  G M  P  N+++T +  V +G+G  +MACP +     SS  ER ++    T
Sbjct  289   SVGLADLNPGSMTAPSLNSKSTSIGIVTNGEGRIEMACPHLGQHGWSSPRERGDQDI--T  346

Query  1159  YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMD  1338
             Y+ V ++LR G+++++P G+P   IAS +  LQI+ FD+N   NER  LAGKNN+ + ++
Sbjct  347   YQRVWSKLRTGSVYIVPAGHPITEIASTNSRLQILWFDLNTRGNERQFLAGKNNVLNTLE  406

Query  1339  DVAKEVSFGVS-SKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
                +++SF V   + +++V +   D ++  +GP+ ++S D A
Sbjct  407   REIRQLSFNVPRGEEIEEVLQAQKD-QVILRGPQ-RRSRDEA  446



>ref|XP_008224282.1| PREDICTED: vicilin C72 [Prunus mume]
Length=541

 Score =   205 bits (521),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 136/400 (34%), Positives = 212/400 (53%), Gaps = 49/400 (12%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEG-IENFRFGILEVESKTFVAPNH  474
             + NPY F     R    +++G + VL  F   S+   G I+N+R  +L+    TFV P H
Sbjct  119   NPNPYYFPKFELRPRFLAEEGAYFVLESFARLSHLLRGRIQNYRTALLQTTPGTFVLPYH  178

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
             LDA+ I +V  G GTL ++ K+ K+S+ I  G ++ +PAGAT+YL+N      L +++L 
Sbjct  179   LDAESIFVVWNGRGTLTLVMKDTKESFKIENGDVIRVPAGATTYLINNHTTENLSLVQLF  238

Query  655   QTISTPGRFEFFFGTGRN---------------SFLRAFKSSILEAAYDESKETIQRVL-  786
             Q ++TP  FE FF  G                 S+   F S +LEAA+D  +E +++   
Sbjct  239   QPVNTPDLFEEFFPAGYKDPEPGSDYSFLHGTESYYSVFSSDLLEAAFDVPREQLEKAFG  298

Query  787   RGRDDSPFIQVSDEQLKSLRKESDTIW----PFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
             + + +   I+ S EQL++L K+    W    P+  D   S    ++   + + SNNYG+ 
Sbjct  299   QQKREGMIIRASKEQLEALSKQPSPWWRKLVPWSMD---SDLNFNLLSQRPLHSNNYGKF  355

Query  952   FEVDNDDFKELGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP-----  1110
             +E    +F +L D  + VA  +I    M+ P +NT+AT L  VVDG G+ +MACP     
Sbjct  356   YEAPPQEFNQLQDMNVSVAMLDINPEAMMVPHYNTKATYLMMVVDGMGYFEMACPKFTIP  415

Query  1111  ----QVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIAS----------QDD  1248
                 ++  Q E++++ +   Y  V+ +L  G +FVIP G+P VSI +          Q+ 
Sbjct  416   ASEEEMKYQEEQADQQS-GAYVKVSGKLSLGDVFVIPAGHP-VSIVAQNNNPNNNGNQNQ  473

Query  1249  NLQIVCFDINADNNERVALAGK-NNLYSNMDDVAKEVSFG  1365
             NL+IV F INA NN R  LAG+  N+   M+  A E++FG
Sbjct  474   NLRIVGFGINAGNNIRNFLAGQEGNIMKQMEREATELTFG  513



>ref|XP_006406142.1| hypothetical protein EUTSA_v10021982mg [Eutrema salsugineum]
 gb|ESQ47595.1| hypothetical protein EUTSA_v10021982mg [Eutrema salsugineum]
Length=495

 Score =   202 bits (513),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 129/407 (32%), Positives = 225/407 (55%), Gaps = 41/407 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQ-GRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNH  474
             +NPY F+ R F++  +S++ G   +LP+FT+RS+  F GIEN RF  +E+E  TF+ P+H
Sbjct  62    NNPYHFKERSFKSWFQSKEVGYMKMLPKFTKRSSTLFRGIENHRFMFMEMEPNTFLVPHH  121

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
             +DAD + +V +G+G +  +    K+S++I+ G +V +P+G T +  NT+    L + K+ 
Sbjct  122   VDADFVFIVLQGKGMIGFVTDKTKESFEIKKGDVVRVPSGVTHFFTNTNETVPLRLAKIA  181

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRD---DSPFIQ  816
               ++TPG F+  F +    + S+   F + +L A+++  +E +  ++RG          +
Sbjct  182   VPVNTPGHFQANFPSRSKFQQSYFSGFSNDVLSASFNIPEELVGSLIRGSQQMGQGIIRR  241

Query  817   VSDEQLKSLRKESDT--------IWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDND  969
             VS EQ+K L + + +            + D S+   P +IFK   + SN++G L E    
Sbjct  242   VSPEQIKELTEHATSPSNKHKEKGKGKEKDTSTMWNPFNIFKEDPIYSNDFGHLHEAHPK  301

Query  970   DFKELG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE  1143
              F +L   DI V++ N+T+G +  P +N++ T + FV +G    +MA P  + Q E+ ++
Sbjct  302   KFSQLQDLDISVSWINMTQGSLFLPHYNSKTTFVVFVENGCARFEMASP-YTFQGEQQQQ  360

Query  1144  GAIPTY------------ETVNAQLR-------PGTLFVIPPGNPYVSIASQDDNLQIVC  1266
                P +            E ++ Q+         G +F+IP G+P+  +A QD N   V 
Sbjct  361   QK-PWFEQEQGEEQEQEEEEMSGQVHKFVSRVCKGEVFIIPAGHPFAVLA-QDQNYVAVG  418

Query  1267  FDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDD  1407
             F INA N++R  LAG+ N+ +N+D VA  +SFGV SK+ +K+F + +
Sbjct  419   FGINAFNSKRTFLAGQENMLNNLDKVATRLSFGVGSKMAEKLFTSQN  465



>ref|XP_010652019.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Vitis vinifera]
Length=252

 Score =   194 bits (493),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 154/230 (67%), Gaps = 12/230 (5%)
 Frame = +1

Query  769   TIQRVLRGRDDSPFIQVSDEQLKSL----RKESDTIWPFKTDKSSSSKPV--DIFKHKSV  930
             T++RV + +    FI+ S EQ+++L      E+  IWPF + +S   +PV   + K  SV
Sbjct  10    TLERVFQQQTKGHFIKASGEQIQALSGGQHGEAAGIWPFTSGESK--RPVFNLLNKDPSV  67

Query  931   SNNYGQLFEVDNDDFKELGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMA  1104
              NNYG+L E D +DF++L D  IE+++ANIT+ GM+GP FN+R+T +A V++G+G+ +M 
Sbjct  68    CNNYGRLHEADAEDFRQLKDMDIEISYANITQEGMMGPFFNSRSTMVAAVLEGEGYLEMV  127

Query  1105  CPQVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINAD  1284
             CP +S + ++ ++GA P Y+ V++ LR GTLFV+P G+P   +A    NL+IVCF INA+
Sbjct  128   CPHLSGEKQQ-QQGASPIYQKVSSSLRRGTLFVVPAGHPIAIVAGTSWNLEIVCFGINAE  186

Query  1285  NNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             NN R  LAGK N+ + ++  AKE++F + ++ VDKVF    + ELF  GP
Sbjct  187   NNRREPLAGKGNVVNGLEKEAKELAFALPAREVDKVFRKQKE-ELFFPGP  235



>prf||1713472A convicilin
Length=607

 Score =   203 bits (516),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 125/393 (32%), Positives = 216/393 (55%), Gaps = 16/393 (4%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G   +L RF +RS+ FE ++N+R         T   P H+DA
Sbjct  201   NPFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRARPHTIFLPQHIDA  260

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  261   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLVIPV  320

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRV-LRGRDDSP-----FIQVS  822
             + PG+FE F     +N +LR F  +ILEA+Y+   ETI++V L  ++  P      ++VS
Sbjct  321   NGPGKFEAFDLAKNKNQYLRGFSKNILEASYNTKYETIEKVLLEEQEKEPQQRRAIVKVS  380

Query  823   DEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDND-DFKELGDIE  996
              EQ++ LRK + +    K    S  +P+++  HK   SN +G+LFE+  +  + +L D++
Sbjct  381   REQIEELRKLAKSS--SKKSLPSEFEPINLRSHKPEYSNKFGKLFEITPEKKYPQLQDLD  438

Query  997   --VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETV  1170
               V+   I  G ++ P +N+RA  +  V +GKG  ++   +   Q     +      +  
Sbjct  439   LFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNLELLGLKDEQQEREDRKERNNEVQRY  498

Query  1171  NAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLYSNMDDVA  1347
              A+L PG + +IP G+P    AS   NL ++ F INA+NNER  L+G  +N+ S +++  
Sbjct  499   EARLSPGDVVIIPAGHPVAITAS--SNLNLLAFGINAENNERNFLSGSDDNVISQIENPV  556

Query  1348  KEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
             KE++F  S + ++++ +N       +  PE ++
Sbjct  557   KELTFPRSVQEINRLIKNQKQSHFANAEPEQKE  589



>ref|XP_002885515.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61774.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
Length=487

 Score =   199 bits (507),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 216/407 (53%), Gaps = 49/407 (12%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHL  477
             ++PY F+ R F+   +S++G   +LP+FT+R+   F GIEN+RF ++E+E  TF  P+H 
Sbjct  61    NHPYHFRKRSFKNWFQSKEGFVKLLPKFTKRAPALFRGIENYRFSLVEMEPTTFFVPHHW  120

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD + +V +G+G ++ +  N K+++ I  G +V +P+G T +L NT+    L + K I 
Sbjct  121   DADSVVIVLQGKGVIEFVTDNTKEAFHINKGDVVRVPSGVTHFLTNTNQTVPLRLAKFIV  180

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL---RGRDDSPFIQV  819
              ++ PG+F+ +F +    + S+       +L  +++  +E ++R++   + R      ++
Sbjct  181   PVNNPGQFKDYFPSPSQFQQSYFSGLSKEVLSTSFNVPEELLERLVTRSKERGQGIIRRI  240

Query  820   SDEQLKSLRKESD-------------------TIWPFKTDKSSSSKPVDIFKHKSV-SNN  939
             S +Q+K L + +                    T+W           P ++F    + SN+
Sbjct  241   SPDQIKELAEHATSPSNKHKAKKEKEEDKDLRTMW----------TPFNLFAIDPIYSND  290

Query  940   YGQLFEVDNDDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ  1113
             +G   E     F +L D+ +  A+A++ +G +  P FN++ T + FV +G    +MA P 
Sbjct  291   FGHFHEAHPKSFDQLQDLHIATAWASMRQGSLFLPHFNSKTTFVTFVENGCARFEMATPY  350

Query  1114  VSSQ---------TERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVC  1266
              S +          E+ EE        V +++  G +F++P G+P+ +I SQD +   V 
Sbjct  351   KSQEEQQQWPGQGQEQEEEDLSEDVHKVVSRVCKGEVFIVPAGHPF-TILSQDQDFVAVG  409

Query  1267  FDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDD  1407
             F I A NN+R  LAG+ N+ SN++  A  V+FGV SKL +K+F + +
Sbjct  410   FGIYATNNKRTFLAGEENMLSNLNPAATRVTFGVGSKLAEKLFTSQN  456



>ref|XP_009369890.1| PREDICTED: beta-conglycinin, beta chain-like [Pyrus x bretschneideri]
Length=591

 Score =   201 bits (511),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 129/394 (33%), Positives = 210/394 (53%), Gaps = 43/394 (11%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEG-IENFRFGILEVESKTFVAPNHLD  480
             NPY F          +++G + VL   T  S    G I+N+R  +      TFV P H+D
Sbjct  160   NPYYFPKSTLLNRFGAEEGGYVVLNSLTRLSPFLRGRIKNYRLALFLTAPGTFVLPYHID  219

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             A+   +V+ G+GTL  + KNKK+S+ I  G ++ +P GAT+YL+N  ++  L +++LI+ 
Sbjct  220   AESAFVVSAGKGTLTFVVKNKKESFKIEEGDVIRVPGGATTYLINHHSSEHLNLVQLIRP  279

Query  661   ISTPGRFEFFFGTGRN--------------SFLRAFKSSILEAAYDESKETIQRVL-RGR  795
             ++ P  FE FF  G                S+   F + ILEAA++  +E +++ L + R
Sbjct  280   VNIPDLFEEFFPGGYKIRDREDYSILDDVESYYSVFSNDILEAAFNTPREQLEKALGQQR  339

Query  796   DDSPFIQVSDEQLKSLRKESDTIW----PFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEV  960
              +   I+ S EQLK+L K+  + W    P+ + + +  K  ++   K + SNNYG+ +E 
Sbjct  340   PEGMIIKASKEQLKALSKQDPSWWRKLVPWWSSEDTDLK-FNLQSQKPLHSNNYGKFYEA  398

Query  961   DNDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ-------  1113
                +F +L D+ V+     I    M+ P +N++AT L  VV G GW +MA PQ       
Sbjct  399   SPQEFNQLLDVNVSVVIVEINSETMMVPHYNSKATYLMMVVSGTGWFEMASPQFTLPGSE  458

Query  1114  --VSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIA-------SQDDNLQIVC  1266
               +  Q ++ E+  +  Y  V+ +L  G +FV+P G P V ++       +Q+ NL+IV 
Sbjct  459   EEIEYQEDQGEQRGM--YTKVSGKLSLGDVFVVPAGRPVVFVSQNNDESNNQNQNLRIVG  516

Query  1267  FDINADNNERVALAGK-NNLYSNMDDVAKEVSFG  1365
             F INA NN R  LAG+ +N+   M+  AK+++FG
Sbjct  517   FGINAPNNIRNFLAGQEDNIMKMMESEAKQLTFG  550



>ref|XP_006299670.1| hypothetical protein CARUB_v10015858mg [Capsella rubella]
 gb|EOA32568.1| hypothetical protein CARUB_v10015858mg [Capsella rubella]
Length=495

 Score =   198 bits (504),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 119/408 (29%), Positives = 215/408 (53%), Gaps = 33/408 (8%)
 Frame = +1

Query  331   FRTAHRSQQGRFSVLPRFTERS-NQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAE  507
             F+   +S +G   +LP+FT+R+ N F GI N+RF + E+E  TF+ P+HLDAD + ++ +
Sbjct  75    FKNWFQSNEGFVKILPKFTKRAPNLFRGIGNYRFALFEMEPNTFLVPHHLDADFVVIILQ  134

Query  508   GEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEF  687
             G+G ++ +    K+S+ +  G +V +P+G T +  NT+    L   K++  ++ PG+F+ 
Sbjct  135   GQGVVEYVTDKTKESFQVTKGDVVRLPSGVTHFATNTNQTVPLRFAKIMVPVNNPGQFKD  194

Query  688   FF---GTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRD---DSPFIQVSDEQLKSLRK  849
             +F      + S+   F   +L A+++  +E + RV  G          ++S +Q+K L +
Sbjct  195   YFPARSQFQQSYFTGFSKEVLSASFNIPEELVGRVFFGSQQMGQGIMRRISPDQIKELTE  254

Query  850   ESDT-------IWPFKTDKSSSSKPVDIFKHKSV---SNNYGQLFEVDNDDFKELGD--I  993
              + +             D ++   P +IFKH SV   +N++G   E   + F +L D  I
Sbjct  255   GATSPSNKHKEKKSKHKDTNTKWNPFNIFKHDSVETYTNDFGHFHEAHPESFDQLQDLHI  314

Query  994   EVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT-----  1158
              VA+ N+ +G +  P +N+R T + FV +G    +MA P  S   ++ ++   P      
Sbjct  315   SVAWVNMKQGSLFLPHYNSRTTFVTFVENGCARYEMASPYTSQGEKQQQQQLWPEQGGEE  374

Query  1159  --------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK  1314
                        + +++  G +F+IP G+P V++ S D+N   V F I+A N  R  LAG+
Sbjct  375   QEEDMSGQVHKIVSRVCKGDVFIIPAGHP-VTLVSHDENFVSVGFGIHASNCTRTFLAGE  433

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
              N+ SN+D VA +V+F V SK+ +K+F + +           QQ++++
Sbjct  434   ENMLSNLDTVATKVTFSVGSKMAEKLFTSQNYSYFAPTTRSHQQTQEK  481



>sp|P13915.1|CVCA_PEA RecName: Full=Convicilin; Flags: Precursor [Pisum sativum]
 emb|CAA29695.1| unnamed protein product [Pisum sativum]
Length=571

 Score =   200 bits (508),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 215/407 (53%), Gaps = 28/407 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  153   NPFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  212

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + IPAG TSYLVN D+   L ++  +  +
Sbjct  213   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKIPAGTTSYLVNQDDEEDLRVVDFVIPV  272

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------------  786
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL                  
Sbjct  273   NRPGKFEAFGLSENKNQYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRKRTQ  332

Query  787   RGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVD  963
             +G +    I+VS EQ++ LRK + +    K    S  +P ++  HK   SN +G+LFE+ 
Sbjct  333   QGEERDAIIKVSREQIEELRKLAKSSS--KKSLPSEFEPFNLRSHKPEYSNKFGKLFEIT  390

Query  964   ND-DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER  1134
              +  + +L D++  V+   I +G ++ P +N+RA  +  V +GKG  ++   +   Q   
Sbjct  391   PEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNEQQERE  450

Query  1135  SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK  1314
               +      +   A+L PG + +IP G+P    AS   NL ++ F INA NN+R  L+G 
Sbjct  451   DRKERNNEVQRYEARLSPGDVVIIPAGHPVAISAS--SNLNLLGFGINAKNNQRNFLSGS  508

Query  1315  -NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
              +N+ S +++  KE++F  SS+ V+++ +N       S  PE ++ E
Sbjct  509   DDNVISQIENPVKELTFPGSSQEVNRLIKNQKQSHFASAEPEQKEEE  555



>ref|XP_007225626.1| hypothetical protein PRUPE_ppa003838mg [Prunus persica]
 gb|EMJ26825.1| hypothetical protein PRUPE_ppa003838mg [Prunus persica]
Length=545

 Score =   198 bits (503),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 130/396 (33%), Positives = 205/396 (52%), Gaps = 40/396 (10%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEG-IENFRFGILEVESKTFVAPNH  474
             + NPY F     R    +++G + VL  F   S+   G I+N+R  +L+    TFV P H
Sbjct  122   NPNPYYFPKFGLRPRFLAEEGAYFVLGSFARLSHLLRGRIQNYRAALLQTTPGTFVLPYH  181

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
             LDA+ I +V  G GTL ++ K+ K+S+ I  G ++ +PAGAT+YL+N      L ++ L 
Sbjct  182   LDAESIFVVWNGRGTLTLVMKDTKQSFKIENGDVIRVPAGATTYLINNHTTENLSLVHLF  241

Query  655   QTISTPGRFEFFFGTGRN---------------SFLRAFKSSILEAAYDESKETIQRVL-  786
             Q ++TP  FE FF  G                 S+   F + +LEAA+D  +E +++   
Sbjct  242   QPVNTPDLFEEFFPAGYKGPEPGSDYSFLHGTESYYSVFSNDLLEAAFDVPREQLEKAFG  301

Query  787   RGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSK-PVDIFKHKSV-SNNYGQLFEV  960
             + + +   I+ S EQL++L K++   W      S  S    ++   + + SNNYG+ +E 
Sbjct  302   QQKREGMIIRASKEQLEALSKQASPWWRKLVPWSMGSDLNFNLLSQRPLHSNNYGKFYEA  361

Query  961   DNDDFKELGD--IEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS-----  1119
                +FK+L D  + VA  +I    M+ P +N++AT L  VVDG G+ +MACP+ +     
Sbjct  362   SPQEFKQLQDMNVSVAMLDINPEAMMVPHYNSKATYLMMVVDGMGYFEMACPKFTIPASE  421

Query  1120  ---SQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIA----------SQDDNLQI  1260
                   E   +     Y  V+ +L  G +FVIP G+P   +A          +Q+ NL+I
Sbjct  422   EEMEYQEEQADQQSGVYSKVSGKLSLGDVFVIPAGHPVSIVAQNNNNNNNGGNQNQNLRI  481

Query  1261  VCFDINADNNERVALAGK-NNLYSNMDDVAKEVSFG  1365
             V F INA NN R  LAG+  N+   M+  A +++FG
Sbjct  482   VGFGINAGNNMRNFLAGQEGNIMKQMEREATQLTFG  517



>ref|XP_009108737.1| PREDICTED: provicilin [Brassica rapa]
Length=486

 Score =   197 bits (500),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 125/417 (30%), Positives = 212/417 (51%), Gaps = 36/417 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHLD  480
             NPY F    F+   +S+ G   +LP+FT+RS+  F GIEN+RF   E+E  TF+ P+HLD
Sbjct  57    NPYHFGQWSFKNFFQSKDGFVKMLPKFTKRSSTLFRGIENYRFLFQEMEPNTFLVPHHLD  116

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD + LV +G+G +  +     +S+ I  G +V +P+  T +  NT+    L + K+   
Sbjct  117   ADYVFLVVQGKGVIGFVTDTANESFQITKGDVVRVPSSVTHFFANTNGTVPLRLAKIAVP  176

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP----FIQV  819
              + PG F+ FF        S+   F   +L A+++  +E + R++RG           +V
Sbjct  177   ANVPGHFQVFFPAHSGFHQSYFTGFSKDVLTASFNIPEELLGRLIRGPQQQVGQGIIRRV  236

Query  820   SDEQLKSLRKESDTIWP-----------FKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVD  963
             S EQ+K L +      P              D+S+   P ++    ++ SN +G+  E  
Sbjct  237   SPEQIKELTEHEHATSPSNKHKDKKDKHKDKDRSTFGSPFNLLAQDAIYSNKFGRYHEAH  296

Query  964   NDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS  1137
                F +L D+++A  + N+T+G +  P +N+  T + FV +G    +MA P  + Q E+ 
Sbjct  297   PKRFSQLQDLDIAVGWVNMTQGSLFLPQYNSETTFVTFVENGCARYEMASP-YTFQAEQQ  355

Query  1138  EEGAIP------------TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINA  1281
             +    P                + +++  G +F++P G+P+ +I SQD+N   V F I+A
Sbjct  356   QPWFGPGQEEEVEEEMSGQVHKIVSRVCKGEVFILPAGHPF-AILSQDENFVAVGFGIHA  414

Query  1282  DNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
              N+ R  LAG++N+ SN++ VA  +SFG+ SKL +K+F + +        P  Q  E
Sbjct  415   SNSTRTFLAGQDNMLSNINTVATRLSFGLGSKLAEKLFTSQNYSHFAPTTPSHQFPE  471



>gb|AEB33716.1| conglutin beta 5 [Lupinus angustifolius]
Length=637

 Score =   199 bits (507),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 215/391 (55%), Gaps = 31/391 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F    F+T ++++ G+  VL RF +R+N+ E ++N+R    +    T + P H DA
Sbjct  215   NPYYFSSERFQTRYKNKNGQIRVLERFDQRTNRLENLQNYRIVEFQSRPNTLILPKHSDA  274

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G  T+ I+  +K+++Y++  G  + +PAG TSY++N D+N  L ++KL   I
Sbjct  275   DYILVVLNGRATITIVNPDKRQAYNLEYGDALRLPAGTTSYILNPDDNQDLRVVKLAIPI  334

Query  664   STPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRG--------------  792
             + PG+F  F+ +    + S+   F  + LEA ++   E IQR+L G              
Sbjct  335   NNPGKFYDFYPSRTKDQQSYFSGFSKNTLEATFNTHYEEIQRILLGYEDEQEDEEQRREQ  394

Query  793   ----RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFE  957
                 +D+   ++VS EQ++ LRK + +    +  K S S P ++  ++ + SN +G  +E
Sbjct  395   EQSHQDEGVIVRVSKEQIQELRKHAQSSS--RKGKPSESGPFNLRSNEPIYSNKFGNFYE  452

Query  958   VDNDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE  1131
             +  D   ++ D++++  F  I+ G +L P +N++A  +  V +G+G  ++    + +Q  
Sbjct  453   ITPDRNPQVQDLDISLIFTEISEGALLLPHYNSKAIFVIVVDEGEGNYELVG--IRNQQR  510

Query  1132  RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
             + +E  +    + NA+L  G + VIP G+P    AS   NL+++ F INAD N+R  LAG
Sbjct  511   QQDEQEVEEVRSYNARLSEGDILVIPAGHPLSINAS--SNLRLLGFGINADENQRNFLAG  568

Query  1312  -KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
              ++N+   +D   KE+ F  S++ V+++  N
Sbjct  569   SEDNVIRQLDREVKELIFPGSAEDVERLIRN  599



>emb|CAP06316.1| cvc [Pisum fulvum]
Length=543

 Score =   197 bits (502),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 192/347 (55%), Gaps = 19/347 (5%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F+T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  201   NPFLFKSNKFQTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  260

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  261   DLILVVLSGKAILTVLSPNARNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLVIPV  320

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGRDDS--PFIQVSDEQL  834
             + PG+FE F     +N +LR F  +ILEA+Y+   ETI++VL    +     ++VS EQ+
Sbjct  321   NGPGKFEAFDLSKNKNQYLRGFSKNILEASYNTKYETIEKVLLEEQEKTDAIVKVSREQI  380

Query  835   KSLRKE----SDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDND-DFKELGDIE  996
             + LRK     S  I+P      S  +P+++  HK   SN +G+LFE+  +  + +L D++
Sbjct  381   EELRKHAKSSSKKIFP------SEFEPINLRNHKPEYSNKFGKLFEITPEKKYPQLQDLD  434

Query  997   --VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETV  1170
               V+   I  G ++ P +N+RA  +  V +GKG  ++   +   Q     +      +  
Sbjct  435   IFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNLELLGLENEQQEREDRKERNNEVQRY  494

Query  1171  NAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
              A+L PG + +IP G+P    AS   NL ++ F INA+NN+R  L+G
Sbjct  495   EARLSPGDVVIIPAGHPVAITAS--SNLNLLAFGINAENNQRNFLSG  539



>emb|CDY34239.1| BnaA01g24560D [Brassica napus]
Length=486

 Score =   195 bits (496),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 124/417 (30%), Positives = 212/417 (51%), Gaps = 36/417 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHLD  480
             NPY F    F+   +S+ G   +LP+FT+RS+  F GIEN+RF   E+E  TF+ P+HLD
Sbjct  57    NPYHFGQWSFKNFFQSKDGFVKMLPKFTKRSSTLFRGIENYRFLFQEMEPNTFLVPHHLD  116

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD + LV +G+G +  +     +S+ I  G +V +P+  T +  NT+    L + K+   
Sbjct  117   ADYVFLVVQGKGVIGFVTDTANESFQITKGDVVRVPSSVTHFFANTNGTVPLRLAKIAVP  176

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP----FIQV  819
              + PG F+ FF        S+   F   +L A+++  +E + R++RG           +V
Sbjct  177   ANVPGHFQVFFPAHSGFHQSYFTGFSKDVLTASFNIPEELLGRLIRGPQQQVGQGIIRRV  236

Query  820   SDEQLKSLRKESDTIWP-----------FKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVD  963
             S EQ+K L +      P              D+S+   P ++    ++ SN +G+  E  
Sbjct  237   SPEQIKELTEHEHATSPSNKHKDKKDKHKDKDRSTFGSPFNLLTQDAIYSNKFGRYHEAH  296

Query  964   NDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS  1137
                F +L D+++A  + N+T+G +  P +N+  T + FV +G    +MA P  + Q E+ 
Sbjct  297   PKRFSQLQDLDIAVGWVNMTQGSLFLPQYNSETTFVTFVENGCARYEMASP-YTFQGEQQ  355

Query  1138  EEGAIP------------TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINA  1281
             +    P                + +++  G +F++P G+P+ +I SQD+N   V F I+A
Sbjct  356   QPWFGPGQEEEVEEEMSGQVHKIVSRVCKGEVFILPAGHPF-AILSQDENFVAVGFGIHA  414

Query  1282  DNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
              N+ R  LAG++N+ SN++ VA  +SFG+ SK+ +K+F + +        P  Q  E
Sbjct  415   SNSTRTFLAGQDNMLSNINTVATRLSFGLGSKMAEKLFTSQNYSHFAPTTPSHQFPE  471



>ref|XP_004496703.1| PREDICTED: convicilin-like [Cicer arietinum]
Length=558

 Score =   196 bits (499),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 129/387 (33%), Positives = 209/387 (54%), Gaps = 31/387 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F    F+T   ++ G   +L RF +RSN FE ++N+R    +    T   P H DA
Sbjct  154   NPFFFNSNKFQTIFENEHGHIRLLQRFDKRSNLFENLQNYRLLEYKARPHTLFLPQHTDA  213

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G+  L ++  N + S+++  G  + +PAG  +YL N D+N  L I+ L   I
Sbjct  214   DFILVVLSGKAILTVLNSNDRNSFNLECGDTIKLPAGTIAYLANRDSNEDLRIVDLAIPI  273

Query  664   STPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVL----------RGRDDS  804
             +TP +F+ FF    N   S+   F  +ILEA+++   E I+R+L          RGR  S
Sbjct  274   NTPAKFQAFFPFANNNQQSYFNGFSKNILEASFNAKYEDIERILLEEPQQRRGHRGRQQS  333

Query  805   P----FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDND  969
                   ++VS EQ++ L K +++    +   SS S+P ++ +   + SN +G+ FE+   
Sbjct  334   QEAEVIVKVSREQIEELSKHAESSS--RKSISSESEPFNLKRRSPIYSNKFGKFFEITPK  391

Query  970   DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE  1143
                +L D++  V +A I  GG++ P FN+RAT +  V +GKG  ++    V  + E  E+
Sbjct  392   KSSQLQDLDILVDYAEINEGGLMLPHFNSRATMVVVVNEGKGNFEL----VGLRNEEEEK  447

Query  1144  GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NN  1320
                   +   A L PG +FVIP G+P    AS   NL ++ F INA NN+R  LAG+ +N
Sbjct  448   SK--QVQRYRANLSPGDVFVIPAGHPVAVNAS--SNLSLLGFGINAQNNQRNFLAGEDDN  503

Query  1321  LYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             + S ++   KE++F  S++ VD++ +N
Sbjct  504   VISQIERPVKELAFPGSAQEVDRLIKN  530



>emb|CAB82855.1| convicilin [Pisum sativum]
Length=613

 Score =   197 bits (501),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 217/399 (54%), Gaps = 22/399 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  201   NPFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  260

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  261   DLILVVLSGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLVIPV  320

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------RGRDDS  804
             + PG+FE F     +N +LR F  +ILEA+Y+   ETI++VL            +G +  
Sbjct  321   NGPGKFEAFDLAKNKNQYLRGFSKNILEASYNTRYETIEKVLLEEQEKDRKRRQQGEETD  380

Query  805   PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDND-DFK  978
               ++VS EQ++ L+K + +    K    S  +P+++  HK   SN +G+LFE+  +  + 
Sbjct  381   AIVKVSREQIEELKKLAKSS--SKKSLPSEFEPINLRSHKPEYSNKFGKLFEITPEKKYP  438

Query  979   ELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAI  1152
             +L D++  V+   I  G ++ P +N+RA  +  V +GKG  ++   +   Q     +   
Sbjct  439   QLQDLDLFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNEQQEREDRKERN  498

Query  1153  PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLYS  1329
                +   A+L PG + +IP G+P    AS   NL ++ F INA+NNER  L+G  +N+ S
Sbjct  499   NEVQRYEARLSPGDVVIIPAGHPVAITAS--SNLNLLGFGINAENNERNFLSGSDDNVIS  556

Query  1330  NMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
              +++  KE++F  S + ++++ +N       +  PE ++
Sbjct  557   QIENPVKELTFPGSVQEINRLIKNQKQSHFANAEPEQKE  595



>ref|XP_008390981.1| PREDICTED: LOW QUALITY PROTEIN: vicilin GC72-A [Malus domestica]
Length=384

 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/365 (34%), Positives = 206/365 (56%), Gaps = 40/365 (11%)
 Frame = +1

Query  331   FRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDADLIGLVAEG  510
             F++  +S +G   VL RF  +SN +                TFV P+H DA+ I +V  G
Sbjct  2     FQSRFQSNEGSLHVLERFG-KSNAY----------------TFVLPHHYDAEAIFVVLNG  44

Query  511   EGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFF  690
             +    ++ K++K+S+++  G ++ +PAGAT+YL+N +N+  L I KLI+++++PGRFE F
Sbjct  45    QCNCTLLMKDRKESFNMEHGDVIRVPAGATTYLINNNNDESLQIAKLIRSVNSPGRFEEF  104

Query  691   FGTGRN---SFLRAFKSSILEAAYDESKETIQRVLR-GRDDSPFIQVSDEQLKSLRKESD  858
             F  G     S+   F + ILE+A++  +E +++  R  R     ++   EQL++L +   
Sbjct  105   FPAGSGNPESYFSVFSNDILESAFNTPREQLEQGFRQQRGQGMVMRPPKEQLEALSQRPS  164

Query  859   TIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVAFANI--TRGGM  1029
                  +  +  S  P ++ +   V SNNYGQ FE   ++F +  D++V+ + I   +  M
Sbjct  165   AR---REGRRQSHGPFNLRQQTPVHSNNYGQFFEARPEEFNQFQDMDVSVSCIEMNQQTM  221

Query  1030  LGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ------TERSEEGAIP-TYETVNAQLRP  1188
             + P FN+ AT L +VV+G    +MACP ++SQ       E+ E+G     +  V AQL P
Sbjct  222   MVPHFNSEATFLMYVVEGNVRVEMACPHLASQMQGQGMMEQQEQGEHSGRFTKVVAQLSP  281

Query  1189  GTLFVIPPGNPYVSIA-----SQDDNLQIVCFDINADNNERVALAG-KNNLYSNMDDVAK  1350
             G  FV+P G+P   +A     +Q+ N++I+ F +NA NN R  LAG K+N+ + MD  AK
Sbjct  282   GDAFVVPAGHPVAFVAQNNNGNQNQNIRILGFGLNAQNNMRNFLAGQKDNIMNQMDREAK  341

Query  1351  EVSFG  1365
             +++FG
Sbjct  342   QLAFG  346



>gb|ACJ65515.1| globulin 3B [Triticum aestivum]
Length=504

 Score =   194 bits (494),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/400 (32%), Positives = 193/400 (48%), Gaps = 66/400 (17%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PYVF PR FR+  RS  G    L  F E S    GI NFR  I+EV  ++FV P   DAD
Sbjct  126   PYVFGPRSFRSIIRSDHGFVKALRPFDEVSRLLRGIRNFRVAIMEVNPRSFVVPGLTDAD  185

Query  487   LIGL--VAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
              + L  +A+GEG L +I+  +++SY +R G                              
Sbjct  186   GVRLSSLAQGEGVLTVIENGERRSYSVRQGD-----------------------------  216

Query  661   ISTPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVLRGR-------DDSPFIQV  819
                      +F       L +    +L AA   S E + R+L GR       +    ++ 
Sbjct  217   ---------YFSA--KPLLASLSKRVLRAALKTSDEQLDRLLFGRRQGQEEEESISIVRA  265

Query  820   SDEQLKSLRKESDT-----IWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKE  981
             S+EQL+ LR+E+        WP    +  S    ++ + +  ++N +G+L+E D   F  
Sbjct  266   SEEQLRELRREASEGGQGHHWPLPPFRGDSRDTYNLLEQRPKIANRHGRLYEADARSFHA  325

Query  982   LG--DIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP  1155
             L   D+ VA ANIT G M  P  NT++ KLA V++G+G  Q+ CP ++  +ER ++G   
Sbjct  326   LAQHDVRVAVANITPGSMTAPYLNTQSFKLAVVLEGEGEVQIVCPHLARDSERHKQGKQG  385

Query  1156  TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNM  1335
             +     A+         PP    V IAS   +  +  F+INA+ NERV LAG+NN+ + +
Sbjct  386   SALRRYAR--------CPPPLSVVEIASSRGSSNLEMFEINAERNERVWLAGRNNVIAKL  437

Query  1336  DDVAKEVSFGVSSKLVDKVFENDDDL-ELFSKGPEWQQSE  1452
             DD A+E++FG  ++ V +VF   D   E F  GPE Q+ E
Sbjct  438   DDPAQELTFGRPAREVQEVFRAKDQQDEGFVAGPEQQEQE  477



>gb|ABR21771.1| conglutin beta [Lupinus angustifolius]
Length=521

 Score =   194 bits (493),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 217/407 (53%), Gaps = 31/407 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F    F+T +R++ G+  VL RF +R+N+ E ++N+R    +    T + P H DA
Sbjct  98    NPYHFSSERFQTRYRNRNGQIRVLERFDQRTNRLENLQNYRIVEFQSNPNTLILPKHSDA  157

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G  T+ I+  +K+++Y++  G  + +PAG TSY++N D+N  L ++KL   I
Sbjct  158   DYILVVLNGRATITIVNPDKRQAYNLEYGDALRLPAGTTSYILNPDDNQNLRVVKLAIPI  217

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG--------------  792
             + P  F  F+ +    + S+   F  + LEA ++   E IQR+L G              
Sbjct  218   NNPSNFYDFYPSSTKDQQSYFSGFSKNTLEATFNTRYEEIQRILLGNEDEQEDEEQRRGQ  277

Query  793   ----RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFE  957
                 +D+   ++VS EQ++ LRK + +    +  K S S P ++  ++S+ SN +G  +E
Sbjct  278   EQSYQDEGVIVRVSKEQIQELRKHAQS--SSRKGKPSESGPFNLRSNESIYSNKFGNFYE  335

Query  958   VD---NDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT  1128
             +    N   ++L DI + F  I  G +L P +N++A  +  V +G+G  ++   +   + 
Sbjct  336   ITPERNPQVQDL-DISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQ  394

Query  1129  ERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA  1308
             +  +E         +A+L  G +FVIP G P    AS   NL+++ F INA+ N+R  LA
Sbjct  395   QDEQEEEEEEVRRYSARLSEGDIFVIPAGYPISVNAS--SNLRLLGFGINANENQRNFLA  452

Query  1309  G-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
             G ++N+ S +D   KE++F  S++ V+++ +N       +  P+ +Q
Sbjct  453   GSEDNVISQLDREVKELTFPGSAQDVERLIKNQQQSYFANAQPQQKQ  499



>emb|CAI84850.2| vicilin-like protein [Lupinus albus]
Length=531

 Score =   194 bits (493),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 125/417 (30%), Positives = 226/417 (54%), Gaps = 33/417 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F  + F+T ++++ G+  VL RF +R+N+ E ++N+R  I+E +SK  T + P H 
Sbjct  113   NPYHFNSQRFQTLYKNRNGKIRVLERFDQRTNRLENLQNYR--IVEFQSKPNTLILPKHS  170

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD + +V  G  T+ I+  +++++Y++  G  + IPAG+TSY++N D+N KL ++KL  
Sbjct  171   DADYVLVVLNGRATITIVNPDRRQAYNLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAI  230

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG------------  792
              I+ PG F  F+ +    + S+   F  + LEA ++   E IQR+L G            
Sbjct  231   PINNPGYFYDFYPSSTKDQQSYFSGFSRNTLEATFNTRYEEIQRILLGNEDEQEYEEQRR  290

Query  793   ------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                   +D+   ++VS EQ++ L K + +      DK S S P ++  ++ + SN YG  
Sbjct  291   GQEQSHQDEGVIVRVSREQIQELTKYAQSSS--GKDKPSQSGPFNLRSNEPIYSNKYGNF  348

Query  952   FEVDNDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ  1125
             +E+  D   ++ D++++  F  I  G +L P +N++A  +  V +G G  ++   +   +
Sbjct  349   YEITPDRNPQVQDLDISLTFTEINEGALLLPHYNSKAIFIVVVGEGNGKYELVGIRDQQR  408

Query  1126  TERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVAL  1305
              +  +E         +A+L  G +FVIP G P    AS   NL+++ F INA  N+R  L
Sbjct  409   QQDEQEEEPEEVRRYSARLSEGDIFVIPAGYPISVNAS--SNLRLLGFGINAYENQRNFL  466

Query  1306  AG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRADQ*G  1473
             AG ++N+   +D   KE++F  S++ ++++ +N       +  P+ QQ  ++  + G
Sbjct  467   AGSEDNVIRQLDREVKELTFPGSAEDIERLIKNQQQSYFANALPQQQQQSEKEGRRG  523



>emb|CAP06322.1| convicilin [Lathyrus clymenum var. clymenum]
Length=498

 Score =   192 bits (489),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 194/353 (55%), Gaps = 26/353 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   FRT   ++ G    L RF +RSN FE ++N+R      +  T   P H+DA
Sbjct  151   NPFLFKSNKFRTLFENENGHIRRLQRFDKRSNLFENLQNYRLVEYRAKPHTIFLPQHIDA  210

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  211   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVDLVIPV  270

Query  664   STPGRFE-FFFGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------RGRDDS  804
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL            R ++  
Sbjct  271   NRPGKFEDFDLYENKNQYLRGFSKNILEASLNAKYETIEKVLLEGPQKQLRDLKRRQETD  330

Query  805   PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVD-NDDFK  978
               ++VS EQ++ LRK + +    K    S  +P ++  ++   SNN+G+LFE+     + 
Sbjct  331   AIVRVSREQIEELRKLAKSS--SKKKLPSEFEPFNLRSQNPKYSNNFGKLFEITPRKKYP  388

Query  979   ELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAI  1152
             +L D++++ +   I  G ++ P +N+RA  +  V  G G  ++   +   Q +R  E  +
Sbjct  389   QLQDLDISVSCVEINEGALMLPHYNSRAIIVVLVTQGNGNLELVGFKNEEQEQR--ENQV  446

Query  1153  PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
               YE   A+L PG + VIP G+P    AS   NL ++ F INA+NN+R+ L+G
Sbjct  447   QRYE---ARLSPGDVVVIPAGHPVAITAS--SNLNLLGFGINAENNQRIFLSG  494



>gb|AEB33718.1| conglutin beta 7 [Lupinus angustifolius]
Length=605

 Score =   194 bits (494),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 217/407 (53%), Gaps = 31/407 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NPY F    F+T +R++ G+  VL RF +R+N+ E ++N+R    +    T + P H DA
Sbjct  182   NPYHFSSERFQTRYRNRNGQIRVLERFDQRTNRLENLQNYRIVEFQSNPNTLILPKHSDA  241

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G  T+ I+  +K+++Y++  G  + +PAG TSY++N D+N  L ++KL   I
Sbjct  242   DYILVVLNGRATITIVNPDKRQAYNLEYGDALRVPAGTTSYILNPDDNQNLRVVKLAIPI  301

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG--------------  792
             + P  F  F+ +    + S+   F  + LEA ++   E IQR+L G              
Sbjct  302   NNPSNFYDFYPSSTKDQQSYFSGFSKNTLEATFNTRYEEIQRILLGNEDEQEDEEQRRGQ  361

Query  793   ----RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFE  957
                 +D+   ++VS EQ++ LRK + +    +  K S S P ++  ++S+ SN +G  +E
Sbjct  362   EQSYQDEGVIVRVSKEQIQELRKHAQSSS--RKGKPSESGPFNLRSNESIYSNKFGNFYE  419

Query  958   VD---NDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQT  1128
             +    N   ++L DI + F  I  G +L P +N++A  +  V +G+G  ++   +   + 
Sbjct  420   ITPERNPQVQDL-DISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQ  478

Query  1129  ERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA  1308
             +  +E         +A+L  G +FVIP G P    AS   NL+++ F INA+ N+R  LA
Sbjct  479   QDEQEEEEEEVRRYSARLSEGDIFVIPAGYPISVNAS--SNLRLLGFGINANENQRNFLA  536

Query  1309  G-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
             G ++N+ S +D   KE++F  S++ V+++ +N       +  P+ +Q
Sbjct  537   GSEDNVISQLDREVKELTFPGSAQDVERLIKNQQQSYFANAQPQQKQ  583



>emb|CDY55260.1| BnaCnng28630D [Brassica napus]
Length=484

 Score =   192 bits (487),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/418 (30%), Positives = 218/418 (52%), Gaps = 40/418 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHLD  480
             NPY F    F+   +SQ+G   +LP+FT+RS+  F GIEN+RF   E++  TF+ P+HLD
Sbjct  57    NPYHFGRWSFKNFFQSQEGFVKMLPKFTKRSSTLFRGIENYRFFFQEMQPNTFLVPHHLD  116

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD + LV +G+G +  +   + +S+ I  G +V +P+  T +  NT+    L + K+   
Sbjct  117   ADYVFLVVQGKGVIGFVTDTENESFQITKGDVVRVPSSVTHFFANTNGTVPLRLAKIAVP  176

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQ-----  816
              + PG F+ FF +      S+   F   +L A+++  +E + R++R R      Q     
Sbjct  177   ANVPGHFQVFFPSHSGFHQSYFTGFSKDVLTASFNVPEELLGRLIR-RPQQQVGQGIIRR  235

Query  817   VSDEQLKSLRKESDTIWP-----------FKTDKSSSSKPVDIFKHKSV-SNNYGQLFEV  960
             VS +Q+K L + +  I P              D+S+   P ++    ++ SN++G+  E 
Sbjct  236   VSPDQIKELTEHA--ISPSNKHKNKKDKHKDKDRSTFGSPFNLLTQDAIYSNDFGRYHEA  293

Query  961   DNDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER  1134
                 F +L D+++A  + N+T+G +  P +N+  T + FV +G    +MA P  + Q E+
Sbjct  294   HPKKFSQLQDLDIAVGWVNMTQGSLFLPQYNSETTFVTFVENGCARYEMASP-YTFQGEQ  352

Query  1135  SEEGAIP------------TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
              +    P                + +++  G +F++P G+P+ +I SQD+N   V F I+
Sbjct  353   QQPWFGPGQEEEVEEEMSGQVHKIVSRVCKGEVFILPAGHPF-AILSQDENFVAVGFGIH  411

Query  1279  ADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             A N+ R  LAG++N+ SN++ VA  +SFG+ SK+ +K+F + +        P  Q  E
Sbjct  412   ASNSTRTFLAGQDNMLSNINTVATRLSFGLGSKMAEKLFTSQNYSHFAPTTPRHQFPE  469



>ref|NP_566714.1| protein PAP85 [Arabidopsis thaliana]
 dbj|BAB01239.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24193.1| AT3g22640/MWI23_1 [Arabidopsis thaliana]
 gb|AAL90968.1| AT3g22640/MWI23_1 [Arabidopsis thaliana]
 gb|AEE76660.1| cupin family protein [Arabidopsis thaliana]
Length=486

 Score =   191 bits (485),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 120/406 (30%), Positives = 215/406 (53%), Gaps = 48/406 (12%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQ-FEGIENFRFGILEVESKTFVAPNHL  477
             ++PY F+ R F    +S++G   VLP+FT+ +   F GIEN+RF ++E+E  TF  P+HL
Sbjct  61    NHPYHFRKRSFSDWFQSKEGFVRVLPKFTKHAPALFRGIENYRFSLVEMEPTTFFVPHHL  120

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD + +V +G+G ++ +    K+S+ I  G +V IP+G T+++ NT+    L + ++  
Sbjct  121   DADAVFIVLQGKGVIEFVTDKTKESFHITKGDVVRIPSGVTNFITNTNQTVPLRLAQITV  180

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQR-VLRGRDDSPFI--QV  819
              ++ PG ++ +F      + S+   F   +L  +++  +E + R V R ++    I  ++
Sbjct  181   PVNNPGNYKDYFPAASQFQQSYFNGFTKEVLSTSFNVPEELLGRLVTRSKEIGQGIIRRI  240

Query  820   SDEQLKSLRKESD-------------------TIWPFKTDKSSSSKPVDIFKHKSV-SNN  939
             S +Q+K L + +                    T+W           P ++F    + SN+
Sbjct  241   SPDQIKELAEHATSPSNKHKAKKEKEEDKDLRTLW----------TPFNLFAIDPIYSND  290

Query  940   YGQLFEVDNDDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP-  1110
             +G   E    ++ +L D+ +  A+AN+T+G +  P FN++ T + FV +G    +MA P 
Sbjct  291   FGHFHEAHPKNYNQLQDLHIAAAWANMTQGSLFLPHFNSKTTFVTFVENGCARFEMATPY  350

Query  1111  -------QVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF  1269
                    Q   Q +  EE        V +++  G +F++P G+P+ +I SQD +   V F
Sbjct  351   KFQRGQQQWPGQGQEEEEDMSENVHKVVSRVCKGEVFIVPAGHPF-TILSQDQDFIAVGF  409

Query  1270  DINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDD  1407
              I A N++R  LAG+ NL SN++  A  V+FGV SK+ +K+F + +
Sbjct  410   GIYATNSKRTFLAGEENLLSNLNPAATRVTFGVGSKVAEKLFTSQN  455



>emb|CAA96513.1| convicilin precursor [Vicia narbonensis]
Length=545

 Score =   192 bits (487),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 222/405 (55%), Gaps = 29/405 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  132   NPFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  191

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI  V  G   L ++  N + SY++  G  + +PAG TSYL+N D+   L ++ L  ++
Sbjct  192   DLILTVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLLNQDDEEDLRVVDLSISV  251

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVL--------------RGRD  798
             + PG+ E F  +G +N +LR F  +ILEA+ +   ETI++VL              + ++
Sbjct  252   NRPGKVESFGLSGSKNQYLRGFSKNILEASLNTKYETIEKVLLEEPQQSIGQKRRSQRQE  311

Query  799   DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVDND-D  972
              +  ++VS EQ++ L++ + +    K   SS  +P ++  ++   SN +G+LFE+  +  
Sbjct  312   TNALVKVSREQVEELKRLAKSSS--KKGVSSEFEPFNLRSQNPKYSNKFGKLFEITPEKK  369

Query  973   FKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMAC--PQVSSQTERSE  1140
             + +L D++  V+   I  GG++ P +N+RA  +  V +GKG  ++     +   Q ER +
Sbjct  370   YPQLQDLDIFVSSVEINEGGLMLPHYNSRAIVILLVNEGKGNLELVGLKNEQQEQRERED  429

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-N  1317
             E  +  YE   A+L PG + +IP G+P    AS   NL ++ F INA+NN+R  L G  +
Sbjct  430   EQQVQRYE---ARLSPGDVVIIPAGHPVAVSAS--SNLNLLGFGINAENNQRNFLTGSDD  484

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             N+ S +++  KE++F  S++ V+++ +N +     +  PE +  E
Sbjct  485   NVISQIENPVKELTFPGSAQEVNRLLKNQEHSHFANAEPEQKGEE  529



>gb|EMS62417.1| Globulin-1 S allele [Triticum urartu]
Length=493

 Score =   191 bits (484),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 126/437 (29%), Positives = 208/437 (48%), Gaps = 59/437 (14%)
 Frame = +1

Query  307   PYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDAD  486
             PY F    +R   +S+ G F VL RF     +   I ++R   L+   + F+ P+H DAD
Sbjct  54    PYHFGQESYREWAKSRHGHFKVLERFDHELLRGS-IGDYRVAYLDAAPRAFLQPSHHDAD  112

Query  487   LIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTIS  666
              I  V EGEG L +++  K++S+ IR G ++ IPAG+  Y  NT  +  L ++ LI  +S
Sbjct  113   EIAFVREGEGVLVLLRNGKRESFCIREGDVIVIPAGSIVYSANTHRSKWLRVVMLINPVS  172

Query  667   TPGRFEFFFGTGRN-----SFLRAFKSSILEAAYDESKETIQRVL--RGRDDSPFIQVSD  825
             TPGRF+ FF  G       SFL  F   +++AA +  +E + RV   + + +    + S+
Sbjct  173   TPGRFQEFFLIGSGDERPQSFLSVFSDEVIQAALNTRREDVDRVFESKSKGEGEIYEASE  232

Query  826   EQLKSLRKESDTIWPFKTDKSSSS---KPVDIFKHK-SVSNNYGQLFEVDNDDFKELG--  987
             EQ++ L +             S     +P  +   K   SN +G+  ++  D    L   
Sbjct  233   EQIRELSRSCSRGGRGGGGSGSEKEDIQPRSLTGEKPRYSNKHGRFHQITGDQCHHLRKL  292

Query  988   DIEVAFANITRGGMLGPLFNTRATKLAFVVDGK-GWAQMACPQVSS--------------  1122
             D++V   NITRG M    + TR+T++  VV+G+ G+ +MACP +SS              
Sbjct  293   DMDVTLVNITRGSMTALKYTTRSTRIYVVVEGRDGYFEMACPHISSSGRSERREHEQERE  352

Query  1123  ----------------------------QTERSEEGAIPTYETVNAQLRPGTLFVIPPGN  1218
                                         Q    E+     Y  V AQ++ G++ V+P G+
Sbjct  353   REHGQGRRSEEREREQGRGRRSEEREQEQGHGREQEKSRGYRQVRAQIKVGSVIVLPAGH  412

Query  1219  PYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGVSSK-LVDKVF  1395
             P   +A  D NL ++ F + A+N+E V + G N++   +D+ AK ++F   ++ L D+V 
Sbjct  413   PATFVAGNDGNLALLSFGVGANNDEEVFVTGGNSVLKQLDEAAKALAFPQQARELADRVI  472

Query  1396  ENDDDLELFSKGPEWQQ  1446
                 +  +F  GP+ Q+
Sbjct  473   RAQPE-SVFVAGPQQQR  488



>ref|XP_004496705.1| PREDICTED: convicilin-like isoform X2 [Cicer arietinum]
Length=563

 Score =   191 bits (484),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 130/415 (31%), Positives = 222/415 (53%), Gaps = 34/415 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F+   F+T   +Q G   +L  F +RSN F+ ++N+RF   +    T + P H+DA
Sbjct  139   NPFFFRSNKFQTIFENQHGHIRLLQNFDKRSNLFQNLQNYRFLEYKARPHTLLLPQHIDA  198

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G+  L ++  N + S+++  G  + +PAG T+YL N D+   L +++L   +
Sbjct  199   DFILVVLSGKAILTVLNPNDRNSFNLERGDTIKLPAGTTAYLANHDDEEDLRVVELAIPV  258

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL---------RGRDDS-  804
             + PG+F+ FF +    + S+   F  SILEA+++   ETI+RVL         RGR  S 
Sbjct  259   NRPGKFQSFFPSSNQNQQSYFNGFSKSILEASFNTKYETIERVLLEEQEPEQSRGRRGSE  318

Query  805   ------PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVD  963
                     ++VS EQ++ L K + +    +   SS S+P ++     + SN +G+ FE+ 
Sbjct  319   ESEEGDAIVKVSREQIEELSKHAKSSS--RKSISSESEPFNLRSRNPIYSNKFGKFFEIT  376

Query  964   NDDFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS  1137
              +   +L D+   V+   I  GG++ P FN+RA  + F+ +GKG  ++   +   Q ++ 
Sbjct  377   PEKSPQLQDLNIFVSCVEINEGGLMLPHFNSRAIVVLFINEGKGHLELVGLRNEQQEQQQ  436

Query  1138  EEGAIPTYETVN-------AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
             EE      E  N       A+L PG +F+IP G+P    AS D  L  V F INA+NN+R
Sbjct  437   EEDEEQEEEERNNQVQRFRARLSPGDVFIIPAGHPVAVNASSD--LNFVGFGINAENNQR  494

Query  1297  VALAGK-NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
               LAG+ +N+ S + +  KE++F  S++ V+++ +N       +  P+ ++ E +
Sbjct  495   NFLAGEDDNVISQIQNPVKELTFPGSAQEVNRLIKNQRQSYFANAQPQQREEESQ  549



>ref|XP_004496704.1| PREDICTED: convicilin-like isoform X1 [Cicer arietinum]
Length=593

 Score =   191 bits (484),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 130/415 (31%), Positives = 222/415 (53%), Gaps = 34/415 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F+   F+T   +Q G   +L  F +RSN F+ ++N+RF   +    T + P H+DA
Sbjct  169   NPFFFRSNKFQTIFENQHGHIRLLQNFDKRSNLFQNLQNYRFLEYKARPHTLLLPQHIDA  228

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G+  L ++  N + S+++  G  + +PAG T+YL N D+   L +++L   +
Sbjct  229   DFILVVLSGKAILTVLNPNDRNSFNLERGDTIKLPAGTTAYLANHDDEEDLRVVELAIPV  288

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL---------RGRDDS-  804
             + PG+F+ FF +    + S+   F  SILEA+++   ETI+RVL         RGR  S 
Sbjct  289   NRPGKFQSFFPSSNQNQQSYFNGFSKSILEASFNTKYETIERVLLEEQEPEQSRGRRGSE  348

Query  805   ------PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVD  963
                     ++VS EQ++ L K + +    +   SS S+P ++     + SN +G+ FE+ 
Sbjct  349   ESEEGDAIVKVSREQIEELSKHAKSSS--RKSISSESEPFNLRSRNPIYSNKFGKFFEIT  406

Query  964   NDDFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS  1137
              +   +L D+   V+   I  GG++ P FN+RA  + F+ +GKG  ++   +   Q ++ 
Sbjct  407   PEKSPQLQDLNIFVSCVEINEGGLMLPHFNSRAIVVLFINEGKGHLELVGLRNEQQEQQQ  466

Query  1138  EEGAIPTYETVN-------AQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNER  1296
             EE      E  N       A+L PG +F+IP G+P    AS D  L  V F INA+NN+R
Sbjct  467   EEDEEQEEEERNNQVQRFRARLSPGDVFIIPAGHPVAVNASSD--LNFVGFGINAENNQR  524

Query  1297  VALAGK-NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDR  1458
               LAG+ +N+ S + +  KE++F  S++ V+++ +N       +  P+ ++ E +
Sbjct  525   NFLAGEDDNVISQIQNPVKELTFPGSAQEVNRLIKNQRQSYFANAQPQQREEESQ  579



>emb|CAR78993.1| convicilin storage protein 1 [Lotus japonicus]
Length=561

 Score =   189 bits (480),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 124/406 (31%), Positives = 223/406 (55%), Gaps = 24/406 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F+   F+T   ++ G   VL RF ERS  FE ++N+R    + + +T V P+H DA
Sbjct  146   NPFHFRSSRFQTHFENEHGHVRVLQRFDERSKLFENLQNYRILEFKAKPQTLVLPHHNDA  205

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I ++  G   L I+  N + SY++  G  + IPAGAT+YL N DN+  L ++KL+  I
Sbjct  206   DSIIVILSGRAILTIVNPNDRDSYNLESGDALVIPAGATAYLANRDNDENLRVVKLLIPI  265

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP---------  807
             + PG+++ FF +    + S+L  F  +ILEA+++   + I+RVL  R++           
Sbjct  266   NRPGQYQPFFPSSSETQESYLNGFSRNILEASFNAGYDEIERVLLQREEQRGEQSQEQGV  325

Query  808   FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVSNN-YGQLFEVDNDDFKEL  984
              ++ S +Q++ L + + +    +   SS S+P ++   K +S+N +G+LFE+  +  ++L
Sbjct  326   IVKASQDQIQQLSRHAKSSS--RKRSSSKSEPFNLRSSKPISSNKFGKLFEITPEKNQQL  383

Query  985   GDIEVAF--ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT  1158
              D+++    A I  G +  P +++ +T +  V +G+G  ++   +   Q  + EE     
Sbjct  384   RDLDILLSEAQIKEGSIFLPHYHSTSTLILVVNEGRGELELVAQRRQQQRGQEEEQEEEQ  443

Query  1159  Y----ETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNL  1323
                  +   A+L PG + VIP  +P+   AS D NL  + F INA+NN+R  LAG+ +N+
Sbjct  444   PRIEAQRFRARLSPGDVIVIPASHPFAVTASSDLNL--LAFGINAENNQRNFLAGRDDNV  501

Query  1324  YSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
              S ++   KE++F  S++ ++ + +N  +    S  P+  + E R+
Sbjct  502   ISQIERPVKELAFPGSAEEIESLIKNQRNSCFASAQPQQGEEEGRS  547



>emb|CAR78997.1| convicilin storage protein 1 [Lotus japonicus]
Length=528

 Score =   189 bits (479),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 124/406 (31%), Positives = 223/406 (55%), Gaps = 24/406 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F+   F+T   ++ G   VL RF ERS  FE ++N+R    + + +T V P+H DA
Sbjct  113   NPFHFRSSRFQTHFENEHGHVRVLQRFDERSKLFENLQNYRILEFKAKPQTLVLPHHNDA  172

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I ++  G   L I+  N + SY++  G  + IPAGAT+YL N DN+  L ++KL+  I
Sbjct  173   DSIIVILSGRAILTIVNPNDRDSYNLESGDALVIPAGATAYLANRDNDENLRVVKLLIPI  232

Query  664   STPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP---------  807
             + PG+++ FF +    + S+L  F  +ILEA+++   + I+RVL  R++           
Sbjct  233   NRPGQYQPFFPSSSETQESYLNGFSRNILEASFNAGYDEIERVLLQREEQRGEQSQEQGV  292

Query  808   FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVSNN-YGQLFEVDNDDFKEL  984
              ++ S +Q++ L + + +    +   SS S+P ++   K +S+N +G+LFE+  +  ++L
Sbjct  293   IVKASQDQIQQLSRHAKSSS--RKRSSSKSEPFNLRSSKPISSNKFGKLFEITPEKNQQL  350

Query  985   GDIEVAF--ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT  1158
              D+++    A I  G +  P +++ +T +  V +G+G  ++   +   Q  + EE     
Sbjct  351   RDLDILLSEAQIKEGSIFLPHYHSTSTLILVVNEGRGELELVAQRRQQQRGQEEEQEEEQ  410

Query  1159  Y----ETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNL  1323
                  +   A+L PG + VIP  +P+   AS D NL  + F INA+NN+R  LAG+ +N+
Sbjct  411   PRIEAQRFRARLSPGDVIVIPASHPFAVTASSDLNL--LAFGINAENNQRNFLAGRDDNV  468

Query  1324  YSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
              S ++   KE++F  S++ ++ + +N  +    S  P+  + E R+
Sbjct  469   ISQIERPVKELAFPGSAEEIESLIKNQRNSCFASAQPQQGEEEGRS  514



>gb|AAS97865.1| beta-conglutin precursor [Lupinus albus]
Length=533

 Score =   188 bits (478),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 119/393 (30%), Positives = 218/393 (55%), Gaps = 33/393 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F  + F+T ++++ G+  VL RF +R+N+ E ++N+R  I+E +SK  T + P H 
Sbjct  113   NPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNRLENLQNYR--IVEFQSKPNTLILPKHS  170

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD + +V  G  T+ I+  +++++Y++  G  + IPAG+TSY++N D+N KL ++KL  
Sbjct  171   DADYVLVVLNGRATITIVNPDRRQAYNLEYGDALRIPAGSTSYILNPDDNQKLRVVKLAI  230

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG------------  792
              I+ PG F  F+ +    + S+   F  + LEA ++   E IQR++ G            
Sbjct  231   PINNPGYFYDFYPSSTKDQQSYFSGFSRNTLEATFNTRYEEIQRIILGNEDEQEYEEQRR  290

Query  793   ------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                   +D+   + VS +Q++ L K + +      DK S S P ++  ++ + SN YG  
Sbjct  291   GQEQSDQDEGVIVIVSKKQIQKLTKHAQSSS--GKDKPSDSGPFNLRSNEPIYSNKYGNF  348

Query  952   FEVDNDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ  1125
             +E+  D   ++ D+ ++  +  I  G +L P +N++A  +  V +G+G  ++   +   +
Sbjct  349   YEITPDRNPQVQDLNISLTYIKINEGALLLPHYNSKAIYVVVVDEGEGNYELVGIRDQQR  408

Query  1126  TERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVAL  1305
              +  +E         +A+L  G +FVIP G P +SI +   NL+++ F INAD N+R  L
Sbjct  409   QQDEQEEKEEEVIRYSARLSEGDIFVIPAGYP-ISINA-SSNLRLLGFGINADENQRNFL  466

Query  1306  AG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             AG K+N+   +D    E++F  S++ ++++ +N
Sbjct  467   AGSKDNVIRQLDRAVNELTFPGSAEDIERLIKN  499



>gb|AEB33713.1| conglutin beta 2 [Lupinus angustifolius]
Length=603

 Score =   189 bits (480),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 216/393 (55%), Gaps = 35/393 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F    F+T ++++ G+  VL RF +R+N+ E ++N+R  I+E +SK  T + P H 
Sbjct  175   NPYYFSYERFQTLYKNRNGQIRVLERFDQRTNRLENLQNYR--IVEFQSKPNTLILPKHS  232

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I +V  G  T+ I+  +K+++Y++  G  + +PAG TSY++N D+N  L ++KL  
Sbjct  233   DADYILVVLNGRATITIVNPDKRQAYNLEHGDALRLPAGTTSYILNPDDNQNLRVVKLAI  292

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------  807
              I+ PG F  F+ +    + S+   F  + LEA ++   E IQR++ G +D         
Sbjct  293   PINNPGNFYDFYPSSTKDQQSYFNGFSRNTLEATFNTRYEEIQRIILGNEDGQEDEEQSR  352

Query  808   -----------FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                         ++VS EQ++ LRK + +       K S S P ++   + + SN +G  
Sbjct  353   GQEQSHQDQGVIVRVSKEQIQELRKHAQS--SSGKGKPSESGPFNLRSDEPIYSNKFGNF  410

Query  952   FEVDNDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ  1125
             +E+  D   +  D++++  F  I  GG+L P +N++A  +  V +G+G  ++    +  Q
Sbjct  411   YEITPDRNPQAQDLDISLTFIEINEGGLLLPHYNSKAIFVVVVDEGEGNYELVG--IRDQ  468

Query  1126  TERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVAL  1305
               + +E         NA+L  G +FVIP G+P +SI +   NL+++ F INAD N+R  L
Sbjct  469   ERQQDEQEQEEVRRYNAKLSEGDIFVIPAGHP-ISINA-SSNLRLLGFGINADENQRNFL  526

Query  1306  AG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             AG ++N+   +D   K+++F  S + V+++ +N
Sbjct  527   AGSEDNVIRQLDKEVKQLTFPGSVEDVERLIKN  559



>emb|CAP06323.1| convicilin [Lathyrus latifolius]
Length=498

 Score =   187 bits (474),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 191/353 (54%), Gaps = 26/353 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RSN FE ++N+R      +  T   P H+DA
Sbjct  151   NPFLFKSNKFETLFENENGHIRRLQRFDKRSNLFENLQNYRLVEYRAKPHTIFLPQHIDA  210

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  211   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVDLVIPV  270

Query  664   STPGRFE-FFFGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------RGRDDS  804
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL            R ++  
Sbjct  271   NRPGKFEDFDLYENKNQYLRGFSKNILEASLNAKYETIEKVLLEGPQKQLRDLRRTQETD  330

Query  805   PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVD-NDDFK  978
               ++VS EQ++ LRK + +    K    S  +P ++  ++   SNN+G+LFE+     + 
Sbjct  331   AIVRVSREQIEELRKLAKSS--SKKKLPSEFEPFNLRSQNPKYSNNFGKLFEITPQKKYP  388

Query  979   ELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAI  1152
             +L D++++ +   I  G ++ P +N RA  +  V  G G  ++   +   Q +R  E  +
Sbjct  389   QLQDLDISVSCVEINEGALMLPHYNLRAIIVVLVTQGNGNLELVGFKNEQQEQR--ENQV  446

Query  1153  PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
               YE   A+L PG + VIP G+P    AS   NL ++ F INA+NN+R  L+G
Sbjct  447   QRYE---ARLSPGDVVVIPAGHPVAITAS--SNLNLLGFGINAENNQRNFLSG  494



>gb|AEB33715.1| conglutin beta 4 [Lupinus angustifolius]
Length=590

 Score =   188 bits (478),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 127/394 (32%), Positives = 220/394 (56%), Gaps = 40/394 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F    F+T +R++ G+  VL RF +R+++ E ++N+R  I+E +SK  T + P H 
Sbjct  172   NPYYFSSERFQTLYRNRNGQIRVLERFDQRTDRLENLQNYR--IVEFQSKPNTLILPKHS  229

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I +V  G  T+ I+  +K++SY++  G  + +PAG TSY++N D+N  L ++KL  
Sbjct  230   DADYILVVLNGSATITIVNPDKRQSYNLENGDALRLPAGTTSYILNPDDNQNLRVVKLAI  289

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG------------  792
              I+ PG F  F+ +    + S+   F  + LEA ++   E IQR+L G            
Sbjct  290   PINNPGNFYDFYPSSSKDQQSYFSGFSRNTLEATFNTRYEEIQRILLGNEDEQEDDEQRH  349

Query  793   ------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                   +D+   ++VS EQ++ LRK + +    +  K S S P ++  +K + SN +G  
Sbjct  350   GQEQSHQDEGVIVRVSKEQVQELRKYAQS--SSRKGKPSKSGPFNLRSNKPIYSNKFGNF  407

Query  952   FEVD---NDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS  1122
             +E+    N   ++L DI + F  I  G +L P +N++A  +  V +G+G  ++    +  
Sbjct  408   YEITPNRNPQAQDL-DISLTFIEINEGALLLPHYNSKAIFVVLVDEGEGNYELVG--IRD  464

Query  1123  QTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVA  1302
             Q  + +E  +  Y   +A+L  G +FVIP G+P +SI +   NL+++ F INAD N+R  
Sbjct  465   QQRQQDEQEVRRY---SARLSEGDIFVIPAGHP-ISINA-SSNLRLLGFGINADENQRNF  519

Query  1303  LAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             LAG ++N+   +D   K ++F  S++ V+++ +N
Sbjct  520   LAGSEDNVIRQLDTEVKGLTFPGSTEDVERLIKN  553



>emb|CAP06325.1| convicilin [Lathyrus aphaca]
Length=513

 Score =   186 bits (473),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/348 (33%), Positives = 192/348 (55%), Gaps = 16/348 (5%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T  +++ G    L RF ERS+ FE ++N+R      +  T   P H+DA
Sbjct  172   NPFLFRSNKFLTLFKNENGHIRRLQRFDERSDLFENLQNYRLVEYRAKPHTMFLPQHIDA  231

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N++ SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  232   DLILVVLNGKAILTVLSPNERNSYNLECGDTIKLPAGTTSYLVNHDDEEDLRVVDLVIPV  291

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVLR-GRDDSPFIQVSDEQLK  837
             + PG+FE F     +N +LR F  +ILEA+ +   E I++VL  G++ +  ++VS EQ+ 
Sbjct  292   NRPGKFEAFDLAENKNQYLRGFSKNILEASLNTKYEIIEKVLLGGQETNAIVKVSREQIA  351

Query  838   SLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEV-DNDDFKELGDIEVAF--  1005
              LRK + +    K    S  +P ++  H    SN +G+LFE+     + +L D++V+   
Sbjct  352   ELRKLAKSS--SKKSLLSEFEPFNLRSHNPKYSNKFGKLFEIAPQKKYPQLQDLDVSIKC  409

Query  1006  ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMAC---PQVSSQTERSEEGAIPTYETVNA  1176
               I  G ++ P +N+RA  +  V +G+G  ++      Q   + ++     +  YE   A
Sbjct  410   VEINEGALMLPHYNSRAIVVLLVNEGRGNLELVGFKNEQQEREDKKERNNGVQRYE---A  466

Query  1177  QLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
             +L PG + +IP G+P    AS   NL ++ F INA+NN+R  L G ++
Sbjct  467   RLSPGDVVIIPAGHPVAISAS--SNLNLLGFGINAENNQRNFLTGSDD  512



>emb|CBK38917.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   184 bits (467),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 125/402 (31%), Positives = 220/402 (55%), Gaps = 42/402 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P +
Sbjct  29    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYR--LLEYKSKPHTLFLPQY  86

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L 
Sbjct  87    TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA  146

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-------------  786
               ++ PG+ + F  +G   + S L  F  +ILEAA++   E I++VL             
Sbjct  147   IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTDYEEIEKVLLEEHEKETQHRRS  206

Query  787   ------RGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYG  945
                   + ++++  +++S  Q++ L K + +    K   SS S+P ++     + SN +G
Sbjct  207   LKDKRQQSQEENVIVKLSRGQIEELSKNAKSTS--KKGVSSESEPFNLRSRGPIYSNEFG  264

Query  946   QLFEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             + FE+     ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   + 
Sbjct  265   KFFEITPGKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN  323

Query  1117  SSQTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
              +Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F IN
Sbjct  324   ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGIN  381

Query  1279  ADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             A+NNER  LAG ++N+ S ++   KE++F  SS  VD++ +N
Sbjct  382   AENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKN  423



>gb|KEH43849.1| vicilin 47 kDa protein [Medicago truncatula]
Length=667

 Score =   188 bits (477),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 125/394 (32%), Positives = 219/394 (56%), Gaps = 32/394 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F+T   ++ G   ++ RF +RSN F+ ++N+R      +  T   P+H DA
Sbjct  245   NPFLFRSNRFQTLFENENGHIRLIQRFDKRSNLFQNLKNYRLLEYRAKPHTIFLPHHTDA  304

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G+  L ++  N + S+++  G  + +PAG+T+YLVN DN+  L ++ L+  +
Sbjct  305   DFILVVLSGKAILTVLNSNNRNSFNLEQGDTIKLPAGSTAYLVNQDNDEDLRVVDLVIPV  364

Query  664   STPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVL-----------RGR--  795
             + PG+F+ F  +G     S+ R F  SILEA+++   ETI+RVL           RGR  
Sbjct  365   NRPGKFQSFDLSGNQNNPSYFRGFSKSILEASFNTDYETIERVLLEEHEHEQQQRRGRKG  424

Query  796   -----DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFE  957
                  + +  ++VS EQ++ LR+ + +    K   SS S P ++     + SN +G+ FE
Sbjct  425   RQQSQEANAIVKVSREQIEELRRHAKSS--SKRSISSESGPFNLRNRNPLYSNKFGKFFE  482

Query  958   VDNDDFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTE  1131
             +  +   +L D++  V+   I  G ++ P +N+R+T +  + +GKG  ++   +   Q +
Sbjct  483   ITPEKNPQLQDLDIFVSSVEINEGALILPHYNSRSTVVLVMNEGKGHLELVGHKSEQQEQ  542

Query  1132  RSEEGAI---PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVA  1302
             R ++      P  +  NA+L PG + +IP G+P    AS   NL  + F INA+NN+R  
Sbjct  543   REQDEKELRNPEVQRYNARLSPGDVVIIPAGHPVAINAS--SNLNFLGFGINAENNQRNF  600

Query  1303  LAGK-NNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             LAG+ +N+ S ++   KEV+F  S++ VD++ +N
Sbjct  601   LAGEDDNVISQIERPVKEVAFPGSAEEVDRLIKN  634



>emb|CAP06317.1| cvc [Lathyrus hirsutus]
Length=576

 Score =   186 bits (473),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 119/354 (34%), Positives = 193/354 (55%), Gaps = 22/354 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF ERS+ FE ++N+R    + +  T   P H+DA
Sbjct  223   NPFLFKSNKFLTLFENENGHIRRLQRFDERSDIFENLQNYRLVEYKAKPHTMFLPQHIDA  282

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L   +
Sbjct  283   DLIIVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVDLAIPV  342

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL-------------RGRDD  801
             + PG+FE F     +N +LR F  +ILEA  +   ETI++VL             +G++ 
Sbjct  343   NRPGKFEAFGLSANKNQYLRGFSKNILEAFLNTKYETIEKVLLEEQERRDRKGRQQGQET  402

Query  802   SPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVDND-DF  975
             +  ++VS EQ++ LRK + +    K    S S+P+++  ++   SN +G+LFE+  +  +
Sbjct  403   NAIVKVSREQIEELRKLAKSS--SKKSLLSESEPINLRSQNPKYSNKFGKLFEITPEKKY  460

Query  976   KELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGA  1149
              +L D++V+ +   I  G  L P +N+RA  L  V +GKG  ++   +   Q +R  E  
Sbjct  461   PQLQDLDVSISCVEINEGAPLLPHYNSRAIVLLLVNEGKGNLELVGFKNEQQRQRENEER  520

Query  1150  IPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
                 +   A+L PG + VIP G+P    AS   NL +V F +NA+NN+R  L G
Sbjct  521   NKKVQRYEARLSPGDVVVIPAGHPVAISASL--NLNLVGFGVNAENNQRNFLTG  572



>ref|XP_003624149.1| Provicilin [Medicago truncatula]
 gb|ABD28364.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80367.1| vicilin 47 kDa protein [Medicago truncatula]
Length=463

 Score =   184 bits (467),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 225/425 (53%), Gaps = 43/425 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP+ F   HF+T   ++ G   +L RF +RS  FE ++N+R  +LE  SK  T   P H
Sbjct  33    ENPFFFNANHFQTLFENENGHIRLLQRFDKRSKIFENLQNYR--LLEYHSKPHTLFLPQH  90

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I  V  G+  L ++  + + S+++  G  + +PAG+ +YL N D+N  L ++ L 
Sbjct  91    NDADFILAVLSGKAILTVLNPDNRNSFNLERGDTIKLPAGSIAYLANRDDNEDLRVLDLA  150

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-----------RG  792
               ++ PG+F+ F  +G   + SF   F  +ILEAA++ + E I+RVL           RG
Sbjct  151   IPVNRPGKFQSFSLSGSQNQQSFFSGFSKNILEAAFNANYEEIERVLIEEHEQEPQHRRG  210

Query  793   ---------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNY  942
                      +D +  ++VS EQ++ L + + +    +   SS S P ++   + + SN +
Sbjct  211   LRKDRRQQSQDSNVIVKVSREQIEELSRHAKSSS--RRSGSSESAPFNLRSREPIYSNEF  268

Query  943   GQLFEV---DNDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMA---  1104
             G  FE+    N   K+L DI V +A I  G +L P FN+RAT +  V +GKG  ++    
Sbjct  269   GNFFEITPEKNPQLKDL-DILVNYAEIREGSLLLPHFNSRATVIVVVDEGKGEFELVGQR  327

Query  1105  ---CPQVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI  1275
                  +   + E+ EE      +   A+L PG ++VIP G+P V  AS D  L ++ F I
Sbjct  328   NENQQEQREEDEQQEEERSQQVQRYRARLSPGDVYVIPAGHPTVVSASSD--LSLLGFGI  385

Query  1276  NADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE  1452
             NA+NNER  LAG ++N+ S ++   KEV+F  S++ V+ + +N       +  P+ ++ E
Sbjct  386   NAENNERNFLAGEEDNVISQIERPVKEVAFPGSAQDVESLLKNQRQSYFANAQPQQRERE  445

Query  1453  DRADQ  1467
             +   Q
Sbjct  446   EGRSQ  450



>ref|XP_003624145.1| Convicilin [Medicago truncatula]
 gb|ABD28361.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80363.1| vicilin 47 kDa protein [Medicago truncatula]
Length=464

 Score =   184 bits (467),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 134/427 (31%), Positives = 225/427 (53%), Gaps = 45/427 (11%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F    F+T   ++ G   +L RF +RS  FE ++N+R  +LE  SK  T   P H
Sbjct  32    ENPFIFNSNRFQTLFENENGHIRLLQRFDKRSKIFENLQNYR--LLEYHSKPHTLFLPQH  89

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+  L ++  N + S+++  G  + +PAG   YL N D+N  L ++ L 
Sbjct  90    NDADFILVVVSGKAILTVLNPNNRNSFNLERGDTIKLPAGTLGYLANRDDNKDLRVLDLA  149

Query  655   QTISTPGRFEFFF---GTGRNSFLRAFKSSILEAAYDESKETIQRVL-----------RG  792
               ++ PG+F+ F       + SFL  F  +ILEAA++ + E I+RVL           RG
Sbjct  150   IPVNRPGQFQSFSLSESENQQSFLSGFSKNILEAAFNSNYEEIERVLIEENEQEPQHRRG  209

Query  793   ----------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNN  939
                       ++ +  ++VS EQ++ L K + +    +  +SS S+P+++   K + SN 
Sbjct  210   LRKDERRQQSQEANVIVKVSREQIEELSKNAKSSS--RRSESSESEPINLRNQKPIYSNK  267

Query  940   YGQLFEV---DNDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP  1110
             +G  FE+    N   K+L DI V +A I  G +L P FN+RAT +  V +GKG  ++   
Sbjct  268   FGNFFEITPEKNPQLKDL-DILVNYAEIREGSLLLPHFNSRATVIVAVEEGKGEFELVGQ  326

Query  1111  Q-------VSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCF  1269
             +          + +  ++      +   A+L PG ++VIP G+P V  AS D  L ++ F
Sbjct  327   RNENQQEQREYEEDEQQQERSQQVQRYRARLSPGDVYVIPAGHPIVVTASSD--LSLLGF  384

Query  1270  DINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQ  1446
              INA+NN+R  LAG ++N+ S ++   KEV+F  S++ V+ + +N       +  P+ ++
Sbjct  385   GINAENNQRNFLAGEEDNVISQIERPVKEVAFPGSAQDVESLLKNQRQSYFANAQPQQRE  444

Query  1447  SEDRADQ  1467
              E+   Q
Sbjct  445   REEGRSQ  451



>sp|P43237.1|ALL11_ARAHY RecName: Full=Allergen Ara h 1, clone P17; AltName: Full=Allergen 
Ara h I; AltName: Allergen=Ara h 1; Flags: Precursor [Arachis 
hypogaea]
 gb|AAA60336.1| Ara h I [Arachis hypogaea]
 dbj|BAG48879.1| major allergen Ara h1 [Arachis hypogaea]
 gb|ACF22884.1| main allergen Ara h1 [Arachis hypogaea]
Length=614

 Score =   187 bits (474),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 127/433 (29%), Positives = 224/433 (52%), Gaps = 47/433 (11%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  R F T + +Q GR  VL RF +RS QF+ ++N R   +E    T V P H D
Sbjct  166   NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPKHAD  225

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I ++ +G+ T+ +   N +KS+++  G  + IP+G  SY++N  +N  L + K+   
Sbjct  226   ADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMP  285

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-----------RGR-  795
             ++TPG+FE FF      ++S+L+ F  + LEAA++     I+RVL           RG+ 
Sbjct  286   VNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQR  345

Query  796   --------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQ  948
                     ++   ++VS E ++ L K + ++    +++   + P+++   +  +SNN+G+
Sbjct  346   RRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGR  405

Query  949   LFEV----DNDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             LFEV     N   ++L D+ +    I  G ++ P FN++A  +  V  G G  ++   + 
Sbjct  406   LFEVKPDKKNPQLQDL-DMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRK  464

Query  1117  SSQTE-------------RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQ  1257
               Q                 EEG+        A+L+ G +F++P  +P    AS +  L 
Sbjct  465   EQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE--LH  522

Query  1258  IVCFDINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             ++ F INA+NN R+ LAG K+N+   ++  AK+++F  S + V+K+ +N  +    S  P
Sbjct  523   LLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARP  582

Query  1435  EWQ--QSEDRADQ  1467
             + Q   S ++ DQ
Sbjct  583   QSQSPSSPEKEDQ  595



>emb|CAP06315.1| cvc [Pisum sativum subsp. elatius]
Length=527

 Score =   185 bits (469),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 115/362 (32%), Positives = 193/362 (53%), Gaps = 27/362 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++ +   F T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  169   NPFLLKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  228

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  229   DLILVVLSGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLVIPV  288

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRV-LRGRDDSP----------  807
             + PG+FE F     +N +LR F  +ILEA+Y+   ETI++V L  ++  P          
Sbjct  289   NGPGKFEAFDLAKNKNQYLRGFSKNILEASYNTKYETIEKVLLEEQEKEPQQRRDRKRRQ  348

Query  808   -------FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVD  963
                     ++VS EQ++ LRK + +    K    S  +P+++  HK   SN +G+LFE+ 
Sbjct  349   QGQETDAIVKVSREQIEELRKLAKSS--SKKSLPSEFEPINLRSHKPEYSNKFGKLFEIT  406

Query  964   ND-DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER  1134
              +  + +L D++  V+   I  G ++ P +N+RA  +  V +GKG  ++   +   Q   
Sbjct  407   PEKKYPQLQDLDLFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNVELLGLKNEQQERE  466

Query  1135  SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK  1314
               +      +   A+L PG + +IP G+P    AS   NL ++ F INA+NNER  L+G 
Sbjct  467   DRKERNNEVQRYEARLSPGDVVIIPAGHPVAITAS--SNLNLLGFGINAENNERNFLSGS  524

Query  1315  NN  1320
             ++
Sbjct  525   DD  526



>emb|CCW28760.1| seed storage protein Ara h1 [Arachis duranensis]
Length=614

 Score =   186 bits (473),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 127/432 (29%), Positives = 224/432 (52%), Gaps = 45/432 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  R F T + +Q GR  VL RF +RS QF+ ++N R   +E    T V P H D
Sbjct  166   NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPKHAD  225

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I ++ +G+ T+ +   N +KS+++  G  + IP+G  SY++N  +N  L + K+   
Sbjct  226   ADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMP  285

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-----------RGR-  795
             ++TPG+FE FF      ++S+L+ F  + LEAA++     I+RVL           RG+ 
Sbjct  286   VNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQR  345

Query  796   --------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKS-VSNNYGQ  948
                     ++   ++VS E ++ L K + ++    +++   + P+++   +  +SNN+G+
Sbjct  346   RRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGR  405

Query  949   LFEVDNDDFK-ELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS  1119
             LFEV  D    +L D+++      I  G ++ P FN++A  +  V  G G  ++   +  
Sbjct  406   LFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKE  465

Query  1120  SQTE-------------RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQI  1260
              Q                 EEG+        A+L+ G +F++P  +P    AS +  L +
Sbjct  466   QQQRGRREREWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE--LHL  523

Query  1261  VCFDINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPE  1437
             + F INA+NN R+ LAG K+N+   ++  AK+++F  S + V+K+ +N  +    S  P+
Sbjct  524   LGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVSARPQ  583

Query  1438  WQ--QSEDRADQ  1467
              Q   S ++ DQ
Sbjct  584   SQSPSSPEKEDQ  595



>ref|XP_010268558.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nelumbo nucifera]
Length=385

 Score =   182 bits (461),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 168/297 (57%), Gaps = 42/297 (14%)
 Frame = +1

Query  517   TLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTISTPGRFEFFFG  696
             T++++  + ++SY++  G +  IPAG  +YLVN D+N  L I+ L +TISTPG    F  
Sbjct  96    TINLVHNDNRESYNLECGDVARIPAGMMAYLVNRDDNENLQIVTLFRTISTPGHISKFSS  155

Query  697   TGR---NSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLRKESDTI-  864
                    SF  AF + ILE A +  K+ ++R+L  +      + S EQ K++ +++ +  
Sbjct  156   ASSEDGESFYIAFSNEILETALNTPKDKLKRLLGEKRKGVMREASKEQTKAMSEQASSSS  215

Query  865   -----WPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKELGDIEVA--FANITR  1020
                  W     KS +  P ++ K + + SN+YGQL+E    D+++L D++V+  F+NI++
Sbjct  216   EGGRRWSI--HKSETRSPFNLLKKRPIYSNSYGQLYEAQPYDYQQLKDLDVSVIFSNISQ  273

Query  1021  --GGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQLRPGT  1194
               G ML PL+NTR T++ FVV G GW +MACP +SS                        
Sbjct  274   GAGAMLAPLYNTRLTRIVFVVKGNGWWEMACPDISS------------------------  309

Query  1195  LFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGK-NNLYSNMDDVAKEVSF  1362
              F+IP G+ +  +AS+ +NLQI+ F INA +N+R  +AGK +N+   MD  AKE++F
Sbjct  310   -FIIPLGHVFTVVASEKENLQIIVFGINAQDNKRNFIAGKEHNVRKQMDKEAKELAF  365



>emb|CAP06311.1| convicilin [Pisum sativum var. pumilio]
Length=511

 Score =   184 bits (468),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 189/359 (53%), Gaps = 27/359 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  153   NPFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  212

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + IPAG TSYLVN D+   L ++  +  +
Sbjct  213   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKIPAGTTSYLVNQDDEEDLRVVDFVIPV  272

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------------  786
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL                  
Sbjct  273   NRPGKFEAFGLSENKNQYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRKRRQ  332

Query  787   RGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVD  963
             +G +    I+VS EQ++ LRK + +    K    S  +P ++  HK   SN +G+LFE+ 
Sbjct  333   QGEERDAIIKVSREQIEELRKLAKSS--SKKSLPSEFEPFNLRSHKPEYSNKFGKLFEIT  390

Query  964   ND-DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER  1134
              +  + +L D++  V+   I +G ++ P +N+RA  +  V +GKG  ++   +   Q   
Sbjct  391   PEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNEQQERE  450

Query  1135  SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
               +      +   A+L PG + +IP G+P    AS   NL ++ F INA+NN+R  L+G
Sbjct  451   DRKERNNEVQRYEARLSPGDVVIIPAGHPVAITAS--SNLNLLAFGINAENNQRNFLSG  507



>emb|CAP06318.1| cvc [Lathyrus annuus]
Length=541

 Score =   184 bits (468),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/352 (33%), Positives = 191/352 (54%), Gaps = 20/352 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF ERS+ FE ++N+R      +  T   P H+DA
Sbjct  190   NPFLFKSNKFLTLFENENGHIRRLQRFDERSDIFENLQNYRLVEYRAKPHTMFLPQHIDA  249

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  V +PAG TSYLVN D+   L ++ L   +
Sbjct  250   DLILVVLNGKAILTVLSPNDRNSYNLERGDTVKLPAGTTSYLVNQDDEEDLRVVDLAIPV  309

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL-----------RGRDDSP  807
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL           +G++ + 
Sbjct  310   NRPGKFEAFGLSANKNQYLRGFSKNILEASLNTKYETIEKVLLEERRDQKGRQQGQETNA  369

Query  808   FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVD-NDDFKE  981
              ++VS EQ++ LRK + +    K    S S+P+++  ++   SN +G+ FE+     + +
Sbjct  370   IVKVSREQIEELRKLAKSS--SKKSLLSESEPLNLRSQNPKYSNKFGKFFEITPQKKYPQ  427

Query  982   LGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP  1155
             L D++V+ +   I +G +L P +N+R+  +  V +GKG  ++   +   Q +R  E    
Sbjct  428   LQDLDVSISCVEINKGALLLPHYNSRSIGILLVNEGKGNLELVGFKNEQQRQRENEETNK  487

Query  1156  TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
               +   A+L  G + VIP G+P    AS   NL ++ F INA NN+R  L G
Sbjct  488   KLQRYEARLSSGDVVVIPEGHPVAISAS--SNLNLLGFGINAANNQRNFLTG  537



>dbj|BAF56571.1| 7S globulin-2 [Vigna angularis]
Length=434

 Score =   182 bits (461),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/406 (31%), Positives = 213/406 (52%), Gaps = 29/406 (7%)
 Frame = +1

Query  301   DNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             +NP+ F   R FRT +R++ G   +L RF +RS Q + +EN+R  ++E +SK  T + P+
Sbjct  20    NNPFYFNSDRWFRTLYRNEWGHIRILHRFDQRSKQIQNLENYR--VVEFKSKPNTLLLPH  77

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + +V  G   L ++  + + SY +  G    IPAG T +LVN D+N  L IIKL
Sbjct  78    HADADFLLVVLNGRAILTLVNPDSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIKL  137

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVL-----------R  789
                ++ P RF+ FF +    + S+LR F  +ILEA++D   + I RVL            
Sbjct  138   AIPVNNPHRFQDFFLSSTEAQQSYLRGFSKNILEASFDSDFKEINRVLFGEERQQQQGEE  197

Query  790   GRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
              R++   +++  EQ++ L K + +    + + SS  +P ++   K + SN +G+ +E+  
Sbjct  198   SREEGVIVELKREQIQELMKHAKS--SSRKELSSQDEPFNLRNSKPIYSNKFGRWYEMTP  255

Query  967   DDFKELGDIEVAFANI--TRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +++    G +L P +N++A  +  + +G+   ++       Q ++ E
Sbjct  256   EKNPQLKDLDVFISSVDMKEGALLLPHYNSKAIVIMVINEGEAKIELVGLSDQQQQKQQE  315

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA-GKN  1317
             E      +   A+L    +FVIP   P    A+   NL    F INA+NN+R  LA GK+
Sbjct  316   ESL--EVQRYRAELSEDDVFVIPAAYPVAINAT--SNLNFFAFGINAENNQRNFLAGGKD  371

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             N+ S +     EVSF  S K V+K+ +   +       PE QQ E+
Sbjct  372   NVMSEIPTEVLEVSFPASGKKVEKLIKKQSESHFVDAQPEQQQREE  417



>gb|AEB33714.1| conglutin beta 3 [Lupinus angustifolius]
Length=580

 Score =   184 bits (468),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 124/393 (32%), Positives = 217/393 (55%), Gaps = 38/393 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F    F+T +R++ G+  VL RF +R+N+ E ++N+R  I+E +SK  T + P H 
Sbjct  162   NPYYFSSERFQTLYRNRNGQIRVLERFDQRTNRLENLQNYR--IVEFQSKPNTLILPKHS  219

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I +V  G  T+ I+  +K++SY++  G  + +PAG TSY++N D+N  L ++KL  
Sbjct  220   DADYILVVLNGSATITIVNPDKRQSYNLENGDALRLPAGTTSYILNPDDNQNLRVVKLAI  279

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG------------  792
              I+ PG F  F+ +    + S+   F  + LEA ++   E IQ +L G            
Sbjct  280   PINNPGNFYDFYPSSSKDQQSYFSGFSKNTLEATFNTRYEEIQSILLGNEDEQEDDEQWH  339

Query  793   ------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                   +D+   ++VS EQ++ LRK + +    +  K   S P ++  +K + SN +G  
Sbjct  340   GQEQSHQDEGVIVRVSKEQVQELRKYAQS--SSRKGKPYESGPFNLRSNKPIYSNKFGNF  397

Query  952   FEVDNDDFKELGDIEVA--FANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQ  1125
             +E+  D   +  D++++  F  I  G +L P +N++A  +  V +G+G  ++    +  Q
Sbjct  398   YEITPDRNPQAQDLDISLTFIEINEGALLLPHYNSKAIFVVVVDEGEGNYELVG--IRDQ  455

Query  1126  TERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVAL  1305
               + +E  +  Y   +A+L  G +FVIP G+P +SI +   NL+++ F INAD N+R  L
Sbjct  456   QRQQDEQEVRRY---SARLSEGDIFVIPAGHP-ISINA-SSNLRLLGFGINADENQRNFL  510

Query  1306  AG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             AG ++N+   +D   K + F  S++ V+++ +N
Sbjct  511   AGSEDNVIRQLDREVKGLIFPGSAEDVERLIKN  543



>ref|XP_002308744.2| hypothetical protein POPTR_0006s00440g [Populus trichocarpa]
 gb|EEE92267.2| hypothetical protein POPTR_0006s00440g [Populus trichocarpa]
Length=292

 Score =   177 bits (449),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/300 (35%), Positives = 175/300 (58%), Gaps = 23/300 (8%)
 Frame = +1

Query  607   LVNTDNNNKLVIIKLIQTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQ  777
             +VN D   KL + K++  ++ PG +E F+G G     SF  AF   ++EAA +  +  ++
Sbjct  1     MVNRDEYEKLYVAKILFPVNLPGNYEAFYGAGGGDSESFFEAFSWDLVEAALNTERGRLE  60

Query  778   RVLRGRDDSPFIQVSDEQLKSLRKE------SDTIWPFKTDKSSSSKPVDIFKHKSV-SN  936
             ++ + +     +  + +Q+++L ++      S+  WPF ++ S S  P ++FK  ++ SN
Sbjct  61    KIFK-QQQGKIMNATKQQIEALSQDEEGVRGSNGAWPFPSNVSGS--PFNLFKKGAIKSN  117

Query  937   NYGQLFEVDNDDFK--ELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP  1110
             +YG L+E D  DFK  E  ++ V+FA+IT+G M GP F+++A K+  VV+G+G+ +M CP
Sbjct  118   DYGDLYEADPRDFKPLEYLNLIVSFASITQGSMAGP-FHSKAAKIFIVVEGEGYFEMTCP  176

Query  1111  QVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNN  1290
               SS +  S     PTY+ +++ LR GT+F+ P   P   +AS +  L+++CF++NA  N
Sbjct  177   HHSSSSGSSS----PTYQNISSHLRRGTIFIAPASYPVAIVASNNSTLKLLCFEVNAQAN  232

Query  1291  ERVALAGKNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSE--DRAD  1464
              R  LAGK N+   M   AKE++FGV+   V+++F N  D   F  GP  +Q     RAD
Sbjct  233   IRYTLAGKGNVIDAMHIEAKELAFGVAGIEVEQIFRNQMDC-FFFPGPSTRQQRQGSRAD  291



>dbj|BAF47690.1| beta-conglycinin alpha' subunit [Glycine soja]
Length=541

 Score =   183 bits (464),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 125/409 (31%), Positives = 219/409 (54%), Gaps = 29/409 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T + P+
Sbjct  128   NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLLPH  185

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  186   HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  245

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  246   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  305

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K + +    +   SS  KP ++  H  + SN  G+LFE+  
Sbjct  306   RLQESVIVEISKKQIRELSKHAKSSS--RKTISSEDKPFNLRSHDPIYSNKLGKLFEITP  363

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  364   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  421

Query  1141  EGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  422   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  479

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             +N+ S +    +E++F  S+K ++ + ++  +       P+ ++  ++ 
Sbjct  480   DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG  528



>emb|CAP06320.1| cvc [Lathyrus cicera]
Length=564

 Score =   183 bits (465),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 119/351 (34%), Positives = 195/351 (56%), Gaps = 22/351 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF ERS+ FE ++N+R      +  T   P H+DA
Sbjct  223   NPFLFKSNKFLTLFENENGYIRRLQRFDERSDIFENLQNYRLVEYRAKPHTIFLPQHIDA  282

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI ++  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  283   DLILVILNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNEDDEEDLRVVDLVIPV  342

Query  664   STPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVL------RGRDDSPFIQVSD  825
             + PG+FE F     N +L  F  S+LEA+ +   ETI++VL      +G++ +  ++VS 
Sbjct  343   NRPGKFEAF---DLNQYLGGFSKSVLEASLNTKYETIEKVLLEEQQKQGQETNAIVKVSR  399

Query  826   EQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDND-DFKELGDIEV  999
             EQ++ LRK + +    K    S  +PV++  H    SN +G+ FE+  +  + +L D++V
Sbjct  400   EQIEELRKLAKSS--SKKSLLSELEPVNLRSHSPKYSNKFGKFFEITPEKKYPQLQDLDV  457

Query  1000  AFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ-VSSQTERSEEGA-IPTYET  1167
             + +   I  G +L P +N+RA  +  V +GKG  ++   Q    Q ER E    +  YE 
Sbjct  458   SISCVEINEGALLLPHYNSRAIVVVLVNEGKGNLELLGVQNEDEQQERKERNKEVQRYE-  516

Query  1168  VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
               A+L PG + +IP G+P    AS   NL ++ F INA+NN+R  L+G ++
Sbjct  517   --ARLSPGDVVIIPSGHPVAVSAS--SNLNLLGFGINAENNQRNFLSGSDD  563



>emb|CAP06324.1| convicilin [Lathyrus ochrus]
Length=499

 Score =   182 bits (461),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 116/356 (33%), Positives = 193/356 (54%), Gaps = 26/356 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F+T   ++ G   +L RF +RSN FE ++N+R      +  T   P H+DA
Sbjct  152   NPFLFKSNKFQTLFENENGHIRLLQRFDKRSNLFEDLQNYRLVEYRAKPHTIFLPQHIDA  211

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++  +  +
Sbjct  212   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVNFVIPV  271

Query  664   STPGRFE-FFFGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------RGRDDS  804
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL            R ++  
Sbjct  272   NRPGKFEDFDLYESKNQYLRGFSKNILEASLNTKYETIEKVLLEGPEKQLRDLKRRQETD  331

Query  805   PFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVD-NDDFK  978
               ++VS EQ++ LR+ + +    K   SS  +P ++  ++   SN +G+LFE+     + 
Sbjct  332   AIVRVSREQIEELRRLAKSS--SKKKLSSEFEPFNLRSQNPKYSNKFGKLFEITPQKKYP  389

Query  979   ELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAI  1152
             +L D++++     I  G +L P +N+RA  +  V  G G  ++   +   Q +R  E  +
Sbjct  390   QLQDLDMSVGCVEINEGALLLPHYNSRAIVVLLVTQGIGNLELVGLKNEQQEQR--ENQV  447

Query  1153  PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
               YE   A L PG + VIP G+P    AS   NL ++ F INA+NN+R  L+G ++
Sbjct  448   QRYE---ASLSPGDVVVIPAGHPVAITAS--SNLNLLGFGINAENNQRNFLSGSDD  498



>emb|CAP06326.1| cvc [Vicia disperma]
Length=549

 Score =   182 bits (463),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 113/357 (32%), Positives = 194/357 (54%), Gaps = 26/357 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F+   F T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H++A
Sbjct  194   NPFYFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIEA  253

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G   L ++  N + SY++  G  + +PAG TSYL+N D+   L ++ L  ++
Sbjct  254   DLILVVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLLNQDDEEDLRVVDLAISV  313

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKS  840
             + PG+ E F  +G RN +LR F  + LEA+++ + E I+ VL    D    Q   ++ +S
Sbjct  314   NRPGKVESFVLSGNRNQYLRGFSKNHLEASFNTNYENIESVLLEEQDIESQQSIGQKRRS  373

Query  841   LRKESDTIWPFKTD---------KSSSSK-------PVDIFKHK-SVSNNYGQLFEVDND  969
              R+E++ +     +         KSSS K       P+++  H    SN +G+LFE+  +
Sbjct  374   QRQETNALVKVSREQIEELKRLAKSSSEKGLSSQFEPINLRSHNPKYSNKFGKLFEITPE  433

Query  970   -DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
               + +L D++  V+  +I  G ++ P +N+RA  +  V +G+G  ++   +   Q +R  
Sbjct  434   KKYPQLQDLDLFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLELVGFKNEQQEQRER  493

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
                +  YE   A+L PG + +IP G+P VS+++   NL ++ F INA+NN+R  LAG
Sbjct  494   NNQVQRYE---ARLSPGDVVIIPAGHP-VSVSA-SSNLNLLAFGINAENNQRNFLAG  545



>gb|KHN02730.1| Beta-conglycinin, alpha' chain [Glycine soja]
Length=627

 Score =   184 bits (466),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 218/407 (54%), Gaps = 31/407 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T + P+
Sbjct  214   NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLLPH  271

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  272   HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  331

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  332   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  391

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K + +    +   SS  KP ++  H  + SN  G+LFE+  
Sbjct  392   RLQESVIVEISKKQIRELSKHAKS--SSRKTISSEDKPFNLRSHDPIYSNKLGKLFEITP  449

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  450   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  507

Query  1141  EGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  508   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  565

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             +N+ S +    +E++F  S+K ++ + ++  +       P  QQ E+
Sbjct  566   DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEE  610



>pdb|1UIK|A Chain A, Crystal Structure Of Soybean Beta-Conglycinin Alpha 
Prime Homotrimer
 pdb|1UIK|B Chain B, Crystal Structure Of Soybean Beta-Conglycinin Alpha 
Prime Homotrimer
 pdb|1UIK|C Chain C, Crystal Structure Of Soybean Beta-Conglycinin Alpha 
Prime Homotrimer
Length=418

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 218/409 (53%), Gaps = 29/409 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T + P+
Sbjct  5     NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLLPH  62

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  63    HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  122

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  123   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  182

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K + +    +   SS  KP ++     + SN  G+LFE+  
Sbjct  183   RLQESVIVEISKKQIRELSKHAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKLFEITP  240

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  241   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  298

Query  1141  EGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  299   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  356

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSEDRA  1461
             +N+ S +    +E++F  S+K ++ + ++  +       P+ ++  ++ 
Sbjct  357   DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKEEGNKG  405



>gb|AEB33717.1| conglutin beta 6 [Lupinus angustifolius]
Length=593

 Score =   183 bits (464),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/394 (32%), Positives = 218/394 (55%), Gaps = 40/394 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F    F+T +R++ G+  VL RF +R+++ E ++N+R  I+E +SK  T + P H 
Sbjct  175   NPYYFSSERFQTLYRNRNGQIRVLERFDKRTDRLENLQNYR--IVEFQSKPNTLILPKHS  232

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I +V  G  T+ I+  +K++SY++  G  + +PAG TSY++N D+N  L ++KL  
Sbjct  233   DADYILVVLNGSATITIVNPDKRQSYNLENGDALRLPAGTTSYILNPDDNQNLRVVKLAI  292

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRG------------  792
              I+ PG F  F+ +    + S+   F  + LEA ++   E IQR+L G            
Sbjct  293   PINNPGNFYDFYPSSSKDQQSYFSGFSRNTLEATFNTRYEEIQRILLGNEDEQEDDEQRH  352

Query  793   ------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                   +D+   ++VS EQ++ LRK + +    +  K S S P ++  +K + SN +G  
Sbjct  353   GQEQSHQDEGVIVRVSKEQVQELRKYAQS--SSRKGKPSKSGPFNLRSNKPIYSNKFGNF  410

Query  952   FEVD---NDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS  1122
             +E+    N   ++L DI + F  I  G +L P +N++A  +  V +G+G  ++    +  
Sbjct  411   YEITPNRNPQAQDL-DISLTFIEINEGALLLPHYNSKAIFVVLVDEGEGNYELVG--IRD  467

Query  1123  QTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVA  1302
             Q  + +E  +  Y   +A+L  G +FVIP G+P +SI +   N +++ F INAD N+R  
Sbjct  468   QQRQQDEQEVRRY---SARLSEGDIFVIPAGHP-ISINA-SSNFRLLGFGINADENQRNF  522

Query  1303  LAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             LAG ++N+   +D   K ++F   ++ V+++ +N
Sbjct  523   LAGFEDNVIRQLDREVKGLTFPGFAEDVERLIKN  556



>gb|ABG02262.1| 8S globulin beta isoform precursor [Vigna radiata]
 gb|ABW23573.1| 8S globulin beta subunit [Vigna radiata]
Length=453

 Score =   180 bits (457),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/406 (31%), Positives = 214/406 (53%), Gaps = 32/406 (8%)
 Frame = +1

Query  301   DNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             +NP+ F   R F T  ++Q G   V+ RF +RS Q + +EN+R  ++E +SK  T + P+
Sbjct  42    NNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYR--VVEFKSKPNTLLLPH  99

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + +V  G   L ++  + + SY +  G    IPAG T +LVN ++N+ L IIKL
Sbjct  100   HADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKL  159

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRG----------  792
                ++ P RF+ FF +    + S+LR F  +ILEA++D   + I RVL G          
Sbjct  160   AIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEE  219

Query  793   -RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
              +++   +++  EQ++ L K + +    + + SS  +P ++     + SN +G+ +E+  
Sbjct  220   SQEEGVIVELKREQIRELIKHAKS--SSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITP  277

Query  967   DDFKELGDIEVAFANI--TRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +++    GG+L P +N++A  +  + +G+   ++  P  S Q ++ E
Sbjct  278   EKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP--SDQQQQDE  335

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
                +  Y    A+L    +FVIP   P    A+   NL    F INA+NN+R  LAG K+
Sbjct  336   SLEVQRYR---AELSEDDVFVIPAAYPVAINAT--SNLNFFAFGINAENNQRNFLAGEKD  390

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             N+ S +     +VSF  S   V+K+ +   +       PE QQ E+
Sbjct  391   NVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREE  436



>pdb|2EA7|A Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-1
 pdb|2EA7|B Chain B, Crystal Structure Of Adzuki Bean 7s Globulin-1
 pdb|2EA7|C Chain C, Crystal Structure Of Adzuki Bean 7s Globulin-1
 dbj|BAF56570.1| 7S globulin-1 [Vigna angularis]
Length=434

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 127/406 (31%), Positives = 212/406 (52%), Gaps = 29/406 (7%)
 Frame = +1

Query  301   DNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             +NP+ F   R FRT +R++ G   VL RF +RS Q + +EN+R  ++E +SK  T + P+
Sbjct  20    NNPFYFNSDRWFRTLYRNEWGHIRVLQRFDQRSKQMQNLENYR--VVEFKSKPNTLLLPH  77

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + +V  G   L ++  + + SY +  G    IPAG T +LVN D+N  L IIKL
Sbjct  78    HADADFLLVVLNGTAVLTLVNPDSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIKL  137

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVL-----------R  789
                ++ P RF+ FF +    + S+LR F  +ILEA++D   + I RVL            
Sbjct  138   AIPVNNPHRFQDFFLSSTEAQQSYLRGFSKNILEASFDSDFKEINRVLFGEERQQQQGEE  197

Query  790   GRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
              R++   +++  EQ++ L K + +    + + SS  +P ++   K + SN +G+ +E+  
Sbjct  198   SREEGVIVELKREQIQELMKHAKS--SSRKELSSQDEPFNLRNSKPIYSNKFGRWYEMTP  255

Query  967   DDFKELGDIEVAFANI--TRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +++    G +L P ++++A  +  + +G+   ++       Q ++ E
Sbjct  256   EKNPQLKDLDVFISSVDMKEGALLLPHYSSKAIVIMVINEGEAKIELVGLSDQQQQKQQE  315

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA-GKN  1317
             E      +   A+L    +FVIP   P    A+   NL    F INA+NN R  LA GK+
Sbjct  316   ESL--EVQRYRAELSEDDVFVIPAAYPVAINAT--SNLNFFAFGINAENNRRNFLAGGKD  371

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             N+ S +     EVSF  S K V+K+ +   +       PE QQ E+
Sbjct  372   NVMSEIPTEVLEVSFPASGKKVEKLIKKQSESHFVDAQPEQQQREE  417



>gb|AAT00597.1| conarachin [Arachis hypogaea]
Length=580

 Score =   182 bits (463),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 122/416 (29%), Positives = 215/416 (52%), Gaps = 43/416 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  R F T + +Q GR  VL RF +RS QF+ ++N R   +E    T V P H D
Sbjct  166   NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPKHAD  225

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I ++ +G+ T+ +   N +KS+++  G  + IP+G  SY++N  +N  L + K+   
Sbjct  226   ADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMP  285

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-----------RGR-  795
             ++TPG+FE FF      ++S+L+ F  + LEAA++     I+RVL           RG+ 
Sbjct  286   VNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQR  345

Query  796   --------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFK-HKSVSNNYGQ  948
                     ++   ++VS E ++ L K + ++    +++   + P+++      +SNN+G+
Sbjct  346   RRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGR  405

Query  949   LFEVDNDDFK-ELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS  1119
             LFEV  D    +L D+++      I  G ++ P FN++A  +  V  G G  ++   +  
Sbjct  406   LFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKE  465

Query  1120  SQTE-------------RSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQI  1260
              Q                 EEG+        A+L+ G +F++P  +P    AS +  L +
Sbjct  466   QQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE--LHL  523

Query  1261  VCFDINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFS  1425
             + F INA+NN R+ LAG K+N+   ++  AK+++F  S + V+K+ +N  +    S
Sbjct  524   LGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFVS  579



>emb|CAA44494.1| vicilin [Theobroma cacao]
Length=460

 Score =   180 bits (456),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/297 (32%), Positives = 166/297 (56%), Gaps = 19/297 (6%)
 Frame = +1

Query  301   DNPYVF-QPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHL  477
             +NPY F + R F+T  R ++G F +L RF E S   +GI ++R  + E    TF+ P+H 
Sbjct  149   NNPYYFPKRRSFQTRFRDEEGNFKILQRFAENSPPLKGINDYRLAMFEANPNTFILPHHC  208

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DA+ I  V  G+GT+  +    K+SY+++ G++V +PAG+T Y+V+ DN  KL I  L  
Sbjct  209   DAEAIYFVTNGKGTITFVTHENKESYNVQRGTVVSVPAGSTVYVVSQDNQEKLTIAVLAL  268

Query  658   TISTPGRFEFFFGTGRN---SFLRAFKSSILEAAYDESKETIQRVLRGRDDSP-------  807
              +++PG++E FF  G N   S+  AF   +LE  ++  +E ++ +L  +           
Sbjct  269   PVNSPGKYELFFPAGNNKPESYYGAFSYEVLETVFNTQREKLEEILEEQRGQKRQQGQQG  328

Query  808   -FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDNDDFKE  981
              F +   EQ++++ +++ +       +      +++     V SN  G+ FE   +DF +
Sbjct  329   MFRKAKPEQIRAISQQATS----PRHRGGERLAINLLSQSPVYSNQNGRFFEACPEDFSQ  384

Query  982   LGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEG  1146
               +++VA +   + +G +  P +N++AT + FV DG G+AQMACP +S Q++ S+ G
Sbjct  385   FQNMDVAVSAFKLNQGAIFVPHYNSKATFVVFVTDGYGYAQMACPHLSRQSQGSQSG  441



>emb|CAP06310.1| convicilin [Pisum sativum subsp. sativum]
Length=511

 Score =   181 bits (458),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/359 (32%), Positives = 188/359 (52%), Gaps = 27/359 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  153   NPFLFKSNKFLTLFENENGHTRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  212

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++  +  +
Sbjct  213   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKVPAGTTSYLVNQDDEEALRVVDFVIPV  272

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------------  786
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL                  
Sbjct  273   NRPGKFEAFGLSENKNQYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRKRTQ  332

Query  787   RGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVD  963
             +G +    I+VS EQ++ LRK + +    K    S  +P ++  HK   SN +G+LFE+ 
Sbjct  333   QGEERDAIIKVSREQIEELRKLAKSS--SKKSLPSEFEPFNLRSHKPEYSNKFGKLFEIT  390

Query  964   ND-DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER  1134
              +  + +L D++  V+   I +G ++ P +N+RA  +  V +GKG  ++   +   Q   
Sbjct  391   PEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNEQQERE  450

Query  1135  SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
               +      +   A+L PG + +IP G+P    AS   NL ++ F INA NN+R  L+G
Sbjct  451   DRKERNNEVQRYEARLSPGDVVIIPAGHPVAISAS--SNLNLLGFGINAKNNQRNFLSG  507



>pdb|2EAA|A Chain A, Crystal Structure Of Adzuki Bean 7s Globulin-3
 pdb|2EAA|B Chain B, Crystal Structure Of Adzuki Bean 7s Globulin-3
 pdb|2EAA|C Chain C, Crystal Structure Of Adzuki Bean 7s Globulin-3
 dbj|BAF56572.1| 7S globulin-3 [Vigna angularis]
Length=433

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 126/407 (31%), Positives = 211/407 (52%), Gaps = 29/407 (7%)
 Frame = +1

Query  298   DDNPYVFQP-RHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAP  468
             ++NP+ F   R F T   +Q G   +L RF +RS Q + +EN+R  ++E +SK  T + P
Sbjct  18    ENNPFYFSSDRRFHTLFTNQYGHLRILHRFDQRSKQIQNLENYR--VVEFKSKPNTLLLP  75

Query  469   NHLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIK  648
             +H DAD + +V  G   L ++  + + SY +  G    IPAG T +LVN D+N  L IIK
Sbjct  76    HHADADFLLVVLNGRAILTLVNPDSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIK  135

Query  649   LIQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVL-----------  786
             L   ++ P RF+ FF +    + S+LR F  +ILEA++D   + I RVL           
Sbjct  136   LAIPVNNPHRFQDFFLSSTEAQQSYLRGFSKNILEASFDSDFKEINRVLFGEERQQQQGE  195

Query  787   RGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVD  963
               R++   +++  EQ++ L K + +    + + SS  +P ++   K + SN +G+ +E+ 
Sbjct  196   ESREEGVIVELKREQIQELMKHAKS--SSRKELSSQDEPFNLRNSKPIYSNKFGRWYEMT  253

Query  964   NDDFKELGDIEVAFANI--TRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS  1137
              +   +L D++V  +++    G +L P +N++A  +  + +G+   ++       Q ++ 
Sbjct  254   PEKNPQLKDLDVFISSVDMKEGALLLPHYNSKAIVIMVINEGEAKIELVGLSDQQQQKQQ  313

Query  1138  EEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALA-GK  1314
             EE      +   A+L    +FVIP   P    A+   NL    F INA+NN+R  LA GK
Sbjct  314   EESL--EVQRYRAELSEDDVFVIPAAYPVAINAT--SNLNFFAFGINAENNQRNFLAGGK  369

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             +N+ S +     EVSF  S K V+K+ +   +       PE QQ E+
Sbjct  370   DNVMSEIPTEVLEVSFPASGKKVEKLIKKQSESHFVDAQPEQQQREE  416



>dbj|BAA23360.2| alpha subunit of beta conglycinin [Glycine max]
Length=543

 Score =   181 bits (458),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 209/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP++F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  130   NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  187

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  188   HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  247

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  248   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  307

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  308   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  365

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q ++ E
Sbjct  366   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE  425

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  426   EQPL-EVRKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  482

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  483   NVISQIPSQVQELAFPGSAQAVEKLLKN  510



>dbj|BAE02727.1| beta-conglycinin alpha subunit [Glycine max]
Length=604

 Score =   181 bits (460),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 209/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP++F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  191   NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  248

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  249   HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  308

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  309   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  368

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  369   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  426

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q ++ E
Sbjct  427   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE  486

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  487   EQPL-EVRKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  543

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  544   NVISQIPSQVQELAFPGSAQAVEKLLKN  571



>ref|XP_003624154.1| Convicilin [Medicago truncatula]
 gb|ABD28367.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80372.1| vicilin 47 kDa protein [Medicago truncatula]
Length=471

 Score =   179 bits (454),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 131/431 (30%), Positives = 223/431 (52%), Gaps = 46/431 (11%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F    F+T   ++ G   +L RF +RS  FE ++N+R  +LE  SK  T   P H
Sbjct  32    ENPFIFNSNRFQTLFENENGHIRLLQRFDKRSKIFENLQNYR--LLEYHSKPHTLFLPQH  89

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I  V  G+  L ++  N + S+++  G  + +PAG+ +YL N D+N  L ++ L 
Sbjct  90    NDADFILAVLSGKAILTVLNPNNRNSFNLERGDTIKLPAGSIAYLANRDDNQDLRVLDLA  149

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL---------RGRD  798
               ++ PG+F+ F  +G   + SF   F  +ILEAA++ + E I+RVL         RG  
Sbjct  150   IPVNRPGQFQSFSLSGNQNQQSFFSGFSKNILEAAFNANYEEIERVLIEEQEPQHRRGLR  209

Query  799   DSP---------FIQVSDEQLKSLRKESD--------TIWPFKTDKSSSSKPVDIFKHKS  927
             D            ++VS EQ++ L + +         +    +   SS S P ++  H+ 
Sbjct  210   DRRHKQSQEADVIVKVSREQIEELSRHAKSSSRRSASSESASRRSASSESAPFNLRSHEP  269

Query  928   V-SNNYGQLFEVDNDDFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQ  1098
             + SN +G  FE+  +   +L D++  V +A I  G +L P FN+RAT +  V +GKG  +
Sbjct  270   IYSNEFGNFFEITPEKNPQLQDLDILVNYAEIREGSLLLPHFNSRATVIVAVEEGKGEFE  329

Query  1099  MACPQ-------VSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQ  1257
             +   +          + +  ++      +   A+L PG ++VIP G+P V  AS D  L 
Sbjct  330   LVGQRNENQQEQREYEEDEQQQERSQQVQRYRARLSPGDVYVIPAGHPIVVKASSD--LS  387

Query  1258  IVCFDINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             ++ F INA+NN+R  LAG ++N+ S ++   KEV+F  S++ V+ + +N       +  P
Sbjct  388   LLGFGINAENNQRNFLAGEEDNVISQIERPVKEVAFPGSAQDVESLLKNQRQSYFANAQP  447

Query  1435  EWQQSEDRADQ  1467
             + ++ E+   Q
Sbjct  448   QQREREEGRSQ  458



>dbj|BAE44299.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAK39721.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAK39722.1| beta-conglycinin alpha subunit [Glycine max]
Length=605

 Score =   181 bits (460),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 209/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP++F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  192   NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  249

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  250   HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  309

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  310   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  369

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  370   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  427

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q ++ E
Sbjct  428   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE  487

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  488   EQPLEV-RKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  544

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  545   NVISQIPSQVQELAFPGSAQAVEKLLKN  572



>emb|CAP06319.1| convicilin [Lathyrus tingitanus]
Length=508

 Score =   180 bits (456),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/347 (31%), Positives = 190/347 (55%), Gaps = 14/347 (4%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T  +++ G    L  F ERS+ FE ++N+R      +  T   P H+DA
Sbjct  167   NPFLFKSNKFLTLFQNENGHIRRLQGFDERSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  226

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G   L ++  N + SY++  G  + +PAG TSYL+N D+   L ++ L+  +
Sbjct  227   DLILVVLNGRAILTVLSSNDRNSYNLECGDTIKLPAGTTSYLLNQDDEEDLRVVDLVVPV  286

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL---RGRDDSPFIQVSDEQ  831
             + PG+FE       +N +LR F  ++LEA+++   ETI++VL   +G++ +  ++VS EQ
Sbjct  287   NRPGKFEALGLSNNKNQYLRGFSKNVLEASFNTKYETIEKVLLEQQGQETNAILKVSREQ  346

Query  832   LKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVD-NDDFKELGDIEVAF  1005
             ++ LRK + +         S  +P ++  ++   SN +G+ FE+     + +L D++V+ 
Sbjct  347   VEELRKHAKSSSKKSL--PSECEPFNLRSQNPKYSNKFGKFFEITPQKKYPQLQDLDVSI  404

Query  1006  AN--ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYETVNAQ  1179
             ++  I  G +L P +N+RA  +  V +G+G  ++      ++ +R  E      +   A+
Sbjct  405   SSVEINEGALLLPHYNSRAIVVVLVNEGEGNLELVG--FKNEQQRQGENEDKNVQRYEAR  462

Query  1180  LRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
             L  G + +IP G+P    AS   NL ++ F INA+NN+R    G ++
Sbjct  463   LSSGDVIIIPAGHPVAISAS--SNLNLLGFGINAENNQRNFFTGSDD  507



>gb|ABH09130.1| beta-conglycinin alpha'-subunit [Glycine max]
Length=600

 Score =   181 bits (460),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 217/407 (53%), Gaps = 31/407 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T ++PN
Sbjct  187   NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLSPN  244

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  245   HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  304

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  305   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  364

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K +      +   SS  KP ++     + SN  G+LFE+  
Sbjct  365   RLQESVIVEISKKQIRELSKHAKP--SSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITP  422

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  423   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  480

Query  1141  EGAIP-TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  481   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  538

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             +N+ S +    +E++F  S+K ++ + ++  +       P  QQ E+
Sbjct  539   DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEE  583



>dbj|BAK39718.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAK39719.1| beta-conglycinin alpha subunit [Glycine max]
Length=605

 Score =   181 bits (460),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 209/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP++F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  192   NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  249

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  250   HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  309

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  310   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  369

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  370   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  427

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q ++ E
Sbjct  428   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE  487

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  488   EQPL-EVRKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  544

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  545   NVISQIPSQVQELAFPGSAQAVEKLLKN  572



>gb|KHN15747.1| Beta-conglycinin, alpha chain [Glycine soja]
 gb|KHN15748.1| Beta-conglycinin, alpha chain [Glycine soja]
Length=605

 Score =   181 bits (460),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 209/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP++F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  192   NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  249

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  250   HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  309

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  310   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  369

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  370   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  427

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q ++ E
Sbjct  428   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE  487

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  488   EQPL-EVRKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  544

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  545   NVISQIPSQVQELAFPGSAQAVEKLLKN  572



>ref|XP_003556051.1| PREDICTED: beta-conglycinin, alpha chain [Glycine max]
 dbj|BAB56161.1| beta-conglycinin alpha subunit [Glycine max]
 dbj|BAE46788.1| beta-conglycinin alpha subunit [Glycine max]
Length=605

 Score =   181 bits (460),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 209/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP++F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  192   NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  249

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  250   HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  309

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  310   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  369

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  370   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  427

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q ++ E
Sbjct  428   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE  487

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  488   EQPL-EVRKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  544

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  545   NVISQIPSQVQELAFPGSAQAVEKLLKN  572



>sp|P13916.2|GLCA_SOYBN RecName: Full=Beta-conglycinin, alpha chain; Flags: Precursor 
[Glycine max]
 emb|CAA35691.1| unnamed protein product [Glycine max]
Length=605

 Score =   181 bits (460),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 209/388 (54%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP++F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  192   NKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  249

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  250   HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  309

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  310   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  369

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  370   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  427

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q ++ E
Sbjct  428   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE  487

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  488   EQPL-EVRKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  544

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  545   NVISQIPSQVQELAFPGSAQAVEKLLKN  572



>emb|CAF25232.1| Vicilin [Pisum sativum]
Length=415

 Score =   177 bits (450),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 127/402 (32%), Positives = 221/402 (55%), Gaps = 42/402 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P +
Sbjct  6     ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYR--LLEYKSKPHTLFLPQY  63

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L 
Sbjct  64    TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA  123

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGR----------  795
               ++ PG+ + F  +G   + S L  F  +ILEAA++ + E I++VL  +          
Sbjct  124   IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS  183

Query  796   ---------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYG  945
                      +++  ++VS EQ++ L K + +    K   SS S P ++     + SN +G
Sbjct  184   LKDRRQEINEENVIVKVSREQIEELSKNAKSSS--KKSVSSESGPFNLRSRNPIYSNKFG  241

Query  946   QLFEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             + FE+  +  ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   + 
Sbjct  242   KFFEITPEKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN  300

Query  1117  SSQTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
              +Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F IN
Sbjct  301   ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGIN  358

Query  1279  ADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             A+NNER  LAG ++N+ S ++   KE++F  SS  VD++ +N
Sbjct  359   AENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKN  400



>pdb|3SMH|A Chain A, Crystal Structure Of Major Peanut Allergen Ara H 1
 pdb|3SMH|B Chain B, Crystal Structure Of Major Peanut Allergen Ara H 1
 pdb|3SMH|C Chain C, Crystal Structure Of Major Peanut Allergen Ara H 1
 pdb|3SMH|D Chain D, Crystal Structure Of Major Peanut Allergen Ara H 1
 pdb|3SMH|E Chain E, Crystal Structure Of Major Peanut Allergen Ara H 1
 pdb|3SMH|F Chain F, Crystal Structure Of Major Peanut Allergen Ara H 1
Length=418

 Score =   177 bits (450),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 121/419 (29%), Positives = 216/419 (52%), Gaps = 44/419 (11%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  R F T + +Q GR  VL RF +RS QF+ ++N R   +E +  T V P H D
Sbjct  3     NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHAD  62

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I ++ +G+ T+ +   N +KS+++  G  + IP+G  SY++N  +N  L + K+   
Sbjct  63    ADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMP  122

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-----------RGR-  795
             ++TPG+FE FF      ++S+L+ F  + LEAA++     I+RVL           RG+ 
Sbjct  123   VNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQR  182

Query  796   ---------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSS-SKPVDIFKHK-SVSNNY  942
                      ++   ++VS E ++ L K + ++    +++    + P+++ + +  +SNN+
Sbjct  183   RWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNF  242

Query  943   GQLFEV----DNDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACP  1110
             G+LFEV     N   ++L D+ +    I  G ++ P FN++A  +  V  G G  ++   
Sbjct  243   GKLFEVKPDKKNPQLQDL-DMMLTXVEIKEGALVLPHFNSKAMVIVVVNKGTGNLELVAV  301

Query  1111  QVSSQTERSEEGAIPT----------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQI  1260
             +   Q     E                    A+L+ G +F++P  +P    AS +  L +
Sbjct  302   RKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE--LHL  359

Query  1261  VCFDINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGP  1434
             + F INA+NN R+ LAG K+N+   ++  AK+++F  S + V+K+ +N  +    S  P
Sbjct  360   LGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSARP  418



>emb|CAP06312.1| cvc [Pisum abyssinicum]
Length=526

 Score =   179 bits (455),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 114/359 (32%), Positives = 188/359 (52%), Gaps = 27/359 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  168   NPFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  227

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + IPAG TSYLVN D+   L ++  +  +
Sbjct  228   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKIPAGTTSYLVNQDDEEDLRVVDFVIPV  287

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL------------------  786
             + PG+FE F     +N +LR F  +ILEA+ +   ETI++VL                  
Sbjct  288   NRPGKFEAFGLSENKNQYLRGFSKNILEASLNTKYETIEKVLLEEQEKKPQQLRDRKRRQ  347

Query  787   RGRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVD  963
             +G +    I+VS EQ++ LRK + +    K    S  +P ++  HK   SN +G+LFE+ 
Sbjct  348   QGGERDAIIKVSREQIEELRKLAKSS--SKKSLPSEFEPFNLRSHKPEYSNKFGKLFEIT  405

Query  964   ND-DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTER  1134
              +  + +L D++  V+   I +G ++ P +N+RA  +  V +GKG  ++   +   Q   
Sbjct  406   PEKKYPQLQDLDILVSCVEINKGALMLPHYNSRAIVVLLVNEGKGNLELLGLKNEQQERE  465

Query  1135  SEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
               +      +   A+L PG + +IP G+P    AS   NL ++ F  NA+NN+R  L+G
Sbjct  466   DRKERNNEVQRYEARLSPGDVVIIPAGHPVAISAS--SNLNLLGFGTNAENNQRNFLSG  522



>emb|CAD87731.1| allergen Len c 1.0102 [Lens culinaris]
Length=415

 Score =   177 bits (449),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 131/402 (33%), Positives = 218/402 (54%), Gaps = 42/402 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P +
Sbjct  6     ENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYR--LLEYKSKPHTLFLPQY  63

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+  L ++  N + S+++  G  + +PAG  +YL N D+N  L ++ L 
Sbjct  64    TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA  123

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRV--------------  783
               ++ PG+ E F  +G   + SFL  F  SILEAA++   E I++V              
Sbjct  124   IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS  183

Query  784   LRGR-----DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYG  945
             LR R      ++  ++VS EQ+K L K + +    K   SS S+P ++     + SN +G
Sbjct  184   LRDRRQEINKENVIVKVSREQIKELSKNAKSSS--KKSVSSESEPFNLRSRNPIYSNKFG  241

Query  946   QLFEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             + FE+  +   +L D+++ F N   I  G +L P +N+RA  +  V +GKG+ ++   + 
Sbjct  242   KFFEITPEKNPQLQDLDI-FVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN  300

Query  1117  SSQTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
              +Q E +++      ET        A+L PG +FV+P G+P    AS D NL  + F IN
Sbjct  301   ENQREENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNL--IGFGIN  358

Query  1279  ADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             A NN+R  LAG ++N+ S +    KE++F  SS+ VD++  N
Sbjct  359   AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTN  400



>emb|CAP06328.1| cvc [Vicia villosa]
Length=589

 Score =   181 bits (458),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 200/367 (54%), Gaps = 33/367 (9%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F+T  +++ G    L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  227   NPFLFKSNKFQTLFQNENGYIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  286

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G   L ++  + + SY++  G  + +PAG TSYLVN D+   L ++ L   +
Sbjct  287   DLIIVVLSGRAILTVLSPDDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRVVDLAIPV  346

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKS  840
             + PG+ E F  +G +N +LR F  +ILEA+++ + ETI+RVL    D    Q   ++ +S
Sbjct  347   NRPGKVESFLLSGNKNQYLRGFSKNILEASFNTNYETIERVLLEEQDKESQQSIGQKRRS  406

Query  841   LRKESDTIWPFKTD---------KSSSS-------KPVDI-FKHKSVSNNYGQLFEVDND  969
              R+E++ +     +         KSSS        +P+++  ++   SN +G++FE+  +
Sbjct  407   QRQETNALVKVSREQLEDLKRLAKSSSQEGLSSQFEPINLRSQNPKYSNKFGKVFEITPE  466

Query  970   -DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
               + +L D++  V+  +I  G ++ P +N+RA  +  V +G+G  ++   +   Q +R +
Sbjct  467   KKYPQLQDLDLFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLELVGLKNEQQEQREK  526

Query  1141  E-------GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERV  1299
             E         +  YE   A+L PG + +IP G+P    AS D NL  + F INA+NN+R 
Sbjct  527   EDEQQERNNQVQRYE---ARLSPGDVVIIPAGHPVAVRASSDLNL--LAFGINAENNQRN  581

Query  1300  ALAGKNN  1320
              LAG ++
Sbjct  582   FLAGSDD  588



>emb|CBK38921.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   177 bits (450),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 127/402 (32%), Positives = 221/402 (55%), Gaps = 42/402 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P +
Sbjct  29    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYR--LLEYKSKPRTLFLPQY  86

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L 
Sbjct  87    TDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLT  146

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGR----------  795
               ++ PG+ + F  +G   + S L  F  +ILEAA++ + E I++VL  +          
Sbjct  147   IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS  206

Query  796   ---------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYG  945
                      +++  ++VS EQ++ L K + +    K   SS S P ++     + SN +G
Sbjct  207   LKDRRQEINEENVIVKVSREQIEELSKNAKSSS--KKSVSSESGPFNLRSRNPIYSNKFG  264

Query  946   QLFEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             + FE+  +  ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   + 
Sbjct  265   KFFEITPEKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN  323

Query  1117  SSQTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
              +Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F IN
Sbjct  324   ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGIN  381

Query  1279  ADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             A+NNER  LAG ++N+ S ++   KE++F  SS  VD++ +N
Sbjct  382   AENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKN  423



>emb|CAP06321.1| convicilin [Lathyrus sativus]
Length=527

 Score =   179 bits (455),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 194/351 (55%), Gaps = 22/351 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF ERS+ FE ++N+R      +  T   P H+DA
Sbjct  186   NPFLFKSNKFLTLFENENGYIRRLQRFDERSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  245

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI ++  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  246   DLILVILNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNEDDEEDLRVVDLVIPV  305

Query  664   STPGRFEFFFGTGRNSFLRAFKSSILEAAYDESKETIQRVL------RGRDDSPFIQVSD  825
             + PG+FE F     N +L  F  S+L+A+ +   ETI++VL      +G++ +  ++VS 
Sbjct  306   NRPGKFEAF---DLNQYLGGFSKSVLKASLNTKYETIEKVLLEEQQKQGQETNAIVKVSR  362

Query  826   EQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDND-DFKELGDIEV  999
             EQ++ LRK + +    K    S  +PV++  H    SN +G+ FE+  +  + +L D++V
Sbjct  363   EQIEELRKLAKSS--SKKSLLSELEPVNLRSHSPKYSNKFGKFFEITPEKKYPQLQDLDV  420

Query  1000  AFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ-VSSQTERSEEGA-IPTYET  1167
             + +   I  G +L P +N+RA  +  V +GKG  ++   Q    Q ER +    +  YE 
Sbjct  421   SISCVEINEGALLLPHYNSRAIVVLLVNEGKGNLELLGVQDEDEQQERKKRNKEVQRYE-  479

Query  1168  VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
               A+L P  + +IP G+P    AS   NL ++ F INA+NNER  L+G ++
Sbjct  480   --ARLSPSDVVIIPAGHPVAVSAS--SNLNLLGFGINAENNERNFLSGSDD  526



>emb|CBK38919.1| vicilin 47k [Pisum sativum]
Length=437

 Score =   177 bits (450),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 127/401 (32%), Positives = 221/401 (55%), Gaps = 41/401 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P +
Sbjct  29    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYR--LLEYKSKPRTLFLPQY  86

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L 
Sbjct  87    TDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA  146

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGR----------  795
               ++ PG+ + F  +G   + S L  F  +ILEAA++ + E I++VL  +          
Sbjct  147   IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRSL  206

Query  796   --------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQ  948
                     +++  ++VS EQ++ L K + +    K   SS S P ++     + SN +G+
Sbjct  207   KDRRQEINEENVIVKVSREQIEELSKNAKSSS--KKSVSSESGPFNLRSRNPIYSNKFGK  264

Query  949   LFEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVS  1119
              FE+  +  ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   +  
Sbjct  265   FFEITPEKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNE  323

Query  1120  SQTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINA  1281
             +Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F INA
Sbjct  324   NQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINA  381

Query  1282  DNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             +NNER  LAG ++N+ S ++   KE++F  SS  VD++ +N
Sbjct  382   ENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKN  422



>pdb|3S7E|A Chain A, Crystal Structure Of Ara H 1
 pdb|3S7E|B Chain B, Crystal Structure Of Ara H 1
 pdb|3S7I|A Chain A, Crystal Structure Of Ara H 1
 pdb|3S7I|B Chain B, Crystal Structure Of Ara H 1
Length=418

 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/415 (29%), Positives = 215/415 (52%), Gaps = 42/415 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  R F T + +Q GR  VL RF +RS QF+ ++N R   +E +  T V P H D
Sbjct  4     NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHAD  63

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I ++ +G+ T+ +   N +KS+++  G  + IP+G  SY++N  +N  L + K+   
Sbjct  64    ADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMP  123

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-----------RGR-  795
             ++TPG+FE FF      ++S+L+ F  + LEAA++     I+RVL           RG+ 
Sbjct  124   VNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQR  183

Query  796   ---------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSS-SKPVDIFKHK-SVSNNY  942
                      ++   ++VS E ++ L K + ++    +++    + P+++ + +  +SNN+
Sbjct  184   RWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNF  243

Query  943   GQLFEVDNDDFK-ELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ  1113
             G+LFEV  D    +L D+++      I  G ++ P FN++A  +  V  G G  ++   +
Sbjct  244   GKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVR  303

Query  1114  VSSQTERSEEGAIPT----------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIV  1263
                Q     E                    A+L+ G +F++P  +P    AS +  L ++
Sbjct  304   KEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE--LHLL  361

Query  1264  CFDINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFS  1425
              F INA+NN R+ LAG K+N+   ++  AK+++F  S + V+K+ +N  +    S
Sbjct  362   GFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVS  416



>emb|CAA47814.1| vicilin 47kD protein [Pisum sativum]
 emb|CBK38918.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 127/402 (32%), Positives = 221/402 (55%), Gaps = 42/402 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P +
Sbjct  29    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYR--LLEYKSKPHTLFLPQY  86

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L 
Sbjct  87    TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA  146

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGR----------  795
               ++ PG+ + F  +G   + S L  F  +ILEAA++ + E I++VL  +          
Sbjct  147   IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS  206

Query  796   ---------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYG  945
                      +++  ++VS EQ++ L K + +    K   SS S P ++     + SN +G
Sbjct  207   LKDRRQEINEENVIVKVSREQIEELSKNAKSSS--KKSVSSESGPFNLRSRNPIYSNKFG  264

Query  946   QLFEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             + FE+  +  ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   + 
Sbjct  265   KFFEITPEKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN  323

Query  1117  SSQTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
              +Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F IN
Sbjct  324   ENQGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGIN  381

Query  1279  ADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             A+NNER  LAG ++N+ S ++   KE++F  SS  VD++ +N
Sbjct  382   AENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKN  423



>dbj|BAE02726.1| beta-conglycinin alpha prime subunit [Glycine max]
 dbj|BAE44298.1| beta-conglycinin alpha prime subunit [Glycine max]
 gb|ADD38965.1| beta-conglycinin alpha prime subunit [Glycine max]
 dbj|BAK53445.1| beta-conglycinin alpha' subunit [Glycine max]
Length=621

 Score =   180 bits (457),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 217/407 (53%), Gaps = 31/407 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T + P+
Sbjct  208   NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLLPH  265

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  266   HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  325

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  326   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  385

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K + +    +   SS  KP ++     + SN  G+LFE+  
Sbjct  386   RLQESVIVEISKKQIRELSKHAKS--SSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITP  443

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  444   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  501

Query  1141  EGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  502   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  559

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             +N+ S +    +E++F  S+K ++ + ++  +       P  QQ E+
Sbjct  560   DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEE  604



>dbj|BAC78524.1| prepro beta-conglycinin alpha prime subunit [Glycine max]
Length=621

 Score =   180 bits (457),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 217/407 (53%), Gaps = 31/407 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T + P+
Sbjct  208   NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLLPH  265

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  266   HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  325

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  326   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  385

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K + +    +   SS  KP ++     + SN  G+LFE+  
Sbjct  386   RLQESVIVEISKKQIRELSKHAKS--SSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITP  443

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  444   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  501

Query  1141  EGAIPT-YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  502   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  559

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             +N+ S +    +E++F  S+K ++ + ++  +       P  QQ E+
Sbjct  560   DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEE  604



>emb|CAP06313.1| cvc [Pisum sativum subsp. sativum]
Length=572

 Score =   179 bits (454),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/372 (31%), Positives = 191/372 (51%), Gaps = 40/372 (11%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  201   NPFLFKSNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  260

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY++  G  + +PAG TSYLVN D+   L ++ L+  +
Sbjct  261   DLILVVLNGKAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLVNQDDEEDLRLVDLVIPV  320

Query  664   STPGRFEFF--------------------------FGTGRNSFLRAFKSSILEAAYDESK  765
             + PG+FE F                              +N +LR F  +ILEA+Y+   
Sbjct  321   NGPGKFEAFDLAKNKNQYLRGFSKNILEASYNAFDLAKNKNQYLRGFSKNILEASYNTKY  380

Query  766   ETIQRV-LRGRDDSP-----FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHK-  924
             ETI++V L  ++  P      ++VS  Q++ LRK + +    K    S  +P+++  HK 
Sbjct  381   ETIEKVLLEEQEKEPQQRRAIVKVSRGQIEELRKLAKSS--SKKSLPSEFEPINLRSHKP  438

Query  925   SVSNNYGQLFEVDND-DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWA  1095
               SN +G+LFE+  +  + +L D++  V+   I  G ++ P +N+RA  +  V +GKG  
Sbjct  439   EYSNKFGKLFEITPEKKYPQLQDLDLFVSCVEINEGALMLPHYNSRAIVVLLVNEGKGNL  498

Query  1096  QMACPQVSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDI  1275
             ++   +   Q     +      +   A+L PG + +IP G+P    AS   NL ++ F I
Sbjct  499   ELLGLKNEQQEREDRKERNNEVQRYEARLSPGDVVIIPAGHPVAITAS--SNLNLLAFGI  556

Query  1276  NADNNERVALAG  1311
             NA+NNER  L+G
Sbjct  557   NAENNERNFLSG  568



>dbj|BAA74452.2| alpha' subunit of beta-conglycinin [Glycine max]
Length=559

 Score =   179 bits (454),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 217/407 (53%), Gaps = 31/407 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T + P+
Sbjct  146   NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLLPH  203

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  204   HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  263

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  264   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  323

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K + +    +   SS  KP ++     + SN  G+LFE+  
Sbjct  324   RLQESVIVEISKKQIRELSKHAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKLFEITP  381

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  382   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  439

Query  1141  EGAIP-TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  440   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  497

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             +N+ S +    +E++F  S+K ++ + ++  +       P  QQ E+
Sbjct  498   DNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEE  542



>emb|CAP06331.1| convicilin [Vicia articulata]
Length=547

 Score =   178 bits (452),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/352 (32%), Positives = 195/352 (55%), Gaps = 21/352 (6%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F+   F+T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H++A
Sbjct  197   NPFFFKSNKFQTVFENENGHIRLLQRFDKRSDLFENLQNYRLTEYRSKPHTIFLPQHVNA  256

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G+  L ++  N++ SY++  G  + +PAG T+YLVN D+   L ++ L+  +
Sbjct  257   DFILVVLSGKAILTVLSPNERNSYNLERGDTIKLPAGTTAYLVNQDDEEDLRVVDLVIPV  316

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVL-----------RGRDDSP  807
             + PG+FE F  +G +N +LR F  +ILEA+ +   ETI++VL           + ++   
Sbjct  317   NRPGKFEAFNLSGNKNQYLRGFSKNILEASLNTRYETIEKVLLEEPQQYRRRQQRQETEA  376

Query  808   FIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVDND-DFKE  981
              ++VS EQ++ LR  + +    K   SS  +P ++  ++   SN +G+LFE+  +    +
Sbjct  377   IVKVSREQIEELRNHAKSS--SKKRLSSEFEPFNLRSQNPKYSNKFGKLFEITPEKKHPQ  434

Query  982   LGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIP  1155
             L D+++  +   I  G ++ P +N+RAT +  V +G+G  ++   +   Q +R EE    
Sbjct  435   LQDLDIFLSHVEIKEGALMLPYYNSRATVVLLVNEGRGKLELVGLKNEQQEQRKEERN-K  493

Query  1156  TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
               +   A+L PG + VIP G+P    AS   NL ++ F INA+NN+R  L+G
Sbjct  494   QVQRFEARLSPGDIVVIPAGHPVAIRAS--SNLNLLGFGINAENNQRNFLSG  543



>emb|CBK38922.1| vicilin 47k [Pisum sativum]
 emb|CBK38923.1| vicilin 47k [Pisum sativum]
Length=438

 Score =   176 bits (446),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/402 (31%), Positives = 220/402 (55%), Gaps = 42/402 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P +
Sbjct  29    ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYR--LLEYKSKPHTLFLPQY  86

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L 
Sbjct  87    TDADFILVVLNGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA  146

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGR----------  795
               ++ PG+ + F  +G   + S L  F  +ILEAA++ + E I++VL  +          
Sbjct  147   IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS  206

Query  796   ---------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYG  945
                      +++  ++VS EQ++ L K + +    K   SS S P ++     + SN +G
Sbjct  207   LKDRRQEINEENVIVKVSREQIEELSKNAKSSS--KKSVSSESGPFNLRSRNPIYSNKFG  264

Query  946   QLFEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQV  1116
             + FE+  +  ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   + 
Sbjct  265   KFFEITPEKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN  323

Query  1117  SSQTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
              +Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F IN
Sbjct  324   ENQGKENDKEEEQEEETSKQVQLYKAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGIN  381

Query  1279  ADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             A+NNER  LAG ++N+ S +    KE++F  SS  +D++ +N
Sbjct  382   AENNERNFLAGEEDNVISQVQRPVKELAFPGSSHEIDRLLKN  423



>ref|NP_001237316.1| beta-conglycinin alpha prime subunit precursor [Glycine max]
 dbj|BAB64303.1| beta-conglycinin alpha prime subunit [Glycine max]
Length=621

 Score =   179 bits (455),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 217/407 (53%), Gaps = 31/407 (8%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F  + F+T  ++Q G   VL RF +RS Q + + ++R  ILE  SK  T + P+
Sbjct  208   NKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYR--ILEFNSKPNTLLLPH  265

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD + ++  G   L ++  + + SY+++ G  + +PAG T Y+VN DN+  L +I L
Sbjct  266   HADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMITL  325

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL GR+        
Sbjct  326   AIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEE  385

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S +Q++ L K + +    +   SS  KP ++     + SN  G+LFE+  
Sbjct  386   RLQESVIVEISKKQIRELSKRAKS--SSRKTISSEDKPFNLRSRDPIYSNKLGKLFEITP  443

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D++V  +  ++  G +  P FN++A  +  +V  +G A +    +  Q +R +
Sbjct  444   EKNPQLRDLDVFLSVVDMNEGALFLPHFNSKA--IVVLVINEGEANIELVGIKEQQQRQQ  501

Query  1141  EGAIP-TYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-K  1314
             +   P       A+L    +FVIP G P V  A+ D  L    F INA+NN+R  LAG K
Sbjct  502   QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSD--LNFFAFGINAENNQRNFLAGSK  559

Query  1315  NNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             +N+ S +    +E++F  S+K ++ + ++  +       P  QQ E+
Sbjct  560   DNVISQIPSQVQELAFLGSAKDIENLIKSQSESYFVDAQP--QQKEE  604



>emb|CBK38920.1| vicilin 47k [Pisum sativum]
Length=441

 Score =   176 bits (446),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 127/400 (32%), Positives = 219/400 (55%), Gaps = 41/400 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NP++F+   F+T   ++ G   +L +F +RS  FE ++N+R  +LE +SK  T   P + 
Sbjct  34    NPFIFKSNKFQTLFENENGHIRLLQKFDQRSKIFENLQNYR--LLEYKSKPRTLFLPQYT  91

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L  
Sbjct  92    DADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI  151

Query  658   TISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGR-----------  795
              ++ PG+ + F  +G   + S L  F  +ILEAA++ + E I++VL  +           
Sbjct  152   PVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRSLK  211

Query  796   -------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                    +++  ++VS EQ++ L K + +    K   SS S P ++     + SN +G+ 
Sbjct  212   DRRQEINEENVIVKVSREQIEELSKNAKSSS--KKSVSSESGPFNLRSRNPIYSNKFGKF  269

Query  952   FEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS  1122
             FE+  +  ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   +  +
Sbjct  270   FEITPEKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN  328

Query  1123  QTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINAD  1284
             Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F INA+
Sbjct  329   QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAE  386

Query  1285  NNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             NNER  LAG ++N+ S ++   KE++F  SS  VD++ +N
Sbjct  387   NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKN  426



>emb|CAF25233.1| Vicilin [Pisum sativum]
Length=415

 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 123/400 (31%), Positives = 217/400 (54%), Gaps = 38/400 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP++F+   F+T + ++ G   +L +F +RS  FE ++N+R    + + +T   P   D
Sbjct  6     ENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQCTD  65

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I +V  G+ TL +++ N + S+++  G  + +PAG  +YL N D+N  L ++ L   
Sbjct  66    ADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLTIP  125

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVLRGR------------  795
             ++ PG+ + F  +G   + S L  F  +ILEAA++ + E I++VL  +            
Sbjct  126   VNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRSLK  185

Query  796   -------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                    +++  ++VS EQ++ L K + +    K   SS S P ++     + SN +G+ 
Sbjct  186   DRRQEINEENVIVKVSREQIEELSKNAKSSS--KKSVSSESGPFNLRSRNPIYSNKFGKF  243

Query  952   FEVDNDDFKELGDIEVAFAN---ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSS  1122
             FE+  +  ++L D+++ F N   I  G +L P +N+RA  +  V +GKG  ++   +  +
Sbjct  244   FEITPEKNQQLQDLDI-FVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNEN  302

Query  1123  QTERSEEGAIPTYET------VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINAD  1284
             Q + +++      ET        A+L PG +FVIP G+P    AS D NL  + F INA+
Sbjct  303   QGKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNL--IGFGINAE  360

Query  1285  NNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             NNER  LAG ++N+ S ++   KE++F  SS  VD++ +N
Sbjct  361   NNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKN  400



>emb|CAP06330.1| convicilin [Vicia lutea]
Length=515

 Score =   177 bits (450),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 111/362 (31%), Positives = 196/362 (54%), Gaps = 28/362 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+  +F T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  152   NPFLFKSNNFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  211

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G+  L ++  N + SY+++ G  + +PAG TSYL+N+D+   L ++ L  ++
Sbjct  212   DLILVVLSGKAILTVLSPNNRNSYNLKRGDTIKLPAGTTSYLLNSDDEEDLRMVDLAISV  271

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKS  840
             + PG+ E F  +G +N +LR F  +ILEA+++   ETI++VL    D    Q   ++  S
Sbjct  272   NRPGKVESFNLSGNKNQYLRGFSKNILEASFNTKYETIEKVLLEEQDKESQQSIGQKRIS  331

Query  841   LRKESDTI---------WPFKTDKSSSSK-------PVDIFKHK-SVSNNYGQLFEVDND  969
              R+E++ +          P +  +SSS K       P+++   +   SN +G+ +E+  +
Sbjct  332   QRQETNALVKVSREQIEEPKRLARSSSRKGVSSEFEPINLRSQRPKYSNKFGKFYEISPE  391

Query  970   -DFKELGDIEVAFAN--ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
               + +L D++V+ ++  I  G +L P +N+RA     V +GKG  ++   Q   Q +R +
Sbjct  392   KKYPQLQDLDVSVSSVEINEGALLLPHYNSRAIVTVLVNEGKGNLELIGFQNEQQGQREK  451

Query  1141  EGAI-----PTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVAL  1305
             E           +  +A+L  G + +IP G+P    AS   NL ++ F INA+N++R  L
Sbjct  452   EDEQQHERNKQVQRYDARLSSGDVVIIPAGHPVAVSAS--SNLDLLGFGINAENSQRNFL  509

Query  1306  AG  1311
              G
Sbjct  510   TG  511



>emb|CAP06333.1| convicilin [Vicia narbonensis]
Length=485

 Score =   177 bits (448),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 115/360 (32%), Positives = 197/360 (55%), Gaps = 28/360 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  132   NPFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIDA  191

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI  V  G   L ++  N + SY++  G  + +PAG TSYL+N D+   L ++ L  ++
Sbjct  192   DLILTVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSYLLNQDDEEDLRVVDLSISV  251

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVL--------------RGRD  798
             + PG+ E F  +G +N +LR F  +ILEA+ +   ETI++VL              + ++
Sbjct  252   NRPGKVESFGLSGSKNQYLRGFSKNILEASLNTKYETIEKVLLEEPQQSIGQKRRSQRQE  311

Query  799   DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVDND-D  972
              +  ++VS EQ++ L++ + +    K   SS  +P ++  ++   SN +G+LFE+  +  
Sbjct  312   TNALVKVSREQVEELKRLAKSS--SKKGVSSEFEPFNLRSQNPKYSNKFGKLFEITPEKK  369

Query  973   FKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMAC--PQVSSQTERSE  1140
             + +L D++  V+   I  GG++ P +N+RA  +  V +GKG  ++     +   Q ER +
Sbjct  370   YPQLQDLDIFVSSVEINEGGLMLPHYNSRAIVILLVNEGKGNLELVGLKNEQQEQRERED  429

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
             E  +  YE   A+L PG + +IP G+P    AS   NL ++ F INA+NN+R  L G ++
Sbjct  430   EQQVQRYE---ARLSPGDVVIIPAGHPVAVSAS--SNLNLLGFGINAENNQRNFLTGSDD  484



>gb|ACB05815.1| conglutin beta [Lupinus angustifolius]
Length=611

 Score =   178 bits (452),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 123/398 (31%), Positives = 215/398 (54%), Gaps = 39/398 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F    F+T +R++ G+  VL RF +R+N+ E ++N+R  I+E +SK  T + P H 
Sbjct  184   NPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYR--IIEFQSKPNTLILPKHS  241

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I +V  G  T+ I+  +K++ Y++  G  + +PAG TSY++N D+N  L + KL  
Sbjct  242   DADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKLAI  301

Query  658   TISTPGR-FEFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRG------------  792
              I+ PG+ ++F+  T ++  S+   F  + LEA ++   E I+RVL G            
Sbjct  302   PINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRR  361

Query  793   ------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                   +D+   ++VS +Q++ LRK + +       K S S P ++  +K + SN +G  
Sbjct  362   GQEQSHQDEGVIVRVSKKQIQELRKHAQSSS--GEGKPSESGPFNLRSNKPIYSNKFGNF  419

Query  952   FEVD---NDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ---  1113
             +E+    N  F++L +I + F  I  G +L P +N++A  +  V +G+G  ++   +   
Sbjct  420   YEITPDINPQFQDL-NISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQ  478

Query  1114  -VSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNN  1290
                 + E   E         + +L  G +F+IP G+P    AS   NL+++ F INA+ N
Sbjct  479   RQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINAS--SNLRLLGFGINANEN  536

Query  1291  ERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             +R  LAG ++N+   +D   KE++F  S + V+++ +N
Sbjct  537   QRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKN  574



>gb|AEB33712.1| conglutin beta 1 [Lupinus angustifolius]
Length=611

 Score =   178 bits (452),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 123/398 (31%), Positives = 215/398 (54%), Gaps = 39/398 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNHL  477
             NPY F    F+T +R++ G+  VL RF +R+N+ E ++N+R  I+E +SK  T + P H 
Sbjct  184   NPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYR--IIEFQSKPNTLILPKHS  241

Query  478   DADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQ  657
             DAD I +V  G  T+ I+  +K++ Y++  G  + +PAG TSY++N D+N  L + KL  
Sbjct  242   DADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNLRVAKLAI  301

Query  658   TISTPGR-FEFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRG------------  792
              I+ PG+ ++F+  T ++  S+   F  + LEA ++   E I+RVL G            
Sbjct  302   PINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQENEKQRR  361

Query  793   ------RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQL  951
                   +D+   ++VS +Q++ LRK + +       K S S P ++  +K + SN +G  
Sbjct  362   GQEQSHQDEGVIVRVSKKQIQELRKHAQSSS--GEGKPSESGPFNLRSNKPIYSNKFGNF  419

Query  952   FEVD---NDDFKELGDIEVAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ---  1113
             +E+    N  F++L +I + F  I  G +L P +N++A  +  V +G+G  ++   +   
Sbjct  420   YEITPDINPQFQDL-NISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQ  478

Query  1114  -VSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNN  1290
                 + E   E         + +L  G +F+IP G+P    AS   NL+++ F INA+ N
Sbjct  479   RQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINAS--SNLRLLGFGINANEN  536

Query  1291  ERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             +R  LAG ++N+   +D   KE++F  S + V+++ +N
Sbjct  537   QRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKN  574



>ref|NP_001236856.1| beta-conglycinin alpha-subunit precursor [Glycine max]
 dbj|BAB64304.1| beta-conglycinin alpha-subunit [Glycine max]
Length=623

 Score =   179 bits (453),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 123/388 (32%), Positives = 207/388 (53%), Gaps = 27/388 (7%)
 Frame = +1

Query  298   DDNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPN  471
             + NP+ F    F T  ++Q GR  VL RF +RS Q + + ++R  ILE  SK  T + PN
Sbjct  210   NKNPFHFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR--ILEFNSKPNTLLLPN  267

Query  472   HLDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKL  651
             H DAD +  +  G   L ++  + + SY ++ G  + +P+G T Y+VN DNN  L +I L
Sbjct  268   HADADYLIAILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL  327

Query  652   IQTISTPGRFEFFFGT---GRNSFLRAFKSSILEAAYDESKETIQRVLRGRD--------  798
                ++ PGRFE FF +    + S+L+ F  +ILEA+YD   E I +VL  R+        
Sbjct  328   AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQ  387

Query  799   ---DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYGQLFEVDN  966
                +S  +++S EQ+++L K + +    +   SS  KP ++     + SN  G+ FE+  
Sbjct  388   RLQESVIVEISKEQIRALSKRAKSSS--RKTISSEDKPFNLRSRDPIYSNKLGKFFEITP  445

Query  967   DDFKELGDIEV--AFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
             +   +L D+++  +  ++  G +L P FN++A  +  + +G    ++   +   Q E+ E
Sbjct  446   EKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEEQQE  505

Query  1141  EGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KN  1317
             E  +       A+L    +FVIP G P V  A+   NL      INA+NN+R  LAG ++
Sbjct  506   EQPLEV-RKYRAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD  562

Query  1318  NLYSNMDDVAKEVSFGVSSKLVDKVFEN  1401
             N+ S +    +E++F  S++ V+K+ +N
Sbjct  563   NVISQIPSQVQELAFLGSAQAVEKLLKN  590



>emb|CAP06329.1| convicilin [Vicia peregrina]
Length=499

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/367 (31%), Positives = 198/367 (54%), Gaps = 35/367 (10%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T  ++  G   +L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  139   NPFLFKSNKFLTLFQNGNGHIRLLQRFDKRSDLFENLQNYRLLEYRAKPHTIFLPQHIDA  198

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G   L ++  + + SY++  G  + +PAG TSY +N D+   L ++ L  ++
Sbjct  199   DLILVVLSGRAILTVLSPDDRNSYNLERGDTIKLPAGTTSYPLNQDDEEDLRVVDLAISV  258

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVL-----------RG-----  792
             + PG+ E F  +G +N +LR F  +ILEA+++   ETI++VL           RG     
Sbjct  259   NRPGKVESFNLSGNKNQYLRGFSENILEASFNTKYETIEKVLLEEQDKESQQPRGQRLQR  318

Query  793   RDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKH-KSVSNNYGQLFEVDND  969
             ++ +  ++VS EQ++ L++ + T    K   SS  +P ++  H    SN +G+ FE+  +
Sbjct  319   QETNALVKVSREQVEELKRLARTSS--KKGVSSEFEPFNLRSHGPKYSNKFGKFFEITPE  376

Query  970   -DFKELGDIEVAFAN--ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSE  1140
               + +L D++++ ++  I  G +  P +N+RA  +  V +GKG  ++   +   Q +R +
Sbjct  377   KKYPQLQDLDISVSSVEINEGALFLPHYNSRAIVVVLVDEGKGNLELVGFKNEQQEQREK  436

Query  1141  E-------GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERV  1299
             E         +  YE   A+L PG + +IP G+P    AS   NL ++ F INA+NN+R 
Sbjct  437   EDEQEERNKQVQRYE---AKLSPGDVVIIPAGHPVAVSAS--SNLNLLGFGINAENNQRN  491

Query  1300  ALAGKNN  1320
              L G ++
Sbjct  492   FLTGSDD  498



>sp|P43238.1|ALL12_ARAHY RecName: Full=Allergen Ara h 1, clone P41B; AltName: Full=Allergen 
Ara h I; AltName: Allergen=Ara h 1; Flags: Precursor [Arachis 
hypogaea]
 gb|AAB00861.1| Ara h I [Arachis hypogaea]
 gb|AAL27476.1| major allergen Arah1 [Arachis hypogaea]
 emb|CCW28826.1| seed storage protein Ara h1 [Arachis hypogaea]
Length=626

 Score =   176 bits (446),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 120/415 (29%), Positives = 214/415 (52%), Gaps = 42/415 (10%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F  R F T + +Q GR  VL RF +RS QF+ ++N R   +E +  T V P H D
Sbjct  172   NNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPKHAD  231

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD I ++ +G+ T+ +   N +KS+++  G  + IP+G  SY++N  +N  L + K+   
Sbjct  232   ADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKISMP  291

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL-----------RGR-  795
             ++TPG+FE FF      ++S+L+ F  + LEAA++     I+RVL           RG+ 
Sbjct  292   VNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEERGQR  351

Query  796   ---------DDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSS-SKPVDIFK-HKSVSNNY  942
                      ++   ++VS E ++ L K + ++    +++    + P+++ +    +SNN+
Sbjct  352   RWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNF  411

Query  943   GQLFEVDNDDFK-ELGDIEVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ  1113
             G+LFEV  D    +L D+++      I  G ++ P FN++A  +  V  G G  ++   +
Sbjct  412   GKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVR  471

Query  1114  VSSQTERSEEGAIPT----------YETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIV  1263
                Q     E                    A+L+ G +F++P  +P    AS +  L ++
Sbjct  472   KEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE--LHLL  529

Query  1264  CFDINADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFS  1425
              F INA+NN R+ LAG K+N+   ++  AK+++F  S + V+K+ +N  +    S
Sbjct  530   GFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVS  584



>ref|XP_003624150.1| Convicilin [Medicago truncatula]
 gb|ABD28365.1| Cupin, RmlC-type [Medicago truncatula]
 gb|AES80368.1| vicilin 47 kDa protein [Medicago truncatula]
Length=464

 Score =   173 bits (439),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 131/424 (31%), Positives = 220/424 (52%), Gaps = 40/424 (9%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESK--TFVAPNH  474
             +NP+ F    F+T   ++ G   +L RF +RS  FE ++N+R  +LE  SK  T   P H
Sbjct  33    ENPFFFNANRFQTLFENENGHIRLLQRFDKRSKIFENLQNYR--LLEYHSKPHTLFLPQH  90

Query  475   LDADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLI  654
              DAD I  V  G+  L ++  N + S+++  G  + +PAG+ +YL N D+N  L ++ L 
Sbjct  91    NDADFILAVLSGKAILTVLNPNNRNSFNLERGDTIKLPAGSIAYLANRDDNQDLRVLDLA  150

Query  655   QTISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL----------RGR  795
               ++ PG+F+ F  +G   + SF   F  +ILEAA++ + E I+RVL          RG 
Sbjct  151   IPVNRPGQFQSFSLSGSQNQQSFFSGFSKNILEAAFNANYEEIERVLIEEQEQDPHRRGL  210

Query  796   DD---------SPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSV-SNNYG  945
              D         +  ++VS EQ++ L + + +    +   SS S P ++   K + SN +G
Sbjct  211   RDRRHKQSQEANVIVKVSREQIEELSRHAKSSSS-RRSASSESAPFNLRSRKPIYSNEFG  269

Query  946   QLFEVDNDDFKELGDIEVAFAN--ITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQ--  1113
               FE+  +  ++L D+++   N  I  G +L P FN+RAT +  V +GKG  ++   +  
Sbjct  270   NFFEITPEKNQQLQDLDILVTNAEIREGSLLLPHFNSRATVIVVVDEGKGEFELVGQRNE  329

Query  1114  -----VSSQTERSEEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDIN  1278
                     + +  EE      +   A+L PG ++VIP G P V  AS D  L ++ F IN
Sbjct  330   NQQEQREYEEDEQEEERSQQVQRYRARLTPGDVYVIPAGYPNVVKASSD--LSLLGFGIN  387

Query  1279  ADNNERVALAG-KNNLYSNMDDVAKEVSFGVSSKLVDKVFENDDDLELFSKGPEWQQSED  1455
             A+NN+R  LAG ++N+ S +    KE++F  S++ V+ + +N       +  P+ ++ E+
Sbjct  388   AENNQRSFLAGEEDNVISQIQRPVKELAFPGSAQDVESLLKNQRQSYFANAQPQQREREE  447

Query  1456  RADQ  1467
                Q
Sbjct  448   GRSQ  451



>emb|CAP06327.1| cvc [Vicia bithynica]
Length=557

 Score =   175 bits (443),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 196/359 (55%), Gaps = 27/359 (8%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP+ F+   F T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H++A
Sbjct  205   NPFYFESNKFLTLFENENGHIRLLQRFDKRSDLFENLQNYRLVEYRAKPHTIFLPQHIEA  264

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             DLI +V  G   L ++  N + SY++  G  + +PAG TS+LVN D+   L +  L  ++
Sbjct  265   DLILVVLSGRAILTVLSPNDRNSYNLERGDTIKLPAGTTSHLVNQDDEEDLRVADLAISV  324

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVL--------------RGRD  798
               PG+ E F  +G +N +LR F  +ILEA+++ + ETI++VL              + ++
Sbjct  325   DRPGKVESFLLSGNKNQYLRGFSKNILEASFNTNYETIEKVLLEEQGKEPQQSRRSQRQE  384

Query  799   DSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVDND-D  972
              +  ++ S EQ++ L++ + +    K   SS  +P+++  ++   SN +G+LFE+  +  
Sbjct  385   TNALVKASREQIEELKRLAKS--SSKEGLSSQFEPINLRSQNPKYSNKFGKLFEITPEKK  442

Query  973   FKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEE-  1143
             + +L D++  V+  +I  G ++ P +N+RA  +  V +G+G  ++   +   Q +R +  
Sbjct  443   YPQLQDLDIFVSSVDIKEGALMLPHYNSRAIVVLLVNEGRGNLELVGLKNEQQEQREKRN  502

Query  1144  GAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNN  1320
               +  YE   A+L PG + +IP G+P    AS   NL ++ F IN +NN+R  L G ++
Sbjct  503   NQLQRYE---ARLSPGDVVIIPAGHPVAVSAS--SNLNLLAFGINGENNQRNFLTGSDD  556



>emb|CAP06332.1| convicilin [Vicia ervilia]
Length=540

 Score =   173 bits (439),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 192/358 (54%), Gaps = 26/358 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+  +F T   ++ G   +L RF +RS+ FE ++N+R      +  T   P H+DA
Sbjct  183   NPFLFKSNNFLTVFENENGYMRLLQRFDKRSDLFENLQNYRLTEYRSKPHTIFLPQHIDA  242

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             + I +V  G+  L ++  N + SY++  G  + +PAG T+Y+VN D+   L +I L+  +
Sbjct  243   EFILVVLSGKAILTVLSPNNRNSYNLERGDTIKLPAGTTAYIVNGDDEEDLRVIDLVIPV  302

Query  664   STPGRFEFFFGTG-RNSFLRAFKSSILEAAYDESKETIQRVL-------RGRDDSPFIQV  819
             + PG FE F  +G +   LR F  +ILEA+ +   ETI++VL       R     P ++V
Sbjct  303   NRPGEFEAFDLSGSKKQSLRGFSKNILEASLNTKYETIEKVLLEDPQQHRRGQAKPIVKV  362

Query  820   SDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVD-NDDFKELGDI  993
             S +Q++ LR  + +    +   SS  +P+++  ++   SN +G+LFE+     + ++ D+
Sbjct  363   SRKQIEELRNHAKSS--SRKSLSSEFEPINLRSQNPEYSNEFGKLFEITPQKKYPQVQDL  420

Query  994   EVAFA--NITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYE-  1164
             +++ +  +I  G +L P +N+RA  +  V +GKG  ++   +   Q +R +EG     E 
Sbjct  421   DISVSSVDIKEGALLLPHYNSRAITVLLVNEGKGNLELVGFKNEEQEQREKEGEQQERED  480

Query  1165  ---------TVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG  1311
                         A L PG + VIP G+P    AS   NL ++ F INA NN+R  L+G
Sbjct  481   EKERNKQVQRYEANLSPGDVVVIPAGHPVAISAS--SNLNLLGFGINAGNNQRNFLSG  536



>ref|XP_003536525.1| PREDICTED: beta-conglycinin, alpha chain-like [Glycine max]
Length=584

 Score =   173 bits (439),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 191/370 (52%), Gaps = 21/370 (6%)
 Frame = +1

Query  301   DNPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLD  480
             +NP+ F    F+T  ++Q G   VL RF +RS Q E + ++R   L  +  T   P+H D
Sbjct  190   NNPFHFSSNRFQTLFKNQHGHLRVLQRFDQRSPQLENLRDYRVVELMAKPNTLFLPHHAD  249

Query  481   ADLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQT  660
             AD + LV  G   +++++ + +  Y +  G    IPAG T YLVN D    L +IKL   
Sbjct  250   ADFLLLVLSGRALINLVKPDDRDPYYLDRGYAQRIPAGTTVYLVNPDKKKDLRVIKLAIP  309

Query  661   ISTPGRFEFFFGTG---RNSFLRAFKSSILEAAYDESKETIQRVL------RGRDDSPFI  813
             ++ PG FE FF +    + S+L+ F  +ILEA+++   E I RVL      R + +   +
Sbjct  310   VNKPGNFEDFFLSSTQDQQSYLQGFSENILEASFNTKFEEINRVLFGGEGRRHQQEGVIL  369

Query  814   QVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDIFKHKSVSNNYGQLFEVDNDDFKELGDI  993
             ++S EQ++ L K + +    ++  S   +P  +   +  SNN+G+ +E+  +   +L D 
Sbjct  370   ELSKEQIRELSKRAKSSS--RSTNSFDYEPFYLRGSQISSNNFGKFYEITPEKNPQLRDF  427

Query  994   EVAF--ANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPTYET  1167
             ++     +I  GG+L P +N++A  +  V +G+   ++   +   Q E + E        
Sbjct  428   DILLNTVDINEGGLLLPHYNSKAIVILMVTEGEANIELVGLKEQQQGEETRE-----VRK  482

Query  1168  VNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAG-KNNLYSNMDDV  1344
               A+L    +FVIP   P+V  A+   NL  V F INA+NN+R  LAG K+N+   +   
Sbjct  483   YRAELSEDDIFVIPAAYPFVVNAT--SNLNFVAFGINAENNQRNFLAGSKDNVIRQIQKQ  540

Query  1345  AKEVSFGVSS  1374
              KE++F   S
Sbjct  541   VKELAFPAGS  550



>ref|XP_009413946.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=330

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 161/262 (61%), Gaps = 16/262 (6%)
 Frame = +1

Query  682   EFFFGTGRN--SFLRAFKSSILEAAYDESKETIQRVLRGRDDSPFIQVSDEQLKSLRKES  855
             E+    GRN  +F  +F + +LEAA++   + + RV R +     I+++++Q+++L +  
Sbjct  54    EYHGAAGRNPQTFYTSFSNEVLEAAFNTPWDKLGRVFRSQRKGEIIKITEDQIRALNESK  113

Query  856   DTIWPFKTDKSSSSKPVDIFKHK-SVSNNYGQLFEVDNDDFKELGD--IEVAFANITRGG  1026
                WPF      S++P ++ ++  S SN +GQ+ E   ++ + L D  ++V+ ANI+   
Sbjct  114   TESWPFGL----SNEPYNLLENNPSHSNEHGQIHEATGNECEMLQDLNVDVSIANISERS  169

Query  1027  MLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERSEEGAIPT------YETVNAQLRP  1188
             M+ P ++TR+TKLA VV+G+G+ +MACP  S++  R++E +         Y TV +++  
Sbjct  170   MMAPNYDTRSTKLAMVVEGRGYIEMACPHRSAERRRTQEESGSQGEQRVRYRTVRSRVSR  229

Query  1189  GTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKNNLYSNMDDVAKEVSFGV  1368
             G++FVIP G+P   +A+ ++NLQ++CF I ++NN R  LAG+NN+ + +D  AK ++FGV
Sbjct  230   GSVFVIPAGHPAAVVAAANENLQVLCFGIRSENNRRYYLAGRNNVLNRLDRAAKAMAFGV  289

Query  1369  SSKLVDKVFENDDDLELFSKGP  1434
              ++ V++V  N     +F  GP
Sbjct  290   PAEEVEEVL-NAQPESVFMPGP  310



>emb|CAP06309.1| convicilin [Lens nigricans]
Length=515

 Score =   171 bits (434),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/361 (30%), Positives = 191/361 (53%), Gaps = 26/361 (7%)
 Frame = +1

Query  304   NPYVFQPRHFRTAHRSQQGRFSVLPRFTERSNQFEGIENFRFGILEVESKTFVAPNHLDA  483
             NP++F+   F T   ++ G    L RF +RS+ FE ++N+R      +  +   P H+DA
Sbjct  158   NPFLFKSNKFLTLFENENGHIRRLQRFDKRSDLFENLQNYRLVEYRAKPHSIFLPQHIDA  217

Query  484   DLIGLVAEGEGTLDIIQKNKKKSYDIRVGSIVFIPAGATSYLVNTDNNNKLVIIKLIQTI  663
             D I +V  G+  L ++  N + SY++  G  + IPAG TSYLVN D+   L ++  + ++
Sbjct  218   DFIVVVLNGKAILAVLSPNDRNSYNLERGDAIKIPAGTTSYLVNQDDEEDLRVVDFVISL  277

Query  664   STPGRFEFF-FGTGRNSFLRAFKSSILEAAYDESKETIQRVL-----------------R  789
             + PG FE F     R  +LR F  S+LEA+ +   +TI++VL                 +
Sbjct  278   NRPGEFEAFDLSANRRQYLRGFSKSVLEASLNTKYDTIEKVLLEEQEREPHQRRDRKGRQ  337

Query  790   GRDDSPFIQVSDEQLKSLRKESDTIWPFKTDKSSSSKPVDI-FKHKSVSNNYGQLFEVDN  966
             G++    ++VS EQ++ LR+ + +    K    S  +P ++  ++   SN +G+ FEV  
Sbjct  338   GQEPHAIVKVSREQIEELRRLAKSS--SKKSLPSEFEPSNLRSQNPKYSNKFGKFFEVTP  395

Query  967   D-DFKELGDIE--VAFANITRGGMLGPLFNTRATKLAFVVDGKGWAQMACPQVSSQTERS  1137
             +  + +L D++  V+   I  GG+L P +N+R T +  V +GKG  ++A  +   +    
Sbjct  396   EKKYPQLQDLDLLVSSVEINEGGLLLPHYNSRTTVVLLVTEGKGNLELAGFKNEQEERED  455

Query  1138  EEGAIPTYETVNAQLRPGTLFVIPPGNPYVSIASQDDNLQIVCFDINADNNERVALAGKN  1317
              +      +   A+L  G + +IP G+P VSI++   NL ++ F INA+NN+R  L G +
Sbjct  456   NKERNNQVQRCEARLSAGDVVIIPAGHP-VSISA-TSNLNLLGFGINAENNQRNFLTGSD  513

Query  1318  N  1320
             +
Sbjct  514   D  514



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8050081859296