BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77650_g1_i1 len=930 path=[1:0-929]

Length=930
                                                                      Score     E

ref|XP_010066270.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    150   2e-38   
gb|AHH32689.1|  xylanase 3                                              150   4e-38   
ref|XP_004147070.1|  PREDICTED: endo-1,4-beta-xylanase C-like           151   6e-38   
ref|XP_004169878.1|  PREDICTED: endo-1,4-beta-xylanase C-like           151   6e-38   
gb|KGN61918.1|  hypothetical protein Csa_2G264620                       151   7e-38   
ref|XP_010315368.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    150   9e-38   
ref|XP_004500734.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    150   1e-37   
ref|XP_010066269.1|  PREDICTED: uncharacterized protein LOC104453...    150   1e-37   
ref|XP_010315367.1|  PREDICTED: endo-1,4-beta-xylanase UM03411 is...    150   1e-37   
ref|XP_008788407.1|  PREDICTED: endo-1,4-beta-xylanase A-like           150   1e-37   
ref|XP_004231450.1|  PREDICTED: endo-1,4-beta-xylanase UM03411 is...    150   2e-37   
ref|XP_009400614.1|  PREDICTED: uncharacterized protein LOC103984779    150   2e-37   
ref|XP_006359674.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    149   2e-37   
ref|XP_006367794.1|  PREDICTED: uncharacterized protein LOC102602944    149   2e-37   
ref|XP_010327543.1|  PREDICTED: endo-1,4-beta-xylanase A-like           148   5e-37   
ref|XP_008457673.1|  PREDICTED: uncharacterized protein LOC103497316    148   9e-37   
gb|KEH36384.1|  glycosyl hydrolase family 10 protein                    147   9e-37   
gb|KEH36385.1|  glycosyl hydrolase family 10 protein                    147   9e-37   
ref|XP_011088588.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    147   1e-36   
gb|AES74285.2|  glycosyl hydrolase family 10 protein                    147   2e-36   
ref|XP_003604034.1|  Endo-1,4-beta-xylanase A                           147   2e-36   
ref|XP_011088586.1|  PREDICTED: uncharacterized protein LOC105169...    147   2e-36   
ref|XP_010920164.1|  PREDICTED: uncharacterized protein LOC105044067    146   3e-36   
ref|XP_010436963.1|  PREDICTED: uncharacterized protein LOC104720...    146   3e-36   
ref|XP_010436964.1|  PREDICTED: uncharacterized protein LOC104720...    146   3e-36   
ref|XP_011088587.1|  PREDICTED: uncharacterized protein LOC105169...    146   3e-36   
ref|XP_010446374.1|  PREDICTED: uncharacterized protein LOC104729170    146   4e-36   
ref|XP_010646993.1|  PREDICTED: probable endo-1,4-beta-xylanase C       146   4e-36   
ref|XP_007041881.1|  Glycosyl hydrolase family 10 protein isoform 2     144   4e-36   
ref|XP_009761415.1|  PREDICTED: uncharacterized protein LOC104213...    145   5e-36   
emb|CBI37893.3|  unnamed protein product                                146   5e-36   
ref|XP_009761414.1|  PREDICTED: uncharacterized protein LOC104213...    145   6e-36   
ref|XP_009761411.1|  PREDICTED: uncharacterized protein LOC104213...    145   7e-36   
ref|XP_008661494.1|  PREDICTED: uncharacterized protein LOC100216...    145   8e-36   
ref|XP_006422632.1|  hypothetical protein CICLE_v10028121mg             145   8e-36   
ref|XP_009799022.1|  PREDICTED: endo-1,4-beta-xylanase A-like           145   1e-35   
ref|XP_007041880.1|  Glycosyl hydrolase family 10 protein isoform 1     145   1e-35   
ref|XP_010934099.1|  PREDICTED: endo-1,4-beta-xylanase-like             145   1e-35   
gb|KDO68006.1|  hypothetical protein CISIN_1g035723mg                   144   1e-35   
ref|XP_007201160.1|  hypothetical protein PRUPE_ppa004290mg             144   1e-35   
ref|XP_008235994.1|  PREDICTED: probable endo-1,4-beta-xylanase C       144   1e-35   
ref|XP_010246857.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    142   1e-35   
ref|XP_011092889.1|  PREDICTED: endo-1,4-beta-xylanase 1 isoform X2     144   2e-35   
ref|XP_004969072.1|  PREDICTED: uncharacterized protein LOC101763135    144   2e-35   
ref|XP_011092888.1|  PREDICTED: uncharacterized protein LOC105172...    144   2e-35   
ref|XP_009622124.1|  PREDICTED: LOW QUALITY PROTEIN: probable end...    142   2e-35   
ref|XP_008781049.1|  PREDICTED: endo-1,4-beta-xylanase-like             144   2e-35   
ref|XP_006486857.1|  PREDICTED: uncharacterized protein LOC102613106    144   2e-35   
ref|XP_010090320.1|  Endo-1,4-beta-xylanase A                           144   3e-35   
ref|XP_008349367.1|  PREDICTED: probable endo-1,4-beta-xylanase C       143   4e-35   
ref|NP_001055145.1|  Os05g0304900                                       142   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010431807.1|  PREDICTED: uncharacterized protein LOC104716145    143   5e-35   
ref|XP_009628229.1|  PREDICTED: uncharacterized protein LOC104118...    142   5e-35   
ref|NP_001152556.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    142   6e-35   Zea mays [maize]
emb|CDO96932.1|  unnamed protein product                                142   6e-35   
ref|XP_009109536.1|  PREDICTED: uncharacterized protein LOC103835171    142   6e-35   
gb|EEC78941.1|  hypothetical protein OsI_19385                          142   7e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_009628227.1|  PREDICTED: uncharacterized protein LOC104118...    142   7e-35   
ref|XP_009615209.1|  PREDICTED: endo-1,4-beta-xylanase A-like           142   7e-35   
ref|XP_009628223.1|  PREDICTED: uncharacterized protein LOC104118...    142   8e-35   
ref|XP_007137357.1|  hypothetical protein PHAVU_009G120500g             142   8e-35   
ref|XP_009628228.1|  PREDICTED: uncharacterized protein LOC104118...    142   8e-35   
ref|XP_010246856.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    142   8e-35   
emb|CDX90288.1|  BnaA08g16960D                                          142   8e-35   
ref|XP_006283442.1|  hypothetical protein CARUB_v10004489mg             140   9e-35   
ref|XP_006652135.1|  PREDICTED: uncharacterized protein LOC102708887    142   1e-34   
gb|EEE63172.1|  hypothetical protein OsJ_17981                          142   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002306176.2|  hypothetical protein POPTR_0004s17900g             142   1e-34   Populus trichocarpa [western balsam poplar]
gb|KHN20002.1|  Endo-1,4-beta-xylanase A                                142   1e-34   
ref|XP_009340235.1|  PREDICTED: probable endo-1,4-beta-xylanase C       142   1e-34   
ref|XP_006581102.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    142   1e-34   
ref|XP_011001985.1|  PREDICTED: endo-1,4-beta-xylanase F1-like is...    141   1e-34   
ref|XP_011001986.1|  PREDICTED: endo-1,4-beta-xylanase F1-like is...    141   1e-34   
ref|XP_006411655.1|  hypothetical protein EUTSA_v10024805mg             141   2e-34   
ref|XP_011013611.1|  PREDICTED: endo-1,4-beta-xylanase A-like           141   2e-34   
gb|KHG02946.1|  Endo-1,4-beta-xylanase A                                141   2e-34   
ref|XP_011001984.1|  PREDICTED: endo-1,4-beta-xylanase A-like iso...    141   2e-34   
ref|XP_010690393.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    140   2e-34   
ref|XP_011001983.1|  PREDICTED: endo-1,4-beta-xylanase A-like iso...    141   2e-34   
ref|XP_006283441.1|  hypothetical protein CARUB_v10004489mg             141   2e-34   
ref|XP_009349686.1|  PREDICTED: probable endo-1,4-beta-xylanase C       141   2e-34   
emb|CDO96931.1|  unnamed protein product                                142   2e-34   
gb|EMS66498.1|  Endo-1,4-beta-xylanase Z                                141   2e-34   
ref|XP_004292166.1|  PREDICTED: endo-1,4-beta-xylanase-like             140   3e-34   
ref|XP_010690392.1|  PREDICTED: endo-1,4-beta-xylanase 5 isoform X1     140   3e-34   
ref|XP_006343478.1|  PREDICTED: uncharacterized protein LOC102583591    140   5e-34   
ref|XP_003581580.1|  PREDICTED: uncharacterized protein LOC100828464    140   5e-34   
gb|EMT25110.1|  Endo-1,4-beta-xylanase Z                                140   6e-34   
ref|XP_010531544.1|  PREDICTED: uncharacterized protein LOC104807819    140   6e-34   
ref|XP_008372900.1|  PREDICTED: probable endo-1,4-beta-xylanase C       139   8e-34   
gb|EPS72309.1|  hypothetical protein M569_02449                         139   1e-33   
ref|XP_002446197.1|  hypothetical protein SORBIDRAFT_06g003350          139   1e-33   Sorghum bicolor [broomcorn]
gb|EYU40424.1|  hypothetical protein MIMGU_mgv1a020606mg                138   2e-33   
ref|XP_002866813.1|  glycosyl hydrolase family 10 protein               137   3e-33   
emb|CAB37521.1|  putative protein                                       137   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006577900.1|  PREDICTED: uncharacterized protein LOC100793558    137   4e-33   
gb|KDO68005.1|  hypothetical protein CISIN_1g036715mg                   135   4e-33   
ref|XP_010313055.1|  PREDICTED: endo-1,4-beta-xylanase C isoform X2     135   6e-33   
ref|NP_195577.2|  glycosyl hydrolase family 10 protein                  136   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002534153.1|  Endo-1,4-beta-xylanase A precursor, putative       135   1e-32   Ricinus communis
ref|XP_006422633.1|  hypothetical protein CICLE_v10030219mg             135   2e-32   
ref|XP_004250707.1|  PREDICTED: uncharacterized protein LOC101263...    135   2e-32   
gb|KDP29627.1|  hypothetical protein JCGZ_18789                         132   1e-31   
ref|XP_002468186.1|  hypothetical protein SORBIDRAFT_01g041310          132   2e-31   Sorghum bicolor [broomcorn]
ref|XP_006851910.1|  hypothetical protein AMTR_s00041p00160040          132   3e-31   
ref|XP_004985034.1|  PREDICTED: uncharacterized protein LOC101776078    132   4e-31   
ref|NP_001049529.1|  Os03g0243700                                       129   1e-30   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA44350.1|  TPA: putative glycosyl hydrolase family 10 protein     129   2e-30   
gb|ABF94922.1|  Glycosyl hydrolase family 10 protein, expressed         129   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001140909.1|  uncharacterized protein LOC100272986 precursor     129   3e-30   Zea mays [maize]
gb|ABF94921.1|  Glycosyl hydrolase family 10 protein, expressed         129   5e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94920.1|  Glycosyl hydrolase family 10 protein, expressed         129   5e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74851.1|  hypothetical protein OsI_10717                          128   2e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_006649724.1|  PREDICTED: uncharacterized protein LOC102701898    126   3e-29   
ref|XP_002980942.1|  hypothetical protein SELMODRAFT_420481             125   6e-29   
ref|XP_002989316.1|  hypothetical protein SELMODRAFT_129690             125   8e-29   
gb|EMT22806.1|  Endo-1,4-beta-xylanase Z                                124   1e-28   
ref|NP_195543.1|  glycosyl hydrolase family 10 protein                  120   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558355.1|  PREDICTED: uncharacterized protein LOC100841372    122   6e-28   
ref|XP_011002023.1|  PREDICTED: uncharacterized protein LOC105109118    120   6e-27   
ref|XP_011013777.1|  PREDICTED: uncharacterized protein LOC105117723    120   6e-27   
ref|XP_002313182.1|  hypothetical protein POPTR_0009s09080g             119   7e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009783073.1|  PREDICTED: uncharacterized protein LOC104231720    117   6e-26   
ref|XP_011076914.1|  PREDICTED: uncharacterized protein LOC105161047    117   6e-26   
ref|XP_007042651.1|  Glycosyl hydrolase family 10 protein, putative     114   5e-25   
ref|XP_010095699.1|  putative endo-1,4-beta-xylanase C                  115   6e-25   
ref|XP_007201537.1|  hypothetical protein PRUPE_ppa016947mg             113   1e-24   
ref|XP_011013781.1|  PREDICTED: uncharacterized protein LOC105117...    113   1e-24   
ref|XP_008236353.1|  PREDICTED: uncharacterized protein LOC103335128    113   2e-24   
gb|KCW55102.1|  hypothetical protein EUGRSUZ_I01061                     112   2e-24   
ref|XP_011013779.1|  PREDICTED: uncharacterized protein LOC105117...    113   2e-24   
ref|XP_010274480.1|  PREDICTED: endo-1,4-beta-xylanase D-like           113   2e-24   
ref|XP_006651140.1|  PREDICTED: uncharacterized protein LOC102718726    113   2e-24   
ref|XP_008372757.1|  PREDICTED: uncharacterized protein LOC103436117    113   2e-24   
gb|AAN10199.1|  endoxylanase                                            113   2e-24   Carica papaya [mamon]
ref|XP_010030624.1|  PREDICTED: uncharacterized protein LOC104420483    113   2e-24   
gb|ABF94504.1|  Glycosyl hydrolase family 10 protein, expressed         112   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561934.2|  PREDICTED: uncharacterized protein LOC100835383    112   3e-24   
ref|NP_001173303.1|  Os03g0201400                                       110   3e-24   
ref|XP_011002043.1|  PREDICTED: uncharacterized protein LOC105109...    112   4e-24   
ref|XP_011002036.1|  PREDICTED: uncharacterized protein LOC105109...    112   5e-24   
gb|KEH44018.1|  glycosyl hydrolase family 10 protein                    111   5e-24   
gb|KEH44019.1|  glycosyl hydrolase family 10 protein                    111   7e-24   
ref|XP_011092706.1|  PREDICTED: uncharacterized protein LOC105172829    111   9e-24   
ref|XP_002532419.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    110   1e-23   Ricinus communis
ref|XP_010547944.1|  PREDICTED: uncharacterized protein LOC104819...    110   1e-23   
ref|XP_002264837.3|  PREDICTED: uncharacterized protein LOC100266982    110   2e-23   Vitis vinifera
emb|CBI22444.3|  unnamed protein product                                110   2e-23   
ref|XP_010547943.1|  PREDICTED: uncharacterized protein LOC104819...    110   2e-23   
ref|XP_004496874.1|  PREDICTED: endo-1,4-beta-xylanase A-like           110   2e-23   
emb|CDY49377.1|  BnaA03g50660D                                          109   3e-23   
gb|KCW55101.1|  hypothetical protein EUGRSUZ_I01060                     109   3e-23   
ref|XP_002532418.1|  Endo-1,4-beta-xylanase C precursor, putative       109   3e-23   Ricinus communis
ref|XP_009138242.1|  PREDICTED: uncharacterized protein LOC103862300    109   4e-23   
ref|XP_003592508.1|  Endo-1 4-beta-xylanase                             109   4e-23   
ref|XP_010647973.1|  PREDICTED: uncharacterized protein LOC100265242    109   5e-23   
emb|CBI22449.3|  unnamed protein product                                108   5e-23   
ref|XP_004496873.1|  PREDICTED: endo-1,4-beta-xylanase A-like           108   6e-23   
ref|XP_010030623.1|  PREDICTED: uncharacterized protein LOC104420481    109   6e-23   
ref|XP_006346513.1|  PREDICTED: uncharacterized protein LOC102598712    110   6e-23   
emb|CDY48434.1|  BnaA08g11430D                                          108   6e-23   
emb|CDO97285.1|  unnamed protein product                                108   7e-23   
gb|KCW63586.1|  hypothetical protein EUGRSUZ_G01209                     105   7e-23   
ref|XP_002313183.1|  glycosyl hydrolase family 10 family protein        107   9e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006412307.1|  hypothetical protein EUTSA_v10027468mg             108   9e-23   
ref|XP_010691571.1|  PREDICTED: endo-1,4-beta-xylanase-like             108   9e-23   
emb|CDX72430.1|  BnaC07g44520D                                          108   1e-22   
ref|XP_007201097.1|  hypothetical protein PRUPE_ppa024827mg             108   1e-22   
gb|AFW89316.1|  putative glycosyl hydrolase family 10 protein           106   1e-22   
ref|XP_007143119.1|  hypothetical protein PHAVU_007G045400g             107   1e-22   
gb|EYU45207.1|  hypothetical protein MIMGU_mgv1a023132mg                105   2e-22   
ref|XP_003592505.1|  Endo-1,4-beta-xylanase C                           106   2e-22   
gb|ACL53900.1|  unknown                                                 105   2e-22   Zea mays [maize]
gb|EYU39073.1|  hypothetical protein MIMGU_mgv1a025021mg                107   2e-22   
gb|KCW55100.1|  hypothetical protein EUGRSUZ_I01059                     107   2e-22   
ref|XP_002313181.1|  hypothetical protein POPTR_0009s09090g             107   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010030622.1|  PREDICTED: endo-1,4-beta-xylanase-like             107   2e-22   
ref|XP_010274469.1|  PREDICTED: endo-1,4-beta-xylanase D-like           107   2e-22   
ref|XP_004985305.1|  PREDICTED: uncharacterized protein LOC101780535    107   3e-22   
gb|KDP44501.1|  hypothetical protein JCGZ_16334                         107   3e-22   
ref|XP_008346318.1|  PREDICTED: probable endo-1,4-beta-xylanase C       107   3e-22   
gb|EPS58555.1|  hypothetical protein M569_16258                         106   3e-22   
ref|XP_008236310.1|  PREDICTED: uncharacterized protein LOC103335087    106   3e-22   
gb|KFK30010.1|  hypothetical protein AALP_AA7G206100                    106   3e-22   
ref|XP_006283361.1|  hypothetical protein CARUB_v10004408mg             107   3e-22   
ref|XP_009108772.1|  PREDICTED: uncharacterized protein LOC103834458    106   3e-22   
gb|KHG30568.1|  Endo-1,4-beta-xylanase A                                106   4e-22   
ref|XP_008658022.1|  PREDICTED: putative glycosyl hydrolase famil...    106   4e-22   
ref|NP_001241765.1|  1,4-beta-xylanase precursor                        106   4e-22   
gb|AES62756.2|  glycosyl hydrolase family 10 protein                    105   5e-22   
ref|XP_009406783.1|  PREDICTED: endo-1,4-beta-xylanase C-like           106   5e-22   
emb|CDX72434.1|  BnaC07g44560D                                          107   5e-22   
ref|XP_010230224.1|  PREDICTED: uncharacterized protein LOC100827817    105   5e-22   
ref|XP_009406796.1|  PREDICTED: uncharacterized protein LOC103989620    106   5e-22   
ref|XP_008658023.1|  PREDICTED: putative glycosyl hydrolase famil...    105   5e-22   
emb|CDX71170.1|  BnaC07g04490D                                          104   5e-22   
ref|XP_002867152.1|  glycosyl hydrolase family 10 protein               106   5e-22   
ref|XP_009406807.1|  PREDICTED: endo-1,4-beta-xylanase A-like           105   5e-22   
ref|XP_007131684.1|  hypothetical protein PHAVU_011G033100g             105   6e-22   
ref|XP_009138241.1|  PREDICTED: uncharacterized protein LOC103862299    105   6e-22   
ref|NP_001130600.1|  putative glycosyl hydrolase family 10 protein      105   6e-22   Zea mays [maize]
ref|XP_003555995.1|  PREDICTED: uncharacterized protein LOC100777980    105   6e-22   
gb|EMT33548.1|  Endo-1,4-beta-xylanase A                                105   7e-22   
ref|XP_010447190.1|  PREDICTED: uncharacterized protein LOC104729...    105   7e-22   
ref|XP_004292118.1|  PREDICTED: endo-1,4-beta-xylanase A-like           105   7e-22   
emb|CAA19865.1|  putative protein                                       105   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867153.1|  glycosyl hydrolase family 10 protein               105   7e-22   
gb|EYU39071.1|  hypothetical protein MIMGU_mgv1a003597mg                105   7e-22   
ref|NP_195109.2|  Glycosyl hydrolase family 10 protein                  105   7e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AFW89320.1|  putative glycosyl hydrolase family 10 protein           105   8e-22   
ref|XP_010447189.1|  PREDICTED: uncharacterized protein LOC104729...    105   8e-22   
ref|XP_009406772.1|  PREDICTED: endo-1,4-beta-xylanase C-like           105   8e-22   
ref|XP_010447188.1|  PREDICTED: uncharacterized protein LOC104729...    105   9e-22   
ref|XP_010683117.1|  PREDICTED: uncharacterized protein LOC104897858    105   9e-22   
gb|AAQ65190.1|  At2g14690                                               105   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAC69373.1|  1,4-beta-xylan endohydrolase                            105   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375682.1|  PREDICTED: uncharacterized protein LOC103964474    105   1e-21   
emb|CDY28323.1|  BnaC03g66360D                                          105   1e-21   
ref|XP_010111686.1|  Endo-1,4-beta-xylanase C                           105   1e-21   
ref|NP_179076.3|  putative glycosyl hydrolase family 10 protein         105   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299800.1|  hypothetical protein CARUB_v10015996mg             105   1e-21   
gb|KDO57900.1|  hypothetical protein CISIN_1g042396mg                   103   1e-21   
ref|XP_007042653.1|  Glycosyl hydrolase family 10 protein, putative     105   1e-21   
ref|XP_010065888.1|  PREDICTED: uncharacterized protein LOC104453...    105   1e-21   
ref|XP_010065886.1|  PREDICTED: uncharacterized protein LOC104453...    105   1e-21   
ref|XP_006422817.1|  hypothetical protein CICLE_v10030382mg             104   2e-21   
ref|XP_009350581.1|  PREDICTED: endo-1,4-beta-xylanase D-like           104   2e-21   
dbj|BAK07928.1|  predicted protein                                      104   2e-21   
gb|KHN39896.1|  Endo-1,4-beta-xylanase C                                104   2e-21   
ref|XP_006591552.1|  PREDICTED: uncharacterized protein LOC100775814    104   3e-21   
ref|XP_006487065.1|  PREDICTED: uncharacterized protein LOC102624921    103   3e-21   
ref|XP_009375680.1|  PREDICTED: uncharacterized protein LOC103964472    103   3e-21   
gb|EYU39074.1|  hypothetical protein MIMGU_mgv1a019481mg                103   3e-21   
ref|XP_010065885.1|  PREDICTED: uncharacterized protein LOC104453...    103   3e-21   
ref|XP_010065884.1|  PREDICTED: uncharacterized protein LOC104453...    103   3e-21   
ref|XP_010673245.1|  PREDICTED: uncharacterized protein LOC104889668    103   3e-21   
gb|KHN39897.1|  Endo-1,4-beta-xylanase C                                102   4e-21   
ref|XP_010065883.1|  PREDICTED: uncharacterized protein LOC104453076    103   4e-21   
emb|CDY49378.1|  BnaA03g50670D                                          103   4e-21   
gb|KCW63584.1|  hypothetical protein EUGRSUZ_G01206                     103   4e-21   
gb|KFK40660.1|  hypothetical protein AALP_AA2G025200                    102   4e-21   
ref|XP_002264605.1|  PREDICTED: uncharacterized protein LOC100242953    103   4e-21   Vitis vinifera
ref|XP_003592507.1|  Endo-1,4-beta-xylanase A                           103   5e-21   
gb|AES62758.2|  glycosyl hydrolase family 10 protein                    103   5e-21   
ref|XP_010496774.1|  PREDICTED: uncharacterized protein LOC104773...    103   5e-21   
ref|XP_002867154.1|  glycosyl hydrolase family 10 protein               103   5e-21   
ref|XP_007143125.1|  hypothetical protein PHAVU_007G045900g             103   6e-21   
ref|XP_010496773.1|  PREDICTED: uncharacterized protein LOC104773...    103   6e-21   
ref|XP_002468320.1|  hypothetical protein SORBIDRAFT_01g043760          103   6e-21   Sorghum bicolor [broomcorn]
emb|CAN61986.1|  hypothetical protein VITISV_034670                     100   6e-21   Vitis vinifera
ref|XP_003621871.1|  Endo-1,4-beta-xylanase C                           102   6e-21   
ref|XP_004169732.1|  PREDICTED: endo-1,4-beta-xylanase Z-like           102   7e-21   
ref|XP_006487064.1|  PREDICTED: uncharacterized protein LOC102624641    102   7e-21   
ref|XP_010437715.1|  PREDICTED: uncharacterized protein LOC104721...    102   7e-21   
ref|XP_010437713.1|  PREDICTED: uncharacterized protein LOC104721...    102   7e-21   
emb|CAA19864.1|  putative protein                                       102   7e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KEH30535.1|  glycosyl hydrolase family 10 protein                    102   7e-21   
ref|NP_001173304.1|  Os03g0201901                                       101   7e-21   
ref|XP_004289778.1|  PREDICTED: LOW QUALITY PROTEIN: endo-1,4-bet...    100   8e-21   
ref|XP_007042652.1|  Glycosyl hydrolase family 10 protein               102   8e-21   
ref|XP_002885933.1|  endo-1,4-beta-xylanase/ hydrolase, hydrolyzi...    102   8e-21   
ref|XP_004137084.1|  PREDICTED: endo-1,4-beta-xylanase Z-like           102   8e-21   
gb|KGN43847.1|  hypothetical protein Csa_7G071360                       102   8e-21   
emb|CAB80099.1|  putative protein                                       102   8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006590847.1|  PREDICTED: LOW QUALITY PROTEIN: endo-1,4-bet...    102   9e-21   
ref|XP_004985301.1|  PREDICTED: uncharacterized protein LOC101779072    102   9e-21   
ref|XP_004490332.1|  PREDICTED: endo-1,4-beta-xylanase A-like           102   9e-21   
ref|XP_006422816.1|  hypothetical protein CICLE_v10028089mg             102   9e-21   
ref|XP_010447186.1|  PREDICTED: uncharacterized protein LOC104729864    102   9e-21   
ref|NP_680761.1|  glycosyl hydrolase family protein                     102   9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451062.1|  PREDICTED: uncharacterized protein LOC104733153    102   9e-21   
gb|KDO57901.1|  hypothetical protein CISIN_1g008838mg                   102   9e-21   
ref|XP_004983257.1|  PREDICTED: uncharacterized protein LOC101782274    102   1e-20   
ref|XP_002601213.1|  hypothetical protein BRAFLDRAFT_81989              102   1e-20   Branchiostoma floridae
emb|CBI22450.3|  unnamed protein product                                103   1e-20   
emb|CDY28325.1|  BnaC03g66340D                                          102   1e-20   
ref|XP_009375672.1|  PREDICTED: endo-1,4-beta-xylanase 2-like           102   1e-20   
gb|EEC74705.1|  hypothetical protein OsI_10421                          102   1e-20   Oryza sativa Indica Group [Indian rice]
gb|ABF94510.1|  1,4-beta-xylanase, putative, expressed                  102   1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006412306.1|  hypothetical protein EUTSA_v10024995mg             101   1e-20   
ref|XP_006841091.1|  hypothetical protein AMTR_s00086p00056140          101   1e-20   
gb|EMS46048.1|  Endo-1,4-beta-xylanase C                                102   2e-20   
ref|XP_008787230.1|  PREDICTED: endo-1,4-beta-xylanase D-like           101   2e-20   
gb|KEH27913.1|  glycosyl hydrolase family 10 protein                    101   2e-20   
ref|XP_009406758.1|  PREDICTED: uncharacterized protein LOC103989595    101   2e-20   
gb|KFK30013.1|  hypothetical protein AALP_AA7G206400                    101   2e-20   
ref|XP_010451108.1|  PREDICTED: uncharacterized protein LOC104733204    101   2e-20   
ref|XP_009102314.1|  PREDICTED: uncharacterized protein LOC103828470    101   2e-20   
ref|XP_010437710.1|  PREDICTED: uncharacterized protein LOC104721430    101   2e-20   
ref|XP_010315493.1|  PREDICTED: uncharacterized protein LOC101254346    101   2e-20   
ref|XP_010432505.1|  PREDICTED: uncharacterized protein LOC104716768    101   2e-20   
ref|XP_010447187.1|  PREDICTED: uncharacterized protein LOC104729865    101   2e-20   
ref|XP_010488907.1|  PREDICTED: uncharacterized protein LOC104766677    101   2e-20   
ref|XP_009758358.1|  PREDICTED: uncharacterized protein LOC104211061    101   3e-20   
ref|XP_002867155.1|  glycosyl hydrolase family 10 protein               100   3e-20   
ref|XP_006360395.1|  PREDICTED: putative endoglucanase type F-like      100   3e-20   
ref|XP_010647914.1|  PREDICTED: uncharacterized protein LOC100248080    100   3e-20   
emb|CDY48433.1|  BnaA08g11420D                                          100   3e-20   
ref|XP_006651142.1|  PREDICTED: uncharacterized protein LOC102719572    100   3e-20   
emb|CDY69164.1|  BnaAnng29520D                                          100   3e-20   
ref|XP_008345163.1|  PREDICTED: uncharacterized protein LOC103408077    100   3e-20   
ref|XP_004292122.1|  PREDICTED: endo-1,4-beta-xylanase A-like           101   3e-20   
ref|XP_009108857.1|  PREDICTED: uncharacterized protein LOC103834542    100   4e-20   
ref|XP_006285354.1|  hypothetical protein CARUB_v10006745mg             100   4e-20   
dbj|BAJ94973.1|  predicted protein                                      100   4e-20   
ref|NP_195107.2|  glycosyl hydrolase family protein                     100   4e-20   
ref|XP_008648082.1|  PREDICTED: xylanase1 isoform X1                    100   4e-20   
tpg|DAA46846.1|  TPA: xylanase1                                         100   4e-20   
emb|CAA20594.1|  beta-xylan endohydrolase-like protein                  100   5e-20   
ref|XP_002867151.1|  glycosyl hydrolase family 10 protein               100   5e-20   
ref|NP_195110.3|  Glycosyl hydrolase family 10 protein                  100   5e-20   
ref|XP_009596823.1|  PREDICTED: uncharacterized protein LOC104092845    100   5e-20   
ref|XP_010431685.1|  PREDICTED: uncharacterized protein LOC104716033    100   6e-20   
emb|CAA19866.1|  putative protein                                       100   6e-20   
gb|AAM08566.1|AC092749_19  Putative 1,4-beta-xylanase                 99.8    7e-20   
ref|XP_002461545.1|  hypothetical protein SORBIDRAFT_02g004490        99.8    7e-20   
ref|NP_001064415.1|  Os10g0351700                                     99.8    8e-20   
gb|EEC66792.1|  hypothetical protein OsI_33191                        99.8    8e-20   
gb|KFK39976.1|  hypothetical protein AALP_AA3G313800                  99.4    8e-20   
ref|XP_010436270.1|  PREDICTED: uncharacterized protein LOC104719990  99.8    8e-20   
ref|XP_009108771.1|  PREDICTED: uncharacterized protein LOC103834457  99.8    8e-20   
ref|XP_010437712.1|  PREDICTED: uncharacterized protein LOC104721432  99.4    1e-19   
gb|KCW63583.1|  hypothetical protein EUGRSUZ_G01205                   99.0    1e-19   
ref|XP_004296033.1|  PREDICTED: endo-1,4-beta-xylanase A-like         99.0    1e-19   
ref|XP_006346512.1|  PREDICTED: uncharacterized protein LOC102598373  99.4    1e-19   
ref|XP_010068352.1|  PREDICTED: uncharacterized protein LOC104455228  99.4    1e-19   
ref|XP_010228324.1|  PREDICTED: uncharacterized protein LOC100828321  99.0    1e-19   
gb|KCW63591.1|  hypothetical protein EUGRSUZ_G01217                   99.0    1e-19   
gb|KCW63587.1|  hypothetical protein EUGRSUZ_G01210                   98.6    1e-19   
ref|XP_011088131.1|  PREDICTED: uncharacterized protein LOC105169440  99.0    1e-19   
ref|XP_010068360.1|  PREDICTED: uncharacterized protein LOC104455238  99.0    1e-19   
gb|EEE58525.1|  hypothetical protein OsJ_09814                        99.8    2e-19   
ref|XP_011002012.1|  PREDICTED: endo-1,4-beta-xylanase 2-like         98.6    2e-19   
emb|CAA19868.1|  putative protein                                     98.6    2e-19   
ref|NP_195112.2|  glycosyl hydrolase family 10 protein                98.6    2e-19   
ref|XP_010065890.1|  PREDICTED: uncharacterized protein LOC104453...  98.6    2e-19   
ref|XP_003592519.1|  Endo-1,4-beta-xylanase A                         98.6    2e-19   
ref|XP_002532417.1|  Endo-1,4-beta-xylanase precursor, putative       95.9    2e-19   
ref|XP_010065889.1|  PREDICTED: uncharacterized protein LOC104453...  98.6    2e-19   
ref|XP_010065891.1|  PREDICTED: uncharacterized protein LOC104453...  98.6    2e-19   
ref|XP_002313180.2|  glycosyl hydrolase family 10 family protein      98.2    2e-19   
ref|XP_010530701.1|  PREDICTED: uncharacterized protein LOC104807213  98.2    2e-19   
emb|CDY28324.1|  BnaC03g66350D                                        98.2    2e-19   
ref|XP_010437711.1|  PREDICTED: uncharacterized protein LOC104721431  98.2    2e-19   
ref|XP_010436271.1|  PREDICTED: uncharacterized protein LOC104719991  98.2    2e-19   
gb|EPS60186.1|  hypothetical protein M569_14617                       96.7    2e-19   
ref|XP_002532422.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  98.2    2e-19   
ref|XP_009778566.1|  PREDICTED: probable endo-1,4-beta-xylanase C     98.2    2e-19   
ref|XP_009598376.1|  PREDICTED: probable endo-1,4-beta-xylanase C     93.6    3e-19   
ref|XP_004292120.1|  PREDICTED: endo-1,4-beta-xylanase A-like         97.8    4e-19   
gb|KHN45114.1|  Endo-1,4-beta-xylanase A                              97.8    4e-19   
ref|XP_007143120.1|  hypothetical protein PHAVU_007G045500g           97.4    5e-19   
ref|XP_008652268.1|  PREDICTED: uncharacterized protein LOC103632224  97.4    5e-19   
gb|KHG02913.1|  endo-1,4-beta-xylanase c                              97.1    5e-19   
ref|NP_001104912.1|  xylanase1                                        94.7    5e-19   
ref|XP_007136802.1|  hypothetical protein PHAVU_009G075400g           96.7    1e-18   
gb|KFK30011.1|  hypothetical protein AALP_AA7G206200                  95.5    1e-18   
ref|XP_002465686.1|  hypothetical protein SORBIDRAFT_01g043730        96.3    1e-18   
ref|XP_003536575.1|  PREDICTED: uncharacterized protein LOC100802367  96.3    1e-18   
gb|ACU19437.1|  unknown                                               96.3    1e-18   
ref|NP_001169055.1|  putative glycosyl hydrolase family 10 protei...  95.9    1e-18   
ref|XP_010315175.1|  PREDICTED: endo-1,4-beta-xylanase C-like         94.7    1e-18   
gb|KHN06813.1|  Endo-1,4-beta-xylanase C                              95.9    1e-18   
ref|XP_006285227.1|  hypothetical protein CARUB_v10006586mg           95.9    2e-18   
ref|XP_010315494.1|  PREDICTED: uncharacterized protein LOC101254648  95.9    2e-18   
ref|XP_011002001.1|  PREDICTED: endo-1,4-beta-xylanase 2-like         95.5    2e-18   
ref|XP_008455522.1|  PREDICTED: uncharacterized protein LOC103495673  95.5    2e-18   
ref|XP_010065892.1|  PREDICTED: uncharacterized protein LOC104453081  95.5    2e-18   
ref|XP_006661710.1|  PREDICTED: uncharacterized protein LOC102721021  95.5    2e-18   
ref|XP_007199168.1|  hypothetical protein PRUPE_ppa021363mg           95.1    2e-18   
ref|XP_008236354.1|  PREDICTED: uncharacterized protein LOC103335129  95.1    2e-18   
ref|WP_038287126.1|  glycoside hydrolase, partial [                   93.6    2e-18   
gb|KGN52750.1|  hypothetical protein Csa_4G000710                     94.7    3e-18   
ref|XP_004150274.1|  PREDICTED: endo-1,4-beta-xylanase A-like         94.7    3e-18   
gb|KCW63590.1|  hypothetical protein EUGRSUZ_G01215                   94.4    3e-18   
ref|XP_010065894.1|  PREDICTED: uncharacterized protein LOC104453082  94.7    3e-18   
ref|XP_004240033.1|  PREDICTED: uncharacterized protein LOC101260730  94.7    4e-18   
ref|XP_010447185.1|  PREDICTED: uncharacterized protein LOC104729863  94.4    4e-18   
ref|XP_008454401.1|  PREDICTED: uncharacterized protein LOC103494817  94.4    4e-18   
gb|EYU38257.1|  hypothetical protein MIMGU_mgv1a004760mg              94.0    5e-18   
ref|XP_006392302.1|  hypothetical protein EUTSA_v10023244mg           94.7    6e-18   
ref|XP_002465685.1|  hypothetical protein SORBIDRAFT_01g043720        93.6    8e-18   
ref|XP_006651141.1|  PREDICTED: uncharacterized protein LOC102719284  93.6    9e-18   
ref|XP_010313152.1|  PREDICTED: uncharacterized protein LOC101264695  94.4    9e-18   
ref|XP_010059839.1|  PREDICTED: uncharacterized protein LOC104447...  94.0    1e-17   
ref|XP_002888217.1|  hypothetical protein ARALYDRAFT_475392           94.0    1e-17   
dbj|GAE87295.1|  endo-1,4-beta-xylanase A precursor [ [               93.2    1e-17   
ref|XP_010059834.1|  PREDICTED: uncharacterized protein LOC104447...  93.6    1e-17   
dbj|BAK07199.1|  predicted protein                                    93.2    1e-17   
ref|XP_010059836.1|  PREDICTED: uncharacterized protein LOC104447...  93.6    1e-17   
gb|AAG50641.1|AC082643_5  xylan endohydrolase isoenzyme, putative     93.6    1e-17   
ref|NP_176133.1|  xylanase 1                                          93.6    1e-17   
ref|XP_001626084.1|  predicted protein                                90.9    1e-17   
gb|AEM36339.1|  At1g58370                                             93.6    1e-17   
gb|EEC74704.1|  hypothetical protein OsI_10420                        92.8    2e-17   
gb|ABF94508.1|  Glycosyl hydrolase family 10 protein, expressed       92.8    2e-17   
gb|ABF94509.1|  Glycosyl hydrolase family 10 protein, expressed       92.4    2e-17   
ref|XP_003571749.1|  PREDICTED: uncharacterized protein LOC100833088  92.4    2e-17   
ref|XP_010418868.1|  PREDICTED: endo-1,4-beta-xylanase C-like         92.0    2e-17   
ref|NP_001049300.1|  Os03g0201800                                     92.4    2e-17   
ref|XP_002988417.1|  hypothetical protein SELMODRAFT_183850           92.8    2e-17   
ref|XP_009337134.1|  PREDICTED: uncharacterized protein LOC103929637  93.2    2e-17   
ref|XP_004986647.1|  PREDICTED: uncharacterized protein LOC101754606  92.0    2e-17   
ref|XP_011088132.1|  PREDICTED: uncharacterized protein LOC105169441  92.0    2e-17   
ref|XP_006578072.1|  PREDICTED: uncharacterized protein LOC100801147  92.0    4e-17   
ref|XP_008236311.1|  PREDICTED: uncharacterized protein LOC103335088  91.7    4e-17   
gb|KHN29740.1|  Endo-1,4-beta-xylanase A                              92.0    4e-17   
ref|XP_006300601.1|  hypothetical protein CARUB_v10019737mg           92.0    4e-17   
gb|EAY88933.1|  hypothetical protein OsI_10417                        91.3    5e-17   
gb|EMS55293.1|  Endo-1,4-beta-xylanase C                              91.3    5e-17   
gb|EYU39067.1|  hypothetical protein MIMGU_mgv1a004157mg              90.9    6e-17   
gb|EPS62016.1|  hypothetical protein M569_12775                       91.7    6e-17   
gb|AAB38390.1|  (1,4)-beta-xylan endohydrolase, isoenzyme X-II        89.4    6e-17   
ref|XP_009361446.1|  PREDICTED: uncharacterized protein LOC103951721  91.7    6e-17   
emb|CDY48844.1|  BnaA09g14690D                                        91.7    6e-17   
ref|XP_006356811.1|  PREDICTED: uncharacterized protein LOC102601527  91.3    7e-17   
gb|EMT05517.1|  Endo-1,4-beta-xylanase Z                              90.9    7e-17   
gb|EYU45206.1|  hypothetical protein MIMGU_mgv1a024427mg              90.5    7e-17   
ref|XP_002979847.1|  hypothetical protein SELMODRAFT_111304           91.3    7e-17   
ref|XP_007199597.1|  hypothetical protein PRUPE_ppa023031mg           90.5    8e-17   
gb|EYU39070.1|  hypothetical protein MIMGU_mgv1a0223221mg             90.1    9e-17   
ref|XP_009113316.1|  PREDICTED: uncharacterized protein LOC103838...  90.9    9e-17   
gb|EMT18889.1|  Endo-1,4-beta-xylanase C                              90.5    1e-16   
ref|XP_010511079.1|  PREDICTED: uncharacterized protein LOC104787239  90.9    1e-16   
ref|XP_004501484.1|  PREDICTED: exoglucanase XynX-like isoform X1     90.5    1e-16   
emb|CDY53797.1|  BnaCnng25660D                                        90.9    1e-16   
ref|WP_003512991.1|  glycoside hydrolase                              90.1    1e-16   
ref|XP_009113315.1|  PREDICTED: uncharacterized protein LOC103838...  90.9    1e-16   
ref|XP_008393673.1|  PREDICTED: uncharacterized protein LOC103455847  90.9    1e-16   
ref|XP_004238054.1|  PREDICTED: uncharacterized protein LOC101247815  90.9    1e-16   
gb|KCW66281.1|  hypothetical protein EUGRSUZ_F00109                   90.5    1e-16   
emb|CAE51307.1|  beta-1,4-xylanase                                    90.1    1e-16   
ref|XP_010458330.1|  PREDICTED: uncharacterized protein LOC104739...  90.9    1e-16   
ref|XP_004252731.1|  PREDICTED: uncharacterized protein LOC101253...  90.5    1e-16   
ref|XP_010059841.1|  PREDICTED: uncharacterized protein LOC104447811  90.5    1e-16   
ref|XP_010458332.1|  PREDICTED: uncharacterized protein LOC104739...  90.5    1e-16   
emb|CAH60862.1|  endo-1,4-beta-xylanase                               89.7    1e-16   
ref|XP_008360966.1|  PREDICTED: uncharacterized protein LOC103424649  90.5    1e-16   
ref|XP_011013782.1|  PREDICTED: endo-1,4-beta-xylanase 2-like         89.7    1e-16   
ref|XP_010314597.1|  PREDICTED: uncharacterized protein LOC101253...  90.1    1e-16   
ref|XP_006351853.1|  PREDICTED: uncharacterized protein LOC102605766  89.4    2e-16   
ref|XP_010544031.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    2e-16   
emb|CAH60863.1|  endo-1,4-beta-xylanase                               89.4    2e-16   
ref|XP_001781282.1|  predicted protein                                89.7    2e-16   
gb|AHH32688.1|  xylanase 2                                            89.4    2e-16   
ref|XP_004292119.1|  PREDICTED: exoglucanase XynX-like                89.4    2e-16   
ref|XP_010943398.1|  PREDICTED: uncharacterized protein LOC105061131  89.4    2e-16   
ref|XP_010490632.1|  PREDICTED: uncharacterized protein LOC104768378  89.7    2e-16   
gb|EYU39076.1|  hypothetical protein MIMGU_mgv1a0048871mg             87.0    2e-16   
gb|KHN37003.1|  Endo-1,4-beta-xylanase A                              89.7    3e-16   
ref|XP_010936208.1|  PREDICTED: uncharacterized protein LOC105055895  89.7    3e-16   
ref|XP_008790429.1|  PREDICTED: uncharacterized protein LOC103707...  89.4    3e-16   
tpg|DAA60497.1|  TPA: putative glycosyl hydrolase family protein      89.0    3e-16   
ref|XP_006601252.1|  PREDICTED: uncharacterized protein LOC100818...  89.4    3e-16   
ref|XP_008790427.1|  PREDICTED: uncharacterized protein LOC103707...  89.7    3e-16   
ref|XP_010315117.1|  PREDICTED: uncharacterized protein LOC101251...  89.0    3e-16   
ref|XP_010315121.1|  PREDICTED: uncharacterized protein LOC101251...  88.6    3e-16   
ref|XP_008220426.1|  PREDICTED: uncharacterized protein LOC103320516  89.4    3e-16   
ref|XP_008790428.1|  PREDICTED: uncharacterized protein LOC103707...  89.4    3e-16   
ref|XP_010315116.1|  PREDICTED: uncharacterized protein LOC101251...  88.6    3e-16   
dbj|BAK06950.1|  predicted protein                                    88.6    3e-16   
ref|XP_004230568.2|  PREDICTED: uncharacterized protein LOC101251...  88.6    3e-16   
ref|XP_003549366.1|  PREDICTED: uncharacterized protein LOC100818...  89.0    3e-16   
ref|XP_003545364.1|  PREDICTED: uncharacterized protein LOC100816...  89.4    3e-16   
ref|XP_010315118.1|  PREDICTED: uncharacterized protein LOC101251...  88.6    4e-16   
ref|XP_008377940.1|  PREDICTED: uncharacterized protein LOC103441016  89.0    4e-16   
ref|XP_010315176.1|  PREDICTED: endo-1,4-beta-xylanase C-like         86.3    4e-16   
gb|EMS65807.1|  Endo-1,4-beta-xylanase Z                              88.6    4e-16   
ref|XP_010941971.1|  PREDICTED: uncharacterized protein LOC105060078  88.6    4e-16   
ref|XP_006596009.1|  PREDICTED: uncharacterized protein LOC100816...  89.0    4e-16   
ref|XP_009764539.1|  PREDICTED: uncharacterized protein LOC104216...  88.6    5e-16   
gb|ABD47727.1|  endo-1,4-beta-xylanase                                85.9    5e-16   
ref|XP_009764538.1|  PREDICTED: uncharacterized protein LOC104216...  88.6    5e-16   
dbj|BAD06323.1|  putative 1,4-beta-xylanase                           88.2    5e-16   
gb|EMT27631.1|  Endo-1,4-beta-xylanase A                              88.2    5e-16   
ref|XP_009791939.1|  PREDICTED: uncharacterized protein LOC104239106  88.2    5e-16   
gb|EYU23792.1|  hypothetical protein MIMGU_mgv1a000981mg              88.6    5e-16   
ref|XP_008796967.1|  PREDICTED: uncharacterized protein LOC103712268  88.2    6e-16   
ref|XP_008652350.1|  PREDICTED: uncharacterized protein LOC103632...  88.6    6e-16   
ref|XP_009613527.1|  PREDICTED: uncharacterized protein LOC104106...  87.8    6e-16   
ref|XP_009774985.1|  PREDICTED: uncharacterized protein LOC104224...  87.8    6e-16   
ref|XP_008652351.1|  PREDICTED: uncharacterized protein LOC103632...  88.2    6e-16   
ref|XP_009761048.1|  PREDICTED: uncharacterized protein LOC104213280  88.2    6e-16   
gb|AAZ79232.1|  putative xylanase Xyn1                                88.2    6e-16   
gb|AAM08565.1|AC092749_18  Putative 1,4-beta-xylanase                 87.8    6e-16   
ref|NP_001064414.1|  Os10g0351600                                     87.8    6e-16   
ref|XP_009774984.1|  PREDICTED: uncharacterized protein LOC104224...  87.8    7e-16   
ref|XP_002889787.1|  glycosyl hydrolase family 10 protein             88.2    7e-16   
ref|XP_009613540.1|  PREDICTED: uncharacterized protein LOC104106...  87.8    7e-16   
ref|XP_008652341.1|  PREDICTED: uncharacterized protein LOC103632...  88.2    7e-16   
gb|EYU18454.1|  hypothetical protein MIMGU_mgv1a021702mg              87.8    7e-16   
gb|EMS47749.1|  Endo-1,4-beta-xylanase C                              87.4    7e-16   
dbj|BAK06212.1|  predicted protein                                    87.4    7e-16   
ref|XP_004956132.1|  PREDICTED: uncharacterized protein LOC101763...  88.2    8e-16   
ref|XP_008652346.1|  PREDICTED: uncharacterized protein LOC103632...  88.2    8e-16   
ref|XP_004956133.1|  PREDICTED: uncharacterized protein LOC101763...  88.2    8e-16   
ref|XP_007225325.1|  hypothetical protein PRUPE_ppa001089mg           87.8    9e-16   
ref|XP_004292783.1|  PREDICTED: uncharacterized protein LOC101304164  87.8    9e-16   
dbj|BAM05669.1|  endo-1,4-beta-xylanase                               85.1    9e-16   
ref|XP_008652345.1|  PREDICTED: uncharacterized protein LOC103632...  87.8    1e-15   



>ref|XP_010066270.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X2 [Eucalyptus 
grandis]
Length=377

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 103/167 (62%), Gaps = 16/167 (10%)
 Frame = +3

Query  267  YKPIPIN--ISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDF  437
            YK  P    I+  I  N   Q WF +R NA VFEN LKW + EP PG  NY I+D+M++F
Sbjct  33   YKDFPFGSAIAKTILGNEAYQSWFVERFNAAVFENELKWYATEPYPGQINYTIADEMLEF  92

Query  438  VTKNKIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNE  581
            +  N+I T GH + W+DP + P W  NL+ P+++            RY+ + +HWDV NE
Sbjct  93   IRANRIVTRGHNIFWEDPKYNPEWVQNLSGPQLESAVDTRIQSLMSRYREEFVHWDVSNE  152

Query  582  LVHYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            ++H+DFYE++L   NA+L+ ++   E DP ATLF+N+F V+E C + 
Sbjct  153  MLHFDFYEQRL-GPNATLHFFQTAHESDPLATLFMNEFNVLETCSDA  198



>gb|AHH32689.1| xylanase 3, partial [Phoenix dactylifera]
Length=460

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 98/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N+  Q WF KR NA VFEN LKW + EP PG  NY ++D++++FV  N
Sbjct  213  PFGSAIAKTILGNTAYQAWFAKRFNAAVFENELKWYTTEPEPGKLNYTLADELLEFVRAN  272

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + PSW  NLT  E            + RYK + +HWDV NE++H+
Sbjct  273  QIVARGHNIFWEDPKYTPSWVQNLTGDELRAAVKSRIDSLLTRYKGEFVHWDVSNEMLHF  332

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NA+ + +   Q+ DP ATLF+NDF V+E C
Sbjct  333  DFYEQRL-GYNATFDFFATAQQSDPYATLFMNDFNVIETC  371



>ref|XP_004147070.1| PREDICTED: endo-1,4-beta-xylanase C-like [Cucumis sativus]
Length=532

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 13/155 (8%)
 Frame = +3

Query  294  SMITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHI  473
            S+I       WF KR NA VFEN LKW + EP PGV NY  +D+M++FV  N+I   GH 
Sbjct  200  SIIGNLPYQDWFVKRFNAAVFENELKWYATEPKPGVLNYTTADRMLEFVRANQITARGHN  259

Query  474  VLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            + W+DP + P W  NLT  E            + RYK++ IHWDV NE++H+DFYE+ L 
Sbjct  260  IFWEDPKYTPLWVQNLTGEELKSAVDSRIKGLLSRYKDEFIHWDVSNEMLHFDFYEKSL-  318

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
             +NA+L+ YK   E DP ATLF+N+F VVE C + 
Sbjct  319  GANATLHFYKTAHEIDPLATLFMNEFNVVETCSDV  353



>ref|XP_004169878.1| PREDICTED: endo-1,4-beta-xylanase C-like, partial [Cucumis sativus]
Length=527

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 13/155 (8%)
 Frame = +3

Query  294  SMITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHI  473
            S+I       WF KR NA VFEN LKW + EP PGV NY  +D+M++FV  N+I   GH 
Sbjct  195  SIIGNLPYQDWFVKRFNAAVFENELKWYATEPKPGVLNYTTADRMLEFVRANQITARGHN  254

Query  474  VLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            + W+DP + P W  NLT  E            + RYK++ IHWDV NE++H+DFYE+ L 
Sbjct  255  IFWEDPKYTPLWVQNLTGEELKSAVDSRIKGLLSRYKDEFIHWDVSNEMLHFDFYEKSL-  313

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
             +NA+L+ YK   E DP ATLF+N+F VVE C + 
Sbjct  314  GANATLHFYKTAHEIDPLATLFMNEFNVVETCSDV  348



>gb|KGN61918.1| hypothetical protein Csa_2G264620 [Cucumis sativus]
Length=556

 Score =   151 bits (381),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 13/155 (8%)
 Frame = +3

Query  294  SMITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHI  473
            S+I       WF KR NA VFEN LKW + EP PGV NY  +D+M++FV  N+I   GH 
Sbjct  224  SIIGNLPYQDWFVKRFNAAVFENELKWYATEPKPGVLNYTTADRMLEFVRANQITARGHN  283

Query  474  VLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            + W+DP + P W  NLT  E            + RYK++ IHWDV NE++H+DFYE+ L 
Sbjct  284  IFWEDPKYTPLWVQNLTGEELKSAVDSRIKGLLSRYKDEFIHWDVSNEMLHFDFYEKSL-  342

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
             +NA+L+ YK   E DP ATLF+N+F VVE C + 
Sbjct  343  GANATLHFYKTAHEIDPLATLFMNEFNVVETCSDV  377



>ref|XP_010315368.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
 ref|XP_010315369.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
 ref|XP_010315370.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
Length=500

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WFK+R NA VFE+ LKW S E   GV NY I DQM++FV KN
Sbjct  160  PFGSAITKTILGNPAYQTWFKERYNAAVFEDELKWYSTENQQGVVNYTIPDQMLEFVRKN  219

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I T GH + W+DP + PSW  NLT P++            ++YKN+ IHWDV NE++HY
Sbjct  220  QIITRGHNIFWEDPRYIPSWVRNLTGPDLKSAVTSRIQSLMNKYKNEFIHWDVDNEMLHY  279

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   N SL  ++  Q+ DP A LF+ND+ VVE C
Sbjct  280  DFYEQRL-GINTSLEFFQTAQQLDPLAKLFMNDYNVVETC  318



>ref|XP_004500734.1| PREDICTED: probable endo-1,4-beta-xylanase C-like [Cicer arietinum]
Length=537

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 98/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  197  PIGSAISKTILGNLPYQDWFVKRFNAAVFENELKWYATEPHEGKINYTISDQMMQFVRAN  256

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            KI   GH + W+DP + P+W  NLT  ++            ++YK + IHWDV NE++H+
Sbjct  257  KIIARGHNIFWEDPKYTPAWVLNLTSTQLQSAINSRIQSLMNQYKQEFIHWDVSNEMLHF  316

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L  +NA+ + ++   E DP ATLF+NDF VVE C
Sbjct  317  DFYEQRL-GTNATFHFFEAAHESDPLATLFMNDFNVVETC  355



>ref|XP_010066269.1| PREDICTED: uncharacterized protein LOC104453421 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64117.1| hypothetical protein EUGRSUZ_G01773 [Eucalyptus grandis]
Length=549

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 103/167 (62%), Gaps = 16/167 (10%)
 Frame = +3

Query  267  YKPIPIN--ISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDF  437
            YK  P    I+  I  N   Q WF +R NA VFEN LKW + EP PG  NY I+D+M++F
Sbjct  205  YKDFPFGSAIAKTILGNEAYQSWFVERFNAAVFENELKWYATEPYPGQINYTIADEMLEF  264

Query  438  VTKNKIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNE  581
            +  N+I T GH + W+DP + P W  NL+ P+++            RY+ + +HWDV NE
Sbjct  265  IRANRIVTRGHNIFWEDPKYNPEWVQNLSGPQLESAVDTRIQSLMSRYREEFVHWDVSNE  324

Query  582  LVHYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            ++H+DFYE++L   NA+L+ ++   E DP ATLF+N+F V+E C + 
Sbjct  325  MLHFDFYEQRL-GPNATLHFFQTAHESDPLATLFMNEFNVLETCSDA  370



>ref|XP_010315367.1| PREDICTED: endo-1,4-beta-xylanase UM03411 isoform X2 [Solanum 
lycopersicum]
Length=533

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WFK+R NA VFE+ LKW S E   GV NY I DQM++FV KN
Sbjct  193  PFGSAITKTILGNPAYQTWFKERYNAAVFEDELKWYSTENQQGVVNYTIPDQMLEFVRKN  252

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I T GH + W+DP + PSW  NLT P++            ++YKN+ IHWDV NE++HY
Sbjct  253  QIITRGHNIFWEDPRYIPSWVRNLTGPDLKSAVTSRIQSLMNKYKNEFIHWDVDNEMLHY  312

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   N SL  ++  Q+ DP A LF+ND+ VVE C
Sbjct  313  DFYEQRL-GINTSLEFFQTAQQLDPLAKLFMNDYNVVETC  351



>ref|XP_008788407.1| PREDICTED: endo-1,4-beta-xylanase A-like [Phoenix dactylifera]
Length=553

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N+  Q WF KR NA VFEN LKW + EP PG  NY ++D +++FV  N
Sbjct  213  PFGSAIAKTILGNTAYQAWFAKRFNAAVFENELKWYTTEPEPGKLNYTLADALLEFVRAN  272

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + PSW  NLT  E            + RYK + +HWDV NE++H+
Sbjct  273  QIVARGHNIFWEDPKYTPSWVQNLTGDELRAAVKSRIDSLLTRYKGEFVHWDVSNEMLHF  332

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NA+ + +   Q+ DP ATLF+NDF V+E C
Sbjct  333  DFYEQRL-GYNATFDFFATAQQSDPYATLFMNDFNVIETC  371



>ref|XP_004231450.1| PREDICTED: endo-1,4-beta-xylanase UM03411 isoform X1 [Solanum 
lycopersicum]
Length=550

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WFK+R NA VFE+ LKW S E   GV NY I DQM++FV KN
Sbjct  210  PFGSAITKTILGNPAYQTWFKERYNAAVFEDELKWYSTENQQGVVNYTIPDQMLEFVRKN  269

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I T GH + W+DP + PSW  NLT P++            ++YKN+ IHWDV NE++HY
Sbjct  270  QIITRGHNIFWEDPRYIPSWVRNLTGPDLKSAVTSRIQSLMNKYKNEFIHWDVDNEMLHY  329

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   N SL  ++  Q+ DP A LF+ND+ VVE C
Sbjct  330  DFYEQRL-GINTSLEFFQTAQQLDPLAKLFMNDYNVVETC  368



>ref|XP_009400614.1| PREDICTED: uncharacterized protein LOC103984779 [Musa acuminata 
subsp. malaccensis]
Length=570

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 101/163 (62%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I++ I  N Q Q WF +R NA VFEN LKW + EP PG  NY ++D+M++FV  N
Sbjct  231  PIGSAIANTILGNKQYQEWFAERFNAAVFENELKWYATEPEPGRLNYTLADEMLEFVVSN  290

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + PSW   L+  +            + RY+ + +HWDV NE++H+
Sbjct  291  QIIARGHNIFWEDPIYTPSWVRKLSGDDLRAAVRSRIESLLSRYRGQFVHWDVSNEMLHF  350

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            DFYE++L  SNAS   ++  Q+ DP ATLF+N+F VVE C + 
Sbjct  351  DFYEQRL-GSNASSEFFRTAQQSDPLATLFMNEFNVVETCSDA  392



>ref|XP_006359674.1| PREDICTED: probable endo-1,4-beta-xylanase C-like isoform X1 
[Solanum tuberosum]
 ref|XP_006359675.1| PREDICTED: probable endo-1,4-beta-xylanase C-like isoform X2 
[Solanum tuberosum]
Length=500

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WFK+R NA VFE+ LKW S EP  G  NY I DQM++FV KN
Sbjct  160  PFGSAITKTILGNPAYQTWFKERFNAAVFEDELKWYSTEPQQGEVNYTIPDQMLEFVRKN  219

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I T GH + W+DP + PSW  NLT  ++            ++YKN+ IHWDV NE++HY
Sbjct  220  QIITRGHNIFWEDPRYIPSWVRNLTGSDLKSAVNSRIQSLMNKYKNEFIHWDVDNEMLHY  279

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L  +N SL  ++  Q+ DP A LF+ND+ VVE C
Sbjct  280  DFYEQRL-GTNTSLEFFQTAQQLDPLAKLFMNDYNVVETC  318



>ref|XP_006367794.1| PREDICTED: uncharacterized protein LOC102602944 [Solanum tuberosum]
Length=541

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 99/160 (62%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR  ATVFEN LKW   EPLPG  NY + DQM+ FV KN
Sbjct  201  PIGTMISRTILGNLPYQEWFLKRFKATVFENELKWYKTEPLPGQFNYTVVDQMMKFVRKN  260

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVDR------------YKNKLIHWDVKNELVHY  593
            K+   GH + W DP +   W  N+T P++ R            Y+N+  HWDV NEL+H+
Sbjct  261  KLIARGHNMFWDDPVYVQDWLENMTAPQLQRAMKSRIKSVMSKYRNEFFHWDVNNELLHF  320

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE+KL    A+L+++K +Q +DP ATLF+N++ +VE+C
Sbjct  321  DFYEKKL-GPKATLDMFKSMQREDPLATLFLNEYNIVERC  359



>ref|XP_010327543.1| PREDICTED: endo-1,4-beta-xylanase A-like [Solanum lycopersicum]
Length=488

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 99/160 (62%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I EN   Q WF KR  ATVFEN LKW   EPLPG  NY + D+M+ FV KN
Sbjct  148  PIGTMISRTILENLPYQEWFLKRFKATVFENELKWYKTEPLPGQYNYTVVDEMMKFVRKN  207

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
            K+   GH + W DP +   W  N+T P++             +Y+N+  HWDV NEL+H+
Sbjct  208  KLIVRGHNMFWDDPTYVQDWLENMTAPQLQTAMNGRIKSVMRKYRNEFFHWDVNNELLHF  267

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE+KL    A+L+++K +Q +DP  TLF+N++ +VE+C
Sbjct  268  DFYEKKL-GPKATLDMFKSMQREDPLTTLFLNEYNIVERC  306



>ref|XP_008457673.1| PREDICTED: uncharacterized protein LOC103497316 [Cucumis melo]
Length=556

 Score =   148 bits (373),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  GV NY  +D+M++FV  N
Sbjct  216  PFGSAIAKTIIGNLPYQDWFVKRFNAAVFENELKWYATEPKQGVLNYTTADRMLEFVRAN  275

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT  E            + RYK++ +HWDV NE++H+
Sbjct  276  QITARGHNIFWEDPKYTPPWVQNLTGEELKSAVDSRIKGLLSRYKDEFVHWDVSNEMLHF  335

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            DFYE+ L  +NA+L+ YK   E DP ATLF+N+F VVE C + 
Sbjct  336  DFYEKSL-GANATLHFYKTAHEIDPLATLFMNEFNVVETCSDV  377



>gb|KEH36384.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=484

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 98/163 (60%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  144  PIGSAIAKTILGNIPYQNWFLKRFNAAVFENELKWYATEPHEGSVNYTISDQMMQFVRAN  203

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            KI   GH + W+DP + P+W  NLT  ++            ++YK + IHWD+ NE++H+
Sbjct  204  KIIARGHNIFWEDPKYNPAWVLNLTGTQLRSAVNSRIQSLMNQYKTEFIHWDISNEMLHF  263

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            DFYE++L   NA+ + ++   E DP ATLF+NDF VVE C + 
Sbjct  264  DFYEQRL-GPNATFHFFEAAHESDPLATLFMNDFNVVETCSDV  305



>gb|KEH36385.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=454

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 98/162 (60%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  114  PIGSAIAKTILGNIPYQNWFLKRFNAAVFENELKWYATEPHEGSVNYTISDQMMQFVRAN  173

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            KI   GH + W+DP + P+W  NLT  ++            ++YK + IHWD+ NE++H+
Sbjct  174  KIIARGHNIFWEDPKYNPAWVLNLTGTQLRSAVNSRIQSLMNQYKTEFIHWDISNEMLHF  233

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   NA+ + ++   E DP ATLF+NDF VVE C +
Sbjct  234  DFYEQRL-GPNATFHFFEAAHESDPLATLFMNDFNVVETCSD  274



>ref|XP_011088588.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Sesamum 
indicum]
Length=500

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+  +I+S I  N   Q WF +R NA VFE+ LKW S EP PG  NY I DQM++F  +N
Sbjct  160  PLGSSIASTILGNLPYQNWFVERFNAAVFEDELKWYSTEPQPGEVNYTIPDQMLEFARRN  219

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP+F PSW  NLT  E+             +Y+N+ IHWDV NE++H+
Sbjct  220  QIIVRGHNIFWEDPDFTPSWVRNLTSSELKSAVSSRIQSLMSQYRNEFIHWDVDNEMLHW  279

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NASL  ++  Q+ DP A LF+N++ V+E C
Sbjct  280  DFYEQRL-GPNASLEFFQTAQKSDPLARLFMNEYNVLETC  318



>gb|AES74285.2| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=535

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 98/162 (60%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  195  PIGSAIAKTILGNIPYQNWFLKRFNAAVFENELKWYATEPHEGSVNYTISDQMMQFVRAN  254

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            KI   GH + W+DP + P+W  NLT  ++            ++YK + IHWD+ NE++H+
Sbjct  255  KIIARGHNIFWEDPKYNPAWVLNLTGTQLRSAVNSRIQSLMNQYKTEFIHWDISNEMLHF  314

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   NA+ + ++   E DP ATLF+NDF VVE C +
Sbjct  315  DFYEQRL-GPNATFHFFEAAHESDPLATLFMNDFNVVETCSD  355



>ref|XP_003604034.1| Endo-1,4-beta-xylanase A [Medicago truncatula]
Length=536

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 98/162 (60%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  196  PIGSAIAKTILGNIPYQNWFLKRFNAAVFENELKWYATEPHEGSVNYTISDQMMQFVRAN  255

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            KI   GH + W+DP + P+W  NLT  ++            ++YK + IHWD+ NE++H+
Sbjct  256  KIIARGHNIFWEDPKYNPAWVLNLTGTQLRSAVNSRIQSLMNQYKTEFIHWDISNEMLHF  315

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   NA+ + ++   E DP ATLF+NDF VVE C +
Sbjct  316  DFYEQRL-GPNATFHFFEAAHESDPLATLFMNDFNVVETCSD  356



>ref|XP_011088586.1| PREDICTED: uncharacterized protein LOC105169775 isoform X1 [Sesamum 
indicum]
Length=558

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+  +I+S I  N   Q WF +R NA VFE+ LKW S EP PG  NY I DQM++F  +N
Sbjct  218  PLGSSIASTILGNLPYQNWFVERFNAAVFEDELKWYSTEPQPGEVNYTIPDQMLEFARRN  277

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP+F PSW  NLT  E+             +Y+N+ IHWDV NE++H+
Sbjct  278  QIIVRGHNIFWEDPDFTPSWVRNLTSSELKSAVSSRIQSLMSQYRNEFIHWDVDNEMLHW  337

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NASL  ++  Q+ DP A LF+N++ V+E C
Sbjct  338  DFYEQRL-GPNASLEFFQTAQKSDPLARLFMNEYNVLETC  376



>ref|XP_010920164.1| PREDICTED: uncharacterized protein LOC105044067 [Elaeis guineensis]
Length=560

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N+  Q WF KR NA VFEN LKW + EP  G  NY ++D ++ FV  N
Sbjct  220  PFGSAIAKTILGNAAYQAWFSKRFNAAVFENELKWYTTEPEEGKLNYTLADDLLGFVRAN  279

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + PSW  NLT  E            + RYK + +HWDV NE++H+
Sbjct  280  QIVARGHNIFWEDPKYTPSWVQNLTGDELRAAVKSRINSLLTRYKGEFVHWDVSNEMLHF  339

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NA+L+ +   Q  DP ATLF+NDF V+E C
Sbjct  340  DFYEQRL-GYNATLDFFATAQNSDPLATLFMNDFNVIETC  378



>ref|XP_010436963.1| PREDICTED: uncharacterized protein LOC104720780 isoform X1 [Camelina 
sativa]
Length=556

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY  +DQM+ FV  N
Sbjct  215  PIGSAISKTILGNLPYQEWFVKRFDATVFENELKWYATEPDQGKLNYTFADQMMSFVRAN  274

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  275  RIIARGHNIFWEDPKYTPNWVRNLTGEDLRSAVNGRIRSLMTRYRGEFVHWDVSNEMLHF  334

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS   +   +E DP ATLF+NDF VVE C +
Sbjct  335  DFYETRL-GKNASYGFFAAAREIDPLATLFLNDFNVVETCSD  375



>ref|XP_010436964.1| PREDICTED: uncharacterized protein LOC104720780 isoform X2 [Camelina 
sativa]
Length=508

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY  +DQM+ FV  N
Sbjct  167  PIGSAISKTILGNLPYQEWFVKRFDATVFENELKWYATEPDQGKLNYTFADQMMSFVRAN  226

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  227  RIIARGHNIFWEDPKYTPNWVRNLTGEDLRSAVNGRIRSLMTRYRGEFVHWDVSNEMLHF  286

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS   +   +E DP ATLF+NDF VVE C +
Sbjct  287  DFYETRL-GKNASYGFFAAAREIDPLATLFLNDFNVVETCSD  327



>ref|XP_011088587.1| PREDICTED: uncharacterized protein LOC105169775 isoform X2 [Sesamum 
indicum]
Length=556

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+  +I+S I  N   Q WF +R NA VFE+ LKW S EP PG  NY I DQM++F  +N
Sbjct  216  PLGSSIASTILGNLPYQNWFVERFNAAVFEDELKWYSTEPQPGEVNYTIPDQMLEFARRN  275

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP+F PSW  NLT  E+             +Y+N+ IHWDV NE++H+
Sbjct  276  QIIVRGHNIFWEDPDFTPSWVRNLTSSELKSAVSSRIQSLMSQYRNEFIHWDVDNEMLHW  335

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NASL  ++  Q+ DP A LF+N++ V+E C
Sbjct  336  DFYEQRL-GPNASLEFFQTAQKSDPLARLFMNEYNVLETC  374



>ref|XP_010446374.1| PREDICTED: uncharacterized protein LOC104729170 [Camelina sativa]
Length=561

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY  +DQM+ FV  N
Sbjct  220  PIGSAISKTILGNLPYQEWFVKRFDATVFENELKWYATEPDQGKLNYTFADQMMSFVRAN  279

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  280  RIIARGHNIFWEDPKYTPNWVRNLTVEDLRSAANRRIRSLMTRYRGEFVHWDVSNEMLHF  339

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS   +   +E DP ATLF+NDF VVE C +
Sbjct  340  DFYETRL-GKNASYGFFAAAREIDPLATLFLNDFNVVETCSD  380



>ref|XP_010646993.1| PREDICTED: probable endo-1,4-beta-xylanase C [Vitis vinifera]
 ref|XP_002277675.2| PREDICTED: probable endo-1,4-beta-xylanase C [Vitis vinifera]
Length=550

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 99/162 (61%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP PG   Y ++DQM++FV  N
Sbjct  210  PFGSAIAKTILGNLPYQNWFVKRFNAAVFENELKWYATEPDPGNITYALADQMLEFVRAN  269

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NL+ P +             +YK++ +HWDV NE++H+
Sbjct  270  QIVARGHNIFWEDPKYTPAWVRNLSGPALQSAVNNRIQSLMSKYKDEFVHWDVSNEMLHF  329

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   E DP ATLF+NDF VVE C +
Sbjct  330  DFYEQRL-GPDATLHFYETAHESDPLATLFMNDFNVVETCSD  370



>ref|XP_007041881.1| Glycosyl hydrolase family 10 protein isoform 2 [Theobroma cacao]
 gb|EOX97712.1| Glycosyl hydrolase family 10 protein isoform 2 [Theobroma cacao]
Length=416

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 99/162 (61%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF +R NA VFEN LKW + EP  G  NY I+DQM++FV  +
Sbjct  76   PFGSAIASTILGNLPYQSWFVERFNAAVFENELKWYATEPDQGKTNYTIADQMLEFVRAH  135

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NL  PE+             +YK + IHWDV NE++H+
Sbjct  136  QIIARGHNIFWEDPKYTPAWVRNLAGPELQSAVNSRIQSLMSKYKEEFIHWDVSNEMLHF  195

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   + DP ATLF+N+F VVE C +
Sbjct  196  DFYEQRL-GPDATLHFYETAHQSDPLATLFMNEFNVVETCSD  236



>ref|XP_009761415.1| PREDICTED: uncharacterized protein LOC104213578 isoform X3 [Nicotiana 
sylvestris]
Length=516

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 13/142 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++DQ+++FV +N+I   GH + W+DP + P
Sbjct  195  WFLERFNAAVFEDEIKWYTTEPKRGQLNYTLADQLLEFVRRNQITVRGHNIFWEDPKYTP  254

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT PE+             +YK++ +HWDV NEL+H+DFYE++L   NA+L  Y+
Sbjct  255  GWVQNLTDPELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFDFYEQRL-GPNATLEFYR  313

Query  648  KVQEKDPNATLFINDFKVVEQC  713
             V ++DP ATLF+N+F VVE C
Sbjct  314  TVHQQDPLATLFLNEFNVVENC  335



>emb|CBI37893.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   146 bits (368),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 99/162 (61%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP PG   Y ++DQM++FV  N
Sbjct  285  PFGSAIAKTILGNLPYQNWFVKRFNAAVFENELKWYATEPDPGNITYALADQMLEFVRAN  344

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NL+ P +             +YK++ +HWDV NE++H+
Sbjct  345  QIVARGHNIFWEDPKYTPAWVRNLSGPALQSAVNNRIQSLMSKYKDEFVHWDVSNEMLHF  404

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   E DP ATLF+NDF VVE C +
Sbjct  405  DFYEQRL-GPDATLHFYETAHESDPLATLFMNDFNVVETCSD  445



>ref|XP_009761414.1| PREDICTED: uncharacterized protein LOC104213578 isoform X2 [Nicotiana 
sylvestris]
Length=530

 Score =   145 bits (367),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 13/142 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++DQ+++FV +N+I   GH + W+DP + P
Sbjct  209  WFLERFNAAVFEDEIKWYTTEPKRGQLNYTLADQLLEFVRRNQITVRGHNIFWEDPKYTP  268

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT PE+             +YK++ +HWDV NEL+H+DFYE++L   NA+L  Y+
Sbjct  269  GWVQNLTDPELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFDFYEQRL-GPNATLEFYR  327

Query  648  KVQEKDPNATLFINDFKVVEQC  713
             V ++DP ATLF+N+F VVE C
Sbjct  328  TVHQQDPLATLFLNEFNVVENC  349



>ref|XP_009761411.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009761412.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009761413.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 13/142 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++DQ+++FV +N+I   GH + W+DP + P
Sbjct  236  WFLERFNAAVFEDEIKWYTTEPKRGQLNYTLADQLLEFVRRNQITVRGHNIFWEDPKYTP  295

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT PE+             +YK++ +HWDV NEL+H+DFYE++L   NA+L  Y+
Sbjct  296  GWVQNLTDPELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFDFYEQRL-GPNATLEFYR  354

Query  648  KVQEKDPNATLFINDFKVVEQC  713
             V ++DP ATLF+N+F VVE C
Sbjct  355  TVHQQDPLATLFLNEFNVVENC  376



>ref|XP_008661494.1| PREDICTED: uncharacterized protein LOC100216852 isoform X1 [Zea 
mays]
 gb|AFW57913.1| hypothetical protein ZEAMMB73_662182 [Zea mays]
Length=575

 Score =   145 bits (366),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 90/160 (56%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF  R NA VFEN LKW + EP PG   Y  +DQ++ FV  N
Sbjct  227  PFGSAISKSILGNGPYQDWFNARFNAAVFENELKWYATEPSPGKEEYGAADQLLRFVQSN  286

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             +   GH + W+DP + P+W  NLT PE            + RYK   +HWDV NE++H+
Sbjct  287  DVTARGHNIFWEDPRYTPAWVKNLTGPELRAAVAGRVQSLLSRYKGDFVHWDVSNEMLHF  346

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NA+ + +   +  DP ATLF+NDF VVE C
Sbjct  347  DFYEDRL-GGNATADFFSTARRADPLATLFLNDFNVVEAC  385



>ref|XP_006422632.1| hypothetical protein CICLE_v10028121mg [Citrus clementina]
 gb|ESR35872.1| hypothetical protein CICLE_v10028121mg [Citrus clementina]
Length=556

 Score =   145 bits (366),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 100/162 (62%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF +R NA VFEN LKW + EP  G  NY I+DQM++FV  N
Sbjct  216  PFGSAIASTILGNLPYQKWFVERFNAAVFENELKWYATEPEQGKINYTIADQMMEFVRSN  275

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W+DP + P+W  NLT P +            ++YK + IHWDV NE++H+
Sbjct  276  QLIARGHNIFWEDPKYTPAWVRNLTGPALQSAVNSRIQSLMNKYKEEFIHWDVSNEMLHF  335

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   + DP ATLF+N+F VVE C +
Sbjct  336  DFYEQRL-GHDATLHFYETAHQSDPLATLFMNEFNVVETCSD  376



>ref|XP_009799022.1| PREDICTED: endo-1,4-beta-xylanase A-like [Nicotiana sylvestris]
Length=557

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 99/160 (62%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    +S  I  N   Q WF KR  ATVFEN LKW   EP PG  NY + DQM++FV KN
Sbjct  217  PFGCAVSKTILGNLPYQEWFAKRFKATVFENELKWYKTEPQPGQFNYTLVDQMMEFVRKN  276

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            K+   GH + W DP +   W  N+T P+            + +Y+N+ +HWDV NEL+H+
Sbjct  277  KLIARGHNMFWDDPVYIQDWLENMTAPQLKQAMKSRIKSVISKYRNEFVHWDVNNELLHF  336

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE KL   NA+L+++KKV  +DP ATLF+N++ VVE+C
Sbjct  337  NFYEGKL-GPNATLDMFKKVHREDPLATLFLNEYNVVERC  375



>ref|XP_007041880.1| Glycosyl hydrolase family 10 protein isoform 1 [Theobroma cacao]
 gb|EOX97711.1| Glycosyl hydrolase family 10 protein isoform 1 [Theobroma cacao]
Length=564

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 99/162 (61%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF +R NA VFEN LKW + EP  G  NY I+DQM++FV  +
Sbjct  224  PFGSAIASTILGNLPYQSWFVERFNAAVFENELKWYATEPDQGKTNYTIADQMLEFVRAH  283

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NL  PE+             +YK + IHWDV NE++H+
Sbjct  284  QIIARGHNIFWEDPKYTPAWVRNLAGPELQSAVNSRIQSLMSKYKEEFIHWDVSNEMLHF  343

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   + DP ATLF+N+F VVE C +
Sbjct  344  DFYEQRL-GPDATLHFYETAHQSDPLATLFMNEFNVVETCSD  384



>ref|XP_010934099.1| PREDICTED: endo-1,4-beta-xylanase-like [Elaeis guineensis]
Length=564

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 99/163 (61%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+S I  NS  Q WF KR NA VFEN LKW + EP PG  NY ++D+M++FV  N
Sbjct  223  PLGSAIASTILGNSPYQAWFLKRFNAAVFENELKWYTTEPQPGKLNYTLADKMLEFVRAN  282

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             +   GH + W++P   P+W  NLT  ++             RY+ K +HWDV NE++H+
Sbjct  283  NVVVRGHNIFWENPTVTPAWVRNLTGDDLRSAVKSRIQSLMSRYRGKFVHWDVNNEMLHF  342

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            +FYE++L   NASL  +   Q+ DP ATLF+N+F V+E C + 
Sbjct  343  NFYEQRL-GPNASLEFFDTAQQADPLATLFMNEFNVLETCADA  384



>gb|KDO68006.1| hypothetical protein CISIN_1g035723mg, partial [Citrus sinensis]
Length=528

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 100/162 (62%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF +R NA VFEN LKW + EP  G  NY I+DQM++FV  N
Sbjct  188  PFGSAIASTILGNLPYQKWFVERFNAAVFENELKWYATEPEQGKINYTIADQMMEFVRSN  247

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W+DP + P+W  NLT P +            ++YK + IHWDV NE++H+
Sbjct  248  QLIARGHNIFWEDPKYTPAWVRNLTGPALQSAVNSRIQSLMNKYKEEFIHWDVSNEMLHF  307

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   + DP ATLF+N+F VVE C +
Sbjct  308  DFYEQRL-GHDATLHFYETAHQSDPLATLFMNEFNVVETCSD  348



>ref|XP_007201160.1| hypothetical protein PRUPE_ppa004290mg [Prunus persica]
 gb|EMJ02359.1| hypothetical protein PRUPE_ppa004290mg [Prunus persica]
Length=518

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 96/160 (60%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY I+DQM+ FV  N
Sbjct  178  PFGSAIAKTILGNLPYQNWFVKRFNAAVFENELKWYATEPEQGKTNYTIADQMLQFVRAN  237

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NLT  E+             +Y+ + IHWDV NE++H+
Sbjct  238  QITARGHNIFWEDPKYTPAWVRNLTGNELHSAVNSRIESLMSKYREEFIHWDVSNEMLHF  297

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE+KL   NA+L+ ++   + DP ATLF+NDF VVE C
Sbjct  298  DFYEQKL-GPNATLHFFETAHKFDPLATLFMNDFNVVETC  336



>ref|XP_008235994.1| PREDICTED: probable endo-1,4-beta-xylanase C [Prunus mume]
Length=556

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 96/160 (60%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY I+DQM+ FV  N
Sbjct  216  PFGSAIAKTILGNLPYQNWFVKRFNAAVFENELKWYATEPEQGKTNYTIADQMLQFVRAN  275

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NLT  E+             +Y+ + IHWDV NE++H+
Sbjct  276  QITARGHNIFWEDPKYTPAWVRNLTGNELHSAVNSRIQSLMSKYREEFIHWDVSNEMLHF  335

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE+KL   NA+L+ ++   + DP ATLF+NDF VVE C
Sbjct  336  DFYEQKL-GPNATLHFFETAHKFDPLATLFMNDFNVVETC  374



>ref|XP_010246857.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 100/169 (59%), Gaps = 16/169 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW   E  PG  NY ++DQM++FV  +
Sbjct  46   PFGSAIAKTILGNLPYQDWFVKRFNAAVFENELKWYVTEAKPGKINYTLADQMLEFVRAH  105

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            +I T GH + W+DP + P W  NLT  E            +++YK + IHWD+ NE++H+
Sbjct  106  QIVTRGHNIFWEDPIYTPDWVRNLTGAELQSAVNSHILSLLNKYKEEFIHWDISNEMLHF  165

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC--GNTTKGH  734
            DFYE+KL   NA+L  ++   + DP ATLF+N+F VVE C   N+T  H
Sbjct  166  DFYEKKL-GPNATLQFFQTAHQADPLATLFMNEFNVVETCADANSTVDH  213



>ref|XP_011092889.1| PREDICTED: endo-1,4-beta-xylanase 1 isoform X2 [Sesamum indicum]
Length=532

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N + Q WF +R NA VFEN LKW + E + G  NY I DQM++FV  N
Sbjct  192  PFGSAIAKTIIGNLEYQKWFVERFNAAVFENELKWDATEHIQGQVNYTIPDQMLEFVRAN  251

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
            +I   GH + W++P + P W  NLTR +++            +YK + IHWDV NE++H+
Sbjct  252  QIIARGHNIFWENPKYTPKWVLNLTRSDLESAVSSRIQSLMNKYKREFIHWDVSNEMLHF  311

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L  ++A+L  +K   E DP ATLF+N+F VVE C
Sbjct  312  DFYEERL-GADATLKFFKTANEADPLATLFMNEFNVVETC  350



>ref|XP_004969072.1| PREDICTED: uncharacterized protein LOC101763135 [Setaria italica]
Length=568

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 91/160 (57%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF KR NA VFEN LKW + EP PG  +Y ++DQ++ FV  N
Sbjct  222  PFGSAISKSILGNKPYQDWFNKRFNAAVFENELKWYATEPSPGKEDYTVADQLLQFVQSN  281

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             +   GH + W+DP + P+W  NLT  E            + RYK   +HWDV NE++H+
Sbjct  282  DVMARGHNIFWEDPKYTPAWVKNLTGSELRAAVAGRIESLLSRYKGDFVHWDVSNEMLHF  341

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NA+   +   +  DP ATLF+NDF VVE C
Sbjct  342  DFYENRL-GGNATAEFFSTAKRADPLATLFLNDFNVVEVC  380



>ref|XP_011092888.1| PREDICTED: uncharacterized protein LOC105172963 isoform X1 [Sesamum 
indicum]
Length=554

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N + Q WF +R NA VFEN LKW + E + G  NY I DQM++FV  N
Sbjct  214  PFGSAIAKTIIGNLEYQKWFVERFNAAVFENELKWDATEHIQGQVNYTIPDQMLEFVRAN  273

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
            +I   GH + W++P + P W  NLTR +++            +YK + IHWDV NE++H+
Sbjct  274  QIIARGHNIFWENPKYTPKWVLNLTRSDLESAVSSRIQSLMNKYKREFIHWDVSNEMLHF  333

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L  ++A+L  +K   E DP ATLF+N+F VVE C
Sbjct  334  DFYEERL-GADATLKFFKTANEADPLATLFMNEFNVVETC  372



>ref|XP_009622124.1| PREDICTED: LOW QUALITY PROTEIN: probable endo-1,4-beta-xylanase 
C [Nicotiana tomentosiformis]
Length=399

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 14/151 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  N   +WFK+R NA VFE+ LKW S EP  G  NY I DQM++FV  N+I   GH +
Sbjct  95   LLKHNLLQKWFKERFNAAVFEDELKWYSTEPQQGEVNYTIPDQMLEFVRANQIIARGHNI  154

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W+DP F PS   NLT PE            + +YKN+ IHWDV NE++HYDFYE++L  
Sbjct  155  FWEDPRFVPSXR-NLTGPELKSAVNSRIESLISKYKNEFIHWDVDNEMLHYDFYEQRL-G  212

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +N SL  +K  Q  DP A L +ND+ VVE C
Sbjct  213  TNTSLEFFKTAQNLDPLAKLLMNDYNVVETC  243



>ref|XP_008781049.1| PREDICTED: endo-1,4-beta-xylanase-like [Phoenix dactylifera]
Length=566

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFEN LKW + EP PG  NY ++D+M++F+  N
Sbjct  225  PFGSAIASTIVGNLPYQAWFLGRFNAAVFENELKWYTTEPQPGKLNYTLADEMLEFIRAN  284

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            K+   GH + W++P+  PSW  NLT  ++             RYK + +HWDV NE++H+
Sbjct  285  KVVARGHNIFWENPSVTPSWVRNLTGDDLRSAAKSRIQSLMSRYKGEFVHWDVNNEMLHF  344

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NASL  +   Q+ DP AT+F+N+F V+E C
Sbjct  345  DFYEQRL-GPNASLEFFGTAQQADPLATMFMNEFNVLETC  383



>ref|XP_006486857.1| PREDICTED: uncharacterized protein LOC102613106 [Citrus sinensis]
Length=556

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF +R NA VFEN LKW + EP  G  NY I+DQM++FV  N
Sbjct  216  PFGSAIASTILGNLPYQKWFVERFNAAVFENELKWYATEPEQGKINYTIADQMMEFVRAN  275

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W+DP + P+W  +LT P +            ++YK + IHWDV NE++H+
Sbjct  276  QLIARGHNIFWEDPRYTPAWVRSLTGPALQSAVNSRIQSLMNKYKEEFIHWDVSNEMLHF  335

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   + DP ATLF+N+F VVE C +
Sbjct  336  DFYEQRL-GHDATLHFYETAHQSDPLATLFMNEFNVVETCSD  376



>ref|XP_010090320.1| Endo-1,4-beta-xylanase A [Morus notabilis]
 gb|EXB39290.1| Endo-1,4-beta-xylanase A [Morus notabilis]
Length=548

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY I+D+M++FV  N
Sbjct  208  PFGSAIAKTILGNLPYQNWFVERFNAAVFENELKWYATEPKQGKVNYTIADKMLEFVRAN  267

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            KI   GH + W+DP + PSW  NLT  ++            ++YK++ IHWDV NE++H+
Sbjct  268  KIIARGHNIFWEDPKYTPSWVRNLTSSDLQSAVNSRIQGLMNKYKDEFIHWDVSNEMLHF  327

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE+KL   NA+L+ ++   + DP ATLF+N+F VVE C
Sbjct  328  DFYEQKL-GPNATLHFFETAHQSDPLATLFMNEFNVVETC  366



>ref|XP_008349367.1| PREDICTED: probable endo-1,4-beta-xylanase C [Malus domestica]
Length=529

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 96/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY I+DQM+ FV  N
Sbjct  189  PFGSAIAKTILGNLPYQDWFAKRFNAAVFENELKWYATEPEQGKTNYTIADQMLQFVRAN  248

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W+DP + P W  NLT  ++             +Y+ + +HWDV NE++H+
Sbjct  249  QVIARGHNIFWEDPKYTPQWVRNLTGSDLQSAVNSRIQSLMSKYREEFVHWDVSNEMLHF  308

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE+KL   NA+L+ ++   + DP ATLF+NDF VVE C +
Sbjct  309  DFYEQKL-GPNATLHFFETAHKSDPLATLFMNDFNVVETCSD  349



>ref|NP_001055145.1| Os05g0304900 [Oryza sativa Japonica Group]
 dbj|BAF17059.1| Os05g0304900 [Oryza sativa Japonica Group]
Length=480

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF KR NA VFEN LKW + EP PG  +Y ++DQ++ FV  N
Sbjct  135  PFGSAISRTILGNKLYQEWFNKRFNAAVFENELKWYATEPYPGKEDYTVADQLLQFVQAN  194

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
                 GH + W+DP + P+W  NLT  +            + RYK   +HWDV NE++H+
Sbjct  195  DAVARGHNIFWEDPKYTPAWVKNLTGSQLRAAVSGRIESLLSRYKGDFVHWDVSNEMLHF  254

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NA+++ +   +  DP ATLF+NDF VVE C
Sbjct  255  DFYENRL-GGNATVDFFDTAKRADPLATLFLNDFNVVEVC  293



>ref|XP_010431807.1| PREDICTED: uncharacterized protein LOC104716145 [Camelina sativa]
Length=556

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 94/162 (58%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY  +DQM+ FV  N
Sbjct  215  PIGSAISKTILGNIPYQEWFVKRFDATVFENELKWYATEPDQGKLNYTFADQMMSFVRAN  274

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+D  + P+W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  275  RIIARGHNIFWEDRKYTPNWVRNLTGEDLRSAVNRRIRSLMTRYRGEFVHWDVSNEMLHF  334

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS   +   +E DP ATLF+NDF VVE C +
Sbjct  335  DFYESRL-GKNASYGFFAAAREIDPLATLFLNDFNVVETCSD  375



>ref|XP_009628229.1| PREDICTED: uncharacterized protein LOC104118640 isoform X4 [Nicotiana 
tomentosiformis]
Length=519

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 13/142 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++DQ+++FV +N+I   GH + W+DP + P
Sbjct  198  WFLERFNAAVFEDEIKWYTTEPKRGQLNYTLADQLLEFVRRNQITVRGHNIFWEDPKYTP  257

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT  E+             +YK++ +HWDV NEL+H+DFYE++L   NA+L  Y+
Sbjct  258  GWVQNLTDSELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFDFYEQRL-GPNATLEFYR  316

Query  648  KVQEKDPNATLFINDFKVVEQC  713
             V ++DP ATLF+N+F VVE C
Sbjct  317  TVHQQDPLATLFLNEFNVVENC  338



>ref|NP_001152556.1| hydrolase, hydrolyzing O-glycosyl compounds precursor [Zea mays]
 gb|ACG48190.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
Length=571

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 90/160 (56%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF  R NA VFEN LKW + EP PG   Y  +DQ++ FV  N
Sbjct  223  PFGSAISKSILGNRPYQDWFNARFNAAVFENELKWYATEPSPGKEEYAAADQLLRFVQSN  282

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             +   GH + W+DP + P+W  NLT P+            + RYK   +HWDV NE++H+
Sbjct  283  DVTARGHNIFWEDPRYTPAWVKNLTGPQLRAAVAGRVQSLLSRYKGDFVHWDVSNEMLHF  342

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NA+ + +   +  DP ATLF+NDF VVE C
Sbjct  343  DFYEDRL-GGNATADFFSTARRADPLATLFLNDFNVVEAC  381



>emb|CDO96932.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF +R NA VFEN LKW + EP  G+ NY + DQM++F   N
Sbjct  239  PFGSAIASTILGNLPYQNWFVERFNAAVFENELKWYATEPQQGIVNYTVPDQMLEFARAN  298

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W++P ++P W  NLT PE+             +YK++ IHWDV NE++H+
Sbjct  299  QIMVRGHNIFWENPKYSPPWVLNLTGPELKVAVNSRIQSLMSQYKSEFIHWDVSNEMLHF  358

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE+KL   +ASL  ++   + DP ATLF+N++ VVE C
Sbjct  359  DFYEQKL-GPDASLQFFETSHQADPLATLFMNEYNVVETC  397



>ref|XP_009109536.1| PREDICTED: uncharacterized protein LOC103835171 [Brassica rapa]
Length=564

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 94/162 (58%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY  +DQM+ FV  N
Sbjct  221  PIGSAISKTILGNIPYQEWFVKRFDATVFENELKWYATEPHQGKLNYTFADQMMSFVRAN  280

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT  ++             RY+ + +HWDV NE++H+
Sbjct  281  RIIARGHNIFWEDPKYTPDWVRNLTGEDLRSAVNQRITSLMTRYRGEFVHWDVSNEMLHF  340

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS  ++   +E D  ATLF+NDF VVE C +
Sbjct  341  DFYESRL-GKNASYELFAAARELDSLATLFLNDFNVVETCSD  381



>gb|EEC78941.1| hypothetical protein OsI_19385 [Oryza sativa Indica Group]
Length=526

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF KR NA VFEN LKW + EP PG  +Y ++DQ++ FV  N
Sbjct  181  PFGSAISRTILGNKLYQEWFNKRFNAAVFENELKWYATEPYPGKEDYTVADQLLQFVQAN  240

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
                 GH + W+DP + P+W  NLT  +            + RYK   +HWDV NE++H+
Sbjct  241  DAVARGHNIFWEDPKYTPAWVKNLTGSQLRAAVSGRIESLLSRYKGDFVHWDVSNEMLHF  300

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NA+++ +   +  DP ATLF+NDF VVE C
Sbjct  301  DFYENRL-GGNATVDFFDTAKRADPLATLFLNDFNVVEVC  339



>ref|XP_009628227.1| PREDICTED: uncharacterized protein LOC104118640 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 13/142 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++DQ+++FV +N+I   GH + W+DP + P
Sbjct  224  WFLERFNAAVFEDEIKWYTTEPKRGQLNYTLADQLLEFVRRNQITVRGHNIFWEDPKYTP  283

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT  E+             +YK++ +HWDV NEL+H+DFYE++L   NA+L  Y+
Sbjct  284  GWVQNLTDSELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFDFYEQRL-GPNATLEFYR  342

Query  648  KVQEKDPNATLFINDFKVVEQC  713
             V ++DP ATLF+N+F VVE C
Sbjct  343  TVHQQDPLATLFLNEFNVVENC  364



>ref|XP_009615209.1| PREDICTED: endo-1,4-beta-xylanase A-like [Nicotiana tomentosiformis]
Length=561

 Score =   142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 98/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    +S  I  N   Q WF KR  ATVFEN LKW   EP  G  NY + DQM++FV KN
Sbjct  221  PFGCAVSKTILGNLPYQEWFAKRFKATVFENELKWYKTEPQLGQFNYTLVDQMMEFVRKN  280

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVDR------------YKNKLIHWDVKNELVHY  593
            K+   GH + W DP +   W  N+T P++ R            Y+N+ +HWDV NEL+H+
Sbjct  281  KLIARGHNMFWDDPVYIQDWLENMTSPQLKRAMKSRIKSVISKYRNEFVHWDVNNELLHF  340

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE KL   NA+L+++KKV  +DP ATLF+N++ VVE+C
Sbjct  341  NFYEGKL-GPNATLDMFKKVHREDPLATLFLNEYNVVERC  379



>ref|XP_009628223.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628225.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628226.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 13/142 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++DQ+++FV +N+I   GH + W+DP + P
Sbjct  236  WFLERFNAAVFEDEIKWYTTEPKRGQLNYTLADQLLEFVRRNQITVRGHNIFWEDPKYTP  295

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT  E+             +YK++ +HWDV NEL+H+DFYE++L   NA+L  Y+
Sbjct  296  GWVQNLTDSELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFDFYEQRL-GPNATLEFYR  354

Query  648  KVQEKDPNATLFINDFKVVEQC  713
             V ++DP ATLF+N+F VVE C
Sbjct  355  TVHQQDPLATLFLNEFNVVENC  376



>ref|XP_007137357.1| hypothetical protein PHAVU_009G120500g [Phaseolus vulgaris]
 gb|ESW09351.1| hypothetical protein PHAVU_009G120500g [Phaseolus vulgaris]
Length=559

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 97/162 (60%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  219  PFGSAIAKTILGNLPYQNWFAKRFNAAVFENELKWYATEPDEGRVNYTISDQMLQFVRTN  278

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I   GH + W+DP + P W  NLT  ++             +YK++ IHWDV NE++H+
Sbjct  279  NIVARGHNIFWEDPKYTPPWVLNLTGIQLQSAVNSRIHSLMSQYKDEFIHWDVSNEMLHF  338

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            +FYE++L  S+A+L+ ++   E DP +TLF+NDF VVE C +
Sbjct  339  EFYEQRL-GSDATLHFFETAHESDPLSTLFMNDFNVVETCSD  379



>ref|XP_009628228.1| PREDICTED: uncharacterized protein LOC104118640 isoform X3 [Nicotiana 
tomentosiformis]
Length=541

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 13/142 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++DQ+++FV +N+I   GH + W+DP + P
Sbjct  220  WFLERFNAAVFEDEIKWYTTEPKRGQLNYTLADQLLEFVRRNQITVRGHNIFWEDPKYTP  279

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT  E+             +YK++ +HWDV NEL+H+DFYE++L   NA+L  Y+
Sbjct  280  GWVQNLTDSELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFDFYEQRL-GPNATLEFYR  338

Query  648  KVQEKDPNATLFINDFKVVEQC  713
             V ++DP ATLF+N+F VVE C
Sbjct  339  TVHQQDPLATLFLNEFNVVENC  360



>ref|XP_010246856.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X1 [Nelumbo 
nucifera]
Length=557

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 100/169 (59%), Gaps = 16/169 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW   E  PG  NY ++DQM++FV  +
Sbjct  217  PFGSAIAKTILGNLPYQDWFVKRFNAAVFENELKWYVTEAKPGKINYTLADQMLEFVRAH  276

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
            +I T GH + W+DP + P W  NLT  E            +++YK + IHWD+ NE++H+
Sbjct  277  QIVTRGHNIFWEDPIYTPDWVRNLTGAELQSAVNSHILSLLNKYKEEFIHWDISNEMLHF  336

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC--GNTTKGH  734
            DFYE+KL   NA+L  ++   + DP ATLF+N+F VVE C   N+T  H
Sbjct  337  DFYEKKL-GPNATLQFFQTAHQADPLATLFMNEFNVVETCADANSTVDH  384



>emb|CDX90288.1| BnaA08g16960D [Brassica napus]
Length=564

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 94/162 (58%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY  +D+M+ FV  N
Sbjct  221  PIGSAISKTILGNIPYQEWFVKRFDATVFENELKWYATEPHQGKLNYTFADKMMSFVRAN  280

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  281  RIIARGHNIFWEDPKYTPDWVRNLTGEDLRSAVNQRIRSLMTRYRGEFVHWDVSNEMLHF  340

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS  ++   +E D  ATLF+NDF VVE C +
Sbjct  341  DFYESRL-GKNASYELFAAARELDSLATLFLNDFNVVETCSD  381



>ref|XP_006283442.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
 gb|EOA16340.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
Length=402

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 92/162 (57%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY   DQM+ FV  N
Sbjct  61   PIGSAISKTILGNIPYQEWFVKRFDATVFENELKWYATEPDQGKLNYTYPDQMMSFVRAN  120

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  121  RIIARGHNIFWEDPKYTPDWVRNLTGSDLRSAVNQRIRSLMTRYRGEFVHWDVSNEMLHF  180

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS   +   +E D  ATLF+NDF VVE C +
Sbjct  181  DFYETRL-GKNASYGFFAAAREIDSLATLFLNDFNVVETCSD  221



>ref|XP_006652135.1| PREDICTED: uncharacterized protein LOC102708887 [Oryza brachyantha]
Length=577

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF KR NA VFEN LKW + EP PG  +Y ++DQ++ FV  N
Sbjct  232  PFGSAISRTILGNKPYQEWFNKRFNAAVFENELKWYATEPYPGKEDYTVADQLLQFVQAN  291

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
                 GH + W+DP + P+W  NLT  +            + RYK   +HWDV NE++H+
Sbjct  292  DAVVRGHNIFWEDPKYTPAWVKNLTGSQLHAAVSGRIESLLSRYKGDFVHWDVSNEMLHF  351

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L  SNA++  +   +  DP ATLF+NDF V+E C
Sbjct  352  DFYENRL-GSNATVEFFNTAKRADPLATLFLNDFNVIEVC  390



>gb|EEE63172.1| hypothetical protein OsJ_17981 [Oryza sativa Japonica Group]
Length=526

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF KR NA VFEN LKW + EP PG  +Y ++DQ++ FV  N
Sbjct  181  PFGSAISRTILGNKLYQEWFNKRFNAAVFENELKWYATEPYPGKEDYTVADQLLQFVQAN  240

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
                 GH + W+DP + P+W  NLT  +            + RYK   +HWDV NE++H+
Sbjct  241  DAVARGHNIFWEDPKYTPAWVKNLTGSQLRAAVSGRIESLLSRYKGDFVHWDVSNEMLHF  300

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NA+++ +   +  DP ATLF+NDF VVE C
Sbjct  301  DFYENRL-GGNATVDYFDTAKRADPLATLFLNDFNVVEVC  339



>ref|XP_002306176.2| hypothetical protein POPTR_0004s17900g [Populus trichocarpa]
 gb|EEE86687.2| hypothetical protein POPTR_0004s17900g [Populus trichocarpa]
Length=543

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY I DQM++FV  N
Sbjct  202  PFGSAIARTILGNLPYQNWFVERFNAAVFENELKWYATEPEQGKVNYTIPDQMLEFVLAN  261

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  +LT P++             +YK + IHWDV NE++H+
Sbjct  262  QIVARGHNIFWEDPKYNPAWVRDLTGPDLKSAVNFRIQSLMSKYKEEFIHWDVSNEMLHF  321

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   +A+L+ YK   E DP A+LF+N+F VVE C
Sbjct  322  DFYEERL-GPDATLHFYKTAHEADPLASLFLNEFNVVETC  360



>gb|KHN20002.1| Endo-1,4-beta-xylanase A [Glycine soja]
Length=551

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  211  PFGSAIAKTILGNVPYQNWFVKRFNAAVFENELKWYATEPDQGKVNYTISDQMLQFVRTN  270

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I   GH + W+DP + P W  NLT  ++             +YK++ +HWDV NE++H+
Sbjct  271  NIIARGHNIFWEDPKYTPPWVLNLTGTQLQSAVNSRIHSLMSQYKDEFVHWDVSNEMLHF  330

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NA+L+ ++   + DP ATLF+NDF VVE C +
Sbjct  331  DFYEERL-GPNATLHFFQTAHKSDPLATLFMNDFNVVETCSD  371



>ref|XP_009340235.1| PREDICTED: probable endo-1,4-beta-xylanase C [Pyrus x bretschneideri]
Length=550

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY + DQM+ FV  N
Sbjct  210  PFGSAIAKTILGNLPYQNWFAKRFNAAVFENELKWYATEPEQGKTNYTVPDQMLQFVRAN  269

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W+DP + P W  NLT  E+             +Y+ + +HWDV NE++H+
Sbjct  270  RVIARGHNIFWEDPKYTPPWVRNLTGSELHLAVNSRIQSLMSQYREEFVHWDVSNEMLHF  329

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE+KL   NA+L+ ++   + DP ATLF+NDF VVE C +
Sbjct  330  DFYEQKL-GPNATLHFFETAHKSDPLATLFMNDFNVVETCSD  370



>ref|XP_006581102.1| PREDICTED: probable endo-1,4-beta-xylanase C-like [Glycine max]
Length=551

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  211  PFGSAIAKTILGNVPYQNWFVKRFNAAVFENELKWYATEPDQGKVNYTISDQMLQFVRTN  270

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I   GH + W+DP + P W  NLT  ++             +YK++ +HWDV NE++H+
Sbjct  271  NIIARGHNIFWEDPKYTPPWVLNLTGTQLQSAVNSRIHSLMSQYKDEFVHWDVSNEMLHF  330

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NA+L+ ++   + DP ATLF+NDF VVE C +
Sbjct  331  DFYEERL-GPNATLHFFQTAHKSDPLATLFMNDFNVVETCSD  371



>ref|XP_011001985.1| PREDICTED: endo-1,4-beta-xylanase F1-like isoform X3 [Populus 
euphratica]
Length=472

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY I DQM++FV  N
Sbjct  131  PFGSAIARTILGNLPYQNWFVERFNAAVFENELKWYATEPEQGKVNYTIPDQMLEFVLAN  190

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  +LT P +             +YK + IHWDV NE++H+
Sbjct  191  QIVARGHNIFWEDPKYNPAWVRDLTGPALKSAVSSRIQSLMSKYKEEFIHWDVSNEMLHF  250

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   +A+L+ YK   E DP A+LF+N+F VVE C
Sbjct  251  DFYEERL-GPDATLHFYKTAHEADPLASLFLNEFNVVETC  289



>ref|XP_011001986.1| PREDICTED: endo-1,4-beta-xylanase F1-like isoform X4 [Populus 
euphratica]
Length=450

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY I DQM++FV  N
Sbjct  109  PFGSAIARTILGNLPYQNWFVERFNAAVFENELKWYATEPEQGKVNYTIPDQMLEFVLAN  168

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  +LT P +             +YK + IHWDV NE++H+
Sbjct  169  QIVARGHNIFWEDPKYNPAWVRDLTGPALKSAVSSRIQSLMSKYKEEFIHWDVSNEMLHF  228

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   +A+L+ YK   E DP A+LF+N+F VVE C
Sbjct  229  DFYEERL-GPDATLHFYKTAHEADPLASLFLNEFNVVETC  267



>ref|XP_006411655.1| hypothetical protein EUTSA_v10024805mg [Eutrema salsugineum]
 gb|ESQ53108.1| hypothetical protein EUTSA_v10024805mg [Eutrema salsugineum]
Length=561

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 94/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY ++D+M++FV   
Sbjct  218  PIGSAISKTILRNIPYQEWFVKRFDATVFENELKWYATEPDRGRLNYTLADEMMNFVRAK  277

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  278  RIIARGHNIFWEDPKYTPDWVRNLTGEDLRSAVSGRIRSLMTRYRGEFVHWDVSNEMLHF  337

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NAS   ++  +E D  ATLF+NDF VVE C
Sbjct  338  DFYESRL-GENASYGFFEAAREIDSLATLFLNDFNVVETC  376



>ref|XP_011013611.1| PREDICTED: endo-1,4-beta-xylanase A-like [Populus euphratica]
Length=563

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY I DQM++FV  N
Sbjct  222  PFGSAIARTILGNLPYQNWFVERFNAAVFENELKWYATEPEQGKVNYTIPDQMLEFVLAN  281

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  +LT P +             +YK + IHWDV NE++H+
Sbjct  282  QIVARGHNIFWEDPKYNPAWVRDLTGPALKSAVSSRIQSLMSKYKEEFIHWDVSNEMLHF  341

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   +A+L+ YK   E DP A+LF+N+F VVE C
Sbjct  342  DFYEERL-GPDATLHFYKTAHEADPLASLFLNEFNVVETC  380



>gb|KHG02946.1| Endo-1,4-beta-xylanase A [Gossypium arboreum]
Length=542

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 99/162 (61%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY ++DQM++FV  +
Sbjct  202  PFGSAIAHTILGNLPYQNWFVERFNAAVFENELKWYATEPDQGKTNYTLADQMLEFVRGH  261

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NLT P++             +YK + IHWDV NE++H+
Sbjct  262  QIIARGHNIFWEDPKYTPAWVRNLTGPDLQSAVNSRIQSLMSKYKEEFIHWDVSNEMLHF  321

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ Y+   + DP ATLF+N+F VVE C +
Sbjct  322  DFYEQRL-GPDATLHFYETAHQSDPLATLFMNEFNVVETCSD  362



>ref|XP_011001984.1| PREDICTED: endo-1,4-beta-xylanase A-like isoform X2 [Populus 
euphratica]
Length=560

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY I DQM++FV  N
Sbjct  219  PFGSAIARTILGNLPYQNWFVERFNAAVFENELKWYATEPEQGKVNYTIPDQMLEFVLAN  278

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  +LT P +             +YK + IHWDV NE++H+
Sbjct  279  QIVARGHNIFWEDPKYNPAWVRDLTGPALKSAVSSRIQSLMSKYKEEFIHWDVSNEMLHF  338

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   +A+L+ YK   E DP A+LF+N+F VVE C
Sbjct  339  DFYEERL-GPDATLHFYKTAHEADPLASLFLNEFNVVETC  377



>ref|XP_010690393.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=462

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 104/200 (52%), Gaps = 39/200 (20%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I++ I  N   Q WF KR +A VFEN LKW   EP PG  NY ++DQM++FV  N
Sbjct  122  PIGSAIAATILGNLPYQSWFLKRFDAAVFENELKWYVTEPEPGKTNYTLADQMLEFVRAN  181

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I T GH + W+   + P W   L   E+            DRY+ + IHWDV NE++H+
Sbjct  182  QITTRGHNIFWEHLKYTPPWVTKLEGTELQGAVNSRISGLMDRYREEFIHWDVNNEMLHF  241

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC--------------------  713
            DFYE++L   +A+L  +K   + DP ATLF+N+F VVE C                    
Sbjct  242  DFYEQRL-GPHATLEFFKTAHQADPLATLFMNEFNVVETCNDANSTVDDYVRRLRELKEG  300

Query  714  -----GNTTKGHSDIHNPPY  758
                 G   +GH  + NPP+
Sbjct  301  GVTMDGIGLEGHFTVPNPPF  320



>ref|XP_011001983.1| PREDICTED: endo-1,4-beta-xylanase A-like isoform X1 [Populus 
euphratica]
Length=563

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW + EP  G  NY I DQM++FV  N
Sbjct  222  PFGSAIARTILGNLPYQNWFVERFNAAVFENELKWYATEPEQGKVNYTIPDQMLEFVLAN  281

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  +LT P +             +YK + IHWDV NE++H+
Sbjct  282  QIVARGHNIFWEDPKYNPAWVRDLTGPALKSAVSSRIQSLMSKYKEEFIHWDVSNEMLHF  341

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   +A+L+ YK   E DP A+LF+N+F VVE C
Sbjct  342  DFYEERL-GPDATLHFYKTAHEADPLASLFLNEFNVVETC  380



>ref|XP_006283441.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
 gb|EOA16339.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
Length=560

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 92/162 (57%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY   DQM+ FV  N
Sbjct  219  PIGSAISKTILGNIPYQEWFVKRFDATVFENELKWYATEPDQGKLNYTYPDQMMSFVRAN  278

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT            R  + RY+ + +HWDV NE++H+
Sbjct  279  RIIARGHNIFWEDPKYTPDWVRNLTGSDLRSAVNQRIRSLMTRYRGEFVHWDVSNEMLHF  338

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS   +   +E D  ATLF+NDF VVE C +
Sbjct  339  DFYETRL-GKNASYGFFAAAREIDSLATLFLNDFNVVETCSD  379



>ref|XP_009349686.1| PREDICTED: probable endo-1,4-beta-xylanase C [Pyrus x bretschneideri]
Length=533

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 96/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY I+DQM+ FV  N
Sbjct  193  PFGSAIAKTILGNLPYQDWFAKRFNAAVFENELKWYATEPEQGKTNYIIADQMLQFVRAN  252

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W+DP + P W  NLT  ++             +Y+ + IHWDV NE++H+
Sbjct  253  QVIARGHNIFWEDPKYTPQWVRNLTGSDLQSAINSRIQSLMSKYREEFIHWDVSNEMLHF  312

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE+KL   +A+L+ ++   + DP ATLF+NDF VVE C +
Sbjct  313  DFYEQKL-GPDAALHFFETAHKSDPLATLFMNDFNVVETCSD  353



>emb|CDO96931.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N + Q WFK+R NA VFEN LKW + EP  G  NY I DQM++ +  N
Sbjct  316  PFGSAIAKTIIGNLRYQSWFKERFNAAVFENELKWYATEPKQGQINYTIPDQMLELLRAN  375

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT            +  +++YK + IHWDV NE++H+
Sbjct  376  QIIVRGHNIFWEDPKYTPEWVLNLTDSMLQSAVNSRIKSLMEKYKEEFIHWDVSNEMLHF  435

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   NA+L+ ++   + DP ATLF+N+F VVE C
Sbjct  436  DFYEQRL-GRNATLSFFETAHKSDPLATLFLNEFNVVETC  474



>gb|EMS66498.1| Endo-1,4-beta-xylanase Z [Triticum urartu]
Length=552

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 92/161 (57%), Gaps = 15/161 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WFKKR NA VFEN LKW + EP PG  +Y ++DQ++ FV  +
Sbjct  208  PFGSAISKTILGNKPYQDWFKKRFNAAVFENELKWYATEPAPGKEDYALADQLLQFVQSS  267

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
                 GH + W+DP + P W  NLT  +             + RYK   +HWDV NE++H
Sbjct  268  DAVARGHNIFWEDPKYTPWWVKNLTSADQLRAAVAGRIESLLSRYKGDFVHWDVSNEMLH  327

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +DFYE +L   NA+ + ++  +  DP ATLF+NDF VVE C
Sbjct  328  FDFYESRL-GRNATTDFFRTAKRADPLATLFLNDFNVVEVC  367



>ref|XP_004292166.1| PREDICTED: endo-1,4-beta-xylanase-like, partial [Fragaria vesca 
subsp. vesca]
Length=535

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 96/161 (60%), Gaps = 15/161 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF +R NA VFEN LKW + EP  G   Y I+DQM+ FV  N
Sbjct  194  PFGSAISKTILGNLPYQNWFVERFNAAVFENELKWYATEPQQGNVTYIIADQMLQFVRAN  253

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
            KI T GH + W+DP + P+W  NLT  +             + +YK + IHWDV NE++H
Sbjct  254  KITTRGHNIFWEDPKYTPAWVRNLTSTDQLKSAVNSRIQSLMTKYKEEFIHWDVSNEMLH  313

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +DFYE++L   NA+L+ ++   + DP ATLF+N+F VVE C
Sbjct  314  FDFYEKQL-GPNATLDFFQTAHKSDPLATLFMNEFNVVETC  353



>ref|XP_010690392.1| PREDICTED: endo-1,4-beta-xylanase 5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 104/200 (52%), Gaps = 39/200 (20%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I++ I  N   Q WF KR +A VFEN LKW   EP PG  NY ++DQM++FV  N
Sbjct  202  PIGSAIAATILGNLPYQSWFLKRFDAAVFENELKWYVTEPEPGKTNYTLADQMLEFVRAN  261

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I T GH + W+   + P W   L   E+            DRY+ + IHWDV NE++H+
Sbjct  262  QITTRGHNIFWEHLKYTPPWVTKLEGTELQGAVNSRISGLMDRYREEFIHWDVNNEMLHF  321

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC--------------------  713
            DFYE++L   +A+L  +K   + DP ATLF+N+F VVE C                    
Sbjct  322  DFYEQRL-GPHATLEFFKTAHQADPLATLFMNEFNVVETCNDANSTVDDYVRRLRELKEG  380

Query  714  -----GNTTKGHSDIHNPPY  758
                 G   +GH  + NPP+
Sbjct  381  GVTMDGIGLEGHFTVPNPPF  400



>ref|XP_006343478.1| PREDICTED: uncharacterized protein LOC102583591 [Solanum tuberosum]
Length=543

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 13/146 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++D++++FV +N+I   GH + W+DP + P
Sbjct  222  WFLERFNAAVFEDEIKWYTTEPKQGQLNYTLADELLEFVRRNQITVRGHNIFWEDPKYTP  281

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  NLT  E+             +YK++ +HWDV NEL+H++FYE++L   NA+L  Y+
Sbjct  282  VWVQNLTDSELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFNFYEQRL-GPNATLEFYR  340

Query  648  KVQEKDPNATLFINDFKVVEQCGNTT  725
             V ++DP ATLF+N+F VVE C +T+
Sbjct  341  TVHQQDPLATLFLNEFNVVETCDSTS  366



>ref|XP_003581580.1| PREDICTED: uncharacterized protein LOC100828464 [Brachypodium 
distachyon]
Length=569

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 93/160 (58%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   IS  I  N   Q WF KR NA VFEN LKW + EP+PG  +Y+++DQ+++FV  +
Sbjct  226  PLGSAISKTILGNRPYQEWFSKRFNAAVFENELKWYATEPVPGKEDYSLADQLLNFVQSS  285

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
                 GH + W+DP + P W  NLT  +            + RYK   +HWDV NE++H+
Sbjct  286  DAVARGHNIFWEDPKYTPGWVKNLTGEQLRAAVAGRIESLLSRYKGDFVHWDVSNEMLHF  345

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
             FYE +L   NA+   ++  +  DP ATLF+NDF VVE C
Sbjct  346  GFYEDRL-GRNATAEFFRTARRADPLATLFLNDFNVVEVC  384



>gb|EMT25110.1| Endo-1,4-beta-xylanase Z [Aegilops tauschii]
Length=562

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 92/161 (57%), Gaps = 15/161 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF+KR NA VFEN LKW + EP PG  +Y ++DQ++ FV  +
Sbjct  218  PFGSAISKTILGNKPYQDWFRKRFNAAVFENELKWYATEPAPGKEDYALADQLLQFVQSS  277

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
                 GH + W+DP + P W  NLT  +             + RYK   +HWDV NE++H
Sbjct  278  DAVARGHNIFWEDPKYTPWWVKNLTSADQLRAAVAGRIESLLSRYKGDFVHWDVSNEMLH  337

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +DFYE +L   NA+ + ++  +  DP ATLF+NDF VVE C
Sbjct  338  FDFYESRL-GRNATTDFFRTAKRADPLATLFLNDFNVVEVC  377



>ref|XP_010531544.1| PREDICTED: uncharacterized protein LOC104807819 [Tarenaya hassleriana]
Length=559

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 92/145 (63%), Gaps = 13/145 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF +R +ATVFEN LKW + EP  G  NY I+D+M+ FV  NK+   GH + W+DP + 
Sbjct  236  KWFVERFDATVFENELKWYATEPEEGKINYTIADEMMRFVRTNKLIARGHNIFWEDPLYT  295

Query  501  PSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHYDFYERKLENSNASLNIY  644
            P W  NLT    R  VD        RY+ + +HWDV NE++H+DFYE++L    AS   +
Sbjct  296  PGWVRNLTGDPLRRAVDGRIRSLMRRYRGEFVHWDVSNEMLHFDFYEKRL-GEKASSGFF  354

Query  645  KKVQEKDPNATLFINDFKVVEQCGN  719
            +  +E+D  ATLF+N+F VVE CG+
Sbjct  355  EAAREEDGLATLFLNEFNVVETCGD  379



>ref|XP_008372900.1| PREDICTED: probable endo-1,4-beta-xylanase C [Malus domestica]
Length=550

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 93/162 (57%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY + DQM+ FV  N
Sbjct  210  PFGSAIAKTILGNLPYQNWFAKRFNAAVFENELKWYATEPEQGKTNYTVPDQMLQFVRAN  269

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +    GH + W+DP + P W  NLT  E+             +Y+ + +HWDV NE++H+
Sbjct  270  RXIARGHNIFWEDPKYTPPWVXNLTGSELHLAVNSRIQSLMSKYREEFVHWDVSNEMLHF  329

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE+KL   NA+L+ ++   + DP ATLF+NDF V E C +
Sbjct  330  DFYEQKL-GPNATLHFFETAHKSDPLATLFMNDFNVXETCSD  370



>gb|EPS72309.1| hypothetical protein M569_02449, partial [Genlisea aurea]
Length=526

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 96/164 (59%), Gaps = 16/164 (10%)
 Frame = +3

Query  267  YKPIPIN--ISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDF  437
            YK  P    I+  I  NS+ Q WF  R NA VFEN LKW + E + G  NY I D M++F
Sbjct  183  YKDFPFGSAIAESIIGNSRYQKWFVDRFNAAVFENELKWQATEYIQGELNYTIPDLMMEF  242

Query  438  VTKNKIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNE  581
            +  N+I   GH + W++PN+ P W  NL R  ++            +Y++  +HWDV NE
Sbjct  243  IRSNQIVARGHNIFWENPNYVPRWVLNLGREALESAVKSRIQSLIGKYRDDFVHWDVNNE  302

Query  582  LVHYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            ++H+DFYE KL   NAS+  ++   + DP ATLF+N+F VVE C
Sbjct  303  MLHFDFYEEKL-GRNASVEFFRTANDADPLATLFMNEFNVVETC  345



>ref|XP_002446197.1| hypothetical protein SORBIDRAFT_06g003350 [Sorghum bicolor]
 gb|EES10525.1| hypothetical protein SORBIDRAFT_06g003350 [Sorghum bicolor]
Length=574

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 90/160 (56%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   IS  I  N   Q WF  R NA VFEN LKW + EP PG  +Y  +DQ++  V  N
Sbjct  224  PLGSAISKSIIGNKPYQDWFNARFNAAVFENELKWYATEPSPGKEDYAAADQLLQLVQSN  283

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             +   GH + W+DP + P+W  NLT  +            + RYK   +HWDV NE++H+
Sbjct  284  DVMARGHNIFWEDPKYTPAWVKNLTGSQLKAAVAGRIESLLSRYKGDFVHWDVSNEMLHF  343

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE +L   NA+ + +   +  DP ATLF+NDF VVE C
Sbjct  344  DFYENRL-GGNATADFFSTAKRADPLATLFLNDFNVVEAC  382



>gb|EYU40424.1| hypothetical protein MIMGU_mgv1a020606mg, partial [Erythranthe 
guttata]
Length=520

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF +R NA VFEN LKW + E   G  NY I DQMV+FV  N
Sbjct  180  PFGSAIASTILGNPLYQKWFVERFNAAVFENELKWDATEHTQGQLNYTIPDQMVEFVRSN  239

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
            +I   GH + W++P + P W  NLT  +++            +YK + IHWDV NE++HY
Sbjct  240  QIMARGHNIFWENPKYIPKWVLNLTGSDLESAVESRIESLMNKYKEEFIHWDVSNEMLHY  299

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE+ L   NA+L  +      DP ATLF+N+F VVE C
Sbjct  300  DFYEKNL-GPNATLRFFGSAHRADPLATLFMNEFNVVETC  338



>ref|XP_002866813.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43072.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + EP  G  NY ++D+M++FV  N
Sbjct  221  PIGSAISKTILGNIPYQEWFVKRFDATVFENELKWYATEPDQGKLNYTLADKMMNFVRAN  280

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NL+  ++             RY+ + +HWDV NE++H+
Sbjct  281  RIIARGHNIFWEDPKYNPNWVRNLSGEDLRSAVNRRIKSLMTRYRGEFVHWDVSNEMLHF  340

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L   NAS   +   +E D  ATLF NDF VVE C +
Sbjct  341  DFYESRL-GKNASYGFFAAAREIDSLATLFFNDFNVVETCSD  381



>emb|CAB37521.1| putative protein [Arabidopsis thaliana]
 emb|CAB80529.1| putative protein [Arabidopsis thaliana]
Length=433

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 13/145 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF KR +ATVFEN LKW + EP  G  NY ++D+M++FV  N+I   GH + W+DP + 
Sbjct  109  EWFVKRFDATVFENELKWYATEPDQGKLNYTLADKMMNFVRANRIIARGHNIFWEDPKYN  168

Query  501  PSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIY  644
            P W  NLT  ++             RY+ + +HWDV NE++H+DFYE +L   NAS   +
Sbjct  169  PDWVRNLTGEDLRSAVNRRIKSLMTRYRGEFVHWDVSNEMLHFDFYETRL-GKNASYGFF  227

Query  645  KKVQEKDPNATLFINDFKVVEQCGN  719
               +E D  ATLF NDF VVE C +
Sbjct  228  AAAREIDSLATLFFNDFNVVETCSD  252



>ref|XP_006577900.1| PREDICTED: uncharacterized protein LOC100793558 [Glycine max]
 gb|KHN33681.1| Endo-1,4-beta-xylanase A [Glycine soja]
Length=557

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF KR NA VFEN LKW + EP  G  NY ISDQM+ FV  N
Sbjct  217  PFGSAIAKTILGNLPYQNWFVKRFNAAVFENELKWYATEPDEGKVNYTISDQMLQFVRTN  276

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I   GH + W++P + P W  NLT  ++             +YK++ IHWDV NE++H+
Sbjct  277  NIIARGHNIFWENPKYTPPWVLNLTGTKLQSAVNSRIHSLMSQYKDEFIHWDVSNEMLHF  336

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            +FYE +L   +A+L+ ++   E DP ATLF+NDF VVE C +
Sbjct  337  NFYEERL-GPDATLHFFETAHESDPLATLFMNDFNVVETCSD  377



>gb|KDO68005.1| hypothetical protein CISIN_1g036715mg [Citrus sinensis]
Length=362

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 99/163 (61%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+S I  N   Q WF KR NA VFEN LKW + E   G  NY ++DQM++FV  N
Sbjct  26   PLGSAIASTILGNLPYQKWFVKRFNAAVFENELKWYATEAEQGKVNYTVADQMMEFVRAN  85

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            K+   GH + W++P + P+W  NLT            +  +++YK + IHWDV NE++H+
Sbjct  86   KLIVRGHNIFWENPKYNPTWVRNLTGFQLQSAVNSRIQSLMNKYKEEFIHWDVSNEILHF  145

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            DFYE++L    A+L+ ++   + DP ATLF+N++ VVE C + 
Sbjct  146  DFYEQRL-GPKAALHFFQTAHQSDPLATLFMNEYNVVETCSDV  187



>ref|XP_010313055.1| PREDICTED: endo-1,4-beta-xylanase C isoform X2 [Solanum lycopersicum]
Length=373

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 96/146 (66%), Gaps = 13/146 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++D++++FV +N+I   GH + W+DP + P
Sbjct  52   WFLERFNAAVFEDEIKWYTTEPKQGQLNYTLADELLEFVRRNQITVRGHNIFWEDPKYIP  111

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
            +W  NLT  E+             +YK++ +HWDV NEL+H++FYE++L   +A+   Y+
Sbjct  112  AWVQNLTDSELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFNFYEQRL-GPDATHEFYR  170

Query  648  KVQEKDPNATLFINDFKVVEQCGNTT  725
             V ++DP ATLF+N+F VVE C +++
Sbjct  171  TVHQQDPLATLFLNEFNVVETCDSSS  196



>ref|NP_195577.2| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 gb|AAO42885.1| At4g38650 [Arabidopsis thaliana]
 dbj|BAE99535.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86958.1| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
Length=562

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 13/145 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF KR +ATVFEN LKW + EP  G  NY ++D+M++FV  N+I   GH + W+DP + 
Sbjct  238  EWFVKRFDATVFENELKWYATEPDQGKLNYTLADKMMNFVRANRIIARGHNIFWEDPKYN  297

Query  501  PSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIY  644
            P W  NLT  ++             RY+ + +HWDV NE++H+DFYE +L   NAS   +
Sbjct  298  PDWVRNLTGEDLRSAVNRRIKSLMTRYRGEFVHWDVSNEMLHFDFYETRL-GKNASYGFF  356

Query  645  KKVQEKDPNATLFINDFKVVEQCGN  719
               +E D  ATLF NDF VVE C +
Sbjct  357  AAAREIDSLATLFFNDFNVVETCSD  381



>ref|XP_002534153.1| Endo-1,4-beta-xylanase A precursor, putative [Ricinus communis]
 gb|EEF28229.1| Endo-1,4-beta-xylanase A precursor, putative [Ricinus communis]
Length=473

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+  +ISS I  N   Q WF +R NA VFEN LKW + EP  G  NY I D+M++ +  N
Sbjct  133  PLGSSISSKILGNLPYQNWFVERFNAAVFENELKWYATEPEQGKVNYTIPDKMLELLRAN  192

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NL+            +  + +YK + IHWDV NE++H+
Sbjct  193  QITGRGHNIFWEDPKYTPKWVQNLSGDALKSAVNSRIQSLMSKYKEEFIHWDVSNEMLHF  252

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            DFYE++L   +A+L+ Y+   + DP ATLF+N+F VVE C
Sbjct  253  DFYEQRL-GPDATLHFYETAHQADPLATLFMNEFNVVETC  291



>ref|XP_006422633.1| hypothetical protein CICLE_v10030219mg, partial [Citrus clementina]
 gb|ESR35873.1| hypothetical protein CICLE_v10030219mg, partial [Citrus clementina]
Length=496

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 99/163 (61%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+S I  N   Q WF KR NA VFEN LKW + E   G  NY ++DQM++FV  N
Sbjct  188  PLGSAIASTILGNLPYQKWFVKRFNAAVFENELKWYATEAEQGKVNYTVADQMMEFVRAN  247

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            K+   GH + W++P + P+W  NLT            +  +++YK + IHWDV NE++H+
Sbjct  248  KLIVRGHNIFWENPKYNPTWVRNLTGFQLQSAVNSRIQSLMNKYKEEFIHWDVSNEILHF  307

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            DFYE++L    A+L+ ++   + DP ATLF+N++ VVE C + 
Sbjct  308  DFYEQRL-GPKAALHFFQTAHQSDPLATLFMNEYNVVETCSDV  349



>ref|XP_004250707.1| PREDICTED: uncharacterized protein LOC101263970 isoform X1 [Solanum 
lycopersicum]
Length=549

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 96/146 (66%), Gaps = 13/146 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF +R NA VFE+ +KW + EP  G  NY ++D++++FV +N+I   GH + W+DP + P
Sbjct  228  WFLERFNAAVFEDEIKWYTTEPKQGQLNYTLADELLEFVRRNQITVRGHNIFWEDPKYIP  287

Query  504  SWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
            +W  NLT  E+             +YK++ +HWDV NEL+H++FYE++L   +A+   Y+
Sbjct  288  AWVQNLTDSELKSAVNSRIQSLMSKYKDEFVHWDVNNELLHFNFYEQRL-GPDATHEFYR  346

Query  648  KVQEKDPNATLFINDFKVVEQCGNTT  725
             V ++DP ATLF+N+F VVE C +++
Sbjct  347  TVHQQDPLATLFLNEFNVVETCDSSS  372



>gb|KDP29627.1| hypothetical protein JCGZ_18789 [Jatropha curcas]
Length=443

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 95/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF +R NA VFEN LKW   EP  G  NY I DQM++ +  N
Sbjct  103  PFGSAIARTILGNEPYQKWFVERFNAAVFENELKWYVTEPEQGKLNYTIPDQMLELIRAN  162

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P+W  NL+            +  + +YK + IHWDV NE++H+
Sbjct  163  QISVRGHNIFWEDPKYTPAWVRNLSSDALKLAVNSRIQSLMSKYKEEFIHWDVSNEMLHF  222

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE++L   +A+L+ ++   + DP ATLF+N+F VVE C +
Sbjct  223  DFYEQRL-GPDATLHFFETAHKVDPLATLFMNEFNVVETCSD  263



>ref|XP_002468186.1| hypothetical protein SORBIDRAFT_01g041310 [Sorghum bicolor]
 gb|EER95184.1| hypothetical protein SORBIDRAFT_01g041310 [Sorghum bicolor]
Length=560

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 96/160 (60%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITEN-SQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+S I  N +  QWF  R NA VFE+ LKW S EP+ G+  +++ DQM+ FV  +
Sbjct  220  PIGSAIASTILGNQAYQQWFVDRFNAAVFEDELKWYSTEPMSGLLRFDVPDQMLAFVRSH  279

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  P W  NLT  ++             RY+ +  HWDV NE++HY
Sbjct  280  RVMVRGHNIFWENQDATPRWVKNLTADDLRSAVNTRIQSLMTRYRGEFAHWDVNNEMLHY  339

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L   NAS++ +   Q+ DP ATLF+N++ V+E C
Sbjct  340  NFYEQRL-GPNASMDFFSVAQDADPLATLFMNEYNVIETC  378



>ref|XP_006851910.1| hypothetical protein AMTR_s00041p00160040 [Amborella trichopoda]
 gb|ERN13377.1| hypothetical protein AMTR_s00041p00160040 [Amborella trichopoda]
Length=547

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 14/145 (10%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKT-GGHIVLWQDPNFA  500
            WF +R NA VFEN LKW + EP PG  NY++ DQ++  V    I T  GH + W+DP + 
Sbjct  224  WFAERFNAAVFENELKWYATEPEPGKLNYSLPDQLLRLVRSRGIPTIRGHNIFWEDPVYT  283

Query  501  PSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIY  644
            PSW  NL+            +  + RYK + +HWDV NE++H+DFYE +L   NA+   +
Sbjct  284  PSWVRNLSGNALLQAVNSRIQSLMSRYKGEFVHWDVSNEMLHFDFYESRL-GPNATAYFF  342

Query  645  KKVQEKDPNATLFINDFKVVEQCGN  719
            +  +  DP ATLF+NDF VVE CG+
Sbjct  343  ETAKRSDPWATLFMNDFNVVETCGD  367



>ref|XP_004985034.1| PREDICTED: uncharacterized protein LOC101776078 [Setaria italica]
Length=560

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITEN-SQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+S I  N +  QWF  R NA VFE+ LKW S EP+ G+  +++ DQM+ FV  +
Sbjct  220  PIGSAIASTILGNQAYQQWFVDRFNAAVFEDELKWYSTEPMSGLLRFDVPDQMLAFVRSH  279

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  P W  NLT  ++             RY+ +  HWDV NE++HY
Sbjct  280  RVMVRGHNIFWENQDATPRWVKNLTADDLRSAVNTRIQSLMTRYRGEFAHWDVNNEMLHY  339

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L   NAS+  +   Q+ DP ATLF+N++ V+E C
Sbjct  340  NFYEQRL-GPNASMEFFSVAQDADPLATLFMNEYNVIETC  378



>ref|NP_001049529.1| Os03g0243700 [Oryza sativa Japonica Group]
 dbj|BAF11443.1| Os03g0243700 [Oryza sativa Japonica Group]
Length=401

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 96/164 (59%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  61   PFGSAIASTILGNQAYQKWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  120

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  PSW   L+    R  V+        RY+ +  HWDV NE++HY
Sbjct  121  RVMVRGHNIFWENQDATPSWVKGLSPDDLRAAVNGRIQNLMTRYRGEFAHWDVNNEMLHY  180

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            +FYE++L  +NAS+  +   Q+ DP ATLF+N+F V+E C + +
Sbjct  181  NFYEQRL-GANASVEFFSVAQDADPLATLFMNEFNVIETCDDVS  223



>tpg|DAA44350.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=470

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 94/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITEN-SQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+S I  N +  QWF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  130  PIGSAIASTILGNQAYQQWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  189

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  P W  NLT    R  V+        RY+ +  HWDV NE++HY
Sbjct  190  RVMVRGHNIFWENQDATPRWVKNLTADDLRAAVNTRIQSLMTRYRGEFAHWDVNNEMLHY  249

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L   NAS   +   Q+ DP ATLF+N++ V+E C
Sbjct  250  NFYEQRL-GPNASAEFFSVAQDADPLATLFMNEYNVIETC  288



>gb|ABF94922.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=470

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 96/164 (59%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  130  PFGSAIASTILGNQAYQKWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  189

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  PSW   L+    R  V+        RY+ +  HWDV NE++HY
Sbjct  190  RVMVRGHNIFWENQDATPSWVKGLSPDDLRAAVNGRIQNLMTRYRGEFAHWDVNNEMLHY  249

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            +FYE++L  +NAS+  +   Q+ DP ATLF+N+F V+E C + +
Sbjct  250  NFYEQRL-GANASVEFFSVAQDADPLATLFMNEFNVIETCDDVS  292



>ref|NP_001140909.1| uncharacterized protein LOC100272986 precursor [Zea mays]
 gb|ACF84937.1| unknown [Zea mays]
 tpg|DAA44349.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=560

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 94/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITEN-SQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+S I  N +  QWF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  220  PIGSAIASTILGNQAYQQWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  279

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  P W  NLT    R  V+        RY+ +  HWDV NE++HY
Sbjct  280  RVMVRGHNIFWENQDATPRWVKNLTADDLRAAVNTRIQSLMTRYRGEFAHWDVNNEMLHY  339

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L   NAS   +   Q+ DP ATLF+N++ V+E C
Sbjct  340  NFYEQRL-GPNASAEFFSVAQDADPLATLFMNEYNVIETC  378



>gb|ABF94921.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=558

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  218  PFGSAIASTILGNQAYQKWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  277

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  PSW   L+    R  V+        RY+ +  HWDV NE++HY
Sbjct  278  RVMVRGHNIFWENQDATPSWVKGLSPDDLRAAVNGRIQNLMTRYRGEFAHWDVNNEMLHY  337

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L  +NAS+  +   Q+ DP ATLF+N+F V+E C
Sbjct  338  NFYEQRL-GANASVEFFSVAQDADPLATLFMNEFNVIETC  376



>gb|ABF94920.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=563

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  223  PFGSAIASTILGNQAYQKWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  282

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  PSW   L+    R  V+        RY+ +  HWDV NE++HY
Sbjct  283  RVMVRGHNIFWENQDATPSWVKGLSPDDLRAAVNGRIQNLMTRYRGEFAHWDVNNEMLHY  342

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L  +NAS+  +   Q+ DP ATLF+N+F V+E C
Sbjct  343  NFYEQRL-GANASVEFFSVAQDADPLATLFMNEFNVIETC  381



>gb|EEC74851.1| hypothetical protein OsI_10717 [Oryza sativa Indica Group]
 gb|EEE58681.1| hypothetical protein OsJ_10107 [Oryza sativa Japonica Group]
Length=717

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  377  PFGSAIASTILGNQAYQKWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  436

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  PSW   L+    R  V+        RY+ +  HWDV NE++HY
Sbjct  437  RVMVRGHNIFWENQDATPSWVKGLSPDDLRAAVNGRIQNLMTRYRGEFAHWDVNNEMLHY  496

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L  +NAS+  +   Q+ DP ATLF+N+F V+E C
Sbjct  497  NFYEQRL-GANASVEFFSVAQDADPLATLFMNEFNVIETC  535



>ref|XP_006649724.1| PREDICTED: uncharacterized protein LOC102701898 [Oryza brachyantha]
Length=558

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFE+ LKW S EP+ G   +++ DQM+ FV  +
Sbjct  218  PFGSAIASTILGNQAYQKWFVDRFNAAVFEDELKWYSTEPMSGQLRFDVPDQMLAFVRSH  277

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  PSW   L+    R  V+        RY+ +  HWDV NE++HY
Sbjct  278  RVMVRGHNIFWENQDATPSWVKGLSPDDLRAAVNGRIQNLMTRYRGEFAHWDVNNEMLHY  337

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            +FYE++L   NAS   +   Q+ DP ATLF+N+F V+E C
Sbjct  338  NFYEQRL-GPNASAEFFSVAQDADPLATLFMNEFNVIETC  376



>ref|XP_002980942.1| hypothetical protein SELMODRAFT_420481 [Selaginella moellendorffii]
 gb|EFJ18127.1| hypothetical protein SELMODRAFT_420481 [Selaginella moellendorffii]
Length=586

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 88/158 (56%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I +N   Q WF  R N  VFEN +KW S E   G  +Y  +D+M+DF   N
Sbjct  262  PFGSAIASTILDNPTYQKWFVTRFNTAVFENEMKWYSTERQQGKVSYETADKMLDFCKAN  321

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I   GH VLW DP + P W  +L+  E+              Y  KL  WDV NE++H+
Sbjct  322  NILVRGHNVLWNDPQYQPGWVKDLSASELRTATMSRIESVMSHYAGKLPQWDVLNEMLHF  381

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            +F+E KL  SNA++ IYK  QE DP  TLF+NDF V+E
Sbjct  382  NFFESKL-GSNAAVEIYKFAQEIDPETTLFLNDFNVIE  418



>ref|XP_002989316.1| hypothetical protein SELMODRAFT_129690, partial [Selaginella 
moellendorffii]
 gb|EFJ09590.1| hypothetical protein SELMODRAFT_129690, partial [Selaginella 
moellendorffii]
Length=554

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 89/158 (56%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I +N   Q WF  R N  VFEN +KW S E   G  +Y  +D+M+DF   N
Sbjct  212  PFGSAIASTILDNPTYQKWFVTRFNTAVFENEMKWYSTERQQGKVSYETADKMLDFCKAN  271

Query  450  KIKTGGHIVLWQDPNFAPSW----------TCNLTRPE--VDRYKNKLIHWDVKNELVHY  593
             I   GH VLW DP + P W          T  ++R E  +  Y  KL  WDV NE++H+
Sbjct  272  NILVRGHNVLWNDPQYQPGWVKDLSDSELRTATMSRIESVMSHYAGKLPQWDVLNEMLHF  331

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            +F+E KL  SNA++ IYK  QE DP  TLF+NDF V+E
Sbjct  332  NFFESKL-GSNAAVEIYKFAQEIDPETTLFLNDFNVIE  368



>gb|EMT22806.1| Endo-1,4-beta-xylanase Z [Aegilops tauschii]
Length=552

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 96/164 (59%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+S I  N   Q WF  R NA VFE+ LKW S EP  G+  +++ DQM+ FV  +
Sbjct  212  PLGSAIASTILGNDAYQKWFVDRFNAAVFEDELKWYSTEPASGLLRFDVPDQMLAFVRSH  271

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            ++   GH + W++ +  P W   L+    R  V+        RY+ +  HWDV NE++H+
Sbjct  272  RVMVRGHNIFWENQDATPRWVKGLSPDDLRSAVNTRIQSLMTRYRGEFAHWDVNNEMLHF  331

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            +FYE++L  +NA++  +   Q+ DP ATLF+N++ VVE C + +
Sbjct  332  NFYEQRL-GANATMEFFSVAQDADPLATLFMNEYNVVETCDDAS  374



>ref|NP_195543.1| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 emb|CAB37486.1| putative protein [Arabidopsis thaliana]
 emb|CAB80495.1| putative protein [Arabidopsis thaliana]
 gb|AEE86911.1| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
Length=277

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 88/162 (54%), Gaps = 24/162 (15%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   IS  I  N   Q WF KR +ATVFEN LKW + E   G  NY ++D+M++ V  N
Sbjct  43   PIGSAISKTILGNIPYQEWFVKRFDATVFENELKWYATESDQGKLNYTLADKMMNLVRAN  102

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
            +I   GH + W+DP + P W  NLT  ++             RY+ + +HWDV NE++H+
Sbjct  103  RIIARGHNIFWEDPKYNPDWVRNLTGEDLRSAVNRRIKSLMTRYRGEFVHWDVSNEMLHF  162

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DFYE +L       N+       D  ATLF NDF VVE C +
Sbjct  163  DFYESRLGK-----NVI------DSLATLFFNDFNVVETCSD  193



>ref|XP_003558355.1| PREDICTED: uncharacterized protein LOC100841372 [Brachypodium 
distachyon]
Length=563

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 91/161 (57%), Gaps = 16/161 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   Q WF  R NA VFE+ LKW S EP  G+  +++ DQM+ FV  +
Sbjct  223  PFGSAIASTILGNEAYQKWFVDRFNAAVFEDELKWYSTEPASGLLRFDVPDQMLAFVRSH  282

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
            ++   GH + W++    P W   L+ PE             + RY+ +  HWDV NE++H
Sbjct  283  RVMVRGHNIFWENQEATPRWVKGLS-PEDLRSAVNTRIQSLMTRYRGEFAHWDVNNEMLH  341

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
            Y+FYE++L   NA++  +   Q+ DP ATLF+N++ V+E C
Sbjct  342  YNFYEQRL-GPNATVEFFSVAQDADPLATLFMNEYNVIETC  381



>ref|XP_011002023.1| PREDICTED: uncharacterized protein LOC105109118 [Populus euphratica]
 ref|XP_011002028.1| PREDICTED: uncharacterized protein LOC105109118 [Populus euphratica]
Length=574

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 84/158 (53%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R   T F N +KW SNEP  G  NY ++D MV F  KN
Sbjct  232  PFGCGMNFHIIDSTDYQNWFASRFKYTTFTNQMKWYSNEPKQGQENYTVADTMVKFAKKN  291

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH +LW DP + P W  NLT  E            V RY  +LI WDV NE +H+
Sbjct  292  GISIRGHNILWDDPKYQPEWVKNLTSDELRKAAAKRVDSVVSRYAGQLIAWDVINENLHF  351

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E KL   NAS   +K+  E DP  T+F+N+F  +E
Sbjct  352  SFFEDKL-GKNASSRYFKRAYELDPKTTMFLNEFNTIE  388



>ref|XP_011013777.1| PREDICTED: uncharacterized protein LOC105117723 [Populus euphratica]
 ref|XP_011013778.1| PREDICTED: uncharacterized protein LOC105117723 [Populus euphratica]
Length=574

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 84/158 (53%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R   T F N +KW SNEP  G  NY ++D MV F  KN
Sbjct  232  PFGCGMNFHIIDSTDYQNWFASRFKYTTFTNQMKWYSNEPKQGQENYTVADTMVKFAKKN  291

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH +LW DP + P W  NLT  E            V RY  +LI WDV NE +H+
Sbjct  292  GISIRGHNILWDDPKYQPEWVKNLTSDELRKAAAKRVDSVVSRYAGQLIAWDVINENLHF  351

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E KL   NAS   +K+  E DP  T+F+N+F  +E
Sbjct  352  SFFEDKL-GKNASSRYFKRAYELDPKTTMFLNEFNTIE  388



>ref|XP_002313182.1| hypothetical protein POPTR_0009s09080g [Populus trichocarpa]
 gb|EEE87137.1| hypothetical protein POPTR_0009s09080g [Populus trichocarpa]
Length=542

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 84/158 (53%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R   T F N +KW SNEP  G  NY ++D MV F  +N
Sbjct  200  PFGCGMNFHIIDSTDYQNWFASRFKYTTFTNQMKWYSNEPKQGQENYTVADTMVKFAQQN  259

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH +LW DP + P W  NLT  E            V RY  +LI WDV NE +H+
Sbjct  260  GISIRGHNILWDDPKYQPEWVKNLTSDELRKAAAKRVDSVVSRYAGQLIAWDVMNENLHF  319

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E KL   NAS   +K+  E DP  T+F+N+F  +E
Sbjct  320  SFFEDKL-GKNASSRYFKRAYELDPKTTMFLNEFNTIE  356



>ref|XP_009783073.1| PREDICTED: uncharacterized protein LOC104231720 [Nicotiana sylvestris]
Length=577

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 86/164 (52%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF  R   TVFEN +KW +NE +PG  +YN++D M+  V K 
Sbjct  231  PFGNAISQHILNNKAYQDWFTSRFKYTVFENEMKWYANEKIPGQLDYNVADAMLSLVQKY  290

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             +K  GH V W +P   PSW C L+  ++            +RY  +LIHWDV NE VH+
Sbjct  291  NVKVRGHNVFWDNPQNMPSWACYLSPAQLSAAASRRINSVMNRYLGQLIHWDVVNENVHF  350

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             F E+ L   NAS   YKK  E D  A  F+NDF  +E   + T
Sbjct  351  SFLEQML-GKNASAVYYKKANEIDSKAIPFLNDFNTIEHGFDGT  393



>ref|XP_011076914.1| PREDICTED: uncharacterized protein LOC105161047 [Sesamum indicum]
Length=580

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 92/165 (56%), Gaps = 17/165 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  ++  Q WF  R   TVFEN +KW  NE + GV +Y+++D MV F   +
Sbjct  228  PFGTAISGHILNSTAYQNWFTSRFRYTVFENEMKWYFNEVVRGVVDYSVTDAMVQFAKSH  287

Query  450  KIKTGGHIVLWQDPNFAPSWTCN--LTRPE-------------VDRYKNKLIHWDVKNEL  584
             +   GH VLW+D NF P W  +  + R E             ++RYK +LIHWDV NE 
Sbjct  288  GVAIRGHTVLWEDRNFQPPWLIDFPINRSEEYRALTNSRVHSVMNRYKGQLIHWDVVNEN  347

Query  585  VHYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            +H+ F + +L   N+S   YKK  E DPNA LF+N++  VE+ G+
Sbjct  348  LHHWFIQDRL-GKNSSAVYYKKAHEIDPNALLFLNEYMTVEKSGD  391



>ref|XP_007042651.1| Glycosyl hydrolase family 10 protein, putative [Theobroma cacao]
 gb|EOX98482.1| Glycosyl hydrolase family 10 protein, putative [Theobroma cacao]
Length=578

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 92/165 (56%), Gaps = 14/165 (8%)
 Frame = +3

Query  270  KPIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTK  446
            KP+    +  I +N+  Q WF  R   T FE+ +KW S EP  G  +Y+++D M+  + +
Sbjct  229  KPVGCATNKNILDNTAYQNWFTSRFTHTTFEDEMKWYSTEPTQGKEDYSVADSMMQLMKQ  288

Query  447  NKIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVH  590
            + I   GH + W DPNF PSW  +L   ++             +YK ++I WDV NE +H
Sbjct  289  HNILVRGHNIFWDDPNFQPSWVPSLQPKDLSEAANKRINSIMSKYKGQVIAWDVVNENLH  348

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            ++F+E KL   +AS   YK   + DP+ TLF+N+F  +E+ G++ 
Sbjct  349  FNFFESKL-GEDASSTFYKMAHDIDPSTTLFMNEFNTIEESGDSA  392



>ref|XP_010095699.1| putative endo-1,4-beta-xylanase C [Morus notabilis]
 gb|EXC41981.1| putative endo-1,4-beta-xylanase C [Morus notabilis]
Length=635

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 85/158 (54%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R  AT F N +KW S E   G  NY I+D M++F   N
Sbjct  216  PFGCGMNYHILQSTDYQNWFSSRFKATTFTNEMKWYSTEKGQGEENYTIADAMMEFAQSN  275

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I+  GH V W +P + PSW  +L+  E            V RY  KLI WDV NE +H+
Sbjct  276  GIRVRGHNVFWDNPKYQPSWVKSLSTDELRSAAAKRISSVVSRYSGKLIGWDVVNENLHF  335

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E KL + NAS   Y   Q+ DPN T+F+N++  +E
Sbjct  336  SFFEDKL-SQNASAEFYHIAQQLDPNTTMFLNEYNTIE  372



>ref|XP_007201537.1| hypothetical protein PRUPE_ppa016947mg, partial [Prunus persica]
 gb|EMJ02736.1| hypothetical protein PRUPE_ppa016947mg, partial [Prunus persica]
Length=530

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 84/150 (56%), Gaps = 13/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T N+   WF  R   T FE+ +KW SNEP PG  +Y+ +D M+ F   + I   GH V
Sbjct  239  ILTNNAYQNWFTSRFRVTTFEDEMKWYSNEPSPGREDYSAADAMLQFARSHGIAVRGHNV  298

Query  477  LWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W DP+F P W  +LT+ ++             RYK ++I WDV NE +H++F+E KL  
Sbjct  299  FWDDPHFQPGWVNSLTKRQLFSATFKRLNSIMHRYKGQVIGWDVVNENLHWNFFESKL-G  357

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQ  710
            S AS  +Y    + D   TLF+N+F  +E+
Sbjct  358  SKASALMYNWAVKADGANTLFMNEFNTIEE  387



>ref|XP_011013781.1| PREDICTED: uncharacterized protein LOC105117724 isoform X2 [Populus 
euphratica]
Length=563

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            +I       WF  R   T F N +KW S E + G  NY ++D MV F  +N I   GH +
Sbjct  226  IINSTDYQNWFALRFKYTTFTNEMKWYSTEKIQGQENYTVADAMVRFAQQNGISIRGHNI  285

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W +P + P W  NLT  E            V RY  KLI WDV NE +H+ F+E KL  
Sbjct  286  FWDNPVYQPHWVKNLTSEELQKAAAQRIKSVVSRYAGKLIAWDVMNENLHFSFFEDKL-G  344

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             NAS   Y +  + DP+ T+F+N++  +E  G+ T
Sbjct  345  KNASAEYYARAYQLDPDTTMFLNEYNTIEYSGDET  379



>ref|XP_008236353.1| PREDICTED: uncharacterized protein LOC103335128 [Prunus mume]
Length=578

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 84/150 (56%), Gaps = 13/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T N+   WF  R   T FE+ +KW SNEP PG  +Y+ +D M+ F   + I   GH V
Sbjct  239  ILTNNAYQNWFTSRFRVTTFEDEMKWYSNEPSPGREDYSAADAMLQFARSHGIAVRGHNV  298

Query  477  LWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W DP+F P W  +LT+ ++             RYK ++I WDV NE +H++F+E KL  
Sbjct  299  FWDDPHFQPGWVNSLTKRQLFSATFKRVNSIMHRYKGQVIGWDVVNENLHWNFFESKL-G  357

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQ  710
            S AS  +Y    + D   TLF+N+F  +E+
Sbjct  358  SKASALMYNWAVKADGANTLFMNEFNTIEE  387



>gb|KCW55102.1| hypothetical protein EUGRSUZ_I01061, partial [Eucalyptus grandis]
Length=523

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 84/149 (56%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T  +   WF  R   T FE+ +KW + EP  G  +Y+ +D M++F  ++ I   GH V
Sbjct  203  ILTNAAYQNWFTSRFTVTTFEDEMKWYTTEPSQGREDYSAADAMLNFARQHGISVRGHNV  262

Query  477  LWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW DP + PSW  +L+  ++             RYK ++I WDV NE +H+ F+E KL  
Sbjct  263  LWDDPRYQPSWVPSLSASQLSKAVANRIMSIMKRYKGQVIGWDVVNENLHFSFFESKL-G  321

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
            S AS N YK  +  DP+ TLF+N++  +E
Sbjct  322  SQASANAYKTAKYMDPSTTLFLNEYNTIE  350



>ref|XP_011013779.1| PREDICTED: uncharacterized protein LOC105117724 isoform X1 [Populus 
euphratica]
Length=578

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            +I       WF  R   T F N +KW S E + G  NY ++D MV F  +N I   GH +
Sbjct  241  IINSTDYQNWFALRFKYTTFTNEMKWYSTEKIQGQENYTVADAMVRFAQQNGISIRGHNI  300

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W +P + P W  NLT  E            V RY  KLI WDV NE +H+ F+E KL  
Sbjct  301  FWDNPVYQPHWVKNLTSEELQKAAAQRIKSVVSRYAGKLIAWDVMNENLHFSFFEDKL-G  359

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             NAS   Y +  + DP+ T+F+N++  +E  G+ T
Sbjct  360  KNASAEYYARAYQLDPDTTMFLNEYNTIEYSGDET  394



>ref|XP_010274480.1| PREDICTED: endo-1,4-beta-xylanase D-like [Nelumbo nucifera]
Length=579

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 85/164 (52%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF  R   T FEN +KW S E  PG  NY+++D M+ F  KN
Sbjct  235  PFGAAIAQTILHNPTYQKWFTSRFTVTTFENEMKWYSTENSPGKENYSVADAMLQFTRKN  294

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
             I+  GH V W DP + P W   L+  +++            RYK ++I WDV NE +H+
Sbjct  295  GIRVRGHNVFWDDPKYQPWWVPKLSYSQLNQAAWKRINSIMSRYKGQVIAWDVVNENLHF  354

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             F+E +L   NAS   YKK  + D  A +F+N++  +E   + T
Sbjct  355  SFFEDRL-GRNASAAFYKKAHQLDDRAIMFLNEYNTIEDSRDGT  397



>ref|XP_006651140.1| PREDICTED: uncharacterized protein LOC102718726 [Oryza brachyantha]
Length=569

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 84/163 (52%), Gaps = 15/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +SS I  N   Q WF  R     FEN +KW S EP PG  +Y++ D M++F  ++
Sbjct  226  PLGAAMSSEILRNPTYQSWFASRFTVATFENEMKWYSTEPAPGREDYSVPDAMLEFARQH  285

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W DPN  P W   L  P+            V RY  KLI WDV NE +HY
Sbjct  286  GIAVRGHNVFWDDPNQQPRWVQALPYPQLLAAASRRIRSVVARYAGKLIAWDVVNENLHY  345

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATL-FINDFKVVEQCGN  719
             F+ER+    +AS   Y   +  D  +TL F+N++  +EQ G+
Sbjct  346  SFFERRF-GWDASTAFYAAARMLDGGSTLMFMNEYNTLEQPGD  387



>ref|XP_008372757.1| PREDICTED: uncharacterized protein LOC103436117 [Malus domestica]
Length=576

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 82/161 (51%), Gaps = 14/161 (9%)
 Frame = +3

Query  264  SYKPIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFV  440
            S+ P    ++  I  NS  Q WF  R   T F N +KW S E   G  NY I+D MV F 
Sbjct  226  SHFPFGCGMNHYILTNSDYQKWFASRFKWTTFTNEMKWYSTEKARGQENYTIADNMVKFA  285

Query  441  TKNKIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNEL  584
             KN I   GH V W DP + P W  +L+  E            V RY+ +LI WDV NE 
Sbjct  286  QKNGISIRGHNVFWDDPKYQPDWVKSLSPEEVRTAAAKRINSVVSRYQGQLIAWDVVNEN  345

Query  585  VHYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            +H+ FYE  L   NAS   Y   Q+ DP+ T+F+N++  +E
Sbjct  346  LHFSFYEDNL-GENASAEFYSTAQQLDPDTTMFMNEYNTME  385



>gb|AAN10199.1| endoxylanase [Carica papaya]
Length=584

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 81/149 (54%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  N+   WF  R   T FEN +KW S EP  G  +Y+ +D MV F  KN I   GH V
Sbjct  242  IVNNNAYQSWFSSRFTVTTFENEMKWASTEPSQGHEDYSTADAMVQFAKKNGIAIRGHNV  301

Query  477  LWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W DP +   W  +L+  ++            +RYK ++I WDV NE +H+ F+E KL  
Sbjct  302  FWDDPKYQSGWVSSLSPNDLNAAATKRINSVMNRYKGQVIGWDVVNENLHFSFFESKL-G  360

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
            +NAS   Y +  + DP+ TLF+N++  VE
Sbjct  361  ANASAVFYGEAHKTDPSTTLFMNEYNTVE  389



>ref|XP_010030624.1| PREDICTED: uncharacterized protein LOC104420483 [Eucalyptus grandis]
Length=611

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 84/149 (56%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T  +   WF  R   T FE+ +KW + EP  G  +Y+ +D M++F  ++ I   GH V
Sbjct  244  ILTNAAYQNWFTSRFTVTTFEDEMKWYTTEPSQGREDYSAADAMLNFARQHGISVRGHNV  303

Query  477  LWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW DP + PSW  +L+  ++             RYK ++I WDV NE +H+ F+E KL  
Sbjct  304  LWDDPRYQPSWVPSLSASQLSKAVANRIMSIMKRYKGQVIGWDVVNENLHFSFFESKL-G  362

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
            S AS N YK  +  DP+ TLF+N++  +E
Sbjct  363  SQASANAYKTAKYMDPSTTLFLNEYNTIE  391



>gb|ABF94504.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ25956.1| hypothetical protein OsJ_09811 [Oryza sativa Japonica Group]
Length=567

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 84/163 (52%), Gaps = 15/163 (9%)
 Frame = +3

Query  273  PIPINISSMITEN-SQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  N S  +WF  R   T FEN +KW S EP PG  +Y++ D M++F   +
Sbjct  224  PLGAAMSGEILRNPSYQRWFASRFTVTTFENEMKWYSTEPAPGREDYSVPDAMLEFARSH  283

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W DPN  P W   L  P+            V RY  KLI WDV NE +H+
Sbjct  284  GIAVRGHNVFWDDPNQQPRWVQGLPYPQLLAAASRRIRSVVARYAGKLIAWDVVNENLHF  343

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATL-FINDFKVVEQCGN  719
             F+ER+    +AS   Y   +  D  +TL F+N++  +EQ G+
Sbjct  344  SFFERRF-GWDASTAFYAAARMLDTGSTLMFMNEYNTLEQPGD  385



>ref|XP_003561934.2| PREDICTED: uncharacterized protein LOC100835383 [Brachypodium 
distachyon]
Length=579

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 82/163 (50%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  N   Q WF KR   T FEN +KW S E   G  +Y++ D MV F   +
Sbjct  236  PLGAAMSQEILRNQAYQSWFTKRFTVTTFENEMKWYSTEQAQGREDYSVPDAMVRFARGH  295

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
             IK  GH + W DP   P W  NL+    R   D        RY  K+I WDV NE VH+
Sbjct  296  GIKVRGHNIFWDDPGTQPGWVRNLSPDQLRRAADRRIKSVMSRYAGKVIAWDVVNENVHF  355

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            DFYE K     AS   Y+K  + D  A + +ND+  +EQ G+T
Sbjct  356  DFYEGKF-GWQASPAFYRKAHQIDGGALMSMNDYNTLEQPGDT  397



>ref|NP_001173303.1| Os03g0201400 [Oryza sativa Japonica Group]
 dbj|BAH92031.1| Os03g0201400 [Oryza sativa Japonica Group]
Length=339

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 82/161 (51%), Gaps = 15/161 (9%)
 Frame = +3

Query  288  ISSMITEN-SQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTG  464
            +S  I  N S  +WF  R   T FEN +KW S EP PG  +Y++ D M++F   + I   
Sbjct  1    MSGEILRNPSYQRWFASRFTVTTFENEMKWYSTEPAPGREDYSVPDAMLEFARSHGIAVR  60

Query  465  GHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYER  608
            GH V W DPN  P W   L  P+            V RY  KLI WDV NE +H+ F+ER
Sbjct  61   GHNVFWDDPNQQPRWVQGLPYPQLLAAASRRIRSVVARYAGKLIAWDVVNENLHFSFFER  120

Query  609  KLENSNASLNIYKKVQEKDPNATL-FINDFKVVEQCGNTTK  728
            +    +AS   Y   +  D  +TL F+N++  +EQ G+   
Sbjct  121  RF-GWDASTAFYAAARMLDTGSTLMFMNEYNTLEQPGDMAA  160



>ref|XP_011002043.1| PREDICTED: uncharacterized protein LOC105109135 isoform X2 [Populus 
euphratica]
Length=563

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            +I       WF  R   T F N +KW S E + G  NY ++D MV F  +N I   GH +
Sbjct  226  IINSTDYQNWFALRFKYTTFTNEMKWYSTEKIQGQENYTVADAMVRFAQQNGISIRGHNI  285

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W +P + P W  NLT  E            V RY  +LI WDV NE +H+ F+E KL  
Sbjct  286  FWDNPVYQPHWVKNLTSEELQKAAAQRIKSVVSRYAGQLIAWDVMNENLHFSFFEDKL-G  344

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             NAS   Y +  + DP+ T+F+N++  +E  G+ T
Sbjct  345  KNASAEYYARAYQLDPDTTMFLNEYNTIEYSGDET  379



>ref|XP_011002036.1| PREDICTED: uncharacterized protein LOC105109135 isoform X1 [Populus 
euphratica]
Length=578

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            +I       WF  R   T F N +KW S E + G  NY ++D MV F  +N I   GH +
Sbjct  241  IINSTDYQNWFALRFKYTTFTNEMKWYSTEKIQGQENYTVADAMVRFAQQNGISIRGHNI  300

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W +P + P W  NLT  E            V RY  +LI WDV NE +H+ F+E KL  
Sbjct  301  FWDNPVYQPHWVKNLTSEELQKAAAQRIKSVVSRYAGQLIAWDVMNENLHFSFFEDKL-G  359

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             NAS   Y +  + DP+ T+F+N++  +E  G+ T
Sbjct  360  KNASAEYYARAYQLDPDTTMFLNEYNTIEYSGDET  394



>gb|KEH44018.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=554

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 78/153 (51%), Gaps = 13/153 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T     +WF  R   T F N +KW S E +PG  NY ISD M++F   N I   GH +
Sbjct  217  ILTNIDYQEWFVSRFKYTTFTNEMKWYSTEIIPGQENYTISDAMLEFAKDNGISVRGHNI  276

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W D  + P W   L+  E            V RYK +LI WDV NE VH+ FYE KL  
Sbjct  277  FWDDEKYQPEWVKYLSPDELRKAAKKRIESVVKRYKGELIAWDVVNENVHFHFYEDKL-G  335

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             NAS   Y K  E DP   LF+N++  +E  G+
Sbjct  336  ENASELYYLKAHELDPETKLFMNEYNTIEYSGD  368



>gb|KEH44019.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=581

 Score =   111 bits (278),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 78/153 (51%), Gaps = 13/153 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T     +WF  R   T F N +KW S E +PG  NY ISD M++F   N I   GH +
Sbjct  244  ILTNIDYQEWFVSRFKYTTFTNEMKWYSTEIIPGQENYTISDAMLEFAKDNGISVRGHNI  303

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W D  + P W   L+  E            V RYK +LI WDV NE VH+ FYE KL  
Sbjct  304  FWDDEKYQPEWVKYLSPDELRKAAKKRIESVVKRYKGELIAWDVVNENVHFHFYEDKL-G  362

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             NAS   Y K  E DP   LF+N++  +E  G+
Sbjct  363  ENASELYYLKAHELDPETKLFMNEYNTIEYSGD  395



>ref|XP_011092706.1| PREDICTED: uncharacterized protein LOC105172829 [Sesamum indicum]
Length=585

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 84/159 (53%), Gaps = 14/159 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+  I  NS  Q W+  R   TVFEN LKW SNE   G  +Y++SD +V F   +
Sbjct  240  PLGCAINQNILRNSAYQSWWSSRFKHTVFENELKWYSNERSRGSEDYSVSDALVQFARSH  299

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
                 GH V W DP + PSW   L+  +            V RYK +L HWDV NE +HY
Sbjct  300  GAAVRGHNVFWNDPRYQPSWVGGLSTNDLWAAANRRIYSVVGRYKGQLFHWDVVNENLHY  359

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQ  710
            +F+E +L   NAS   Y+K  E D   T F+N++  +E+
Sbjct  360  NFFESRL-GYNASNVFYQKANEIDSRTTPFLNEYNTIEE  397



>ref|XP_002532419.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF29960.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=550

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 78/160 (49%), Gaps = 14/160 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I EN   Q WF  R   T F N +KW SNE   G  NY I+D MV F  +N
Sbjct  203  PFGCGMNHYIVENLDYQKWFSSRFRYTTFTNEMKWYSNEKKQGKENYTIADAMVKFAKEN  262

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH + W DP + P W  +L+               V RY  +LI WDV NE +H+
Sbjct  263  GICIRGHNIFWDDPKYQPDWVKDLSSDNLRKAAAKRINSVVSRYSGQLIAWDVMNENLHF  322

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQC  713
             FYE KL   NAS   Y      DP+  LF+N++  +E C
Sbjct  323  RFYEDKL-GENASAEYYSIAHRLDPSTRLFMNEYNTIEDC  361



>ref|XP_010547944.1| PREDICTED: uncharacterized protein LOC104819528 isoform X2 [Tarenaya 
hassleriana]
Length=521

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            +++      WF  R   T F N +KW + E + G  NY ++D M+ F  +N IK  GH V
Sbjct  177  ILSSQGYRNWFASRFKLTSFTNEMKWYTTEKVRGRENYTLADSMLKFAEENGIKVRGHTV  236

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            LW +P   PSW  N+T  E             + RYK KL  WDV NE VH+ F+E  L 
Sbjct  237  LWDNPKMQPSWVQNVTGAEDLMNVTLNRINSVMTRYKGKLTGWDVMNENVHFRFFEDML-  295

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS + Y    + DP+ TLF+N++  +E
Sbjct  296  GENASASFYSLASKLDPDITLFVNEYNTLE  325



>ref|XP_002264837.3| PREDICTED: uncharacterized protein LOC100266982, partial [Vitis 
vinifera]
Length=575

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 86/164 (52%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+  +  N+  Q WF KR     F N LKW SNE  PG  NY+  D M+ F  KN
Sbjct  226  PIGAVINEFVINNTVYQNWFTKRFTVATFGNQLKWYSNERSPGKENYSFPDAMLQFCKKN  285

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH +LW DP   P W  +L+  +            V+RY+ + I WDV NE +H+
Sbjct  286  GINVRGHNILWDDPVMQPKWVPSLSPTQLRSAADRRINSVVNRYRGQFIAWDVVNENLHF  345

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             F+E +L  +N S  +++K  + DP   LF+ND+  +E+  + +
Sbjct  346  TFFEDRL-GANYSAAVFQKTHQLDPEPVLFLNDYNTLERIDDAS  388



>emb|CBI22444.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 86/164 (52%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            PI   I+  +  N+  Q WF KR     F N LKW SNE  PG  NY+  D M+ F  KN
Sbjct  203  PIGAVINEFVINNTVYQNWFTKRFTVATFGNQLKWYSNERSPGKENYSFPDAMLQFCKKN  262

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH +LW DP   P W  +L+  +            V+RY+ + I WDV NE +H+
Sbjct  263  GINVRGHNILWDDPVMQPKWVPSLSPTQLRSAADRRINSVVNRYRGQFIAWDVVNENLHF  322

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             F+E +L  +N S  +++K  + DP   LF+ND+  +E+  + +
Sbjct  323  TFFEDRL-GANYSAAVFQKTHQLDPEPVLFLNDYNTLERIDDAS  365



>ref|XP_010547943.1| PREDICTED: uncharacterized protein LOC104819528 isoform X1 [Tarenaya 
hassleriana]
Length=571

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            +++      WF  R   T F N +KW + E + G  NY ++D M+ F  +N IK  GH V
Sbjct  227  ILSSQGYRNWFASRFKLTSFTNEMKWYTTEKVRGRENYTLADSMLKFAEENGIKVRGHTV  286

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            LW +P   PSW  N+T  E             + RYK KL  WDV NE VH+ F+E  L 
Sbjct  287  LWDNPKMQPSWVQNVTGAEDLMNVTLNRINSVMTRYKGKLTGWDVMNENVHFRFFEDML-  345

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS + Y    + DP+ TLF+N++  +E
Sbjct  346  GENASASFYSLASKLDPDITLFVNEYNTLE  375



>ref|XP_004496874.1| PREDICTED: endo-1,4-beta-xylanase A-like [Cicer arietinum]
Length=587

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 80/161 (50%), Gaps = 14/161 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I  N++ Q WF  R   T F N +KW S E + G+ NY I+D MV+F  +N
Sbjct  240  PFGCGMNHNILNNTEYQKWFVSRFKYTTFTNEMKWYSTEKIQGIENYTIADAMVEFNRRN  299

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
             I   GH + W D  F P W   L+               V RYK K+I WDV NE VHY
Sbjct  300  GISVRGHTIFWDDMKFNPVWVKTLSPRGLRKAAAKRINSIVLRYKGKVIAWDVMNENVHY  359

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCG  716
             F+E KL   NAS   Y K  E DP   +F+N+F  +   G
Sbjct  360  RFFEDKL-GENASAIYYSKAHELDPTVPMFMNEFNTIAYSG  399



>emb|CDY49377.1| BnaA03g50660D [Brassica napus]
Length=570

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 78/148 (53%), Gaps = 14/148 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E + G  NY  +D M+ F  +N I   GH VLW DP   
Sbjct  233  KWFASRFAITSFTNEMKWYTTEKVRGQENYTAADSMLKFAEENDILVRGHTVLWDDPKMQ  292

Query  501  PSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW  N+  PE             + RYK KL  WDV NE +H+D++E+ L   NAS   
Sbjct  293  PSWVENIKDPEDVRNVTLNRINSVMKRYKGKLTGWDVVNENLHWDYFEKML-GVNASSRF  351

Query  642  YKKVQEKDPNATLFINDFKVVEQCGNTT  725
            Y    + DP+ TLF+N++  +E  G+ T
Sbjct  352  YNLAYKLDPDVTLFVNEYNTIENPGDVT  379



>gb|KCW55101.1| hypothetical protein EUGRSUZ_I01060, partial [Eucalyptus grandis]
Length=553

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 85/155 (55%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T ++   WF  R   T FE+ +KW + EP  G  +Y+ +D ++ F  ++ I   GH V
Sbjct  218  ILTNSAYQNWFTSRFTVTTFEDEMKWYTTEPSQGREDYSAADALLKFAQQHGISVRGHNV  277

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW DP + PSW  +L+  +            + RYK ++I WDV NE +H+ F+E KL  
Sbjct  278  LWDDPRYQPSWVPSLSASQLSKAVANRIISIIKRYKGQVIGWDVVNENLHFSFFESKL-G  336

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
              AS N YK  +  DP+ TLF+N++  +E   + T
Sbjct  337  PQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDRT  371



>ref|XP_002532418.1| Endo-1,4-beta-xylanase C precursor, putative [Ricinus communis]
 gb|EEF29959.1| Endo-1,4-beta-xylanase C precursor, putative [Ricinus communis]
Length=569

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF  R   TVFEN +KW S E   G  +Y++ D M+ F  ++
Sbjct  224  PFGCAINKNILSNPDYQNWFTSRFTVTVFENEMKWYSTERTRGNLDYSVPDAMIQFAKQH  283

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
             I   GH V W DP F P W  +L++ +++            RYK ++I WDV NE +H+
Sbjct  284  NIAVRGHNVFWDDPKFQPGWVNSLSQSDLNRATINRLNSVMSRYKGQVIGWDVVNENLHF  343

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            +F+E KL   NAS   Y   Q+ D + TLF+N++  +E+ G+
Sbjct  344  NFFESKL-GQNASSVFYNLAQKADGSTTLFLNEYNTIEESGD  384



>ref|XP_009138242.1| PREDICTED: uncharacterized protein LOC103862300 [Brassica rapa]
Length=570

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E + G  NY  +D M+ F  +N I   GH VLW DP   
Sbjct  233  KWFASRFAITSFTNEMKWYTTEKVRGQENYTAADSMLKFAEENDILVRGHTVLWDDPKMQ  292

Query  501  PSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW  N+  PE             + RYK KL  WDV NE +H+D++E+ L   NAS   
Sbjct  293  PSWVENIKDPEDVRNVTLNRINSVMKRYKGKLTGWDVVNENLHWDYFEKML-GVNASSRF  351

Query  642  YKKVQEKDPNATLFINDFKVVEQCGNTT  725
            Y    + DP+ TLF+N++  +E  G  T
Sbjct  352  YNLAYKLDPDVTLFVNEYNTIENPGEVT  379



>ref|XP_003592508.1| Endo-1 4-beta-xylanase [Medicago truncatula]
Length=671

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 75/145 (52%), Gaps = 13/145 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW S E +PG  NY ISD M++F   N I   GH + W D  + 
Sbjct  342  EWFVSRFKYTTFTNEMKWYSTEIIPGQENYTISDAMLEFAKDNGISVRGHNIFWDDEKYQ  401

Query  501  PSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIY  644
            P W   L+  E            V RYK +LI WDV NE VH+ FYE KL   NAS   Y
Sbjct  402  PEWVKYLSPDELRKAAKKRIESVVKRYKGELIAWDVVNENVHFHFYEDKL-GENASELYY  460

Query  645  KKVQEKDPNATLFINDFKVVEQCGN  719
             K  E DP   LF+N++  +E  G+
Sbjct  461  LKAHELDPETKLFMNEYNTIEYSGD  485



>ref|XP_010647973.1| PREDICTED: uncharacterized protein LOC100265242 [Vitis vinifera]
Length=582

 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 89/162 (55%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I +N+  Q WF  R +   F N +KW S E   GV NY ++D M+ F  +N
Sbjct  232  PFGAVISDYILQNTAFQNWFTSRFSVATFANEMKWYSTENSRGVENYKVADDMLQFCKQN  291

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
             I   GH +LW DP + PSW  +L+    +  VD        RYK ++I WDV NE +H+
Sbjct  292  GIAVRGHNILWDDPKYQPSWVNSLSPGDLQAAVDRRINSIASRYKGQVIAWDVVNENLHF  351

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+E +L  ++AS   ++K ++ D    LF+N++  +E+ G+
Sbjct  352  SFFEDRL-GASASAAAFQKTRQIDGTVELFMNEYNTIEERGD  392



>emb|CBI22449.3| unnamed protein product [Vitis vinifera]
Length=557

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 89/162 (55%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I +N+  Q WF  R +   F N +KW S E   GV NY ++D M+ F  +N
Sbjct  207  PFGAVISDYILQNTAFQNWFTSRFSVATFANEMKWYSTENSRGVENYKVADDMLQFCKQN  266

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
             I   GH +LW DP + PSW  +L+    +  VD        RYK ++I WDV NE +H+
Sbjct  267  GIAVRGHNILWDDPKYQPSWVNSLSPGDLQAAVDRRINSIASRYKGQVIAWDVVNENLHF  326

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+E +L  ++AS   ++K ++ D    LF+N++  +E+ G+
Sbjct  327  SFFEDRL-GASASAAAFQKTRQIDGTVELFMNEYNTIEERGD  367



>ref|XP_004496873.1| PREDICTED: endo-1,4-beta-xylanase A-like [Cicer arietinum]
Length=579

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 83/159 (52%), Gaps = 15/159 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T N   +WF  R   T F N +KW S E +PG  NY ISD M+     N I   GH +
Sbjct  242  ILTNNEYQKWFVSRFKYTTFTNEMKWYSTEKIPGQENYTISDAMLKLAKDNGISVRGHNI  301

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW + N  P W  +L+  +            V RYK +LI WDV NE VH+ F+E KL  
Sbjct  302  LWDNGNRQPQWVKSLSPDKLREVADIRMNSVVSRYKGQLIAWDVVNENVHFHFFEDKL-G  360

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTTKGHS  737
            SNAS   Y K  + DP   +F+N++  +E  G+  KG S
Sbjct  361  SNASGVYYSKAYQLDPKTNMFMNEYNTIEYSGD--KGAS  397



>ref|XP_010030623.1| PREDICTED: uncharacterized protein LOC104420481 [Eucalyptus grandis]
Length=675

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 85/155 (55%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T ++   WF  R   T FE+ +KW + EP  G  +Y+ +D ++ F  ++ I   GH V
Sbjct  244  ILTNSAYQNWFTSRFTVTTFEDEMKWYTTEPSQGREDYSAADALLKFAQQHGISVRGHNV  303

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW DP + PSW  +L+  +            + RYK ++I WDV NE +H+ F+E KL  
Sbjct  304  LWDDPRYQPSWVPSLSASQLSKAVANRIISIIKRYKGQVIGWDVVNENLHFSFFESKL-G  362

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
              AS N YK  +  DP+ TLF+N++  +E   + T
Sbjct  363  PQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDRT  397



>ref|XP_006346513.1| PREDICTED: uncharacterized protein LOC102598712 [Solanum tuberosum]
Length=1126

 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 85/159 (53%), Gaps = 14/159 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N   Q WF  R   TVFEN +KW +NE + G  +YN++D M+ FV K+
Sbjct  238  PFGNAISQHILNNKAYQDWFTSRFKYTVFENEMKWYANEKIQGKQDYNMADAMLSFVQKH  297

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I+  GH + W +P   PSWT +L+  ++            ++Y  +LIHWDV NE VH+
Sbjct  298  NIQVRGHNIFWNNPMSMPSWTRSLSPAQLSSAASKRINSVMNQYLGQLIHWDVVNENVHF  357

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQ  710
             F E  L   NAS   YKK  E D  A  F+NDF  +E 
Sbjct  358  SFLENIL-GKNASAIYYKKANEIDSKAIPFLNDFNTIEH  395


 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  N+   WF  R   TVFE+ +KW S E   G  +Y+ SD MV+      +   G  V
Sbjct  788  ILNNNAYQNWFFSRFKYTVFEDEMKWYSTENSQGKVDYSTSDAMVNLCKSKGVSIRGQNV  847

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW D  F P+W   L+  +            V +YK +L+HWDV NE +H+ F+E KL  
Sbjct  848  LWDDQKFQPNWVPALSPQQLSVAAGKRVASIVTKYKGQLLHWDVMNENLHFKFFESKL-G  906

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
            +NAS   Y+   + D    LF+N++  +E
Sbjct  907  ANASATFYRLASQFDNKTPLFLNEYNTIE  935



>emb|CDY48434.1| BnaA08g11430D [Brassica napus]
Length=573

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 84/163 (52%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P   +  S I  N   Q WF KR   TVFEN +KW S E + G  +Y+ +D MV    ++
Sbjct  226  PFGCSAGSNILGNQAFQDWFTKRFTVTVFENEMKWYSTEVVRGKEDYSTADAMVRLFKQH  285

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH ++  DP + PSW   L  P+            V RYK +L  WDV NE +H+
Sbjct  286  GIAIRGHHIILDDPKYQPSWVTALNGPDLYNAVKRRVDSVVSRYKGQLASWDVVNENLHF  345

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
             F+E K+     S N++++    DP  T+F+N+F  +EQ G+ 
Sbjct  346  SFFENKM-GPKVSYNVFEQAHAVDPTTTMFMNEFNTLEQPGDA  387



>emb|CDO97285.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 79/141 (56%), Gaps = 13/141 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF  R   TVFEN +KW S E  PG  +Y+++D ++ F T N     GH VLW DP + P
Sbjct  220  WFTSRFRLTVFENEMKWYSTETSPGKEDYSVADTLLRFATMNGAVVRGHNVLWDDPQYNP  279

Query  504  SWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
            SW   L+  +            V RYK +LIHWDV NE +H++F+E KL  + +S+  Y 
Sbjct  280  SWVQALSPGDLEAAATKRVNSIVTRYKGQLIHWDVVNENIHHNFFESKLGETASSV-FYG  338

Query  648  KVQEKDPNATLFINDFKVVEQ  710
            +  + D  A  F+ND+  +E+
Sbjct  339  QANQIDGKAIPFLNDYNTIEK  359



>gb|KCW63586.1| hypothetical protein EUGRSUZ_G01209 [Eucalyptus grandis]
Length=305

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 76/154 (49%), Gaps = 16/154 (10%)
 Frame = +3

Query  300  ITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            I E++  Q WF  R   T F N +KW S E   G  NY I+D MV F   N I   GH V
Sbjct  5    ILESTDYQNWFASRFRYTTFTNAMKWYSTEAKQGQENYTIADAMVKFSQDNGISIRGHNV  64

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
             W DPN+ P W   L  PE             V RY  KLI WDV NE +H+ F+E  L 
Sbjct  65   FWDDPNYQPDWVKTLL-PEDLRKAAEKRINSVVSRYAGKLIAWDVVNENLHFSFFEDNL-  122

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
              NAS   Y    + DP   +F+N++  +E CG+
Sbjct  123  GKNASSIYYSTSYKLDPTPRMFLNEYNTIEYCGD  156



>ref|XP_002313183.1| glycosyl hydrolase family 10 family protein [Populus trichocarpa]
 gb|EEE87138.1| glycosyl hydrolase family 10 family protein [Populus trichocarpa]
Length=508

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 73/149 (49%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  N+   WF  R   T F N +KW S E   G  NY I+D M+ F  KN I   GH +
Sbjct  171  ILLSNAYQNWFASRFKFTTFTNEMKWYSTEKEQGHENYTIADAMLSFAEKNGIAVRGHNI  230

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW  P   P W  NL+  E            V RY  KLI WDV NE +H+ FYE KL  
Sbjct  231  LWDSPKMQPQWVKNLSPGELRIAATKRTDSVVRRYSGKLIAWDVMNENMHFSFYEDKL-G  289

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   Y +  + DP   +F N+F  +E
Sbjct  290  KNASSEYYLRAYQLDPKTKMFSNEFNTIE  318



>ref|XP_006412307.1| hypothetical protein EUTSA_v10027468mg, partial [Eutrema salsugineum]
 gb|ESQ53760.1| hypothetical protein EUTSA_v10027468mg, partial [Eutrema salsugineum]
Length=569

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    +   I  N   Q WF KR   T F N +KW S E + G  +Y+ +D M+ F  ++
Sbjct  227  PFGCAVEKNILGNQAYQNWFTKRFTVTTFGNEMKWYSTERVRGKEDYSTADAMLRFFKQH  286

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             +   GH +LW+DP + P W  +L+  +            V RYK +L  WDV NE +H+
Sbjct  287  GVAVRGHNILWEDPKYQPRWVSSLSGKDLYNAVKRRVFSVVSRYKGQLAGWDVVNENLHF  346

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             F+E K+    AS N Y +    DP  T+F+N+F  +EQ G++ 
Sbjct  347  SFFESKM-GPKASYNTYAEAHIIDPRTTMFMNEFNTLEQPGDSA  389



>ref|XP_010691571.1| PREDICTED: endo-1,4-beta-xylanase-like [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+  +I+  I  N+  Q WF  +   T FEN +KW S E  PG  +Y+ +D M+ F +++
Sbjct  236  PLGASINYNIVNNAAYQNWFTSKFTVTTFENEMKWYSTENTPGKEDYSAADAMLGFTSRH  295

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH + W DP + P+W  NL+  +            V RY  K+I WDV NE +H+
Sbjct  296  GIPVRGHNIFWDDPKYQPAWVKNLSPNDLQIASNKRLNSIVTRYAGKVIAWDVNNENLHF  355

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            +F+E KL   N +   ++K Q+ D   TLFIND+  +E
Sbjct  356  NFFESKL-GENTTDVFFQKTQQLDGRTTLFINDYNTIE  392



>emb|CDX72430.1| BnaC07g44520D [Brassica napus]
Length=567

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E + G  NY  +D M+ F  +N I   GH VLW DP   
Sbjct  230  KWFASRFAITSFTNEMKWYTTEEVRGQENYTAADSMLKFAEENGILVRGHTVLWDDPKMQ  289

Query  501  PSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW  N+  P+             + RYK KL  WDV NE +H+D++E+ L   NAS   
Sbjct  290  PSWVKNIKDPDDVMNVTLNRINSVMKRYKGKLTGWDVVNENLHWDYFEKML-GVNASSRF  348

Query  642  YKKVQEKDPNATLFINDFKVVEQCGNTT  725
            Y    + DP+ TLF+N++  +E  G  T
Sbjct  349  YNIAYKLDPDVTLFVNEYNTIENPGEVT  376



>ref|XP_007201097.1| hypothetical protein PRUPE_ppa024827mg [Prunus persica]
 gb|EMJ02296.1| hypothetical protein PRUPE_ppa024827mg [Prunus persica]
Length=570

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 82/161 (51%), Gaps = 14/161 (9%)
 Frame = +3

Query  264  SYKPIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFV  440
            S+ P    ++  I  N   Q WF  R   T F N +KW S E + G+ NY I+D MV F 
Sbjct  221  SHFPFGCGMNHYILTNPDYQNWFASRFKWTTFTNEMKWYSTEKIQGLENYTIADNMVKFA  280

Query  441  TKNKIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNEL  584
             +N I   GH V W DP + P W  +L+  E            V RY+ +LI WDV NE 
Sbjct  281  QQNGISIRGHNVFWDDPKYQPDWVKSLSPEELRTAAAKRINSVVCRYRGQLIAWDVMNEN  340

Query  585  VHYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            VH+ F+E  L   NAS   Y   Q+ DP+  +F+N++  +E
Sbjct  341  VHFRFFEDNL-GENASAESYSIAQQLDPDTVMFMNEYNTIE  380



>gb|AFW89316.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=392

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  84   PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGQEDYTVPDAMMAFAKSN  143

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  144  GIAVRGHNVFWDQPSQQPRWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  203

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N+F  VEQ G+   
Sbjct  204  NFYEGRF-GWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAA  248



>ref|XP_007143119.1| hypothetical protein PHAVU_007G045400g [Phaseolus vulgaris]
 gb|ESW15113.1| hypothetical protein PHAVU_007G045400g [Phaseolus vulgaris]
Length=579

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 76/153 (50%), Gaps = 13/153 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T      WF  R     F N +KW S E   GV NY ISD M+ F  +N I   GH +
Sbjct  242  ILTNKDYQNWFVSRFKFATFTNEMKWYSTEKKQGVENYTISDAMLKFTKENGISVRGHNI  301

Query  477  LWQDPNFAPSWTCNLT----------RPE--VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W DP + P W   L+          R E  V RYK +LI WDV NE +H+ F+E KL  
Sbjct  302  FWDDPKYQPEWAKTLSPADLAKAAAKRMESVVSRYKGQLIAWDVMNENLHFHFFEDKL-G  360

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             NAS   Y    E DP   +F+N++  +E  G+
Sbjct  361  QNASAEAYATAYEIDPKQKMFLNEYNTIEDSGD  393



>gb|EYU45207.1| hypothetical protein MIMGU_mgv1a023132mg, partial [Erythranthe 
guttata]
Length=356

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+  I +NS  Q WF  R   TVFEN LKW SNE   G  +Y+ SD +V F    
Sbjct  77   PVGCAINQNILQNSAYQNWFTSRFKYTVFENELKWYSNERSRGSEDYSASDALVKFAQSR  136

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             +   GH V W +P   P+W   L+  ++             RY+ +L HWDV NE +H+
Sbjct  137  GVAVRGHNVFWANPADQPNWVPGLSSNDLWAASNKRINSVMGRYRGQLFHWDVMNENLHF  196

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            +F+E KL   NAS   Y K    D   T F+N++  +E+ G+ T
Sbjct  197  NFFETKL-GWNASTIFYGKANAIDGKTTPFLNEYNTIEESGDGT  239



>ref|XP_003592505.1| Endo-1,4-beta-xylanase C [Medicago truncatula]
Length=438

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 77/162 (48%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   ++  I  N + Q WF  R   T F N +KW S E   G  NY I D M+ F  +N
Sbjct  200  PLGCGMNHYILTNFEYQRWFVSRFKYTAFTNEMKWYSTERFQGQENYTIPDAMMKFAKEN  259

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
             I   GH V W D  F P W   L+            R  V RY+ +LI WDV NE VHY
Sbjct  260  GISVRGHTVFWDDETFQPKWVKFLSPEELRKAAAKRIRSVVSRYRGQLIAWDVVNENVHY  319

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+E KL   NAS   Y      DP   +F+N+F  +E  G+
Sbjct  320  HFFENKL-GENASPIYYSTAYHLDPEIKMFMNEFNTIESSGD  360



>gb|ACL53900.1| unknown [Zea mays]
 gb|AFW89315.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=430

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  84   PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGQEDYTVPDAMMAFAKSN  143

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  144  GIAVRGHNVFWDQPSQQPRWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  203

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N+F  VEQ G+   
Sbjct  204  NFYEGRF-GWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAA  248



>gb|EYU39073.1| hypothetical protein MIMGU_mgv1a025021mg, partial [Erythranthe 
guttata]
Length=530

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 84/159 (53%), Gaps = 14/159 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P  + I+  I  NS  Q WF  R   TVFEN LKW +NE   GV +Y+ISD +V F   N
Sbjct  232  PFGVAINKNIIGNSAYQNWFTSRFKYTVFENELKWYANEVQRGVEDYSISDALVKFAQSN  291

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
             +   GH V W + +  PSW   L+            +  ++RYK +L HWDV NE +H+
Sbjct  292  GVSIRGHNVFWDNESDQPSWVPGLSSNDLRAAAEQRIKSVMNRYKGQLFHWDVVNENLHW  351

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQ  710
             F+E KL  +NAS   Y+     D   T F+N++  +EQ
Sbjct  352  SFFESKL-GANASAVFYEMASGIDGGTTPFLNEYNTIEQ  389



>gb|KCW55100.1| hypothetical protein EUGRSUZ_I01059, partial [Eucalyptus grandis]
Length=552

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 13/154 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T  +   WF  R   TVFEN +KW + EP  G  +Y+ +D ++ F  ++ I   GH V
Sbjct  218  ILTNTAYQNWFTSRFTVTVFENEMKWDTTEPSQGQEDYSAADALLKFAQQHGIPVRGHTV  277

Query  477  LWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW+ P   PSW  +L+  ++             RYK +L  WDV NE +H  F+E +L  
Sbjct  278  LWEHPGHQPSWVPSLSASQLSKAVTNRINSIMYRYKGQLNGWDVVNENIHLSFFESRL-G  336

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
              AS N YK  +  DP+ TLF+N++  +E   +T
Sbjct  337  PQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDT  370



>ref|XP_002313181.1| hypothetical protein POPTR_0009s09090g [Populus trichocarpa]
 gb|EEE87136.1| hypothetical protein POPTR_0009s09090g [Populus trichocarpa]
Length=575

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            +I       WF  R   T F N +KW + E + G  NY ++D MV F  +N I   GH +
Sbjct  238  IINSTDYQNWFTLRFKYTTFTNEMKWYTTEKIQGQENYTVADAMVRFAQQNGISIRGHNI  297

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W +P + P W  NLT  E            V RY  +LI WDV NE +H+ F+E KL  
Sbjct  298  FWDNPVYQPHWVKNLTLEELQNAADQRIKSVVSRYAGQLIAWDVMNENLHFSFFEDKL-G  356

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   Y +  + DP+ T+F+N++  +E
Sbjct  357  KNASAEYYARAYQLDPDTTMFLNEYNTIE  385



>ref|XP_010030622.1| PREDICTED: endo-1,4-beta-xylanase-like [Eucalyptus grandis]
Length=572

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 82/154 (53%), Gaps = 13/154 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T  +   WF  R   TVFEN +KW + EP  G  +Y+ +D ++ F  ++ I   GH V
Sbjct  238  ILTNTAYQNWFTSRFTVTVFENEMKWDTTEPSQGQEDYSAADALLKFAQQHGIPVRGHTV  297

Query  477  LWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW+ P   PSW  +L+  ++             RYK +L  WDV NE +H  F+E +L  
Sbjct  298  LWEHPGHQPSWVPSLSASQLSKAVTNRINSIMYRYKGQLNGWDVVNENIHLSFFESRL-G  356

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
              AS N YK  +  DP+ TLF+N++  +E   +T
Sbjct  357  PQASANAYKTAKFIDPSTTLFLNEYNTIEDSRDT  390



>ref|XP_010274469.1| PREDICTED: endo-1,4-beta-xylanase D-like [Nelumbo nucifera]
Length=576

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 80/158 (51%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I  N   Q WF  R   T FEN +KW S E  PG  +Y+++D M+ F  +N
Sbjct  231  PFGAAIAKTILNNPAYQKWFTSRFTVTAFENEMKWYSTESSPGKEDYSVADAMLQFAKQN  290

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I   GH V W DP + P W   L+  ++             RYK ++I WDV NE +H+
Sbjct  291  GISVRGHNVFWNDPKYQPWWVPKLSPSQLSEAAWKRINSIMSRYKGQVIAWDVVNENLHF  350

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F E +L   NAS   Y++  + D  A +F+NDF  +E
Sbjct  351  SFLEDRL-GWNASAAFYQRAHQLDDRAIMFLNDFNTIE  387



>ref|XP_004985305.1| PREDICTED: uncharacterized protein LOC101780535 [Setaria italica]
Length=579

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 81/166 (49%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +SS I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  234  PLGAAMSSHILTNSAYQAWFASRFAVATFENEMKWYSTEPAPGREDYTVPDAMMAFAKSN  293

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  294  GIAVRGHNVFWDQPSQQPKWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  353

Query  594  DFYERKLENSNASLNIYKKVQEKD-PNATLFINDFKVVEQCGNTTK  728
             FYE +    +AS   Y   +  D  NA +F+N+F  +EQ G+   
Sbjct  354  SFYEGRF-GWDASTAFYAAARLLDTGNALMFMNEFNTLEQPGDMAA  398



>gb|KDP44501.1| hypothetical protein JCGZ_16334 [Jatropha curcas]
Length=585

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 82/164 (50%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    +++ I  N   Q WF  R   T F N +KW S E + G  NY  +D M+ F   N
Sbjct  238  PFGCAMNNAIINNKNYQNWFASRFKYTTFVNEMKWYSTENVQGRENYADADAMLKFAEAN  297

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
             I   GH + W DP +   W  NL+            R  V RYK KLI WDV NE +H+
Sbjct  298  GIHVRGHNIFWDDPKYQMDWVKNLSPDQLRVAAEKRIRSVVSRYKGKLIAWDVMNENLHF  357

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             F+E KL   +AS   +   ++ DP  TLF+N++  +E+ G+ T
Sbjct  358  SFFEDKL-GKDASAVYFALARQLDPGTTLFMNEYNTIEESGDGT  400



>ref|XP_008346318.1| PREDICTED: probable endo-1,4-beta-xylanase C [Malus domestica]
Length=577

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 89/163 (55%), Gaps = 15/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRS-NATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTK  446
            P  + I+  I  N+  Q WF  R    T FE+ +KW S EP  G  +Y+ +D ++ F  +
Sbjct  229  PFGVAINKNILTNTAYQNWFTSRPFTVTTFEDEMKWYSTEPSLGREDYSAADALLQFAKQ  288

Query  447  NKIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVH  590
            +KI   GH V W DP++ PSW  +L+  +            + RYK ++I WDV NE +H
Sbjct  289  HKIAVRGHNVFWDDPHYQPSWLNSLSGRQFSDAAYKRLTSVMGRYKGQVIAWDVCNENLH  348

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            ++F+E K+  +NAS   Y    + D   TLF+ND+  +E+ G+
Sbjct  349  FNFFESKM-GANASAEFYNWASKADGTTTLFLNDYNTIEESGD  390



>gb|EPS58555.1| hypothetical protein M569_16258, partial [Genlisea aurea]
Length=539

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+ + I++ +  N+  Q WF +R   TVFEN +KW + E   G  +Y+ +D ++ F   +
Sbjct  200  PLGVAINNNLIGNAAYQDWFARRFKYTVFENEMKWYATESTRGTEDYSAADALLGFAKSH  259

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W   N+ PSW   ++ P+            V RYK +LIHWDV NE +HY
Sbjct  260  GIAVRGHNVFWDAKNYQPSWVPWISVPDLWTAVNRRLNSVVGRYKGQLIHWDVVNESMHY  319

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+E +L    +S+  + + ++ D  A  F+N+F  +E+ G+
Sbjct  320  RFFELRLSRRFSSI-FFSRARDLDSTALPFLNEFNTIEESGD  360



>ref|XP_008236310.1| PREDICTED: uncharacterized protein LOC103335087 [Prunus mume]
Length=571

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 82/161 (51%), Gaps = 14/161 (9%)
 Frame = +3

Query  264  SYKPIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFV  440
            S+ P    ++  I  N   Q WF  R   T F N +KW S E + G+ NY I+D MV F 
Sbjct  222  SHFPFGCGMNHYILTNPDYQNWFASRFKWTTFTNEMKWYSTEKIQGLENYTIADNMVKFA  281

Query  441  TKNKIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNEL  584
             +N I   GH V W DP + P W  +L+  E            V RY+ +LI WDV NE 
Sbjct  282  QQNGISIRGHNVFWDDPKYQPDWVKSLSPEELRTAAAKRINSVVCRYRGQLIAWDVMNEN  341

Query  585  VHYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            +H+ F+E  L   NAS   Y   Q+ DP+  +F+N++  +E
Sbjct  342  LHFRFFEDNL-GENASAESYSIAQQLDPDTVMFMNEYNTME  381



>gb|KFK30010.1| hypothetical protein AALP_AA7G206100 [Arabis alpina]
Length=596

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 75/142 (53%), Gaps = 14/142 (10%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E + G  NY ++D M++F  +N I   GH VLW +P   
Sbjct  259  KWFASRFKITSFTNEMKWYTTEKVRGRENYTLADSMMEFAKENGILVRGHTVLWDNPKMQ  318

Query  501  PSW-------------TCNLTRPEVDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW             T N  +  + RYK KL  WDV NE VH+D++E+ L   NAS   
Sbjct  319  PSWVQKIKDPKDVMNVTTNRIKSVMKRYKGKLTGWDVVNENVHFDYFEKML-GVNASSRF  377

Query  642  YKKVQEKDPNATLFINDFKVVE  707
            Y    + DP  TLF+N++  +E
Sbjct  378  YNLASKLDPGMTLFVNEYNTIE  399



>ref|XP_006283361.1| hypothetical protein CARUB_v10004408mg [Capsella rubella]
 gb|EOA16259.1| hypothetical protein CARUB_v10004408mg [Capsella rubella]
Length=605

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 82/158 (52%), Gaps = 21/158 (13%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E + G  NY ++D M+ F  +N I   GH VLW +P   
Sbjct  269  KWFASRFKITSFTNEMKWYTTEKVRGQENYTLADSMLKFAEENGILVRGHTVLWDNPKMQ  328

Query  501  PSW-------------TCNLTRPEVDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW             T N     + RYK KL  WDV NE VH+D++ER+L  +NAS + 
Sbjct  329  PSWVPKIEDPNDLMNVTLNRINSVMKRYKGKLTGWDVVNENVHWDYFERRL-GANASSSF  387

Query  642  YKKVQEKDPNATLFINDFKVVEQCGNTTKGHSDIHNPP  755
            YK   + DP+  LF+N++       NT + H ++   P
Sbjct  388  YKLAFKLDPDVRLFVNEY-------NTIENHKEVTAAP  418



>ref|XP_009108772.1| PREDICTED: uncharacterized protein LOC103834458 [Brassica rapa]
Length=573

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 83/163 (51%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P   +  S I  N   Q WF KR   TVFEN +KW S E + G  +Y+ +D MV    ++
Sbjct  226  PFGCSAGSNILGNQAFQDWFTKRFTVTVFENEMKWYSTEVVRGKEDYSTADAMVRLFKQH  285

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH ++  DP + PSW   L  P+            V RYK +L  WDV NE +H+
Sbjct  286  GIAIRGHHIILDDPKYQPSWVTALNGPDLYNAVKRRVDSVVSRYKGQLASWDVVNENLHF  345

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
             F+E  +     S N++++    DP  T+F+N+F  +EQ G+ 
Sbjct  346  SFFENAM-GPKVSYNVFEQAHAVDPTTTMFMNEFNTLEQPGDA  387



>gb|KHG30568.1| Endo-1,4-beta-xylanase A [Gossypium arboreum]
Length=545

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T+ +  QWF  R   T F N +KW S E   GV NY ++D MV+F  +N I   GH V
Sbjct  212  IVTDEAYRQWFASRFKVTSFTNEMKWYSTEKTRGVENYTVADAMVNFAEQNGISIRGHNV  271

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W +    P W  +L   E            V RY  +LI WDV NE +H+ F+E KL  
Sbjct  272  FWDNRVMQPKWVKDLPPAELMKAATRRLNSVVSRYAGRLIGWDVMNENLHFRFFEDKL-G  330

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   Y      DP+ TLF+N++  +E
Sbjct  331  ENASSMFYSMAYHLDPSTTLFMNEYNTIE  359



>ref|XP_008658022.1| PREDICTED: putative glycosyl hydrolase family 10 protein isoform 
X1 [Zea mays]
 gb|AFW89318.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=576

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  230  PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGQEDYTVPDAMMAFAKSN  289

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  290  GIAVRGHNVFWDQPSQQPRWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  349

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N+F  VEQ G+   
Sbjct  350  NFYEGRF-GWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAA  394



>ref|NP_001241765.1| 1,4-beta-xylanase precursor [Zea mays]
 gb|ACG36704.1| 1,4-beta-xylanase [Zea mays]
Length=576

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  230  PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGQEDYTVPDAMMAFAKSN  289

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  290  GIAVRGHNVFWDQPSQQPRWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  349

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N+F  VEQ G+   
Sbjct  350  NFYEGRF-GWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAA  394



>gb|AES62756.2| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=546

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 77/162 (48%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   ++  I  N + Q WF  R   T F N +KW S E   G  NY I D M+ F  +N
Sbjct  200  PLGCGMNHYILTNFEYQRWFVSRFKYTAFTNEMKWYSTERFQGQENYTIPDAMMKFAKEN  259

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
             I   GH V W D  F P W   L+            R  V RY+ +LI WDV NE VHY
Sbjct  260  GISVRGHTVFWDDETFQPKWVKFLSPEELRKAAAKRIRSVVSRYRGQLIAWDVVNENVHY  319

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+E KL   NAS   Y      DP   +F+N+F  +E  G+
Sbjct  320  HFFENKL-GENASPIYYSTAYHLDPEIKMFMNEFNTIESSGD  360



>ref|XP_009406783.1| PREDICTED: endo-1,4-beta-xylanase C-like [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 82/158 (52%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I ENS  Q WF  R   T FEN +KWPSNEP  G   Y  +D M+ F  ++
Sbjct  218  PFGCAIASTILENSAYQSWFTSRFTVTTFENEMKWPSNEPEQGKEQYADADAMLAFAKQH  277

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH ++   P    SW  +L   +            + RY+ ++I WDV NE +H 
Sbjct  278  GIAVRGHNLVMDVPEAVQSWVQSLPTQQLREAVNKRFNSVIPRYRGQVIAWDVVNENIHN  337

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             +YE KL   NAS   Y++  + DPNA +F+NDF  +E
Sbjct  338  TYYEDKL-GENASSIFYQQAHQLDPNALMFLNDFNTLE  374



>emb|CDX72434.1| BnaC07g44560D [Brassica napus]
Length=877

 Score =   107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++   +   WF KR   T F N +KW S E + G  +Y  +D M+ F  ++ +   GH +
Sbjct  244  ILGSQAYQNWFTKRFTVTTFANEMKWYSTEAVRGKEDYTTADAMLRFFKQHGVAVRGHNI  303

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            +W DP +  SW  +L+  +            V RYK +L+ WDV NE +H+ F+E K+  
Sbjct  304  VWNDPKYQLSWVTSLSGNDLYNAVKRRVSSVVSRYKGQLVSWDVVNENLHFSFFESKM-G  362

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            + AS NIY      DP  T+F+N++  +EQ G++ 
Sbjct  363  AQASYNIYALAHSIDPRTTMFMNEYNTLEQPGDSA  397


 Score =   107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++   +   WF KR   T F N +KW S E + G  +Y  +D M+ F  ++ +   GH +
Sbjct  540  ILVNQAYQNWFTKRFTVTTFANEMKWYSTEAVRGKEDYTTADAMLRFFKQHGVAVRGHNI  599

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            +W DP +  SW  +L+  +            V RYK +L+ WDV NE +H+ F+E K+  
Sbjct  600  VWNDPKYQLSWVTSLSGNDLYNAVKRRVSSVVSRYKGQLVSWDVVNENLHFSFFESKM-G  658

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            + AS NIY      DP  T+F+N++  +EQ G++ 
Sbjct  659  AQASYNIYALAHSIDPRTTMFMNEYNTLEQPGDSA  693



>ref|XP_010230224.1| PREDICTED: uncharacterized protein LOC100827817 [Brachypodium 
distachyon]
Length=548

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 83/163 (51%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  N+  Q WF  R   T FEN +KW S EP PG  +Y+++D M+    ++
Sbjct  204  PVGAAMSREILSNAAYQSWFTSRFTVTTFENEMKWYSTEPSPGKEDYSVADAMLALAKQH  263

Query  450  KIKTGGHIVLWQDPNFAPSWTCNL------------TRPEVDRYKNKLIHWDVKNELVHY  593
             I   GH V W DP   P W   L             R  V RY  ++I WDV NE +H+
Sbjct  264  GIGVRGHNVFWDDPKQQPRWVQALPYTDLLAASSRRIRSFVSRYAGEVIAWDVVNENLHF  323

Query  594  DFYERKLE-NSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+ER+   +++ +     ++ +  P A +F+N+F  +EQ G+
Sbjct  324  SFFERQFGWDASTAFYAAARLLDGAPGALMFMNEFNTLEQPGD  366



>ref|XP_009406796.1| PREDICTED: uncharacterized protein LOC103989620 [Musa acuminata 
subsp. malaccensis]
Length=572

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 86/158 (54%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   + S I ++S  Q WF  R N T F N +KW SNE + G   Y ++D M+ F  ++
Sbjct  231  PLGCALKSTILQSSAYQSWFTARFNVTTFTNEMKWYSNEKVEGNETYAVADAMLAFAKQH  290

Query  450  KIKTGGHIVLWQDPNFAPSWTCNL----TRPEVD--------RYKNKLIHWDVKNELVHY  593
             I   GH V+W D  +  +W  +L     R  V+        RY+ ++I WDV NE VH+
Sbjct  291  GIAVRGHNVVWDDRQYVQNWVQSLPTQKLREAVNRRFNSVMTRYRGQVIAWDVVNENVHF  350

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             ++E +L   NAS   Y++  + DPNA +F+NDF  +E
Sbjct  351  SYFESRL-GENASSIFYQQAHQLDPNALMFLNDFNTLE  387



>ref|XP_008658023.1| PREDICTED: putative glycosyl hydrolase family 10 protein isoform 
X2 [Zea mays]
 gb|ACL53134.1| unknown [Zea mays]
 gb|AFW89317.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=555

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  209  PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGQEDYTVPDAMMAFAKSN  268

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  269  GIAVRGHNVFWDQPSQQPRWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  328

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N+F  VEQ G+   
Sbjct  329  NFYEGRF-GWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAA  373



>emb|CDX71170.1| BnaC07g04490D [Brassica napus]
Length=454

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 79/150 (53%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  +S  +WF  R   T F N +KW + E + G  NY ++D M+    +NKI   GH V
Sbjct  103  ILESDSYREWFVSRFRLTSFTNEMKWYTTEEVRGQENYTLADAMMQLAEENKILVKGHTV  162

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            LW D  + P W  ++T P+             + RYK +LI WDV NE +HY +YE  L 
Sbjct  163  LWDDKKWQPIWVKSITDPDDLKNVTLNRMNSVMKRYKGRLIGWDVINENLHYSYYEDML-  221

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS  IY    + DP+  LFIN++  VE
Sbjct  222  GKNASAMIYSLASKIDPDIPLFINEYNTVE  251



>ref|XP_002867152.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43411.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    + + I  N   Q WF +R   T F N +KW S E + G  +Y+ +D M  F  ++
Sbjct  226  PFGCAVENNILGNQAYQNWFTQRFTVTTFGNEMKWYSTERIRGQEDYSTADAMFSFFKQH  285

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH +LW DP + P W  +L+R +            V RYK +L  WDV NE +H+
Sbjct  286  GIAVRGHNILWDDPRYQPGWVNSLSRDDLYNAVKRRVFSVVSRYKGQLTGWDVVNENLHF  345

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
             F+E KL    AS N Y      DP  T+F+N++  +EQ  + T
Sbjct  346  SFFESKL-GPKASYNTYAMAHAFDPRTTMFLNEYNTLEQPNDLT  388



>ref|XP_009406807.1| PREDICTED: endo-1,4-beta-xylanase A-like [Musa acuminata subsp. 
malaccensis]
Length=571

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 83/158 (53%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I++ I ENS  Q WF  R   T FEN +KW +NE   G   Y  +D MV F  ++
Sbjct  231  PFGCAIANTILENSAYQSWFTSRFTVTTFENEMKWYANEREQGKETYTDADAMVAFAKQH  290

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
             I   GH V+W DP    +W  +L   ++             RY+ K+I WDV NE VH+
Sbjct  291  GIAVRGHNVVWNDPQDVQNWVKSLPTQQIGEAVNRRFNSVMPRYRGKVIAWDVVNENVHF  350

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             ++E +L   NAS   Y++  + DPNA +F+ND+  +E
Sbjct  351  SYFESQL-GQNASSVFYQQAHQLDPNALMFLNDYNTLE  387



>ref|XP_007131684.1| hypothetical protein PHAVU_011G033100g [Phaseolus vulgaris]
 gb|ESW03678.1| hypothetical protein PHAVU_011G033100g [Phaseolus vulgaris]
Length=570

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 78/144 (54%), Gaps = 13/144 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF  R   T FEN +KW S E + G  +Y  +D M+ F  ++ I+  GH V W DP++ P
Sbjct  239  WFTSRFTVTTFENEMKWYSTEAVKGKVDYTTADAMLQFAKQHNIEVRGHNVFWDDPHYQP  298

Query  504  SWTCNLT------------RPEVDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
            SW  +L+            +  V +YK KLI WDV NE +H+ FYE KL     S  I+ 
Sbjct  299  SWVPSLSPTQLSSAVEERVKSVVSKYKGKLISWDVVNENMHFSFYESKL-GKTFSGKIFN  357

Query  648  KVQEKDPNATLFINDFKVVEQCGN  719
            +V + D   TLF+ND+  +E+  +
Sbjct  358  EVHKIDGQTTLFLNDYNTIEEISD  381



>ref|XP_009138241.1| PREDICTED: uncharacterized protein LOC103862299 [Brassica rapa]
Length=572

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++   +   WF KR   T F N +KW S E + G  +Y  +D M+ F  ++ I   GH +
Sbjct  235  ILVNQAYQNWFTKRFTVTTFANEMKWYSTEAVRGKEDYTTADAMLRFFKQHGIAVRGHNI  294

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            +W DP +  SW  +L+  +            V RYK +L+ WDV NE +H+ F+E K+  
Sbjct  295  VWNDPKYQLSWVSSLSGNDLYNAVKRRVSSVVSRYKGQLLSWDVVNENLHFSFFESKM-G  353

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
              AS NI+      DP  T+F+N+F  +EQ G++ 
Sbjct  354  PQASYNIFALAHSIDPRTTMFMNEFDTLEQPGDSA  388



>ref|NP_001130600.1| putative glycosyl hydrolase family 10 protein [Zea mays]
 gb|ACF78883.1| unknown [Zea mays]
 gb|ACR35838.1| unknown [Zea mays]
 gb|AFW89319.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=595

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  249  PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGQEDYTVPDAMMAFAKSN  308

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  309  GIAVRGHNVFWDQPSQQPRWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  368

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N+F  VEQ G+   
Sbjct  369  NFYEGRF-GWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAA  413



>ref|XP_003555995.1| PREDICTED: uncharacterized protein LOC100777980 [Glycine max]
Length=580

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 74/153 (48%), Gaps = 13/153 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T      WF  R   T F N +KW S E   G  NY I+D M+ F  +N I   GH +
Sbjct  243  ILTNEDYQSWFVSRFKFTTFTNEMKWYSTEKKQGEENYTIADAMLKFTQENGISVRGHNI  302

Query  477  LWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W DP + P W   L+            +  + RYK +LI WDV NE +H+ FYE K   
Sbjct  303  FWDDPKYQPDWVRTLSPADLTKAAAKRMKSVLSRYKGELIAWDVMNENLHFHFYEDKF-G  361

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             NAS   Y    E DP   LF+N+F  +E  G+
Sbjct  362  ENASAVAYATAYELDPEPKLFLNEFNTIEYSGD  394



>gb|EMT33548.1| Endo-1,4-beta-xylanase A [Aegilops tauschii]
Length=542

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 79/162 (49%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  N + Q WF KR   T FEN +KW S E   G  +Y + D M+ F   +
Sbjct  196  PLGSAMSKEIITNVKYQEWFAKRFTVTTFENEMKWYSTEWTQGHEDYTVPDAMLRFARSH  255

Query  450  KIKTGGHIVLWQDPNFAPSW------------TCNLTRPEVDRYKNKLIHWDVKNELVHY  593
             I   GH V W DP+    W            T N  R  + RY  K+I WDV NE +H+
Sbjct  256  GIAVRGHNVFWDDPSTQLGWVKALSGDQLRAATANRMRSVMSRYAGKVIAWDVVNENLHF  315

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            DF+E K   + AS   Y+K    D  A + +NDF  +EQ G+
Sbjct  316  DFFEEKF-GAGASAAFYQKAHGMDGGALMSMNDFNTLEQPGD  356



>ref|XP_010447190.1| PREDICTED: uncharacterized protein LOC104729866 isoform X3 [Camelina 
sativa]
 ref|XP_010447191.1| PREDICTED: uncharacterized protein LOC104729866 isoform X3 [Camelina 
sativa]
Length=528

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E   G  NY ++D M+ F  +N I   GH VLW DP   
Sbjct  193  KWFASRFKITSFTNEMKWYTTEKARGQENYTLADSMLKFAEENGILVRGHTVLWDDPKMQ  252

Query  501  PSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW   L  P              + RYK K+  WDV NE VH+D++E+ L  +NAS + 
Sbjct  253  PSWVQKLEDPNDLMNVTLNRINSVMTRYKGKVTGWDVVNENVHWDYFEKML-GANASSSF  311

Query  642  YKKVQEKDPNATLFINDFKVVEQCGNTT  725
            Y    + DP+ TLF+N++  +E   + T
Sbjct  312  YNLAYKLDPDVTLFVNEYNTIENRMDVT  339



>ref|XP_004292118.1| PREDICTED: endo-1,4-beta-xylanase A-like [Fragaria vesca subsp. 
vesca]
Length=571

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 73/150 (49%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T      WF  R   T F N +KW S E   G  NY I+D MV F  +N I   GH V
Sbjct  233  ILTSTEYQNWFASRFRYTTFTNEMKWYSTEIKQGQENYTIADGMVKFAKENGISIRGHNV  292

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
             W +P   P W  +   PE             V RYK +LI WDV NE +H+ F+E KL 
Sbjct  293  FWDNPKMQPRWVNSTLSPEELGTASAKRINSVVARYKGQLIAWDVMNENLHFRFFEDKL-  351

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS   Y   Q+ DP   +F+N++  +E
Sbjct  352  GENASAAFYYTAQQLDPGTMMFMNEYNTME  381



>emb|CAA19865.1| putative protein [Arabidopsis thaliana]
 emb|CAB80100.1| putative protein [Arabidopsis thaliana]
Length=544

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 82/158 (52%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I  N   Q WF +R   T FEN +KW S E + G+ NY ++D M+ F  ++
Sbjct  195  PFGSAVAQNILGNQAYQNWFTQRFTVTTFENEMKWYSTESVRGIENYTVADAMLRFFNQH  254

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V+W  P +   W  +L+R +            V RYK +L  WDV NE +H+
Sbjct  255  GIAVRGHNVVWDHPKYQSKWVTSLSRNDLYNAVKRRVFSVVSRYKGQLAGWDVVNENLHH  314

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E K    NAS NI+      DP+ T+F+N+F  +E
Sbjct  315  SFFESKF-GPNASNNIFAMAHAIDPSTTMFMNEFYTLE  351



>ref|XP_002867153.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43412.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=591

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 81/158 (51%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I  N   Q WF +R   T FEN +KW S E + G+ NY I+D M+ F  ++
Sbjct  242  PFGSAVAQNILGNQAYQNWFTQRFTVTTFENEMKWYSTESVRGIENYTIADAMLRFFKQH  301

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V+W  P +   W  +L+R +            V RYK +L  WDV NE +H+
Sbjct  302  DIAVRGHNVVWDHPKYQSKWVTSLSRNDIYNAVKRRVFSVVSRYKGQLAGWDVVNENLHH  361

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E K    NAS NI+      DP  T+F+N+F  +E
Sbjct  362  SFFESKF-GPNASNNIFAMAHAIDPRTTMFMNEFYTLE  398



>gb|EYU39071.1| hypothetical protein MIMGU_mgv1a003597mg [Erythranthe guttata]
Length=575

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+  I +NS  Q WF  R   TVFEN LKW SNE   G  +Y+ SD +V F    
Sbjct  230  PVGCAINQNILQNSAYQNWFTTRFKYTVFENELKWYSNERSRGSEDYSASDALVKFAQSR  289

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             +   GH V W +P   P+W   L+  ++             RY+ +L HWDV NE +H+
Sbjct  290  GVAVRGHNVFWANPADQPNWVPGLSSNDLWAASNKRINSVMGRYRGQLFHWDVMNENLHF  349

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
            +F+E KL   NAS   Y K    D   T F+N++  +E+ G+ T
Sbjct  350  NFFESKL-GWNASTVFYGKANAIDGKTTPFLNEYNTIEESGDGT  392



>ref|NP_195109.2| Glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 gb|AEE86282.1| Glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
Length=576

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 82/158 (52%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I  N   Q WF +R   T FEN +KW S E + G+ NY ++D M+ F  ++
Sbjct  227  PFGSAVAQNILGNQAYQNWFTQRFTVTTFENEMKWYSTESVRGIENYTVADAMLRFFNQH  286

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V+W  P +   W  +L+R +            V RYK +L  WDV NE +H+
Sbjct  287  GIAVRGHNVVWDHPKYQSKWVTSLSRNDLYNAVKRRVFSVVSRYKGQLAGWDVVNENLHH  346

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E K    NAS NI+      DP+ T+F+N+F  +E
Sbjct  347  SFFESKF-GPNASNNIFAMAHAIDPSTTMFMNEFYTLE  383



>gb|AFW89320.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=625

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  279  PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGQEDYTVPDAMMAFAKSN  338

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P+            V RY  ++I WDV NE +H+
Sbjct  339  GIAVRGHNVFWDQPSQQPRWVQSLPYPQLLAAASRRIRSVVSRYAGQVIGWDVVNENLHF  398

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N+F  VEQ G+   
Sbjct  399  NFYEGRF-GWDASTAFYAAARLLDAGSALMFMNEFNTVEQPGDMAA  443



>ref|XP_010447189.1| PREDICTED: uncharacterized protein LOC104729866 isoform X2 [Camelina 
sativa]
Length=565

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 75/142 (53%), Gaps = 14/142 (10%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E   G  NY ++D M+ F  +N I   GH VLW DP   
Sbjct  230  KWFASRFKITSFTNEMKWYTTEKARGQENYTLADSMLKFAEENGILVRGHTVLWDDPKMQ  289

Query  501  PSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW   L  P              + RYK K+  WDV NE VH+D++E+ L  +NAS + 
Sbjct  290  PSWVQKLEDPNDLMNVTLNRINSVMTRYKGKVTGWDVVNENVHWDYFEKML-GANASSSF  348

Query  642  YKKVQEKDPNATLFINDFKVVE  707
            Y    + DP+ TLF+N++  +E
Sbjct  349  YNLAYKLDPDVTLFVNEYNTIE  370



>ref|XP_009406772.1| PREDICTED: endo-1,4-beta-xylanase C-like [Musa acuminata subsp. 
malaccensis]
Length=571

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 83/158 (53%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I++ I EN   Q WF  R   T FEN +KW +NE   G   Y  +D MV F  ++
Sbjct  231  PLGCAIANTILENKAYQTWFTSRFTVTTFENEMKWYANEREQGKETYTDADAMVAFAKQH  290

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEVD------------RYKNKLIHWDVKNELVHY  593
             I   GH V+W DP    SW  +L   ++             RY+ K+I WDV NE VH+
Sbjct  291  GIAVRGHNVVWNDPQDVQSWVKSLPTQQLGEAVNRRFNSVMPRYRGKVIAWDVVNENVHF  350

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             ++E +L   NAS   Y++  + DP+A +F+NDF  +E
Sbjct  351  SYFESQL-GQNASSIFYQQAHQLDPHALMFLNDFNTLE  387



>ref|XP_010447188.1| PREDICTED: uncharacterized protein LOC104729866 isoform X1 [Camelina 
sativa]
Length=573

 Score =   105 bits (262),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 75/142 (53%), Gaps = 14/142 (10%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E   G  NY ++D M+ F  +N I   GH VLW DP   
Sbjct  238  KWFASRFKITSFTNEMKWYTTEKARGQENYTLADSMLKFAEENGILVRGHTVLWDDPKMQ  297

Query  501  PSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW   L  P              + RYK K+  WDV NE VH+D++E+ L  +NAS + 
Sbjct  298  PSWVQKLEDPNDLMNVTLNRINSVMTRYKGKVTGWDVVNENVHWDYFEKML-GANASSSF  356

Query  642  YKKVQEKDPNATLFINDFKVVE  707
            Y    + DP+ TLF+N++  +E
Sbjct  357  YNLAYKLDPDVTLFVNEYNTIE  378



>ref|XP_010683117.1| PREDICTED: uncharacterized protein LOC104897858 [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   105 bits (262),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 81/159 (51%), Gaps = 15/159 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   I+  I  N++ Q WF  R + T F N +KW   E   G  +Y I D M+ F  +N
Sbjct  228  PMGCEINLNILNNTKYQNWFASRFSITAFGNEMKWYFTEKTRGEEDYAIPDAMLQFCEQN  287

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
             I   GH ++W DP + P+W    T  E             + RYK +LIHWDV+NE +H
Sbjct  288  NIDVRGHNIVWDDPRYQPTWINGETTSEELKEVVEKRMKSVILRYKGRLIHWDVENENLH  347

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            + FYE KL   NAS   Y +  E D    LF+N++  +E
Sbjct  348  FRFYENKL-GENASAEFYARAYELDQKPILFMNEYNSIE  385



>gb|AAQ65190.1| At2g14690 [Arabidopsis thaliana]
Length=529

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 79/150 (53%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  +S  +WF  R   T F N +KW + E + G  NY I+D M+    +N I   GH V
Sbjct  177  ILESDSYREWFVSRFRLTSFTNEMKWYATEAVRGQENYKIADSMMQLAEENAILVKGHTV  236

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            LW D  + P+W   +T PE             + RYK +LI WDV NE VH++++E  L 
Sbjct  237  LWDDKYWQPNWVKTITDPEDLKNVTLNRMNSVMKRYKGRLIGWDVMNENVHFNYFENML-  295

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS  +Y    + DP+  LF+N+F  VE
Sbjct  296  GGNASAIVYSLASKLDPDIPLFLNEFNTVE  325



>gb|AAC69373.1| 1,4-beta-xylan endohydrolase [Arabidopsis thaliana]
Length=552

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 79/150 (53%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  +S  +WF  R   T F N +KW + E + G  NY I+D M+    +N I   GH V
Sbjct  200  ILESDSYREWFVSRFRLTSFTNEMKWYATEAVRGQENYKIADSMMQLAEENAILVKGHTV  259

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            LW D  + P+W   +T PE             + RYK +LI WDV NE VH++++E  L 
Sbjct  260  LWDDKYWQPNWVKTITDPEDLKNVTLNRMNSVMKRYKGRLIGWDVMNENVHFNYFENML-  318

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS  +Y    + DP+  LF+N+F  VE
Sbjct  319  GGNASAIVYSLASKLDPDIPLFLNEFNTVE  348



>ref|XP_009375682.1| PREDICTED: uncharacterized protein LOC103964474 [Pyrus x bretschneideri]
Length=577

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 89/163 (55%), Gaps = 15/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRS-NATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTK  446
            P  + I+  I  N+  Q WF  +    T FE+ +KW + EP PG  +Y+ +D +V F  +
Sbjct  229  PFGVAINKNILTNTAYQNWFTSKPFKVTTFEDEMKWYTTEPSPGQEDYSAADALVQFAKQ  288

Query  447  NKIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVH  590
            ++I   GH V W+DP++   W  +L+  +            + RYK ++I WDV NE +H
Sbjct  289  HQIAVRGHNVFWEDPHYQAGWLNSLSGQQFSDAANKRLNSIMGRYKGQVIAWDVSNENLH  348

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            ++F+E K+  + AS   Y    + D  ATLF+ND+  +E+ G+
Sbjct  349  FNFFESKM-GATASAEFYNWASKADDTATLFLNDYNTIEESGD  390



>emb|CDY28323.1| BnaC03g66360D [Brassica napus]
Length=557

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 83/162 (51%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P   +  S I  N   Q WF KR   T FEN +KW S E + G  +Y+ +D MV    ++
Sbjct  210  PFGCSAGSNILGNQAFQDWFTKRFTVTAFENEMKWYSTEVVRGKEDYSTADAMVRLFKQH  269

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH ++  DP +  SW   L  P+            V RYK +L  WDV NE +H+
Sbjct  270  GIAIRGHHIILDDPKYQLSWVTALNGPDLYKAVKRRVDSVVSRYKGQLASWDVVNENLHF  329

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+E K+    AS N++++    DP  T+F+N+F  +EQ G+
Sbjct  330  SFFENKM-GPKASYNVFEQAHAVDPTTTMFMNEFNTLEQPGD  370



>ref|XP_010111686.1| Endo-1,4-beta-xylanase C [Morus notabilis]
 gb|EXC31477.1| Endo-1,4-beta-xylanase C [Morus notabilis]
Length=581

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 85/163 (52%), Gaps = 15/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRS-NATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTK  446
            P+   I+  I  N   Q WF  RS   T FEN +KW S E  PG  +Y+ +D M+ F  +
Sbjct  224  PLGCAINDNILTNQAYQNWFTSRSFTVTTFENEMKWYSTEKTPGKEDYSTADSMIQFAKR  283

Query  447  NKIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVH  590
            + +   GH V W DP + P W  +L++ +            V RY+ +LI WDV NE +H
Sbjct  284  HNVLVRGHNVFWDDPKYQPWWLNSLSKRQFSSAVWRRLNSVVSRYRGQLIAWDVVNENLH  343

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             +F+E K+ N NAS   Y      DP  T+F+N++  +E  G+
Sbjct  344  NNFFESKMGN-NASATFYNWAFRADPETTMFLNEYNTIENPGD  385



>ref|NP_179076.3| putative glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 dbj|BAD43713.1| 1,4-beta-xylan endohydrolase [Arabidopsis thaliana]
 gb|AEC06322.1| putative glycosyl hydrolase [Arabidopsis thaliana]
Length=570

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 79/150 (53%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  +S  +WF  R   T F N +KW + E + G  NY I+D M+    +N I   GH V
Sbjct  218  ILESDSYREWFVSRFRLTSFTNEMKWYATEAVRGQENYKIADSMMQLAEENAILVKGHTV  277

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            LW D  + P+W   +T PE             + RYK +LI WDV NE VH++++E  L 
Sbjct  278  LWDDKYWQPNWVKTITDPEDLKNVTLNRMNSVMKRYKGRLIGWDVMNENVHFNYFENML-  336

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS  +Y    + DP+  LF+N+F  VE
Sbjct  337  GGNASAIVYSLASKLDPDIPLFLNEFNTVE  366



>ref|XP_006299800.1| hypothetical protein CARUB_v10015996mg [Capsella rubella]
 gb|EOA32698.1| hypothetical protein CARUB_v10015996mg [Capsella rubella]
Length=556

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 14/150 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++  +S  +WF  R   T F N +KW +NE + G+ NY+++D M+    +NKI   GH V
Sbjct  204  ILESDSYREWFVSRFRLTSFTNEMKWYTNEAVRGLENYSLADLMMSTAEENKILVKGHTV  263

Query  477  LWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLE  617
            LW D  + P+W   +T PE             + RYK ++I WDV NE VH+ ++E  L 
Sbjct  264  LWDDKTWQPNWVKKITDPEDLKNVTINRINSVMKRYKGRVIGWDVMNENVHFSYFEDML-  322

Query  618  NSNASLNIYKKVQEKDPNATLFINDFKVVE  707
              NAS   Y    + DP+  LF+N+F  +E
Sbjct  323  GKNASAIFYSLASKLDPDIPLFLNEFNTIE  352



>gb|KDO57900.1| hypothetical protein CISIN_1g042396mg, partial [Citrus sinensis]
Length=472

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 77/149 (52%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T  +   WF  R   T FE+ +KW S E  PG  +Y+ SD M+ F   + I   GH +
Sbjct  192  ILTNTAYQNWFTSRFKVTAFEDEMKWYSTEASPGREDYSASDAMLQFAKNHNIAVRGHNI  251

Query  477  LWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W DP + P W  +L+  ++             RYK ++I WDV NE +H+ F+E KL  
Sbjct  252  FWDDPQYQPGWVNSLSPSDLSKAADKRINSVTSRYKGQVIAWDVVNENLHFSFFESKL-G  310

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   + +V   D   TLF+ND+  +E
Sbjct  311  QNASGVFFNRVHSLDGATTLFMNDYNTIE  339



>ref|XP_007042653.1| Glycosyl hydrolase family 10 protein, putative [Theobroma cacao]
 gb|EOX98484.1| Glycosyl hydrolase family 10 protein, putative [Theobroma cacao]
Length=588

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 74/149 (50%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T     +WF  R   T F N +KW S E   G  NY I+D MV F  +N I   GH +
Sbjct  251  ILTSTGYQEWFASRFKLTSFTNEMKWYSTEKKQGEENYTIADAMVKFAKQNGISIRGHNI  310

Query  477  LWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW +P   P W  +L   E+             RY  +LI WDV NE +H+ F+E KL  
Sbjct  311  LWDNPKMLPDWVMDLPPEELQKAATRRLKSVMSRYAGQLIGWDVVNENLHFRFFEDKL-G  369

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   Y      +PN TLF+N++  +E
Sbjct  370  ENASSAFYSMAYHLEPNTTLFMNEYNTIE  398



>ref|XP_010065888.1| PREDICTED: uncharacterized protein LOC104453078 isoform X2 [Eucalyptus 
grandis]
Length=579

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 78/163 (48%), Gaps = 16/163 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I E++  Q WF  R   T F N +KW S E   G  NY  +D MV F   N
Sbjct  234  PFGCGMNFHILESTDYQNWFASRFRYTTFTNAMKWYSTEAKQGQENYTTADAMVKFSQDN  293

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
             I   GH V W DP + P W   L+ PE             V RY  KLI WDV NE +H
Sbjct  294  GISIRGHNVFWDDPKYQPDWVKTLS-PEDLRKAAEKRINSVVSRYAGKLIAWDVVNENLH  352

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            + F+E  L   NAS   Y    + DP   +F+N++  +E CG+
Sbjct  353  FSFFEDNL-GKNASSIYYSTAYKLDPTPRMFLNEYNTIEYCGD  394



>ref|XP_010065886.1| PREDICTED: uncharacterized protein LOC104453078 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010065887.1| PREDICTED: uncharacterized protein LOC104453078 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63589.1| hypothetical protein EUGRSUZ_G01214 [Eucalyptus grandis]
Length=582

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 78/163 (48%), Gaps = 16/163 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I E++  Q WF  R   T F N +KW S E   G  NY  +D MV F   N
Sbjct  237  PFGCGMNFHILESTDYQNWFASRFRYTTFTNAMKWYSTEAKQGQENYTTADAMVKFSQDN  296

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
             I   GH V W DP + P W   L+ PE             V RY  KLI WDV NE +H
Sbjct  297  GISIRGHNVFWDDPKYQPDWVKTLS-PEDLRKAAEKRINSVVSRYAGKLIAWDVVNENLH  355

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            + F+E  L   NAS   Y    + DP   +F+N++  +E CG+
Sbjct  356  FSFFEDNL-GKNASSIYYSTAYKLDPTPRMFLNEYNTIEYCGD  397



>ref|XP_006422817.1| hypothetical protein CICLE_v10030382mg [Citrus clementina]
 gb|ESR36057.1| hypothetical protein CICLE_v10030382mg [Citrus clementina]
Length=580

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 77/149 (52%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T  +   WF  R   T FE+ +KW S E  PG  +Y+ SD M+ F   + I   GH +
Sbjct  241  ILTNTAYQNWFTSRFKVTAFEDEMKWYSTEASPGREDYSASDAMLQFAKNHNIAVRGHNI  300

Query  477  LWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W DP + P W  +L+  ++             RYK ++I WDV NE +H+ F+E KL  
Sbjct  301  FWDDPQYQPGWVNSLSPSDLSKAADKRINSVTSRYKGQVIAWDVVNENLHFSFFESKL-G  359

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   + +V   D   TLF+ND+  +E
Sbjct  360  QNASGVFFNRVHSLDGATTLFMNDYNTIE  388



>ref|XP_009350581.1| PREDICTED: endo-1,4-beta-xylanase D-like, partial [Pyrus x bretschneideri]
 ref|XP_009350582.1| PREDICTED: endo-1,4-beta-xylanase D-like, partial [Pyrus x bretschneideri]
Length=557

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 89/163 (55%), Gaps = 15/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRS-NATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTK  446
            P  + I+  I  N+  Q WF  +    T FE+ +KW + EP PG  +Y+ +D +V F  +
Sbjct  209  PFGVAINKNILTNTAYQNWFTSKPFKVTTFEDEMKWYTTEPSPGQEDYSAADALVQFAKQ  268

Query  447  NKIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVH  590
            ++I   GH V W+DP++   W  +L+  +            + RYK ++I WDV NE +H
Sbjct  269  HQIAVRGHNVFWEDPHYQAGWLNSLSGQQFSDAANKRLNSIMGRYKGQVIAWDVSNENLH  328

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            ++F+E K+  + AS   Y    + D  ATLF+ND+  +E+ G+
Sbjct  329  FNFFESKM-GATASAEFYNWASKVDDTATLFLNDYNTIEESGD  370



>dbj|BAK07928.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITEN-SQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  N    QWF  R   T FEN +KW S EP PG  +Y + D M+    ++
Sbjct  229  PLGAAMSREILTNPGYQQWFTSRFTVTTFENEMKWYSTEPAPGREDYTVPDAMLALAKQH  288

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH V W DP   P W  +L  P+            V RY  ++I WDV NE +HY
Sbjct  289  GIGVRGHNVFWDDPKQQPRWVQSLPYPDLLAAASRRIRSFVSRYAGQVIAWDVVNENLHY  348

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
             F+ER+    +AS   Y   +  D   A +F+N++  +EQ G+   
Sbjct  349  SFFERQF-GWDASTAFYAAARLLDAGSALMFMNEYNTLEQPGDAAA  393



>gb|KHN39896.1| Endo-1,4-beta-xylanase C [Glycine soja]
Length=566

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 84/158 (53%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P   ++SS I  N   Q WF  R   T F N +KW S E + G  +Y+++D M+ F  ++
Sbjct  217  PFGSSMSSSILNNKLYQDWFTSRFTVTTFGNEMKWYSTENVQGKEDYSVADAMLQFAKQH  276

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH + W DP+F PSW  +L+ P+            V RY+ +LI WDV NE +H+
Sbjct  277  NIAVRGHNIFWDDPHFQPSWVPSLSPPQLNSAVEKRVRSVVSRYRGQLIAWDVVNENLHF  336

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E KL  +  S  I+ +    D   TLF+N++  +E
Sbjct  337  SFFEDKLGQA-FSGRIFNEAHNIDGQTTLFLNEYNTIE  373



>ref|XP_006591552.1| PREDICTED: uncharacterized protein LOC100775814 [Glycine max]
Length=604

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 84/158 (53%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P   ++SS I  N   Q WF  R   T F N +KW S E + G  +Y+++D M+ F  ++
Sbjct  255  PFGSSMSSSILNNKLYQDWFTSRFTVTTFGNEMKWYSTENVQGKEDYSVADAMLQFAKQH  314

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             I   GH + W DP+F PSW  +L+ P+            V RY+ +LI WDV NE +H+
Sbjct  315  NIAVRGHNIFWDDPHFQPSWVPSLSPPQLNSAVEKRVRSVVSRYRGQLIAWDVVNENLHF  374

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E KL  +  S  I+ +    D   TLF+N++  +E
Sbjct  375  SFFEDKLGQA-FSGRIFNEAHNIDGQTTLFLNEYNTIE  411



>ref|XP_006487065.1| PREDICTED: uncharacterized protein LOC102624921, partial [Citrus 
sinensis]
Length=565

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T  +   WF  R   T FE+ +KW S E  PG  +Y+ SD M+ F   + I   GH +
Sbjct  226  ILTNTAYQNWFTSRFKVTTFEDEMKWYSTEASPGREDYSTSDAMLQFAKNHNIAVRGHNI  285

Query  477  LWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W+DP + P W  +L+  ++             RYK ++I WDV NE +H+ F+E KL  
Sbjct  286  FWEDPRYQPGWVNSLSPSDLSKAADKRINSITSRYKGQVIAWDVVNENLHFSFFESKL-G  344

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             +AS   + +V   D   TLF+ND+  +E
Sbjct  345  QDASGVFFNRVHSLDGATTLFMNDYNTIE  373



>ref|XP_009375680.1| PREDICTED: uncharacterized protein LOC103964472 [Pyrus x bretschneideri]
Length=508

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 80/160 (50%), Gaps = 13/160 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T      WF  R   T F N +KW S E   G  NY I+D MV F  +N I   GH V
Sbjct  172  ILTSPDYQNWFTSRFKWTTFTNEMKWYSTEKTQGQENYTIADDMVKFAQQNGISIRGHNV  231

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
             W + N  P+W  +L+  E            V RY+ KLI WDV NE +H+ F+E KL  
Sbjct  232  FWDNANAQPNWVKSLSPEELRKAAEKRINSVVSRYRGKLIAWDVVNENLHFRFFEDKL-G  290

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTTKGHSD  740
             NAS   Y   Q+ DP+  +F+N++  +E   +   G ++
Sbjct  291  KNASAEFYFTAQQLDPSTVMFMNEYNSIEYSKDMKAGAAN  330



>gb|EYU39074.1| hypothetical protein MIMGU_mgv1a019481mg, partial [Erythranthe 
guttata]
Length=555

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 82/163 (50%), Gaps = 14/163 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+  I EN + + WF  R   TVFEN +KW +NE   GV NY I D MV     +
Sbjct  202  PFGTAITLHILENPKYRDWFFSRFRYTVFENEMKWYANEIERGVENYTICDAMVRLAQSH  261

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             +   GH V W   N  P W   L+  E+            +RYK +LIHWDV NE +H+
Sbjct  262  GVAIRGHNVFWDHGNLQPEWVPALSSDELRVAADKRIKSVMNRYKGQLIHWDVMNENLHW  321

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGNT  722
            +F+E KL   NAS   Y+   + D  A  F+N++  VE  G+ 
Sbjct  322  NFFETKL-GPNASNVYYEMANKLDGKALPFLNEYNTVEHAGDV  363



>ref|XP_010065885.1| PREDICTED: uncharacterized protein LOC104453077 isoform X2 [Eucalyptus 
grandis]
Length=579

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R   T F N +KW S E   G  NY I+D MV F   N
Sbjct  234  PFGCGMNFHILDSADYQNWFASRFRYTTFTNAMKWYSTEEKQGQENYTIADAMVKFSQDN  293

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
             I   GH V W DP + P W   L+ PE             V RY  +LI WDV NE +H
Sbjct  294  GISIRGHNVFWDDPKYQPDWVKTLS-PEDLRKAAEKRINSVVSRYAGQLIAWDVVNENLH  352

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            + F+E  L   NAS   Y    + DP   +F+N++  +E CG+
Sbjct  353  FSFFEDNL-GKNASSIYYSTAYKLDPTPRMFLNEYNTIEYCGD  394



>ref|XP_010065884.1| PREDICTED: uncharacterized protein LOC104453077 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63588.1| hypothetical protein EUGRSUZ_G01213 [Eucalyptus grandis]
Length=582

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R   T F N +KW S E   G  NY I+D MV F   N
Sbjct  237  PFGCGMNFHILDSADYQNWFASRFRYTTFTNAMKWYSTEEKQGQENYTIADAMVKFSQDN  296

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
             I   GH V W DP + P W   L+ PE             V RY  +LI WDV NE +H
Sbjct  297  GISIRGHNVFWDDPKYQPDWVKTLS-PEDLRKAAEKRINSVVSRYAGQLIAWDVVNENLH  355

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            + F+E  L   NAS   Y    + DP   +F+N++  +E CG+
Sbjct  356  FSFFEDNL-GKNASSIYYSTAYKLDPTPRMFLNEYNTIEYCGD  397



>ref|XP_010673245.1| PREDICTED: uncharacterized protein LOC104889668 [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 79/160 (49%), Gaps = 16/160 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLP-GVPNYNISDQMVDFVTK  446
            PI   I+  I  N++ + WF  R + T F N +KW   E    G  NY I D M+ F  +
Sbjct  231  PIGCEINEFILNNTKYRNWFASRFSVTAFGNEMKWYFTEKKAVGRENYTIPDAMLQFCEQ  290

Query  447  NKIKTGGHIVLWQDPNFAPSWTCN-------------LTRPEVDRYKNKLIHWDVKNELV  587
            N I   GH + W DP + P+W                  +  V RYK +LIHWDV NE +
Sbjct  291  NNIDVRGHNIFWDDPKYQPTWLTTKIASKKLKKLVEKRLKSVVSRYKGRLIHWDVMNENL  350

Query  588  HYDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
            H+ FYE KL   NAS  I+ +  E D    LF+ND+  +E
Sbjct  351  HFRFYEDKL-GKNASAEIFSRTYELDQKPILFMNDYNTIE  389



>gb|KHN39897.1| Endo-1,4-beta-xylanase C [Glycine soja]
Length=420

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 82/158 (52%), Gaps = 14/158 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    I+S I  N   + WF  R   T FEN +KW S E + G  +Y+++D M+ FV ++
Sbjct  69   PFGSAINSYILNNGLYKNWFTSRFTVTTFENEMKWYSTENVQGREDYSVADAMLQFVKQH  128

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT------------RPEVDRYKNKLIHWDVKNELVHY  593
             I   GH + W DP + P W  +L+            R  V RY+ +LI WDV NE +H+
Sbjct  129  NIAVRGHNIFWDDPRYQPGWVPSLSPYQLNSAVEKRVRSVVSRYRGQLISWDVVNENLHF  188

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
             F+E KL  +  S  I+ +    D   TLF+N++  +E
Sbjct  189  SFFEGKLGQA-FSGRIFHEAHNIDGQTTLFLNEYNTIE  225



>ref|XP_010065883.1| PREDICTED: uncharacterized protein LOC104453076 [Eucalyptus grandis]
Length=535

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R   T F N +KW S E   G  NY I+D MV F   N
Sbjct  190  PFGCGMNFHILDSADYQNWFASRFRYTTFTNAMKWYSTEEKQGQENYTIADAMVKFSQDN  249

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
             I   GH V W DP + P W   L+ PE             V RY  +LI WDV NE +H
Sbjct  250  GISIRGHNVFWDDPKYQPDWVKALS-PEDLRKAAEKRINSVVSRYAGQLIAWDVVNENLH  308

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            + F+E  L   NAS   Y    + DP   +F+N++  +E CG+
Sbjct  309  FSFFEDNL-GKNASSIYYSTAYKLDPTPRMFLNEYNTIEYCGD  350



>emb|CDY49378.1| BnaA03g50670D [Brassica napus]
Length=572

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++   +   WF KR   T F N +KW S E + G  +Y  +D M+ F  ++ I   GH +
Sbjct  235  ILVNQAYQNWFTKRFTVTTFANEMKWYSTEAVRGKEDYTTADAMLRFFKQHGIAVRGHNI  294

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            +W DP +  SW  +L+  +            V RYK +L+ WDV NE +H+ F+E K+  
Sbjct  295  VWNDPKYQLSWVSSLSGNDLYNAVKRRVSSVVSRYKGQLLSWDVVNENLHFSFFESKM-G  353

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGNTT  725
              AS NI+      DP   +F+N+F  +EQ G++ 
Sbjct  354  PQASYNIFALAHSIDPRTPMFMNEFNTLEQPGDSA  388



>gb|KCW63584.1| hypothetical protein EUGRSUZ_G01206 [Eucalyptus grandis]
Length=582

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +++  Q WF  R   T F N +KW S E   G  NY I+D MV F   N
Sbjct  237  PFGCGMNFHILDSADYQNWFASRFRYTTFTNAMKWYSTEEKQGQENYTIADAMVKFSQDN  296

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVH  590
             I   GH V W DP + P W   L+ PE             V RY  +LI WDV NE +H
Sbjct  297  GISIRGHNVFWDDPKYQPDWVKALS-PEDLRKAAEKRINSVVSRYAGQLIAWDVVNENLH  355

Query  591  YDFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
            + F+E  L   NAS   Y    + DP   +F+N++  +E CG+
Sbjct  356  FSFFEDNL-GKNASSIYYSTAYKLDPTPRMFLNEYNTIEYCGD  397



>gb|KFK40660.1| hypothetical protein AALP_AA2G025200 [Arabis alpina]
Length=429

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 74/141 (52%), Gaps = 13/141 (9%)
 Frame = +3

Query  324  WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFAP  503
            WF KR   T F N +KW S E + G   Y+ +D M+    ++ I   GH VLW DP + P
Sbjct  103  WFTKRFTVTTFGNAMKWYSTERIRGKETYSEADAMLKLFKQHGIAVRGHNVLWDDPKYQP  162

Query  504  SWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNIYK  647
             W  +L+  +            V RYK +L+ WDV NE +H+ F+E KL   NAS  IY 
Sbjct  163  EWVKSLSSKDLYNAVKQRVFSVVSRYKGQLLGWDVVNENLHFSFFESKL-GPNASNVIYA  221

Query  648  KVQEKDPNATLFINDFKVVEQ  710
                 DP  T+F+N++  +E+
Sbjct  222  MAHANDPKTTMFMNEYNTLEK  242



>ref|XP_002264605.1| PREDICTED: uncharacterized protein LOC100242953 [Vitis vinifera]
Length=574

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 86/162 (53%), Gaps = 14/162 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    ++  I +N   Q WF  R  AT FE+ LKW +NEP PG  +Y+ +D +  F  +N
Sbjct  228  PFGNAMNKYILDNPAHQNWFTSRFTATAFEDALKWYTNEPSPGKEDYSDADALFQFSEQN  287

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLT----RPEVD--------RYKNKLIHWDVKNELVHY  593
            +I   GH +LW DP + P W  +L+    R + D        RY  K+  WDV NE +H 
Sbjct  288  QIAVRGHNILWDDPKYLPGWLLSLSPSQIRSDADKRINSVVQRYIGKVNSWDVVNENLHT  347

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             F+E KL   NAS   +++ ++ D    LF+N++  +E  G+
Sbjct  348  SFFEDKL-GPNASAVFFQETRQLDKTTPLFMNEYNTLENGGD  388



>ref|XP_003592507.1| Endo-1,4-beta-xylanase A [Medicago truncatula]
Length=581

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 74/149 (50%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T     +WF  R   T F N +KW S E + G  NY I D M+ F  +N I   GH +
Sbjct  244  ILTNIEYQKWFVSRFKYTTFTNEMKWYSTEKIQGQENYTIPDAMLKFAKENGISVRGHAI  303

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW D  F P W  +L+  E            V RY  +LI WDV NE VH  F+E KL  
Sbjct  304  LWDDERFQPQWVKSLSPEELREAAAKRMKSVVSRYSGQLIAWDVVNENVHNRFFEDKL-G  362

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   Y      DPN ++F+N+F  +E
Sbjct  363  ENASAVYYSTAYYLDPNTSMFMNEFNTIE  391



>gb|AES62758.2| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=580

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 74/149 (50%), Gaps = 13/149 (9%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T     +WF  R   T F N +KW S E + G  NY I D M+ F  +N I   GH +
Sbjct  243  ILTNIEYQKWFVSRFKYTTFTNEMKWYSTEKIQGQENYTIPDAMLKFAKENGISVRGHAI  302

Query  477  LWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW D  F P W  +L+  E            V RY  +LI WDV NE VH  F+E KL  
Sbjct  303  LWDDERFQPQWVKSLSPEELREAAAKRMKSVVSRYSGQLIAWDVVNENVHNRFFEDKL-G  361

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVE  707
             NAS   Y      DPN ++F+N+F  +E
Sbjct  362  ENASAVYYSTAYYLDPNTSMFMNEFNTIE  390



>ref|XP_010496774.1| PREDICTED: uncharacterized protein LOC104773807 isoform X2 [Camelina 
sativa]
Length=573

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 81/151 (54%), Gaps = 15/151 (10%)
 Frame = +3

Query  297  MITENSQ-SQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHI  473
            +I EN +  +WF  R   T F N +KW S E + G  NY+++D+M+    +NKI   GH 
Sbjct  220  LILENDRYKEWFVSRFRLTSFTNEMKWYSTESVRGQENYSLADRMMTLAEENKILVKGHT  279

Query  474  VLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKL  614
            VLW D  + PSW   +T P+             + RYK +LI WDV NE VH+ ++E  L
Sbjct  280  VLWDDKTWQPSWVKTITDPKDLKNVTLNRINSVMKRYKGRLIGWDVVNENVHFSYFEDML  339

Query  615  ENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
               NAS   +    + DP+  LF+N+F  +E
Sbjct  340  -GKNASAIFFSLASKLDPDIPLFVNEFNTLE  369



>ref|XP_002867154.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43413.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 72/142 (51%), Gaps = 14/142 (10%)
 Frame = +3

Query  321  QWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIVLWQDPNFA  500
            +WF  R   T F N +KW + E   G  NY ++D M+ F   N I   GH VLW +P   
Sbjct  233  KWFASRFKITSFTNEMKWYATEKARGQENYTVADSMLKFAEDNGILVRGHTVLWDNPRMQ  292

Query  501  PSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKLENSNASLNI  641
            PSW   +  PE             + RYK KL  WDV NE +H+D++E+ L   NAS   
Sbjct  293  PSWVKKINNPEDVMNVTLNRINSVMKRYKGKLTGWDVVNENLHWDYFEKML-GENASSRF  351

Query  642  YKKVQEKDPNATLFINDFKVVE  707
            Y    + DP+  LF+N++  +E
Sbjct  352  YNMASKIDPDVRLFVNEYNTIE  373



>ref|XP_007143125.1| hypothetical protein PHAVU_007G045900g [Phaseolus vulgaris]
 gb|ESW15119.1| hypothetical protein PHAVU_007G045900g [Phaseolus vulgaris]
Length=578

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 74/153 (48%), Gaps = 13/153 (8%)
 Frame = +3

Query  297  MITENSQSQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHIV  476
            ++T      WF  R   T F N +KW S E + G  +Y+I+D M+ F  +  I   GH +
Sbjct  242  ILTSKDYQNWFASRFKITTFTNEMKWYSTERIQGQEDYSIADAMLTFAKEKGISVRGHNI  301

Query  477  LWQDPNFAPSWTCNL------------TRPEVDRYKNKLIHWDVKNELVHYDFYERKLEN  620
            LW D  + P W   L            TR  V RYK ++I WDV NE +H+ F+E  L  
Sbjct  302  LWDDEKYLPQWIKTLSPEDLKKAAAKRTRSVVSRYKGQVIAWDVMNENLHFHFFEDNL-G  360

Query  621  SNASLNIYKKVQEKDPNATLFINDFKVVEQCGN  719
             NAS   Y      DP   +F+N+F  +E  G+
Sbjct  361  QNASAKAYAATFALDPGTQMFLNEFNTIEYSGD  393



>ref|XP_010496773.1| PREDICTED: uncharacterized protein LOC104773807 isoform X1 [Camelina 
sativa]
Length=574

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 81/151 (54%), Gaps = 15/151 (10%)
 Frame = +3

Query  297  MITENSQ-SQWFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKNKIKTGGHI  473
            +I EN +  +WF  R   T F N +KW S E + G  NY+++D+M+    +NKI   GH 
Sbjct  221  LILENDRYKEWFVSRFRLTSFTNEMKWYSTESVRGQENYSLADRMMTLAEENKILVKGHT  280

Query  474  VLWQDPNFAPSWTCNLTRPE-------------VDRYKNKLIHWDVKNELVHYDFYERKL  614
            VLW D  + PSW   +T P+             + RYK +LI WDV NE VH+ ++E  L
Sbjct  281  VLWDDKTWQPSWVKTITDPKDLKNVTLNRINSVMKRYKGRLIGWDVVNENVHFSYFEDML  340

Query  615  ENSNASLNIYKKVQEKDPNATLFINDFKVVE  707
               NAS   +    + DP+  LF+N+F  +E
Sbjct  341  -GKNASAIFFSLASKLDPDIPLFVNEFNTLE  370



>ref|XP_002468320.1| hypothetical protein SORBIDRAFT_01g043760 [Sorghum bicolor]
 gb|EER95318.1| hypothetical protein SORBIDRAFT_01g043760 [Sorghum bicolor]
Length=573

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 80/166 (48%), Gaps = 15/166 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P+   +S  I  NS  Q WF  R     FEN +KW S EP PG  +Y + D M+ F   N
Sbjct  228  PLGAAVSRYILTNSAYQTWFASRFAVATFENEMKWYSTEPAPGREDYTVPDAMMAFAKSN  287

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPEV------------DRYKNKLIHWDVKNELVHY  593
             I   GH V W  P+  P W  +L  P++             RY  ++I WDV NE +H+
Sbjct  288  GIAVRGHNVFWDQPSQQPGWVQSLPYPQLLAAASRRIRSVMSRYAGQVIGWDVVNENLHF  347

Query  594  DFYERKLENSNASLNIYKKVQEKDPN-ATLFINDFKVVEQCGNTTK  728
            +FYE +    +AS   Y   +  D   A +F+N++  +EQ G+   
Sbjct  348  NFYEGRF-GWDASTAFYAAARLLDTGSALMFLNEYNTLEQPGDMAA  392



>emb|CAN61986.1| hypothetical protein VITISV_034670 [Vitis vinifera]
Length=356

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 84/161 (52%), Gaps = 14/161 (9%)
 Frame = +3

Query  273  PIPINISSMITENSQSQ-WFKKRSNATVFENVLKWPSNEPLPGVPNYNISDQMVDFVTKN  449
            P    IS  I  N+  Q WF  R   TVFEN LKW S E   G  +Y++ D M+ F  ++
Sbjct  11   PFGSAISKYILSNTAYQNWFTSRFTVTVFENELKWYSTEWSRGKEDYSVPDAMLRFAKQH  70

Query  450  KIKTGGHIVLWQDPNFAPSWTCNLTRPE------------VDRYKNKLIHWDVKNELVHY  593
             +   GH +LW + N  PSW  +L+  E            V RY  + I WDV NE +H+
Sbjct  71   GLAVRGHNILWDNGNNQPSWVPSLSNSELQAAVDKRINSVVRRYSGQFIGWDVVNENLHF  130

Query  594  DFYERKLENSNASLNIYKKVQEKDPNATLFINDFKVVEQCG  716
             F+E +L  + A+   ++K ++ D   TLF+N++  +E+ G
Sbjct  131  SFFESRL-GAKATGVAFQKTRQLDGRTTLFMNEYDTIEKSG  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1972844437608