BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77553_g1_i1 len=1017 path=[995:0-1016]

Length=1017
                                                                      Score     E

ref|XP_009592040.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    361   3e-115   
ref|XP_009789304.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    358   2e-114   
ref|XP_006352479.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    333   4e-109   
ref|XP_006352418.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    334   5e-105   
ref|XP_010312719.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    334   3e-104   
emb|CDP01658.1|  unnamed protein product                                322   4e-100   
ref|XP_011099936.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    301   4e-92    
ref|XP_006494663.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    288   8e-89    
ref|XP_006421081.1|  hypothetical protein CICLE_v10007029mg             288   1e-87    
ref|XP_006494662.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    286   1e-86    
gb|KDO41051.1|  hypothetical protein CISIN_1g046513mg                   284   6e-86    
ref|XP_002533478.1|  DNA binding protein, putative                      284   8e-86    Ricinus communis
ref|XP_002263205.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    283   2e-85    Vitis vinifera
ref|XP_010689687.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    279   1e-83    
ref|XP_008244388.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    278   1e-83    
gb|KDP25820.1|  hypothetical protein JCGZ_22542                         277   2e-83    
ref|XP_007216520.1|  hypothetical protein PRUPE_ppa024280mg             278   3e-83    
ref|XP_009370077.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    275   3e-82    
ref|XP_007141934.1|  hypothetical protein PHAVU_008G238400g             275   4e-82    
gb|EYU30865.1|  hypothetical protein MIMGU_mgv1a002061mg                274   1e-81    
ref|XP_008381356.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    272   2e-81    
gb|AES99203.2|  PHD finger protein MALE meiocyte DEATH protein          271   8e-81    
ref|XP_003616245.1|  PHD finger protein                                 271   1e-80    
ref|XP_004490840.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    270   3e-80    
ref|XP_007019293.1|  RING/FYVE/PHD zinc finger superfamily protei...    267   3e-79    
ref|XP_010034488.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    265   1e-78    
gb|KHN39480.1|  PHD finger protein MALE MEIOCYTE DEATH 1                259   5e-76    
ref|XP_010278619.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    255   5e-76    
ref|XP_003544360.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    258   1e-75    
ref|XP_006372523.1|  hypothetical protein POPTR_0017s02450g             256   2e-75    
ref|XP_011038253.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    256   3e-75    
ref|XP_010278538.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    254   1e-74    
ref|XP_003518369.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    254   3e-74    
ref|XP_010108961.1|  PHD finger protein MALE MEIOCYTE DEATH 1           250   5e-73    
ref|XP_004146114.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    249   1e-72    
gb|KGN55704.1|  hypothetical protein Csa_3G006660                       248   2e-72    
ref|XP_004164188.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    249   2e-72    
ref|XP_008448613.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    244   7e-71    
ref|XP_004288593.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    243   2e-70    
ref|XP_006391351.1|  hypothetical protein EUTSA_v10018197mg             235   4e-67    
gb|EPS59525.1|  hypothetical protein M569_15279                         232   1e-66    
ref|XP_010528997.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    229   6e-65    
ref|XP_010415158.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    224   3e-63    
ref|XP_008343056.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    213   5e-63    
gb|KDO60815.1|  hypothetical protein CISIN_1g041583mg                   218   6e-62    
ref|XP_006469331.1|  PREDICTED: PHD finger protein At2g01810-like       219   8e-62    
ref|XP_006448127.1|  hypothetical protein CICLE_v10017749mg             216   1e-60    
ref|XP_008353887.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    214   6e-60    
ref|XP_008343055.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    214   9e-60    
gb|KDP38152.1|  hypothetical protein JCGZ_04795                         214   1e-59    
ref|XP_010470485.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    212   7e-59    
ref|XP_010068687.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    212   7e-59    
gb|AAG51303.1|AC026480_10  PHD-finger protein, putative                 203   7e-56    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176791.2|  PHD finger protein MALE MEIOCYTE DEATH 1              203   1e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127470.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    203   2e-55    
ref|XP_010511544.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    202   3e-55    
ref|XP_006302059.1|  hypothetical protein CARUB_v10020044mg             199   3e-55    
ref|XP_006826580.1|  hypothetical protein AMTR_s00138p00033180          201   5e-55    
ref|XP_006302058.1|  hypothetical protein CARUB_v10020044mg             199   1e-54    
ref|XP_002888484.1|  hypothetical protein ARALYDRAFT_894251             199   3e-54    
ref|XP_011024453.1|  PREDICTED: PHD finger protein At2g01810            196   3e-53    
ref|XP_006395850.1|  hypothetical protein EUTSA_v10003728mg             196   4e-53    
ref|XP_002311539.2|  PHD finger family protein                          195   8e-53    Populus trichocarpa [western balsam poplar]
ref|XP_010502170.1|  PREDICTED: PHD finger protein At2g01810-like       194   1e-52    
ref|XP_010424952.1|  PREDICTED: PHD finger protein At2g01810-like       194   3e-52    
ref|XP_006826579.1|  hypothetical protein AMTR_s00138p00031220          193   6e-52    
ref|XP_002527531.1|  DNA binding protein, putative                      191   2e-51    Ricinus communis
ref|XP_009405163.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    191   2e-51    
emb|CDY50318.1|  BnaCnng19010D                                          187   6e-50    
gb|EMS67490.1|  PHD finger protein MALE MEIOCYTE DEATH 1                183   4e-49    
ref|XP_006293073.1|  hypothetical protein CARUB_v10019360mg             184   6e-49    
ref|NP_178290.1|  RING/FYVE/PHD zinc finger superfamily protein         184   6e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777846.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    184   6e-49    
ref|XP_010513908.1|  PREDICTED: PHD finger protein At2g01810-like       184   1e-48    
ref|XP_010229496.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    183   1e-48    
emb|CDY17644.1|  BnaA06g34630D                                          183   1e-48    
ref|XP_009101316.1|  PREDICTED: PHD finger protein At2g01810            183   1e-48    
ref|XP_010554390.1|  PREDICTED: PHD finger protein At2g01810            183   2e-48    
emb|CDY16433.1|  BnaA02g12370D                                          181   5e-48    
ref|XP_006651751.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    180   6e-48    
emb|CDY36263.1|  BnaC07g21170D                                          180   2e-47    
ref|XP_004236465.1|  PREDICTED: PHD finger protein At2g01810-like       180   2e-47    
ref|NP_001170504.1|  uncharacterized protein LOC100384509               177   3e-47    Zea mays [maize]
ref|XP_002875094.1|  PHD finger family protein                          179   3e-47    
gb|KFK41037.1|  hypothetical protein AALP_AA2G077200                    179   4e-47    
ref|XP_006851141.1|  hypothetical protein AMTR_s00043p00045130          173   8e-47    
ref|XP_008644163.1|  PREDICTED: uncharacterized protein LOC100384...    177   2e-46    
emb|CDP05546.1|  unnamed protein product                                177   3e-46    
ref|XP_010916807.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    176   4e-46    
ref|XP_002463991.1|  hypothetical protein SORBIDRAFT_01g010120          176   8e-46    Sorghum bicolor [broomcorn]
dbj|BAK03548.1|  predicted protein                                      174   2e-45    
ref|XP_009620363.1|  PREDICTED: PHD finger protein At2g01810-like       175   2e-45    
ref|XP_009770533.1|  PREDICTED: PHD finger protein At2g01810-like       174   3e-45    
ref|XP_001780078.1|  predicted protein                                  171   2e-44    
gb|EAZ28373.1|  hypothetical protein OsJ_12353                          170   7e-44    Oryza sativa Japonica Group [Japonica rice]
gb|AAL58226.1|AC090882_29  putative collagen                            169   9e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001781922.1|  predicted protein                                  168   4e-43    
ref|XP_004986276.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    162   6e-41    
ref|XP_002281717.1|  PREDICTED: PHD finger protein MALE STERILITY 1     159   5e-40    Vitis vinifera
ref|XP_003518728.1|  PREDICTED: PHD finger protein MALE STERILITY...    155   6e-39    
ref|XP_006851143.1|  hypothetical protein AMTR_s00043p00048200          146   3e-37    
ref|XP_004490060.1|  PREDICTED: PHD finger protein MALE STERILITY...    150   4e-37    
ref|XP_002964302.1|  hypothetical protein SELMODRAFT_31177              143   1e-34    
ref|XP_003613773.1|  Histone-lysine N-methyltransferase MLL5            143   2e-34    
ref|XP_002967734.1|  hypothetical protein SELMODRAFT_31178              141   7e-34    
ref|XP_009414350.1|  PREDICTED: PHD finger protein MALE STERILITY 1     139   9e-34    
emb|CAN78037.1|  hypothetical protein VITISV_041469                     141   1e-33    Vitis vinifera
ref|XP_002315838.1|  hypothetical protein POPTR_0010s11170g             140   2e-33    Populus trichocarpa [western balsam poplar]
ref|XP_007157621.1|  hypothetical protein PHAVU_002G085000g             138   5e-33    
ref|XP_011021716.1|  PREDICTED: PHD finger protein MALE STERILITY 1     139   5e-33    
ref|XP_006355027.1|  PREDICTED: PHD finger protein MALE STERILITY...    137   3e-32    
ref|XP_007226344.1|  hypothetical protein PRUPE_ppa022178mg             135   1e-31    
ref|XP_007040228.1|  RING/FYVE/PHD zinc finger superfamily protein      135   1e-31    
ref|XP_006492305.1|  PREDICTED: PHD finger protein MALE STERILITY...    134   3e-31    
gb|KDO40585.1|  hypothetical protein CISIN_1g040083mg                   133   5e-31    
emb|CDY68248.1|  BnaC02g47750D                                          131   5e-31    
ref|XP_010454488.1|  PREDICTED: PHD finger protein MALE STERILITY...    133   6e-31    
ref|XP_006448066.1|  hypothetical protein CICLE_v10017892mg             132   7e-31    
ref|XP_008381804.1|  PREDICTED: PHD finger protein MALE STERILITY 1     133   9e-31    
gb|KDP38178.1|  hypothetical protein JCGZ_04821                         132   1e-30    
ref|XP_008220957.1|  PREDICTED: PHD finger protein MALE STERILITY 1     132   1e-30    
ref|XP_008348744.1|  PREDICTED: PHD finger protein MALE STERILITY...    132   1e-30    
ref|XP_010493299.1|  PREDICTED: PHD finger protein MALE STERILITY 1     132   1e-30    
ref|XP_002521912.1|  DNA binding protein, putative                      132   2e-30    Ricinus communis
ref|XP_010271105.1|  PREDICTED: PHD finger protein MALE STERILITY 1     131   3e-30    
ref|XP_007048632.1|  RING/FYVE/PHD zinc finger superfamily protei...    129   3e-30    
gb|KGN50860.1|  hypothetical protein Csa_5G291680                       128   9e-30    
ref|XP_009350911.1|  PREDICTED: PHD finger protein MALE STERILITY...    129   1e-29    
ref|XP_001417810.1|  predicted protein                                  130   1e-29    Ostreococcus lucimarinus CCE9901
ref|XP_003079461.1|  putative male sterility 1 protein (ISS)            130   2e-29    
ref|XP_007048631.1|  RING/FYVE/PHD zinc finger superfamily protei...    129   2e-29    
emb|CDP05466.1|  unnamed protein product                                128   3e-29    
ref|XP_004140423.1|  PREDICTED: PHD finger protein MALE STERILITY...    128   4e-29    
ref|XP_008456986.1|  PREDICTED: PHD finger protein MALE STERILITY 1     127   4e-29    
ref|XP_010043916.1|  PREDICTED: PHD finger protein MALE STERILITY 1     127   4e-29    
ref|XP_010536249.1|  PREDICTED: PHD finger protein MALE STERILITY 1     127   6e-29    
gb|EYU30216.1|  hypothetical protein MIMGU_mgv1a002812mg                127   7e-29    
ref|XP_011070712.1|  PREDICTED: PHD finger protein MALE STERILITY 1     126   1e-28    
ref|XP_010319373.1|  PREDICTED: PHD finger protein MALE STERILITY 1     126   2e-28    
ref|XP_006289308.1|  hypothetical protein CARUB_v10002790mg             125   2e-28    
ref|XP_009775431.1|  PREDICTED: PHD finger protein MALE STERILITY 1     125   2e-28    
ref|XP_009351795.1|  PREDICTED: PHD finger protein MALE STERILITY...    125   3e-28    
ref|XP_006851139.1|  hypothetical protein AMTR_s00043p00044190          117   5e-28    
ref|XP_010999680.1|  PREDICTED: PHD finger protein At1g33420-like       125   5e-28    
gb|KFK26332.1|  hypothetical protein AALP_AA8G234100                    124   7e-28    
ref|XP_004156135.1|  PREDICTED: PHD finger protein MALE STERILITY...    124   9e-28    
ref|XP_011005581.1|  PREDICTED: PHD finger protein At1g33420-like...    123   1e-27    
ref|XP_011005579.1|  PREDICTED: PHD finger protein At1g33420-like...    124   1e-27    
ref|XP_007143927.1|  hypothetical protein PHAVU_007G114100g             122   1e-27    
gb|KEH42842.1|  PHD finger plant-like protein                           122   1e-27    
gb|KEH42841.1|  PHD finger plant-like protein                           122   3e-27    
ref|XP_004956970.1|  PREDICTED: PHD finger protein MALE STERILITY...    122   4e-27    
ref|XP_009604856.1|  PREDICTED: PHD finger protein MALE STERILITY 1     122   5e-27    
ref|XP_002325292.2|  hypothetical protein POPTR_0019s00330g             122   5e-27    Populus trichocarpa [western balsam poplar]
gb|KEH42843.1|  PHD finger plant-like protein                           122   6e-27    
ref|XP_010421013.1|  PREDICTED: PHD finger protein MALE STERILITY 1     121   8e-27    
ref|XP_007143926.1|  hypothetical protein PHAVU_007G114100g             121   8e-27    
ref|XP_003622362.1|  PHD finger protein                                 121   8e-27    
ref|XP_010917298.1|  PREDICTED: PHD finger protein MALE STERILITY 1     120   1e-26    
ref|XP_003622361.1|  PHD finger protein                                 121   1e-26    
ref|XP_002305350.1|  hypothetical protein POPTR_0004s14230g             121   1e-26    Populus trichocarpa [western balsam poplar]
ref|XP_008806642.1|  PREDICTED: PHD finger protein MALE STERILITY 1     120   1e-26    
ref|XP_010112064.1|  PHD finger protein                                 120   2e-26    
ref|XP_006589256.1|  PREDICTED: PHD finger protein At1g33420-like...    118   4e-26    
ref|XP_011070715.1|  PREDICTED: PHD finger protein At2g01810            118   4e-26    
gb|KHN30528.1|  PHD finger protein                                      118   4e-26    
ref|XP_002518819.1|  DNA binding protein, putative                      119   5e-26    Ricinus communis
ref|XP_004288656.1|  PREDICTED: PHD finger protein At1g33420-like       119   5e-26    
ref|XP_002460302.1|  hypothetical protein SORBIDRAFT_02g026200          119   5e-26    Sorghum bicolor [broomcorn]
ref|XP_009366883.1|  PREDICTED: PHD finger protein At1g33420            119   6e-26    
ref|XP_003536185.1|  PREDICTED: PHD finger protein At1g33420-like...    119   7e-26    
ref|XP_007514134.1|  predicted protein                                  119   9e-26    
ref|XP_004298641.1|  PREDICTED: PHD finger protein MALE STERILITY...    118   1e-25    
ref|XP_010674317.1|  PREDICTED: PHD finger protein MALE STERILITY 1     117   1e-25    
ref|XP_006826582.1|  hypothetical protein AMTR_s00138p00035380          112   2e-25    
ref|XP_007019721.1|  DNA binding protein, putative isoform 3            115   3e-25    
ref|NP_197618.1|  PHD finger protein MALE STERILITY 1                   116   3e-25    Arabidopsis thaliana [mouse-ear cress]
emb|CAC69663.1|  male sterility 1 protein                               116   4e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927813.1|  PREDICTED: PHD finger protein At1g33420-like       116   5e-25    
ref|XP_007019720.1|  DNA binding protein, putative isoform 2            115   6e-25    
ref|XP_010542547.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    115   7e-25    
ref|XP_006426400.1|  hypothetical protein CICLE_v10025026mg             115   1e-24    
ref|XP_006606403.1|  PREDICTED: PHD finger protein At1g33420-like...    114   1e-24    
ref|XP_007019719.1|  DNA binding protein, putative isoform 1            115   1e-24    
ref|NP_564424.1|  PHD finger protein                                    114   1e-24    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495439.1|  PREDICTED: PHD finger protein At1g33420-like       114   2e-24    
ref|XP_006606402.1|  PREDICTED: PHD finger protein At1g33420-like...    114   2e-24    
ref|XP_010252344.1|  PREDICTED: PHD finger protein At1g33420            114   2e-24    
ref|XP_008803796.1|  PREDICTED: PHD finger protein At1g33420-like       114   3e-24    
gb|KHN05025.1|  PHD finger protein                                      114   3e-24    
gb|EYU30150.1|  hypothetical protein MIMGU_mgv1a019304mg                112   3e-24    
ref|XP_010027490.1|  PREDICTED: PHD finger protein At1g33420-like       113   4e-24    
ref|XP_002874056.1|  hypothetical protein ARALYDRAFT_489076             113   4e-24    
ref|XP_004980335.1|  PREDICTED: PHD finger protein At1g33420-like       113   4e-24    
ref|XP_006400732.1|  hypothetical protein EUTSA_v10012892mg             113   4e-24    
ref|XP_004512621.1|  PREDICTED: PHD finger protein At1g33420-like       113   5e-24    
ref|XP_009120674.1|  PREDICTED: PHD finger protein MALE STERILITY...    112   6e-24    
ref|XP_006466218.1|  PREDICTED: PHD finger protein At1g33420-like       112   7e-24    
ref|XP_010237811.1|  PREDICTED: PHD finger protein At1g33420-like       112   8e-24    
emb|CDX98585.1|  BnaC05g37900D                                          112   1e-23    
ref|XP_008657002.1|  PREDICTED: PHD finger protein At1g33420            112   1e-23    
gb|EAZ09313.1|  hypothetical protein OsI_31586                          112   1e-23    Oryza sativa Indica Group [Indian rice]
ref|NP_001063319.2|  Os09g0449000                                       112   1e-23    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009120673.1|  PREDICTED: PHD finger protein MALE STERILITY...    112   1e-23    
ref|XP_004236973.1|  PREDICTED: PHD finger protein At1g33420            112   2e-23    
ref|XP_002456731.1|  hypothetical protein SORBIDRAFT_03g041550          111   2e-23    Sorghum bicolor [broomcorn]
ref|XP_008449753.1|  PREDICTED: PHD finger protein At1g33420            111   2e-23    
ref|XP_006836898.1|  hypothetical protein AMTR_s00099p00124180          111   2e-23    
ref|XP_009587240.1|  PREDICTED: PHD finger protein At1g33420            111   2e-23    
ref|XP_010096402.1|  PHD finger protein                                 111   2e-23    
ref|XP_008786465.1|  PREDICTED: PHD finger protein At1g33420-like       111   2e-23    
ref|XP_007131323.1|  hypothetical protein PHAVU_011G004000g             111   2e-23    
gb|EPS71344.1|  hypothetical protein M569_03413                         110   3e-23    
ref|XP_006304773.1|  hypothetical protein CARUB_v10012280mg             110   3e-23    
ref|XP_006360454.1|  PREDICTED: PHD finger protein At1g33420-like       110   3e-23    
ref|NP_001051078.2|  Os03g0716200                                       110   3e-23    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK05033.1|  predicted protein                                      110   4e-23    
ref|XP_009783934.1|  PREDICTED: PHD finger protein At1g33420            110   5e-23    
ref|XP_007199715.1|  hypothetical protein PRUPE_ppa002124mg             110   5e-23    
ref|XP_008237816.1|  PREDICTED: PHD finger protein At1g33420            110   5e-23    
ref|XP_006849470.1|  hypothetical protein AMTR_s00024p00102300          108   6e-23    
ref|XP_004144350.1|  PREDICTED: PHD finger protein At1g33420-like       109   6e-23    
gb|KGN54749.1|  hypothetical protein Csa_4G443130                       110   7e-23    
ref|XP_004165011.1|  PREDICTED: PHD finger protein At1g33420-like       109   7e-23    
gb|KDP24219.1|  hypothetical protein JCGZ_25876                         109   1e-22    
ref|XP_008802928.1|  PREDICTED: PHD finger protein At1g33420-like       108   1e-22    
ref|XP_004970770.1|  PREDICTED: PHD finger protein At1g33420-like       108   1e-22    
gb|EPS66457.1|  hypothetical protein M569_08321                         108   2e-22    
ref|XP_011083217.1|  PREDICTED: PHD finger protein At1g33420            108   2e-22    
ref|XP_003540842.1|  PREDICTED: PHD finger protein At1g33420-like       108   2e-22    
emb|CDP21393.1|  unnamed protein product                                108   2e-22    
ref|XP_010674289.1|  PREDICTED: PHD finger protein At1g33420            108   3e-22    
gb|EAY76692.1|  hypothetical protein OsI_04645                          107   4e-22    Oryza sativa Indica Group [Indian rice]
ref|XP_002267837.1|  PREDICTED: PHD finger protein At1g33420            107   5e-22    Vitis vinifera
gb|EYU31209.1|  hypothetical protein MIMGU_mgv1a026000mg                107   5e-22    
ref|NP_001159230.1|  hypothetical protein                               106   5e-22    Zea mays [maize]
ref|XP_003056829.1|  predicted protein                                  104   6e-22    
ref|XP_008677465.1|  PREDICTED: hypothetical protein isoform X3         106   6e-22    
ref|XP_008227667.1|  PREDICTED: PHD finger protein At1g33420-like       107   7e-22    
ref|XP_008394231.1|  PREDICTED: PHD finger protein At1g33420-like       106   7e-22    
ref|XP_010063730.1|  PREDICTED: PHD finger protein At1g33420            106   8e-22    
gb|KCW70986.1|  hypothetical protein EUGRSUZ_F04095                     106   8e-22    
ref|NP_001067563.1|  Os11g0234200                                       106   8e-22    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677464.1|  PREDICTED: hypothetical protein isoform X2         106   9e-22    
ref|XP_008391867.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    104   9e-22    
gb|EAZ17917.1|  hypothetical protein OsJ_33464                          106   9e-22    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044975.1|  Os01g0877500                                       106   1e-21    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04913.1|  predicted protein                                      106   1e-21    
ref|XP_003534422.1|  PREDICTED: PHD finger protein At1g33420-like       105   2e-21    
gb|KHN11645.1|  PHD finger protein                                      105   2e-21    
ref|XP_007212930.1|  hypothetical protein PRUPE_ppa021865mg             104   2e-21    
ref|XP_002519951.1|  DNA binding protein, putative                      104   3e-21    Ricinus communis
ref|XP_004292411.1|  PREDICTED: PHD finger protein At1g33420-like       104   3e-21    
ref|XP_008677470.1|  PREDICTED: hypothetical protein isoform X4         103   3e-21    
emb|CBI16978.3|  unnamed protein product                                104   4e-21    
ref|XP_002265123.1|  PREDICTED: PHD finger protein At1g33420            104   4e-21    Vitis vinifera
ref|XP_005646272.1|  hypothetical protein COCSUDRAFT_47922              105   4e-21    
ref|XP_006645112.1|  PREDICTED: PHD finger protein At1g33420-like       104   5e-21    
ref|XP_010232639.1|  PREDICTED: PHD finger protein At1g33420            104   5e-21    
ref|XP_011013353.1|  PREDICTED: PHD finger protein At1g33420            103   6e-21    
ref|XP_009393484.1|  PREDICTED: PHD finger protein At1g33420-like       103   7e-21    
gb|EAY80449.1|  hypothetical protein OsI_35630                          102   2e-20    Oryza sativa Indica Group [Indian rice]
ref|XP_006663315.1|  PREDICTED: PHD finger protein At1g33420-like       101   3e-20    
gb|EMT27461.1|  hypothetical protein F775_12135                         101   3e-20    
gb|EPS70707.1|  hypothetical protein M569_04052                         101   3e-20    
ref|XP_006376093.1|  PHD finger family protein                          101   4e-20    
ref|XP_010930553.1|  PREDICTED: PHD finger protein At1g33420-like       101   4e-20    
ref|XP_002891485.1|  hypothetical protein ARALYDRAFT_891770           94.4    5e-20    
ref|XP_002449306.1|  hypothetical protein SORBIDRAFT_05g007460        97.8    6e-20    Sorghum bicolor [broomcorn]
gb|KDP37798.1|  hypothetical protein JCGZ_06700                         100   6e-20    
gb|EMT13329.1|  PHD finger protein                                      100   8e-20    
ref|XP_002873847.1|  hypothetical protein ARALYDRAFT_909771           93.6    9e-20    
emb|CDM85226.1|  unnamed protein product                                100   1e-19    
ref|XP_003578202.1|  PREDICTED: PHD finger protein MALE STERILITY 1     100   1e-19    
emb|CDX92370.1|  BnaA10g14090D                                        99.8    1e-19    
gb|EMT08696.1|  PHD finger protein                                    99.8    1e-19    
ref|XP_010910248.1|  PREDICTED: PHD finger protein At1g33420-like     99.8    1e-19    
ref|XP_002893768.1|  PHD finger family protein                        97.1    9e-19    
ref|XP_010538899.1|  PREDICTED: PHD finger protein At1g33420-like     97.1    1e-18    
ref|XP_006415087.1|  hypothetical protein EUTSA_v10006958mg           96.7    2e-18    
ref|XP_010499890.1|  PREDICTED: PHD finger protein At1g33420-like     95.5    3e-18    
ref|XP_006851134.1|  hypothetical protein AMTR_s00043p00041380        93.2    8e-18    
ref|XP_010461171.1|  PREDICTED: PHD finger protein At1g33420-like     94.0    1e-17    
ref|XP_003605664.1|  PHD finger protein                               93.6    1e-17    
gb|AES87861.2|  PHD finger plant-like protein                         93.6    1e-17    
ref|XP_010478770.1|  PREDICTED: PHD finger protein At1g33420          92.4    3e-17    
ref|XP_006660674.1|  PREDICTED: PHD finger protein MALE STERILITY...  91.7    5e-17    
ref|YP_008992329.1|  hypothetical protein Salmi_Mp065                 85.5    8e-17    
emb|CDY09415.1|  BnaA02g25950D                                        90.1    1e-16    
ref|XP_006851135.1|  hypothetical protein AMTR_s00043p00041500        82.4    2e-16    
ref|XP_009421159.1|  PREDICTED: PHD finger protein At1g33420-like...  88.6    5e-16    
ref|XP_009421161.1|  PREDICTED: PHD finger protein At1g33420-like...  88.6    6e-16    
pdb|1WEE|A  Chain A, Solution Structure Of Phd Domain In Phd Fing...  80.5    1e-15    
ref|XP_002883861.1|  hypothetical protein ARALYDRAFT_899705           80.1    7e-15    
ref|NP_001288391.1|  uncharacterized protein LOC103643406             81.6    7e-15    
ref|XP_007227386.1|  hypothetical protein PRUPE_ppb016870mg           79.7    4e-13    
ref|XP_001695692.1|  hypothetical protein CHLREDRAFT_149807           78.6    2e-12    
ref|XP_002963917.1|  hypothetical protein SELMODRAFT_69964            71.6    2e-12    
ref|XP_005844680.1|  hypothetical protein CHLNCDRAFT_138585           77.8    2e-12    
ref|YP_008992330.1|  hypothetical protein Salmi_Mp066                 72.8    3e-12    
ref|XP_002950120.1|  hypothetical protein VOLCADRAFT_49050            67.4    7e-11    
ref|XP_002311554.2|  hypothetical protein POPTR_0008s13970g           71.2    8e-11    
gb|AHA86557.1|  PHD-typetranscription factor                          72.8    1e-10    
ref|XP_002508791.1|  predicted protein                                66.6    2e-10    
ref|XP_004298359.1|  PREDICTED: PHD finger protein At2g01810-like     69.3    1e-09    
gb|ACN26296.1|  unknown                                               65.5    4e-09    
ref|XP_005646075.1|  hypothetical protein COCSUDRAFT_66934            67.8    5e-09    
ref|XP_004304762.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...  63.9    6e-08    
ref|XP_001899047.1|  hypothetical protein                             63.2    2e-07    
emb|CDP94913.1|  Protein Bm3397, isoform l                            63.2    2e-07    
gb|KDO25213.1|  hypothetical protein SPRG_20791                       62.8    2e-07    
ref|XP_010325318.1|  PREDICTED: uncharacterized protein LOC101260...  62.8    2e-07    
ref|XP_010325314.1|  PREDICTED: uncharacterized protein LOC101260...  62.8    2e-07    
ref|XP_006343768.1|  PREDICTED: microtubule-associated protein fu...  62.8    2e-07    
ref|XP_008864414.1|  hypothetical protein H310_02622                  62.4    3e-07    
gb|EJW85675.1|  hypothetical protein WUBG_03414                       62.8    3e-07    
ref|XP_008606485.1|  hypothetical protein SDRG_02670                  62.0    3e-07    
ref|XP_009778932.1|  PREDICTED: uncharacterized protein LOC104228...  62.0    3e-07    
gb|EEE60542.1|  hypothetical protein OsJ_13883                        62.0    4e-07    
emb|CAD39984.3|  OSJNBb0045P24.2                                      62.0    4e-07    
ref|XP_002891011.1|  hypothetical protein ARALYDRAFT_473467           61.6    6e-07    
gb|KHN87706.1|  Histone-lysine N-methyltransferase 2E                 60.8    1e-06    
ref|XP_002305893.2|  hypothetical protein POPTR_0004s08190g           57.0    1e-06    
ref|XP_009844384.1|  hypothetical protein, variant 2                  60.5    1e-06    
ref|NP_001077646.1|  RING/FYVE/PHD zinc finger protein                60.5    1e-06    
ref|XP_008463095.1|  PREDICTED: dentin sialophosphoprotein isofor...  60.5    1e-06    
ref|XP_008463097.1|  PREDICTED: probable GPI-anchored adhesin-lik...  60.5    1e-06    
ref|XP_009844383.1|  hypothetical protein, variant 1                  60.1    1e-06    
ref|XP_009844382.1|  hypothetical protein H257_17334                  60.1    1e-06    
ref|XP_010529675.1|  PREDICTED: uncharacterized protein LOC104806458  60.5    1e-06    
ref|XP_006415147.1|  hypothetical protein EUTSA_v10006636mg           60.5    1e-06    
ref|XP_009844385.1|  hypothetical protein, variant 3                  60.1    1e-06    
ref|XP_004170652.1|  PREDICTED: uncharacterized LOC101213020          60.5    1e-06    
ref|XP_004138548.1|  PREDICTED: uncharacterized protein LOC101213020  60.5    1e-06    
ref|XP_010461091.1|  PREDICTED: uncharacterized protein LOC104741...  60.1    2e-06    
ref|XP_010478702.1|  PREDICTED: uncharacterized protein LOC104757...  60.1    2e-06    
ref|XP_010478701.1|  PREDICTED: uncharacterized protein LOC104757...  60.1    2e-06    
ref|XP_010461092.1|  PREDICTED: uncharacterized protein LOC104741...  60.1    2e-06    
ref|XP_010461090.1|  PREDICTED: uncharacterized protein LOC104741...  60.1    2e-06    
gb|EEC76812.1|  hypothetical protein OsI_14941                        59.3    2e-06    
ref|NP_001052269.2|  Os04g0221600                                     59.3    3e-06    
gb|KFK45030.1|  hypothetical protein AALP_AA1G335000                  59.3    3e-06    
gb|KFK45031.1|  hypothetical protein AALP_AA1G335000                  59.3    3e-06    
ref|XP_002172953.2|  transcription elongation regulator               59.3    3e-06    
ref|XP_010239729.1|  PREDICTED: uncharacterized protein LOC100830596  59.3    3e-06    
ref|XP_010100223.1|  Ubiquitin carboxyl-terminal hydrolase 10         59.3    3e-06    
ref|XP_009622828.1|  PREDICTED: uncharacterized protein LOC104114154  58.9    4e-06    
ref|XP_010499817.1|  PREDICTED: uncharacterized protein LOC104777...  58.9    4e-06    
ref|XP_010499816.1|  PREDICTED: uncharacterized protein LOC104777...  58.9    4e-06    
ref|XP_010499815.1|  PREDICTED: uncharacterized protein LOC104777...  58.9    4e-06    
ref|XP_007777468.1|  hypothetical protein W97_01370                   58.9    4e-06    
gb|KDP25219.1|  hypothetical protein JCGZ_20375                       58.9    4e-06    
gb|EJD75104.1|  hypothetical protein LOAG_17683                       58.5    5e-06    
ref|XP_002272230.1|  PREDICTED: uncharacterized protein LOC100244469  58.5    5e-06    
gb|KEH42910.1|  RING/FYVE/PHD zinc finger protein, putative           58.5    5e-06    
ref|XP_009360204.1|  PREDICTED: uncharacterized protein LOC103950...  58.5    5e-06    
ref|XP_009360203.1|  PREDICTED: uncharacterized protein LOC103950...  58.5    5e-06    
ref|XP_003138520.1|  hypothetical protein LOAG_02935                  58.5    5e-06    
gb|EJD75105.1|  hypothetical protein, variant                         58.5    6e-06    
ref|XP_008374134.1|  PREDICTED: dentin sialophosphoprotein isofor...  58.2    6e-06    
ref|XP_008374133.1|  PREDICTED: dentin sialophosphoprotein isofor...  58.2    6e-06    
gb|EFA10814.1|  hypothetical protein TcasGA2_TC030632                 58.2    6e-06    
ref|XP_008197793.1|  PREDICTED: uncharacterized protein LOC658527     58.2    6e-06    
ref|XP_010676928.1|  PREDICTED: uncharacterized protein LOC104892642  58.2    7e-06    
ref|XP_010908133.1|  PREDICTED: uncharacterized protein LOC105034615  58.2    7e-06    
gb|AAF25973.2|AC017118_10  F6N18.18                                   54.3    7e-06    
ref|XP_004495510.1|  PREDICTED: dentin sialophosphoprotein-like i...  58.2    7e-06    
ref|XP_008811871.1|  PREDICTED: uncharacterized protein LOC103722918  57.8    8e-06    
ref|XP_008239271.1|  PREDICTED: dentin sialophosphoprotein            57.8    9e-06    
ref|XP_011040597.1|  PREDICTED: uncharacterized protein LOC105136808  57.8    9e-06    
ref|XP_007210419.1|  hypothetical protein PRUPE_ppa000509mg           57.8    9e-06    
ref|XP_006439202.1|  hypothetical protein CICLE_v100185871mg          57.8    9e-06    
ref|XP_006439203.1|  hypothetical protein CICLE_v100185871mg          57.8    1e-05    
ref|XP_007872909.1|  hypothetical protein PNEG_00995                  57.0    1e-05    
gb|EPY50620.1|  transcription elongation regulator                    57.4    1e-05    
ref|XP_010538863.1|  PREDICTED: uncharacterized protein LOC104813063  57.8    1e-05    
ref|XP_006476271.1|  PREDICTED: uncharacterized protein LOC102628...  57.8    1e-05    
ref|XP_011037994.1|  PREDICTED: uncharacterized protein LOC105135023  57.4    1e-05    
gb|AGO13224.1|  AaceriAFR077Wp                                        57.4    1e-05    
gb|AEY97760.1|  FAFR077Wp                                             57.4    1e-05    
ref|NP_985624.2|  AFR077Wp                                            57.4    1e-05    
ref|XP_009401915.1|  PREDICTED: uncharacterized protein LOC103985...  57.4    1e-05    
ref|XP_003375544.1|  putative PHD finger protein                      57.4    1e-05    
ref|XP_009401916.1|  PREDICTED: uncharacterized protein LOC103985...  57.4    1e-05    
ref|XP_009401917.1|  PREDICTED: uncharacterized protein LOC103985...  57.4    1e-05    
emb|CCA18791.1|  conserved hypothetical protein                       57.0    1e-05    
gb|EGD99931.1|  hypothetical protein TESG_07261                       57.0    1e-05    
ref|XP_003535394.1|  PREDICTED: dentin sialophosphoprotein-like       57.0    2e-05    
ref|XP_011070397.1|  PREDICTED: uncharacterized protein LOC105156064  57.0    2e-05    
ref|XP_004309526.1|  PREDICTED: uncharacterized protein LOC101300304  57.0    2e-05    
ref|XP_008463099.1|  PREDICTED: dentin sialophosphoprotein isofor...  56.6    2e-05    
gb|KHF99210.1|  hypothetical protein F383_17031                       56.6    2e-05    
ref|XP_007039353.1|  RING/FYVE/PHD zinc finger superfamily protei...  56.6    2e-05    
emb|CDP12244.1|  unnamed protein product                              56.6    2e-05    
ref|XP_007161587.1|  hypothetical protein PHAVU_001G082200g           56.6    2e-05    
ref|XP_006306791.1|  hypothetical protein CARUB_v10008334mg           56.6    2e-05    
gb|EPX70974.1|  transcription elongation regulator                    56.6    2e-05    
ref|XP_003171253.1|  PHD finger domain-containing protein             56.6    2e-05    
emb|CCX31723.1|  Similar to Transcription factor bye1; acc. no. Q...  56.6    2e-05    
dbj|GAM22294.1|  hypothetical protein SAMD00019534_054690             56.6    2e-05    
ref|XP_003555547.1|  PREDICTED: dentin sialophosphoprotein-like       56.6    2e-05    
gb|KHN04993.1|  PHD finger protein                                    56.2    2e-05    
gb|EZF99861.1|  hypothetical protein H113_00578                       56.2    2e-05    
gb|EZF27477.1|  hypothetical protein H100_00573                       56.2    3e-05    
gb|EZF78408.1|  hypothetical protein H105_00561                       56.2    3e-05    
gb|EZF99860.1|  hypothetical protein H113_00578                       56.2    3e-05    
gb|EZF27476.1|  hypothetical protein H100_00573                       56.2    3e-05    
gb|EZF78407.1|  hypothetical protein H105_00561                       56.2    3e-05    
ref|XP_003231402.1|  hypothetical protein TERG_08187                  56.2    3e-05    
ref|XP_002420544.1|  negative regulator of transcription elongati...  55.8    3e-05    
gb|KFH41116.1|  Reticulocyte-binding protein 2 a-like protein         55.8    3e-05    
gb|ENH77127.1|  phd finger domain-containing protein                  55.8    3e-05    
gb|KHC33472.1|  hypothetical protein MGO_04176                        55.8    3e-05    
gb|KGU27450.1|  hypothetical protein MGK_04206                        55.8    3e-05    
gb|KGR06410.1|  hypothetical protein MG5_04212                        55.8    3e-05    
ref|XP_720714.1|  hypothetical protein CaO19.11754                    55.8    3e-05    
gb|EEQ46298.1|  conserved hypothetical protein                        55.8    3e-05    
ref|NP_588122.1|  transcription elongation regulator (predicted)      55.8    3e-05    
gb|KGQ91584.1|  hypothetical protein MG1_04210                        55.8    3e-05    
ref|XP_010053058.1|  PREDICTED: uncharacterized protein LOC104441...  55.8    3e-05    
gb|KHC73640.1|  hypothetical protein MGS_04224                        55.8    3e-05    
gb|KHC34076.1|  hypothetical protein MGQ_04180                        55.8    3e-05    
gb|KHC65099.1|  hypothetical protein MGI_04180                        55.8    3e-05    
ref|XP_010053057.1|  PREDICTED: uncharacterized protein LOC104441...  55.8    3e-05    
gb|KGQ85221.1|  hypothetical protein MEO_04148                        55.8    3e-05    
ref|XP_003003993.1|  conserved hypothetical protein                   55.8    3e-05    
gb|KHC35627.1|  hypothetical protein W5O_04245                        55.8    4e-05    
gb|KGU06807.1|  hypothetical protein MEQ_04176                        55.5    4e-05    
ref|XP_002401906.1|  hypothetical protein IscW_ISCW002283             55.8    4e-05    
gb|KHC59860.1|  hypothetical protein MGE_04188                        55.5    4e-05    
ref|XP_002518927.1|  hypothetical protein RCOM_1314010                55.8    4e-05    
ref|XP_001243572.1|  hypothetical protein CIMG_03013                  55.5    4e-05    
ref|XP_010260668.1|  PREDICTED: uncharacterized protein LOC104599...  55.5    4e-05    
gb|EAS32071.2|  hypothetical protein CIMG_03013                       55.5    4e-05    
ref|XP_010260669.1|  PREDICTED: uncharacterized protein LOC104599...  55.5    4e-05    
ref|XP_006671883.1|  PHD finger domain protein                        55.5    4e-05    
ref|XP_010260670.1|  PREDICTED: uncharacterized protein LOC104599...  55.5    5e-05    
ref|XP_011128360.1|  hypothetical protein AOL_s00215g856              55.5    5e-05    
ref|XP_004495511.1|  PREDICTED: dentin sialophosphoprotein-like i...  55.5    5e-05    
ref|XP_008669585.1|  PREDICTED: probable GPI-anchored adhesin-lik...  55.5    5e-05    
ref|XP_009496437.1|  hypothetical protein H696_04285                  55.5    5e-05    
ref|XP_003071906.1|  PHD-finger motif containing protein              55.1    6e-05    
gb|KDQ21769.1|  hypothetical protein BOTBODRAFT_26195                 55.1    6e-05    
ref|XP_006833260.1|  hypothetical protein AMTR_s00113p00130190        55.1    6e-05    
ref|XP_004975348.1|  PREDICTED: dentin sialophosphoprotein-like       55.1    6e-05    
gb|EPX71566.1|  histone deacetylase complex subunit Cti6              54.7    6e-05    
gb|EFW14128.1|  conserved hypothetical protein                        55.1    6e-05    
ref|XP_004913076.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_004913074.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
gb|KGU23395.1|  hypothetical protein MG7_04201                        52.0    6e-05    
ref|XP_003771532.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_003771531.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
gb|KFQ63836.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
ref|XP_009486356.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_009919986.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_008174014.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
gb|KGL92072.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
gb|KFO73529.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
ref|XP_005025302.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  55.1    6e-05    
gb|KFP60580.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
gb|KFO65771.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
ref|XP_008174011.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_009667728.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
gb|KFW70141.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
gb|KFO87927.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
ref|XP_009932087.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  55.1    6e-05    
gb|KFM14068.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
gb|KFV75928.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
ref|XP_004177240.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  55.1    6e-05    
gb|KFP41494.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
gb|KFV78483.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
gb|KFW74493.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
gb|KFP00278.1|  Histone-lysine N-methyltransferase 2E                 55.1    6e-05    
ref|XP_008174008.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_010579203.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_009707349.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_009667725.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_005482707.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_010722598.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_010393944.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_009326610.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_009287331.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_006265263.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_006034106.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_006265262.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_006034105.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_007066947.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_010579199.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_005443522.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_005243537.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_009907266.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_010393946.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_010117775.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_010002150.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  55.1    6e-05    
ref|XP_009867064.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  55.1    6e-05    
ref|XP_009085089.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_008919503.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_008640737.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_005526063.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    
ref|XP_005423576.1|  PREDICTED: histone-lysine N-methyltransferas...  55.1    6e-05    



>ref|XP_009592040.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Nicotiana 
tomentosiformis]
Length=701

 Score =   361 bits (927),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/277 (62%), Positives = 217/277 (78%), Gaps = 5/277 (2%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            YVV RAVNRATRVLEYT+QEL+N DQ++QE++  PEP +  ++   P  DV+ DV CLY+
Sbjct  404  YVVRRAVNRATRVLEYTIQELRNCDQSEQEKL--PEPVQNYAVN--PGTDVYSDVLCLYN  459

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPKG  360
            N+LL + ESDV+ LA +T+LD+KHFVKEWPFRD+ DD LLRFIC ++PSS  +E VL KG
Sbjct  460  NLLLSFAESDVLKLAVRTVLDSKHFVKEWPFRDDPDDILLRFICCILPSSSGLEAVLRKG  519

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
              P E + VPLHSTIGDLK+AI++AMRDTYC M+ F+VTDI G+E +GD EV+FGIVESG
Sbjct  520  YPPGELVDVPLHSTIGDLKIAIESAMRDTYCIMDNFMVTDIVGMERMGDCEVLFGIVESG  579

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
            ++L+++G GL    +LK E  A NWTV C+CGARDDDGERM+SCD+CEIWQHTRC GI+D
Sbjct  580  SELWVRGFGLDLESELKNEGGADNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGIED  639

Query  721  DKAVPPLFVCEVCCGRLAPTRTLGGFELGCHETALIP  831
             + VPPLFVCE CC  LAP R    FE G +  +L+P
Sbjct  640  SEVVPPLFVCEACCTSLAPPRAQNSFEFGHYAASLVP  676



>ref|XP_009789304.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Nicotiana 
sylvestris]
Length=688

 Score =   358 bits (920),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/288 (60%), Positives = 219/288 (76%), Gaps = 5/288 (2%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            YVV RAVNRATRVLEYT+QEL+N DQ++QE++  PEP +  ++   P  DV+ DV CLY+
Sbjct  405  YVVRRAVNRATRVLEYTIQELRNCDQSEQEKL--PEPVQNYAVN--PGTDVYSDVLCLYN  460

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPKG  360
            N+LL + ES+V+ LA +T+LD+KHFVKEWPFRD+ DD LLRFIC ++PSS  +E VL KG
Sbjct  461  NLLLSFAESNVLKLAVRTVLDSKHFVKEWPFRDDPDDILLRFICCILPSSSGLEAVLRKG  520

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
              P E + VPLHSTIGDLK AI++AMRDTYC M+ F+VTDI G+E + D EV+FGI+ESG
Sbjct  521  YPPGEMVEVPLHSTIGDLKTAIESAMRDTYCIMDNFMVTDIVGMETMEDCEVLFGIIESG  580

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
            ++L+++G GL    +LK E  A NWTV C+CGARDDDGERM+SCD+CEIWQHTRC GI+D
Sbjct  581  SELWVRGFGLDLESELKNEGGADNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGIED  640

Query  721  DKAVPPLFVCEVCCGRLAPTRTLGGFELGCHETALIPWQVEADTALYF  864
             + VPPLFVCE CC  LAP R    FE G + T+L+P   E    L +
Sbjct  641  SEVVPPLFVCEACCTSLAPPRAQNSFEYGLYATSLVPCDSEFGMDLIY  688



>ref|XP_006352479.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Solanum 
tuberosum]
Length=333

 Score =   333 bits (855),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/279 (58%), Positives = 209/279 (75%), Gaps = 7/279 (3%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            YVV RAVNRATRVLEYT+QEL+N DQ +QE++  PEP +  ++   P  D + DV CLY+
Sbjct  35   YVVRRAVNRATRVLEYTIQELRNCDQPEQEKL--PEPFQDYAVN--PGADAYTDVLCLYN  90

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPKG  360
            N+LL + ESD +SLA + + D+K F+KEWPFRD+ DD LLRFIC ++PSS  +E V  KG
Sbjct  91   NLLLSFAESDELSLAVRIVSDSKQFLKEWPFRDDPDDSLLRFICCILPSSNGLEAVFTKG  150

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
              P E + VPLHSTIGDLK+A+++AMR TYC ++  ++TDI G+E + D EV+FGIV+SG
Sbjct  151  YPPGEVVEVPLHSTIGDLKIAVESAMRGTYCIIDNLMITDIAGMEQLEDYEVLFGIVQSG  210

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
            ++L+++G GL    +LK E  + NWTV C+CGARDDDGERM+SCD+CEIWQHTRC GI+D
Sbjct  211  SELWVRGFGLDLDSELKNEGGSDNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGIED  270

Query  721  DKAVPPLFVCEVCCGRLAPTRTLGGFELGCHET--ALIP  831
             + VPPLFVCE CC  LAP R    FE G + T  AL+P
Sbjct  271  SEVVPPLFVCEACCTSLAPPRAQNSFEFGHYGTAAALVP  309



>ref|XP_006352418.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Solanum 
tuberosum]
Length=685

 Score =   334 bits (857),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/279 (58%), Positives = 208/279 (75%), Gaps = 7/279 (3%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            YVV RAVNRATRVLEYT+QEL+N DQ +QE++  PEP +  ++   P  D + DV CLY+
Sbjct  400  YVVRRAVNRATRVLEYTIQELRNCDQPEQEKL--PEPFQDYAVN--PGADAYTDVLCLYN  455

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPKG  360
            N+LL + ESD +SLA + + D+K F+KEWPFRD+ DD LLRFIC ++PSS  +E V  KG
Sbjct  456  NLLLSFAESDELSLAVRIVSDSKQFLKEWPFRDDPDDSLLRFICCILPSSNGLEAVFTKG  515

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
              P E + VPLHSTIGDLK+A+++AMRDTYC M+  ++TDI G+E + D EV+FGIV+SG
Sbjct  516  YPPGEVVEVPLHSTIGDLKIAVESAMRDTYCIMDNLMITDIAGMEQLEDYEVLFGIVQSG  575

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
            ++L+++G GL    +LK E  + NWTV C+CGARDDDGERM+SCD+CEIWQHTRC G +D
Sbjct  576  SELWVRGFGLDLDSELKNEGGSDNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGFED  635

Query  721  DKAVPPLFVCEVCCGRLAPTRTLGGFELGCHET--ALIP  831
             + VPPLFVCE CC  LAP R    FE   + T  AL+P
Sbjct  636  SEVVPPLFVCEACCTSLAPPRAQNSFEFAHYGTAAALVP  674



>ref|XP_010312719.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein MALE MEIOCYTE 
DEATH 1-like [Solanum lycopersicum]
Length=761

 Score =   334 bits (857),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/279 (58%), Positives = 210/279 (75%), Gaps = 7/279 (3%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            YVV RAVNRATRVLEYT+QEL+N DQ +QE++  PEP +  ++   P  D + DV CLY+
Sbjct  476  YVVRRAVNRATRVLEYTIQELRNCDQPEQEKL--PEPFQDYNVN--PGADAYTDVLCLYN  531

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPKG  360
            N+LL + ESD +SLA + +LD+K F+KEWPF D+ +D LLRFIC ++P+S  +E V  KG
Sbjct  532  NLLLSFAESDELSLAVRIVLDSKQFLKEWPFSDDPNDSLLRFICCILPNSNGLEAVFTKG  591

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
              P E + VPLHSTIGDLK+A+++AMRDTYC M+  ++TDI G+E + D EV+FGIV+SG
Sbjct  592  YPPGEVVEVPLHSTIGDLKIAVESAMRDTYCIMDNLMITDIVGMEQLEDYEVLFGIVQSG  651

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
            ++L+++G GL    +LK E  + NWTV C+CGARDDDGERM+SCD+CEIWQHTRC GI+D
Sbjct  652  SELWVRGFGLDLDSELKNEGGSDNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGIED  711

Query  721  DKAVPPLFVCEVCCGRLAPTRTLGGFELGCHET--ALIP  831
             + VPPLFVCE CC  LAP R    FE G + T  AL+P
Sbjct  712  SEVVPPLFVCEACCTSLAPPRAQNSFEFGHYGTAAALVP  750



>emb|CDP01658.1| unnamed protein product [Coffea canephora]
Length=702

 Score =   322 bits (825),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/261 (59%), Positives = 197/261 (75%), Gaps = 4/261 (2%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R VNRATR LE+T++E+KN  + D+ +V    P    +   VP  DVFGD+ CLY 
Sbjct  404  YIVRRMVNRATRKLEFTIEEVKNGVKFDEGKV----PAAVQACHTVPRNDVFGDLSCLYD  459

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGI  363
            N+LL Y E D+V LAA T+L++K+FVKEWPFRDE D  LRF C ++PS  +MET L + +
Sbjct  460  NILLDYPEVDMVRLAAGTVLNSKYFVKEWPFRDEQDLALRFTCRLMPSLTEMETELTREL  519

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
               E+IVVPLHSTIGDLK+AIQ+AMRDTYC M+  +VTDI   EG+ D EV+FGI+ESGT
Sbjct  520  PRGEYIVVPLHSTIGDLKIAIQSAMRDTYCIMKHLLVTDIIETEGMSDGEVLFGILESGT  579

Query  544  QLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
            +L+++G GL    DL++E  A NW V CKCGA+DDDGERM+SCDVCEIWQHTRC GI+D 
Sbjct  580  ELWVRGTGLDLETDLRYEGGADNWKVSCKCGAQDDDGERMVSCDVCEIWQHTRCCGIEDS  639

Query  724  KAVPPLFVCEVCCGRLAPTRT  786
            +AVPP+FVC+ CC  LAP+R 
Sbjct  640  EAVPPVFVCDACCTSLAPSRA  660



>ref|XP_011099936.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Sesamum 
indicum]
Length=702

 Score =   301 bits (770),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 192/267 (72%), Gaps = 5/267 (2%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V RAVNR+T+VLEYT+Q+ K    + +E  L   P+   +        VF D+  LY
Sbjct  413  NYIVRRAVNRSTKVLEYTIQDSK----SSKEAYLSKVPELIQTHAIGVGRSVFDDMAYLY  468

Query  181  SNVLLGYKES-DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            +NV LGY ES D + LA Q IL +KHFVKEWPFRDE DD LRFIC +  SSID+ +    
Sbjct  469  TNVFLGYPESSDSMKLAVQMILYSKHFVKEWPFRDEDDDSLRFICRLTMSSIDLNSNSSC  528

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
               P+E+IVVPL++TIGDLK+AIQ AMR+TYC ME+ +VTDI  +EG+ D+EV+FGI+ES
Sbjct  529  DFPPREYIVVPLYATIGDLKVAIQNAMRETYCVMEKLLVTDILDMEGLQDEEVLFGIIES  588

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G +L+++G GL    DL++E     WTV+CKCGARDDDGERM++CD+CE WQHTRC GI+
Sbjct  589  GRELWVRGFGLDLENDLRYEGGTEKWTVRCKCGARDDDGERMVACDICETWQHTRCSGIE  648

Query  718  DDKAVPPLFVCEVCCGRLAPTRTLGGF  798
            D +AVP LFVC+ CC  LAP +T   F
Sbjct  649  DTEAVPRLFVCDACCSSLAPVQTQCSF  675



>ref|XP_006494663.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X2 [Citrus sinensis]
Length=553

 Score =   288 bits (738),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/284 (50%), Positives = 192/284 (68%), Gaps = 14/284 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPV------DVFG  162
            S++VHRAVN ATR+LEYT+ +L        +   + EP    S   +PP+      DV+ 
Sbjct  258  SHIVHRAVNPATRLLEYTIHDL-------CDGAGISEPGPEISDEPLPPLALETGSDVYS  310

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            +V  LY NVLL Y ES++V+LA Q +LD+KHFVKEWPFRDE D  LRF C V+PS +D E
Sbjct  311  EVVYLYMNVLLNYPESELVALATQAVLDSKHFVKEWPFRDEDDQFLRFKCQVMPSFVDSE  370

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
            T L   + P E +++PLHST+ +LK A ++A+RDTYC ME   VTD+  ++ + D E++F
Sbjct  371  TDLTAKLPPGELVMIPLHSTVLELKEAAESALRDTYCIMENLGVTDVVNMQKLDDGELLF  430

Query  523  GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G VESG+Q++++G G+     L++E     W VKC+CGA+DDDGERM++CD+CE+WQHTR
Sbjct  431  GAVESGSQVWIQGYGIDSDSKLRYEGGNDKWIVKCECGAQDDDGERMVACDICEVWQHTR  490

Query  703  CVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGFE-LGCHETALIP  831
            C GI+D   VPPLFVC  CC   AP+RT   F  LG  +  L+P
Sbjct  491  CHGIEDSGTVPPLFVCPRCCSSFAPSRTESSFRFLGSDDLLLVP  534



>ref|XP_006421081.1| hypothetical protein CICLE_v10007029mg, partial [Citrus clementina]
 gb|ESR34321.1| hypothetical protein CICLE_v10007029mg, partial [Citrus clementina]
Length=660

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 188/272 (69%), Gaps = 13/272 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPV------DVFG  162
            S++VHRAVN ATR+LEYT+ +L        +   + EP    S   +PP+      DV+ 
Sbjct  396  SHIVHRAVNPATRLLEYTIHDL-------CDGAGISEPGPEISDEPLPPLALETGSDVYS  448

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            +V  LY NVLL Y ES++V+LA Q +LD+KHFVKEWPFRDE D  LRF C V+PS +D E
Sbjct  449  EVVYLYMNVLLNYPESELVALATQAVLDSKHFVKEWPFRDEDDQFLRFKCQVMPSFVDSE  508

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
            T L   + P E +++PLHST+ +LK A ++A+RDTYC ME  VVTD+  ++ + D E++F
Sbjct  509  TDLTGKLPPGELVMIPLHSTVLELKEAAESALRDTYCIMENLVVTDVGNMQKLDDGELLF  568

Query  523  GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G VESG+Q++++G G+     L++E     W VKC+CGA+DDDGERM++CD+CE+WQHTR
Sbjct  569  GAVESGSQVWIQGYGIDSDSKLRYEGGNDKWIVKCECGAQDDDGERMVACDICEVWQHTR  628

Query  703  CVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGF  798
            C+GI+D   VPPLFVC  CC   AP+RT   F
Sbjct  629  CLGIEDSGTVPPLFVCPRCCSSFAPSRTESSF  660



>ref|XP_006494662.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X1 [Citrus sinensis]
Length=691

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/284 (50%), Positives = 192/284 (68%), Gaps = 14/284 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPV------DVFG  162
            S++VHRAVN ATR+LEYT+ +L        +   + EP    S   +PP+      DV+ 
Sbjct  396  SHIVHRAVNPATRLLEYTIHDL-------CDGAGISEPGPEISDEPLPPLALETGSDVYS  448

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            +V  LY NVLL Y ES++V+LA Q +LD+KHFVKEWPFRDE D  LRF C V+PS +D E
Sbjct  449  EVVYLYMNVLLNYPESELVALATQAVLDSKHFVKEWPFRDEDDQFLRFKCQVMPSFVDSE  508

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
            T L   + P E +++PLHST+ +LK A ++A+RDTYC ME   VTD+  ++ + D E++F
Sbjct  509  TDLTAKLPPGELVMIPLHSTVLELKEAAESALRDTYCIMENLGVTDVVNMQKLDDGELLF  568

Query  523  GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G VESG+Q++++G G+     L++E     W VKC+CGA+DDDGERM++CD+CE+WQHTR
Sbjct  569  GAVESGSQVWIQGYGIDSDSKLRYEGGNDKWIVKCECGAQDDDGERMVACDICEVWQHTR  628

Query  703  CVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGFE-LGCHETALIP  831
            C GI+D   VPPLFVC  CC   AP+RT   F  LG  +  L+P
Sbjct  629  CHGIEDSGTVPPLFVCPRCCSSFAPSRTESSFRFLGSDDLLLVP  672



>gb|KDO41051.1| hypothetical protein CISIN_1g046513mg, partial [Citrus sinensis]
Length=660

 Score =   284 bits (726),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 186/272 (68%), Gaps = 13/272 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPV------DVFG  162
            S++VHRAVN ATR+LEYT+ +L        +   + EP    S   +PP+      DV+ 
Sbjct  396  SHIVHRAVNPATRLLEYTIHDL-------CDGAGISEPGPEISDEPLPPLALETGSDVYS  448

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            +V  LY NVLL Y ES++V+LA Q +LD+KHFVKEWPFRDE D  LRF C V+PS +D E
Sbjct  449  EVVYLYMNVLLNYPESELVALATQAVLDSKHFVKEWPFRDEDDQFLRFKCQVMPSFVDSE  508

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
            T L   + P E +++PLHST+ +LK A ++A+RDTYC ME   VTD+  ++ + D E++F
Sbjct  509  TDLTGKLPPGELVMIPLHSTVLELKEAAESALRDTYCIMENLGVTDVVNMQKLDDGELLF  568

Query  523  GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G VESG+Q++++G G+     L++E     W VKC+CGA+DDDGERM++CD+CE+WQHTR
Sbjct  569  GAVESGSQVWIQGYGIDSDSKLRYEGGNDKWIVKCECGAQDDDGERMVACDICEVWQHTR  628

Query  703  CVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGF  798
            C GI+D   VPPLFVC  CC   AP+RT   F
Sbjct  629  CHGIEDSGTVPPLFVCPRCCSSFAPSRTESSF  660



>ref|XP_002533478.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28910.1| DNA binding protein, putative [Ricinus communis]
Length=698

 Score =   284 bits (727),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/278 (50%), Positives = 192/278 (69%), Gaps = 6/278 (2%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQT---DQERVLVPEPDKPASLTAVPPVDVFGDVFC  174
            +VV RAVN  T++LEY++ EL   +++    +    VPEP  PA+   VP  D++ D+  
Sbjct  407  HVVRRAVNPKTKILEYSIDELGKENRSAGLTEIEAAVPEP-LPAA--PVPGADLYADLGY  463

Query  175  LYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLP  354
            LY  VLL Y ES++  LA QTILD+KHFVK WPF+DE D+LLRFIC V+P+ I +E  L 
Sbjct  464  LYLKVLLNYPESELAELATQTILDSKHFVKVWPFKDEEDELLRFICQVMPNIIHLEVELK  523

Query  355  KGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVE  534
            K + P E +V+PLHST+ +LK A + A+RDTYC ME F VT+I  +E + D+E++FG VE
Sbjct  524  KELPPGEIVVLPLHSTVAELKQAAENALRDTYCIMENFEVTEINQMEELMDEELLFGSVE  583

Query  535  SGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGI  714
            SG +LFM+G G+    +L++E    NW V+C+CGA DDDGERM++CD+CE+WQHTRC GI
Sbjct  584  SGAELFMRGNGMDLNTELRYESGPDNWKVRCQCGAEDDDGERMVACDICEVWQHTRCNGI  643

Query  715  KDDKAVPPLFVCEVCCGRLAPTRTLGGFELGCHETALI  828
            +D +AVP LFVC  CC  +  +R     E+G  E  L+
Sbjct  644  EDSEAVPLLFVCTRCCDSMIKSRKKVKVEIGNSEDLLM  681



>ref|XP_002263205.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Vitis vinifera]
 emb|CAN73422.1| hypothetical protein VITISV_032904 [Vitis vinifera]
 emb|CBI33452.3| unnamed protein product [Vitis vinifera]
Length=683

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 191/263 (73%), Gaps = 4/263 (2%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQEL-KNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            ++VV RAVN ATRVLEYTL+EL K    ++ E  ++P+P    S+  VP  DV+ DV  L
Sbjct  402  NHVVCRAVNPATRVLEYTLKELGKGTLVSELESEMLPKPFPEQSI--VPGADVYNDVIYL  459

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y NVLL Y +S++V LA + +LD+KHFVKEWPF DE D LLRF+C ++PS  ++E +  +
Sbjct  460  YRNVLLNYPDSELVELATRAVLDSKHFVKEWPFSDEDDQLLRFVCHMMPSLSELE-IFTR  518

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E IVVP ++T+G+LK  ++  +RDTYC ME+ VVT+I+ +EG+ D+EV+FG +ES
Sbjct  519  ELPPGEFIVVPPYATVGELKETVERTLRDTYCIMEQVVVTEIEDMEGMTDEEVLFGTIES  578

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G++++M+G G+    +LK+E  + NW V C+CGA DDDGERM++CD+CE+WQHT C GI 
Sbjct  579  GSEVWMRGTGMDLEAELKYEGGSDNWRVSCECGALDDDGERMVACDICEVWQHTVCSGID  638

Query  718  DDKAVPPLFVCEVCCGRLAPTRT  786
            D + VPPLFVC  CC  L P R+
Sbjct  639  DSETVPPLFVCPKCCALLVPARS  661



>ref|XP_010689687.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Beta vulgaris 
subsp. vulgaris]
Length=699

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/294 (47%), Positives = 190/294 (65%), Gaps = 23/294 (8%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA-VPPV----------  150
            Y+V R ++   RVLEYT+  +             P P KPA   A V PV          
Sbjct  407  YIVRRRIDPVNRVLEYTIHRVGEAS---------PSPKKPAREKASVAPVLALATTTSGP  457

Query  151  DVFGDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRD-ELDDLLRFICIVVPS  327
            D + DV  LY+  +LG  ESD++ L+ + ILD+KH VKEWPF+D E D LLRFIC V+P+
Sbjct  458  DTYRDVSILYNQTILGRPESDILGLSVRVILDSKHLVKEWPFKDDENDQLLRFICHVLPT  517

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
            S +++  L + + P + IV+PLH++ GDL++A Q A+RDTYC M+ +VVTDI  +E   D
Sbjct  518  SSELDMELSRNLSPGDMIVLPLHASFGDLRVAAQHALRDTYCIMDRYVVTDIDSMENFVD  577

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
             EV+FG VESG++L+++G G+    DL++E    NWTV+C CGA DDDGERM+SCD+CE 
Sbjct  578  AEVVFGAVESGSELWIRGSGIDIKTDLRYEGGPDNWTVRCSCGATDDDGERMVSCDICEA  637

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTR--TLGGFELGCHETALIPWQVE  843
            WQHTRC GI+D +AVPPLFVC+ CC  L P R  T+  F+    +  L+P  +E
Sbjct  638  WQHTRCTGIEDTEAVPPLFVCQRCCASLMPPRVETISYFDNESSQNMLLPQPLE  691



>ref|XP_008244388.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Prunus mume]
Length=680

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 187/262 (71%), Gaps = 3/262 (1%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQ-ERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +++V RAVN  TR+LEYT+ +L +  +  Q E  ++P+    ASL  VP VDV+ DV  L
Sbjct  402  NHIVCRAVNPTTRILEYTVHDLTDGVKVSQPENEILPQSLPSASL--VPGVDVYNDVLYL  459

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y +VLLGY ES++V LA + ILDTKHFVKE  FRDE + LL FIC ++PSS+DM+    +
Sbjct  460  YEHVLLGYPESELVELATRAILDTKHFVKECSFRDEEEQLLTFICQLLPSSMDMDFEFKR  519

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E +V+ LH+TIG+LKLA + A+RDTYC  E FVV  I+GL+ + D EV+FG+V+S
Sbjct  520  ELPPGEIVVMALHATIGELKLAAETALRDTYCITERFVVKGIEGLDEMDDMEVLFGVVQS  579

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G ++ ++G G+     L++E  +  W V+C+CGARDDDGERM+SCD+CE+WQHTRC GI+
Sbjct  580  GAEVGVRGTGIDLDTPLRYEGGSDTWMVRCECGARDDDGERMVSCDICEVWQHTRCCGIE  639

Query  718  DDKAVPPLFVCEVCCGRLAPTR  783
            D   VPPLFVC  CC  L P +
Sbjct  640  DADTVPPLFVCSACCVSLVPPK  661



>gb|KDP25820.1| hypothetical protein JCGZ_22542 [Jatropha curcas]
Length=682

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 188/266 (71%), Gaps = 5/266 (2%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQ--TDQERVLVPEPDKPASLTAVPPVDVFGDVFC  174
            ++VVHRA+N  TR+LEY++ EL NR    T+ E   V +P    SL  VP  D++GD+  
Sbjct  395  NHVVHRAMNLETRILEYSIDELDNRKVKVTEPEEEEVADPIPVPSL--VPGADLYGDMGY  452

Query  175  LYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLP  354
            LY  VL+ Y ES++V  A Q ILD+KHFVKEWPF +E D LLR+IC V+P+ I+  T   
Sbjct  453  LYMKVLMNYPESELVETATQAILDSKHFVKEWPFENEEDQLLRYICQVMPNIIEAGTKFT  512

Query  355  KGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVE  534
            + + P E I++PLH+T+ +LK A + A++DTY  +E FVVT+I+ +E + D EV+FG+VE
Sbjct  513  RELPPGEIIMLPLHATVAELKRAAENALKDTYYILENFVVTEIELMEELEDWEVLFGVVE  572

Query  535  SGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGI  714
            SG++LFMKG G+    +L++E    NW V+C+CGA+DDDGERM++CD+CE+W+HTRC GI
Sbjct  573  SGSELFMKGNGVDLNTELRYEAGPDNWKVRCECGAQDDDGERMVACDICEVWEHTRCNGI  632

Query  715  KDDKAVPPLFVCEVCCGRLA-PTRTL  789
             D K VPPLF+C  CC  +  PT  L
Sbjct  633  DDSKTVPPLFICTECCNSVVKPTNEL  658



>ref|XP_007216520.1| hypothetical protein PRUPE_ppa024280mg [Prunus persica]
 gb|EMJ17719.1| hypothetical protein PRUPE_ppa024280mg [Prunus persica]
Length=697

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 187/262 (71%), Gaps = 3/262 (1%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQ-ERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +++V RAVN  TR+LEYT+ +L +  +  Q E  ++P+    ASL  VP VDV+ DV  L
Sbjct  403  NHIVCRAVNPTTRILEYTVHDLTDGVKVSQPENEVLPQSLPSASL--VPGVDVYNDVLYL  460

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y +VLLGY ES++V LA + ILDTKHFVKE  FRDE + LL FIC ++PS +DM+    +
Sbjct  461  YEHVLLGYPESELVELATRAILDTKHFVKECSFRDEEEQLLTFICQLLPSLMDMDIEFKR  520

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E +V+PLH+TIG+LKLA + A+RDTYC  E FVV  I+GL+ + D EV+FG+V+S
Sbjct  521  ELPPGEIVVMPLHATIGELKLAAETALRDTYCITERFVVKGIEGLDEMEDMEVLFGVVQS  580

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G ++ ++G G+     L++E  +  W V+C+CGARDDDGERM++CD+CE+WQHTRC GI+
Sbjct  581  GAEVGVRGTGIDLDTPLRYEGGSDTWMVRCECGARDDDGERMVACDICEVWQHTRCCGIE  640

Query  718  DDKAVPPLFVCEVCCGRLAPTR  783
            D   VPPLFVC  CC  L P +
Sbjct  641  DADTVPPLFVCSACCVSLVPPK  662



>ref|XP_009370077.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Pyrus x 
bretschneideri]
Length=672

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 182/267 (68%), Gaps = 13/267 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP------ASLTAVPPVDVFG  162
            +++V RAVN ATR+LEYT+ +L +        V V EP K        S T  P VDV+ 
Sbjct  394  NHIVCRAVNPATRILEYTVHDLADG-------VKVSEPGKEIVAQSFQSATLFPGVDVYN  446

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            DV  LY +VLLGY ES++V LA + +LD KHFVKE PFRD+ +  L F C ++PSS D E
Sbjct  447  DVLYLYEHVLLGYPESELVDLATRAVLDAKHFVKECPFRDDEEQWLTFFCQLLPSSTDKE  506

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
                +G+ P E +V+PLH+TIG+LK A ++A+RDTYC  E+FVV  I+GLE + D EV+F
Sbjct  507  IEFKRGMPPGEVVVMPLHATIGELKRAAESALRDTYCITEQFVVMGIEGLEEMDDMEVLF  566

Query  523  GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G+ ESG ++ ++G G+     L++E  +  W V+C+CGARDDDGERM++CD+CE+WQHTR
Sbjct  567  GVAESGAEVGVRGSGIDLDTPLRYEGGSDTWMVRCECGARDDDGERMVACDICEVWQHTR  626

Query  703  CVGIKDDKAVPPLFVCEVCCGRLAPTR  783
            C GI+D   VPPLFVC  CC  L P R
Sbjct  627  CCGIEDADTVPPLFVCSACCVSLVPPR  653



>ref|XP_007141934.1| hypothetical protein PHAVU_008G238400g [Phaseolus vulgaris]
 gb|ESW13928.1| hypothetical protein PHAVU_008G238400g [Phaseolus vulgaris]
Length=702

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 191/269 (71%), Gaps = 4/269 (1%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQEL-KNRDQTDQERVLVPEPDKPASLTA-VPPVDVFGDVFC  174
            +YVV R VN ++R+LEYT+ +L K     +QE   +   D+    ++ VP  DV+ DV  
Sbjct  411  NYVVRRMVNPSSRILEYTIHDLGKGYKAPEQESEGMAYVDQQVVESSWVPGNDVYCDVLF  470

Query  175  LYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVL  351
            LY NVLLGY +S+ V LA QTILD+++FVKEW  RDE+++ LL FIC + P+ +D +  L
Sbjct  471  LYKNVLLGYPDSETVDLAIQTILDSRYFVKEWAERDEVEEQLLTFICRLQPNFVDKKYEL  530

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
             KG+   E +VVPLH+T+GDLK A +AA+RDTYC  E  +VTDIK L GV D+EV+FG++
Sbjct  531  -KGLPCGEVVVVPLHATVGDLKRASEAALRDTYCIAERLIVTDIKQLMGVSDEEVLFGLI  589

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            +SG +L ++G+ +    +LK++  + NW V+C+CGA+DDDGERM++CD+CE+WQHTRC G
Sbjct  590  QSGVELCVRGIAIDLCTNLKYQGGSDNWKVRCECGAQDDDGERMVACDICEVWQHTRCCG  649

Query  712  IKDDKAVPPLFVCEVCCGRLAPTRTLGGF  798
            I D + VPPLFVC  CC  L P+RT   F
Sbjct  650  IDDSETVPPLFVCTGCCDSLVPSRTESSF  678



>gb|EYU30865.1| hypothetical protein MIMGU_mgv1a002061mg [Erythranthe guttata]
Length=720

 Score =   274 bits (700),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/273 (51%), Positives = 190/273 (70%), Gaps = 8/273 (3%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKN-RDQTDQERVLVPEP--DKPASLTAVPPVDVFGDVF  171
            ++VV R+VNR+T++LEYT+ +L+  RD  +       E   ++  +   VP   VF DV 
Sbjct  418  NFVVRRSVNRSTKILEYTIHDLEGGRDVYEPRSDFFKEKPFNQVIATAPVPGRCVFVDVN  477

Query  172  CLYSNVLLGY----KESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSID-  336
             LY NVL+GY     E   V+LA QT+L +KHFVKEWPFRDE DD  RFIC +  SS D 
Sbjct  478  ILYKNVLMGYPIQDSEFSSVNLAVQTVLHSKHFVKEWPFRDEDDDSFRFICRLTMSSFDE  537

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEV  516
             ++ L   ++ +E +VVPL++T+GDL+LA++ AMRDTYC ME   VT+I  +EGV +DEV
Sbjct  538  NDSDLCCDLLHRECVVVPLYATLGDLRLAVENAMRDTYCVMENLKVTEILEMEGVQEDEV  597

Query  517  IFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQH  696
            +FG++ESG ++ ++G GL    +L++E    NWTV+C+CGA DDDGERM++CD+CEIWQH
Sbjct  598  LFGVIESGGEIRVRGGGLDLETELRYEGGNENWTVRCRCGAHDDDGERMVACDICEIWQH  657

Query  697  TRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLGG  795
            TRC GI+D  AVP LFVC+ CC  LAP +T  G
Sbjct  658  TRCGGIEDSDAVPRLFVCDACCTALAPAQTRCG  690



>ref|XP_008381356.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Malus domestica]
Length=678

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 181/267 (68%), Gaps = 13/267 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP------ASLTAVPPVDVFG  162
            +++V RAVN ATR+LEYT+ +L +        V V EP K        S T  P VDV+ 
Sbjct  400  NHIVCRAVNPATRILEYTVHDLADG-------VKVSEPGKEIVAQSFQSATLFPGVDVYN  452

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            DV  LY +VLLGY ES++V LA + +LD KHFVKE PFRD+ +  L F C ++PSS D E
Sbjct  453  DVLYLYEHVLLGYPESELVDLATRAVLDAKHFVKECPFRDDEEQWLTFFCQLLPSSTDKE  512

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
                +G+ P E +V+PLH+TIG+LK A ++A+RDTYC  E FVV  I+GL+ + D EV+F
Sbjct  513  IEFKRGLPPGEVVVMPLHATIGELKRAAESALRDTYCITERFVVMGIEGLDEMDDMEVLF  572

Query  523  GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G+ ESG ++ ++G G+     L++E  +  W V+C+CGARDDDGERM++CD+CE+WQHTR
Sbjct  573  GVAESGAEVGVRGSGIDLDTPLRYEGGSDTWMVRCECGARDDDGERMVACDICEVWQHTR  632

Query  703  CVGIKDDKAVPPLFVCEVCCGRLAPTR  783
            C GI+D   VPPLFVC  CC  L P R
Sbjct  633  CCGIEDADTVPPLFVCSACCVSLVPPR  659



>gb|AES99203.2| PHD finger protein MALE meiocyte DEATH protein [Medicago truncatula]
Length=715

 Score =   271 bits (694),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 185/270 (69%), Gaps = 10/270 (4%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQT-DQERVLVPEPDKP--------ASLTAVPPVD  153
            +YVV R VN ++R+LEYT+ EL+   Q  + E  ++   DKP        +S ++VP  D
Sbjct  417  NYVVRRTVNSSSRILEYTIDELRKGHQAPEMEHGVLTVADKPQVESSTLSSSSSSVPGND  476

Query  154  VFGDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSI  333
            V+ DV  LY NVLLGY +S+ V LA QTILD +HFVKEW  RDE++ +L FIC + P+ +
Sbjct  477  VYSDVVYLYKNVLLGYPDSEAVELAVQTILDCRHFVKEWKLRDEMEQVLTFICHLKPNFV  536

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
            + ++ L KG    E + VPLH+T+ DLK   +AA+RDTYC  E  +VTDIK L  V D+E
Sbjct  537  ENKSDL-KGPSCGEIVTVPLHATVRDLKQTAEAALRDTYCIAERLIVTDIKELMDVEDEE  595

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQ  693
            VIFG +ESG +L ++G+G+     LK++  + NW V+C+CGA+DDDGERM++CD+CE+WQ
Sbjct  596  VIFGQIESGVKLSVRGIGIDLCTPLKYQGGSDNWKVRCECGAQDDDGERMVACDICEVWQ  655

Query  694  HTRCVGIKDDKAVPPLFVCEVCCGRLAPTR  783
            HTRC GI D + VPPLFVC  CC  L P R
Sbjct  656  HTRCCGIDDSETVPPLFVCSGCCDSLMPPR  685



>ref|XP_003616245.1| PHD finger protein [Medicago truncatula]
Length=739

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 185/270 (69%), Gaps = 10/270 (4%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQT-DQERVLVPEPDKP--------ASLTAVPPVD  153
            +YVV R VN ++R+LEYT+ EL+   Q  + E  ++   DKP        +S ++VP  D
Sbjct  441  NYVVRRTVNSSSRILEYTIDELRKGHQAPEMEHGVLTVADKPQVESSTLSSSSSSVPGND  500

Query  154  VFGDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSI  333
            V+ DV  LY NVLLGY +S+ V LA QTILD +HFVKEW  RDE++ +L FIC + P+ +
Sbjct  501  VYSDVVYLYKNVLLGYPDSEAVELAVQTILDCRHFVKEWKLRDEMEQVLTFICHLKPNFV  560

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
            + ++ L KG    E + VPLH+T+ DLK   +AA+RDTYC  E  +VTDIK L  V D+E
Sbjct  561  ENKSDL-KGPSCGEIVTVPLHATVRDLKQTAEAALRDTYCIAERLIVTDIKELMDVEDEE  619

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQ  693
            VIFG +ESG +L ++G+G+     LK++  + NW V+C+CGA+DDDGERM++CD+CE+WQ
Sbjct  620  VIFGQIESGVKLSVRGIGIDLCTPLKYQGGSDNWKVRCECGAQDDDGERMVACDICEVWQ  679

Query  694  HTRCVGIKDDKAVPPLFVCEVCCGRLAPTR  783
            HTRC GI D + VPPLFVC  CC  L P R
Sbjct  680  HTRCCGIDDSETVPPLFVCSGCCDSLMPPR  709



>ref|XP_004490840.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Cicer 
arietinum]
Length=707

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/287 (47%), Positives = 190/287 (66%), Gaps = 12/287 (4%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKN--RDQTDQERVLVPEPDKPAS--------LTAVPPV  150
            +YVV R VN +TR+LEYT+ EL    +  T+ E  ++   D P           + +P  
Sbjct  408  NYVVRRMVNPSTRILEYTIHELGKGFKAPTEVEHGVMTVKDNPQKDSSLSSSTSSWIPGN  467

Query  151  DVFGDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSS  330
            DV+ DV  LY NVLL Y +S+VV LA QTILD +HFVKEW  RDE++ +L FIC + P+ 
Sbjct  468  DVYSDVVFLYKNVLLCYPDSEVVELAVQTILDCRHFVKEWKLRDEMEQVLTFICHLKPNF  527

Query  331  IDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD  510
            ++ ++ L KG    E ++VPLH+T+ DLK A +A +RDTYC  E  +VTDIK L GV D+
Sbjct  528  VENKSEL-KGPSCGEIVIVPLHATVRDLKQAAEATLRDTYCIAERLIVTDIKELLGVSDE  586

Query  511  EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIW  690
            EV+FG+++SG +L ++G+G+     LK++  + NW V+C+CGA+DDDGERM++CD+CE+W
Sbjct  587  EVLFGLIQSGVKLCVRGIGIDLCTPLKYQGGSDNWKVRCECGAQDDDGERMVACDICEVW  646

Query  691  QHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRT-LGGFELGCHETALI  828
            QHTRC GI D + VPPLFVC  CC  L P R     + + C +  LI
Sbjct  647  QHTRCCGIDDSETVPPLFVCSGCCDSLVPPRVETSNYAIDCADDFLI  693



>ref|XP_007019293.1| RING/FYVE/PHD zinc finger superfamily protein, putative [Theobroma 
cacao]
 gb|EOY16518.1| RING/FYVE/PHD zinc finger superfamily protein, putative [Theobroma 
cacao]
Length=696

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 178/259 (69%), Gaps = 2/259 (1%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA-VPPVDVFGDVFCLY  180
            ++V RA+N  +R+LEYT+ ++ N  +  +  + +     P +L A VP  DV+ DV  LY
Sbjct  402  HIVRRAIN-TSRILEYTIDDIDNGFKAPEAELEIHHKPLPDALPALVPGTDVYDDVVYLY  460

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKG  360
            +NVLL Y ES+ + LA Q +LD+KHFVKE PFRDE D LLRF C V+P+    E +L K 
Sbjct  461  NNVLLDYPESEFLELATQAVLDSKHFVKERPFRDEDDQLLRFFCQVMPNLFGAENILTKK  520

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
                E + VPLH+T+ DLK A++ A+RDTYC M++ VVTDI  L  + D +V+FG +ESG
Sbjct  521  SPAGELVTVPLHATVLDLKQAVEKALRDTYCIMDKLVVTDIVDLGEMDDRDVLFGALESG  580

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
             ++ + G G+    +L+ E  A NW V+C+CGA+DDDGERM+SCD+CE+WQHTRC GI+D
Sbjct  581  AKILVSGSGIDLDSNLRHEGGADNWIVRCECGAQDDDGERMVSCDICEVWQHTRCCGIED  640

Query  721  DKAVPPLFVCEVCCGRLAP  777
             +AVPPLFVC  CC  L P
Sbjct  641  SEAVPPLFVCPGCCASLGP  659



>ref|XP_010034488.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Eucalyptus 
grandis]
 gb|KCW52193.1| hypothetical protein EUGRSUZ_J01622 [Eucalyptus grandis]
Length=694

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/260 (51%), Positives = 176/260 (68%), Gaps = 4/260 (2%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            YVV RAVN  TR+LEYT+ E     +  ++  LV E     SL      DV+ D+  +YS
Sbjct  403  YVVRRAVNPLTRILEYTIHEFDGGREPPEQ--LVKETLLSPSLAV--GHDVYKDMARVYS  458

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGI  363
             V L +  SD V  AAQ +LD+KHF+KEWPF+DE D LL FIC ++PS   +ET+  K +
Sbjct  459  AVFLNHPTSDCVGSAAQVLLDSKHFMKEWPFQDEEDQLLTFICNLIPSIDRLETLPRKKV  518

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
             P E I+VPLH+T+GDLK A ++A R+TYCA E  VVTDI+ ++   D EV+FGI+ESG 
Sbjct  519  PPGEIIMVPLHATVGDLKAAAESAFRETYCAFEHLVVTDIEAVKETEDTEVLFGIMESGQ  578

Query  544  QLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
            +++++G G+     L++E  + NW V+C CGA DDDGERM++CD+CE+WQHTRC GI D 
Sbjct  579  EVWVRGTGMDVDSQLRYEGGSENWEVRCMCGAEDDDGERMVACDLCEVWQHTRCCGIDDT  638

Query  724  KAVPPLFVCEVCCGRLAPTR  783
              VPPLFVC  CC  LA +R
Sbjct  639  DNVPPLFVCSACCKSLAQSR  658



>gb|KHN39480.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Glycine soja]
Length=708

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 179/263 (68%), Gaps = 12/263 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPV-----DVFGD  165
            +YVV R VN +TR+LEYT+ +L    +  +E    PE    A   AV        DV+ D
Sbjct  409  NYVVRRMVNPSTRILEYTIHDLGKGSKAPEENK--PEVMAHADQQAVESSWMLGNDVYSD  466

Query  166  VFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDEL-DDLLRFICIVVPSSIDME  342
               LY NVLLGY +S+ V  A QTILD+++FVKEWP RDE+ + +L FIC + P+ +D +
Sbjct  467  ALFLYKNVLLGYPDSEAVDTAVQTILDSRYFVKEWPVRDEMKEQVLTFICRLQPNFVDKK  526

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
              L KG+   E +VVPLH+T+GDLK A +AA+RDTYC  E  +VTDIK L  V D+EV+F
Sbjct  527  HEL-KGLACGEVVVVPLHATVGDLKRAAEAALRDTYCIAERLIVTDIKELMDVSDEEVLF  585

Query  523  GIVESGTQLFMKGLGLAFAGDLKFE---DRAHNWTVKCKCGARDDDGERMISCDVCEIWQ  693
            G+++SG +L ++G+ +     LK++   + A NW V+C+CGA+DDDGERM++CD+CE+WQ
Sbjct  586  GLIQSGVELCVRGIAIDLLTPLKYQGESESADNWKVRCECGAQDDDGERMVACDICEVWQ  645

Query  694  HTRCVGIKDDKAVPPLFVCEVCC  762
            HTRC GI D + VPPLFVC  CC
Sbjct  646  HTRCYGIDDSETVPPLFVCTGCC  668



>ref|XP_010278619.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X2 [Nelumbo nucifera]
Length=563

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 185/260 (71%), Gaps = 4/260 (2%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPD-KPASLTAVPPVDVFGDVFCL  177
            +++V R VN ATR+LEYT+ E+ + +    E    PEP  +       P  DV+GDV  L
Sbjct  290  NHIVRRTVNPATRLLEYTIHEVCSGESAVDES---PEPTVEDPPPDPEPGADVYGDVVFL  346

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y  VL G+ ES+++ LA++ +LD KHF+KEWPF+DE D+LLRF+C  +PS  ++E+ L +
Sbjct  347  YKRVLKGFPESELLGLASRVVLDGKHFMKEWPFKDEQDELLRFVCRFMPSVGEVESELTR  406

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E +VVP ++T+G+LK+A + A+RDTY  +E FV  +++G+ G+ D+EV+FG +ES
Sbjct  407  PLPPGEVVVVPPYATVGELKVAAEKALRDTYGMLEWFVAKEVEGVGGMEDEEVLFGALES  466

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G  ++++G G+    DL++E  A NWTV C+CGARDDDGERM++CDVCE+WQHTRC GI 
Sbjct  467  GAHIWVEGSGVDLRTDLRYEGGADNWTVDCRCGARDDDGERMVACDVCEVWQHTRCAGIV  526

Query  718  DDKAVPPLFVCEVCCGRLAP  777
            DD+AVP LFVCE C   + P
Sbjct  527  DDEAVPALFVCERCRADMIP  546



>ref|XP_003544360.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Glycine 
max]
Length=708

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 179/261 (69%), Gaps = 8/261 (3%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQER---VLVPEPDKPASLTAVPPVDVFGDVF  171
            +YVV R VN +TR+LEYT+ +L    +  +E    V+     +    + +   DV+ D  
Sbjct  409  NYVVRRMVNPSTRILEYTIHDLGKGSKAPEENKPEVMAHADQQVVESSWMLGNDVYSDAL  468

Query  172  CLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDEL-DDLLRFICIVVPSSIDMETV  348
             LY NVLLGY +S+ V  A QTILD+++FVKEWP RDE+ + +L FIC + P+ +D +  
Sbjct  469  FLYKNVLLGYPDSEAVDTAVQTILDSRYFVKEWPVRDEMKEQVLTFICRLQPNFVDKKHE  528

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI  528
            L KG+   E +VVPLH+T+GDLK A +AA+RDTYC  E  +VTDIK L  V D+EV+FG+
Sbjct  529  L-KGLACGEVVVVPLHATVGDLKRAAEAALRDTYCIAERLIVTDIKELMDVSDEEVLFGL  587

Query  529  VESGTQLFMKGLGLAFAGDLKFE---DRAHNWTVKCKCGARDDDGERMISCDVCEIWQHT  699
            ++SG +L ++G+ +     LK++   + A NW V+C+CGA+DDDGERM++CD+CE+WQHT
Sbjct  588  IQSGVELCVRGIAIDLLTPLKYQGESESADNWKVRCECGAQDDDGERMVACDICEVWQHT  647

Query  700  RCVGIKDDKAVPPLFVCEVCC  762
            RC GI D + VPPLFVC  CC
Sbjct  648  RCYGIDDSETVPPLFVCTGCC  668



>ref|XP_006372523.1| hypothetical protein POPTR_0017s02450g, partial [Populus trichocarpa]
 gb|ERP50320.1| hypothetical protein POPTR_0017s02450g, partial [Populus trichocarpa]
Length=687

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 172/266 (65%), Gaps = 13/266 (5%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA-----VPPVDVFGDV  168
            YVV RAVN  TR+LEY++ E  +         ++P   +P S T      +P  DV  DV
Sbjct  399  YVVQRAVNPKTRILEYSIDEFGDG--------IIPVKSEPESETVPAQPLLPGADVNADV  450

Query  169  FCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
              +Y NVL  Y ES++V +A Q ILD+KHFVKEWPFR E D LL FIC V+P+  D+E  
Sbjct  451  VFVYENVLFNYPESELVEVATQAILDSKHFVKEWPFRVENDQLLSFICQVMPTWNDLEAK  510

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI  528
              +   P E IV+PLH+++ +LK   ++A+RDTYC +E FVV +I+ +E + D +++   
Sbjct  511  FHRKAPPGEIIVLPLHASVLELKQEAESALRDTYCMLERFVVIEIEHMENLDDKDLLCKF  570

Query  529  VESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
            VESG ++F+KG G+     L++E  + NW V+C+CGA DDDGERM+ CD+CE+WQHTRC 
Sbjct  571  VESGAEIFVKGYGMDINSQLRYEGGSDNWKVRCECGACDDDGERMVECDICEVWQHTRCN  630

Query  709  GIKDDKAVPPLFVCEVCCGRLAPTRT  786
            GI D   VP LF+C  CC  L P +T
Sbjct  631  GIDDADTVPQLFICSGCCDSLLPGKT  656



>ref|XP_011038253.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Populus 
euphratica]
Length=688

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 173/266 (65%), Gaps = 13/266 (5%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA-----VPPVDVFGDV  168
            YVV RAVN  TR+LEY+++E  +         ++P   +P S T      +P  DV  DV
Sbjct  399  YVVQRAVNPKTRILEYSIEEFGDG--------IIPVKSEPESETVPAQPLLPGADVNADV  450

Query  169  FCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
              +Y NVL  Y ES++V +A Q ILD+KHFVKEWPFR E D LL FIC V+P+  D+E  
Sbjct  451  VFVYENVLFNYPESELVEVATQAILDSKHFVKEWPFRVENDQLLSFICQVMPTWNDLEAK  510

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI  528
              +   P E IV+PLH+++ +LK   ++A+RDTYC +E FVV +I+ +E + D +++   
Sbjct  511  FHRKAPPGEIIVLPLHASVLELKQEAESALRDTYCMLESFVVIEIEHMENLDDKDLLCKF  570

Query  529  VESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
            V+SG ++F+KG G+     L++E  + NW V+C+CGA DDDGERM+ CD+CE+WQHTRC 
Sbjct  571  VKSGAEIFVKGYGMDINSQLRYEGGSDNWKVRCECGACDDDGERMVECDICEVWQHTRCN  630

Query  709  GIKDDKAVPPLFVCEVCCGRLAPTRT  786
            GI D   VP LF+C  CC  L P +T
Sbjct  631  GIDDADTVPQLFICSGCCDSLLPGKT  656



>ref|XP_010278538.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X1 [Nelumbo nucifera]
Length=674

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 185/260 (71%), Gaps = 4/260 (2%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPD-KPASLTAVPPVDVFGDVFCL  177
            +++V R VN ATR+LEYT+ E+ + +    E    PEP  +       P  DV+GDV  L
Sbjct  401  NHIVRRTVNPATRLLEYTIHEVCSGESAVDES---PEPTVEDPPPDPEPGADVYGDVVFL  457

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y  VL G+ ES+++ LA++ +LD KHF+KEWPF+DE D+LLRF+C  +PS  ++E+ L +
Sbjct  458  YKRVLKGFPESELLGLASRVVLDGKHFMKEWPFKDEQDELLRFVCRFMPSVGEVESELTR  517

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E +VVP ++T+G+LK+A + A+RDTY  +E FV  +++G+ G+ D+EV+FG +ES
Sbjct  518  PLPPGEVVVVPPYATVGELKVAAEKALRDTYGMLEWFVAKEVEGVGGMEDEEVLFGALES  577

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G  ++++G G+    DL++E  A NWTV C+CGARDDDGERM++CDVCE+WQHTRC GI 
Sbjct  578  GAHIWVEGSGVDLRTDLRYEGGADNWTVDCRCGARDDDGERMVACDVCEVWQHTRCAGIV  637

Query  718  DDKAVPPLFVCEVCCGRLAP  777
            DD+AVP LFVCE C   + P
Sbjct  638  DDEAVPALFVCERCRADMIP  657



>ref|XP_003518369.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Glycine 
max]
 gb|KHN41052.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Glycine soja]
Length=707

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 178/259 (69%), Gaps = 6/259 (2%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQEL-KNRDQTDQERVLVPEPDKPASLTAVPP-VDVFGDVFC  174
            +YVV R VN  TR+LEYT+ +L K     + E  ++   D+    ++  P  DV+ D   
Sbjct  411  NYVVRRMVNPTTRILEYTIHDLGKGLKAPEVETEVMAHVDQQVEESSWKPGNDVYCDALF  470

Query  175  LYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDEL-DDLLRFICIVVPSSIDMETVL  351
            LY NVLL Y +S+ V  A QTILD+++FVKEWP RDE+ + +L FIC + P+ +D +  L
Sbjct  471  LYKNVLLSYPDSEAVDTAVQTILDSRYFVKEWPVRDEIKEQVLTFICRLQPNFVDKKHEL  530

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
             KG+   E +VVPLH+T+GDLK A +AA+RDTYC  E  +VTDIK L  V D+EV+FG++
Sbjct  531  -KGVACGEIVVVPLHATVGDLKRASEAALRDTYCIAESLIVTDIKELMDVSDEEVLFGLI  589

Query  532  ESGTQLFMKGLGLAFAGDLKFE--DRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
            +SG +L ++G+ +     LK+E    + NW V+C+CGA+DDDGERM++CD+CE+WQHTRC
Sbjct  590  QSGVELCVRGIAIDLLTPLKYEGGSESDNWKVRCECGAQDDDGERMVACDICEVWQHTRC  649

Query  706  VGIKDDKAVPPLFVCEVCC  762
             GI D + VPPLFVC  CC
Sbjct  650  CGIDDSETVPPLFVCTGCC  668



>ref|XP_010108961.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Morus notabilis]
 gb|EXC20601.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Morus notabilis]
Length=688

 Score =   250 bits (639),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 175/260 (67%), Gaps = 12/260 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            ++ RAVN ATR+LEYT+ E+  +   +QE V     + P+    VP VDV+ DV  LY +
Sbjct  413  IIRRAVNPATRILEYTIHEVGEKVSEEQELV----SNIPSPARIVPGVDVYNDVLFLYKH  468

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII  366
            VL+ Y +S+ V LA QTILDTKH VKEWPFRDE D LL F+C ++P S         GI 
Sbjct  469  VLMEYPDSEFVDLATQTILDTKHLVKEWPFRDEEDQLLTFVCRLLPRSFG------DGI-  521

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQ  546
              E + VPLH+TI DLK A++ A+RDTYC  EE  V +I GLE V D+EV+FG VESGT+
Sbjct  522  -AEIVRVPLHATISDLKEAVECALRDTYCVTEEIEVVEIDGLEEVEDEEVLFGRVESGTE  580

Query  547  LFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDK  726
            + ++G+G+   G L  +     W V C+CGARDDDGERM++CD+CE+WQHTRC GI+D +
Sbjct  581  IRVRGVGVDTEGPLMHQGGCDPWKVVCECGARDDDGERMVACDICEVWQHTRCCGIEDAE  640

Query  727  AVPPLFVCEVCCGRLAPTRT  786
             VPPLFVC  CC  L P R 
Sbjct  641  TVPPLFVCSACCDSLVPLRA  660



>ref|XP_004146114.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Cucumis 
sativus]
Length=671

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 173/272 (64%), Gaps = 11/272 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +V RAVN  TR+LEYT+ EL+N  Q  +E+    E  + +  T  P  D++ DV C+Y +
Sbjct  406  IVRRAVNPKTRILEYTIHELRNGIQLTEEQ----ESTENSEPTVTPGKDIYNDVLCIYRS  461

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVP----SSIDMETVLP  354
            + L Y ES++V LA Q +LD+KHF KEWP +DE + LL FI  ++P    +  D+E  L 
Sbjct  462  IFLDYPESEMVELATQGVLDSKHFAKEWPLQDEEEHLLTFIIKLMPRLTFTHTDLE--LK  519

Query  355  KGIIPK-EHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
               +P  E +V+PLH+TIG++K A + A+RDTY   E+F V  I+ LE   D EVIFG V
Sbjct  520  SDFMPSGEVVVLPLHTTIGEVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFGAV  579

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            ESG +LF+KG+G+     LK++     W V+C+CG  DDDGERM++CD+CEIWQHTRC G
Sbjct  580  ESGAELFVKGMGIDLDTPLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRCCG  639

Query  712  IKDDKAVPPLFVCEVCCGRLAPTRTLGGFELG  807
            I D   VP LFVC  CC  L   +     E+G
Sbjct  640  IDDADNVPLLFVCAACCDSLVFAKKKIHIEIG  671



>gb|KGN55704.1| hypothetical protein Csa_3G006660 [Cucumis sativus]
Length=664

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 169/261 (65%), Gaps = 11/261 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +V RAVN  TR+LEYT+ EL+N  Q  +E+    E  + +  T  P  D++ DV C+Y +
Sbjct  406  IVRRAVNPKTRILEYTIHELRNGIQLTEEQ----ESTENSEPTVTPGKDIYNDVLCIYRS  461

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVP----SSIDMETVLP  354
            + L Y ES++V LA Q +LD+KHF KEWP +DE + LL FI  ++P    +  D+E  L 
Sbjct  462  IFLDYPESEMVELATQGVLDSKHFAKEWPLQDEEEHLLTFIIKLMPRLTFTHTDLE--LK  519

Query  355  KGIIPK-EHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
               +P  E +V+PLH+TIG++K A + A+RDTY   E+F V  I+ LE   D EVIFG V
Sbjct  520  SDFMPSGEVVVLPLHTTIGEVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFGAV  579

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            ESG +LF+KG+G+     LK++     W V+C+CG  DDDGERM++CD+CEIWQHTRC G
Sbjct  580  ESGAELFVKGMGIDLDTPLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRCCG  639

Query  712  IKDDKAVPPLFVCEVCCGRLA  774
            I D   VP LFVC  CC  L 
Sbjct  640  IDDADNVPLLFVCAACCDSLG  660



>ref|XP_004164188.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein MALE MEIOCYTE 
DEATH 1-like [Cucumis sativus]
Length=708

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 170/264 (64%), Gaps = 11/264 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +V RAVN  TR+LEYT+ EL+N  Q  +E+    E  + +  T  P  D++ DV C+Y +
Sbjct  406  IVRRAVNPKTRILEYTIHELRNGIQLTEEQ----ESTENSEPTVTPGKDIYNDVLCIYRS  461

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVP----SSIDMETVLP  354
            + L Y ES++V LA Q +LD+KHF KEWP +DE + LL FI  ++P    +  D+E  L 
Sbjct  462  IFLDYPESEMVELATQGVLDSKHFAKEWPLQDEEEHLLTFIIKLMPRLTFTHTDLE--LK  519

Query  355  KGIIPK-EHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
               +P  E +V+PLH+TIG++K A + A+RDTY   E+F V  I+ LE   D EVIFG V
Sbjct  520  SDFMPSGEVVVLPLHTTIGEVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFGAV  579

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            ESG +LF+KG+G+     LK++     W V+C+CG  DDDGERM++CD+CEIWQHTRC G
Sbjct  580  ESGAELFVKGMGIDLDTPLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRCCG  639

Query  712  IKDDKAVPPLFVCEVCCGRLAPTR  783
            I D   VP LFVC  CC  +   R
Sbjct  640  IDDADNVPLLFVCAACCDSIFKNR  663



>ref|XP_008448613.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Cucumis 
melo]
Length=664

 Score =   244 bits (623),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 167/263 (63%), Gaps = 15/263 (6%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +V RAVN  TR+LEYT+ EL+N  Q  +E+    E  +    T  P  D++ DV C+Y +
Sbjct  406  IVRRAVNPKTRILEYTIHELRNGIQLTEEQ----ESTENLEPTVTPGKDIYNDVLCVYRS  461

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVP----SSIDMET---  345
            + L Y ES++V LA Q +LD+KHF KEWP +DE +  L FI  ++P    +  D+E    
Sbjct  462  IFLDYPESEMVELAIQGVLDSKHFAKEWPLQDEEEHQLTFIIKLMPRLTFTHTDLELKSD  521

Query  346  VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
             LP G    E +V+PLH+TIG++K A + A+RDTY   E+F V  I+ LE   D EVIFG
Sbjct  522  FLPSG----EVVVLPLHTTIGEVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFG  577

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
             VESG +LF+KG+G+     LK++     W V+C+CG  DDDGERM++CD+CEIWQHTRC
Sbjct  578  AVESGAELFVKGMGIDLDTPLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRC  637

Query  706  VGIKDDKAVPPLFVCEVCCGRLA  774
             GI D   VP LFVC  CC  L 
Sbjct  638  CGIDDADNVPLLFVCAACCDSLG  660



>ref|XP_004288593.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Fragaria 
vesca subsp. vesca]
Length=682

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 179/284 (63%), Gaps = 15/284 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP------ASLTAVPPVDVFGDV  168
            VV R+VN  TR+LEYT+ +L + D+       V EP+K        +   V  +DV+ DV
Sbjct  406  VVCRSVNPTTRILEYTVHDLDDDDK-------VSEPEKEILPPPPQAAAPVSGIDVYSDV  458

Query  169  FCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
              LY +VLLGY ES +V LA Q +LD+KHFVKE   RD+ + LL   C ++PS  D E  
Sbjct  459  LYLYEHVLLGYPESGLVELATQAVLDSKHFVKECSVRDDTEKLLTLFCQILPSFTDKEID  518

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI  528
              + + P E +V+PL++T+G+LK   + A+RDTYC  E+FVVT+IKGLE   D +V+ G 
Sbjct  519  FKRDLPPGEIVVMPLNATVGELKQEAENALRDTYCMTEQFVVTEIKGLEESDDMDVLAGT  578

Query  529  VESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
            V+SGT++ ++G G+     L+++  +  W V+C+CGA DDDGERM++CD+CE+WQHTRC 
Sbjct  579  VQSGTEVGVRGSGIDLDTPLRYQGGSDTWMVRCECGATDDDGERMVACDICEVWQHTRCC  638

Query  709  GIKDDKAVPPLFVCEVCCGRLAPTRTL-GGFELGCHETALIPWQ  837
            G++D   VP LF+C  C   L P +T        C  TA + W+
Sbjct  639  GMEDADEVPRLFICSTCYVSLVPPKTEPAALRFDC-STAFLEWR  681



>ref|XP_006391351.1| hypothetical protein EUTSA_v10018197mg [Eutrema salsugineum]
 gb|ESQ28637.1| hypothetical protein EUTSA_v10018197mg [Eutrema salsugineum]
Length=714

 Score =   235 bits (599),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 160/263 (61%), Gaps = 17/263 (6%)
 Frame = +1

Query  16   RAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVP---------PVDVFGDV  168
            R V+  TR+L YT+QEL +  +       + EP K  +L  +P           DV GD+
Sbjct  407  RYVDPMTRILHYTIQELDDATK-------LIEPKKEPALEVIPLRVVTESKPGADVHGDL  459

Query  169  FCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
              LY+NVLL Y ES+ V  A Q ILD+KHFVKEWP  D  D + RF+C + PS ID+ T 
Sbjct  460  QLLYTNVLLNYPESESVRSATQAILDSKHFVKEWPLWDNNDKIFRFVCRIDPSLIDLRTE  519

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD-EVIFG  525
                + P E + V L +T+ DLK AI+   RDTYC +  FVV +I  L+  GDD +V+FG
Sbjct  520  QITELPPGELVTVSLQATVFDLKQAIEDTFRDTYCILTNFVVNEIDELKEDGDDRKVLFG  579

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
             +ES + L ++G G+    +LKF+     W VKC C ARDDDGERMISCDVCE+WQHTRC
Sbjct  580  RLESCSALTVRGFGIDMESELKFQGGCETWMVKCVCRARDDDGERMISCDVCEVWQHTRC  639

Query  706  VGIKDDKAVPPLFVCEVCCGRLA  774
             GI D   +PPL+VC  CC   A
Sbjct  640  CGIDDSDTLPPLYVCSNCCEDFA  662



>gb|EPS59525.1| hypothetical protein M569_15279, partial [Genlisea aurea]
Length=649

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/280 (47%), Positives = 180/280 (64%), Gaps = 28/280 (10%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            VV R+VNR+T+VLEY ++E +     D+E  +      PA+ T     D   D+  LY N
Sbjct  384  VVERSVNRSTKVLEYVIRESR-----DEEYAI------PAAFTGRG--DASSDLDYLYRN  430

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII  366
            VLL + + D  ++A+Q IL++K ++KEWPFRDE DDLLRFIC +  S    +  +   + 
Sbjct  431  VLLHHPDPDK-AMASQIILNSKRYMKEWPFRDEDDDLLRFICRLTSSCFRFDGDVFAQVP  489

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQ  546
            P EH+ VPL+ST+GDLK+A++ A++DTYC ME+    +I G E + +DEVIFGI ESG +
Sbjct  490  PSEHVAVPLYSTVGDLKVAVRKALQDTYCVMEKAEAVEILGTEEMQEDEVIFGICESGEE  549

Query  547  LFMKGLGLAFAGD-------------LKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
            ++++ LGL   GD             L +E     W+V+C+CGA+DDDGERM+SCDVCE 
Sbjct  550  IWVRVLGLDTTGDGGGGGGGGGGGRLLVYEAGTEKWSVECRCGAKDDDGERMMSCDVCET  609

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGFELG  807
            WQHTRC GI+D + VP LFVCE CC  LAP  T   FE G
Sbjct  610  WQHTRCSGIEDHEPVPRLFVCEACCSSLAPA-TEKRFEDG  648



>ref|XP_010528997.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Tarenaya 
hassleriana]
Length=722

 Score =   229 bits (584),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/253 (44%), Positives = 162/253 (64%), Gaps = 3/253 (1%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKP--ASLTAVPPVDVFGDVFCLYSNVLLG  198
            N  TR+L+YT+QEL N  +  +    + + + P   S+   P  D++ D+F LY+NVL+ 
Sbjct  415  NPTTRILQYTIQELDNETKVAEPEKEIVKENLPLRISIEFQPGADIYRDLFFLYTNVLMN  474

Query  199  YKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEH  378
            Y ES+ V+ A+Q +LD+KHFVKE    D+ + +  F C V PS +D+ + L   + P E 
Sbjct  475  YPESESVNSASQAVLDSKHFVKECALWDDREHVFVFCCRVNPSLVDLRSELITELPPGEM  534

Query  379  IVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL-EGVGDDEVIFGIVESGTQLFM  555
            + VPL +T+ DLK AI+   RDTYC +  FVVT+I+ L E   D+E++FG +E  + L +
Sbjct  535  VTVPLQATVSDLKQAIEDNFRDTYCVLANFVVTEIEELGEDTEDEELLFGRIEPYSALTV  594

Query  556  KGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVP  735
            +G G+     LK +  +  W V+C CGA DDDGERM++CD+CE+WQHTRC GI+D + +P
Sbjct  595  RGFGIDTGSKLKCQGGSDTWMVRCPCGAHDDDGERMVACDICEVWQHTRCCGIEDSETLP  654

Query  736  PLFVCEVCCGRLA  774
            PLFVC  CC   A
Sbjct  655  PLFVCTRCCDSFA  667



>ref|XP_010415158.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Camelina 
sativa]
Length=706

 Score =   224 bits (571),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 160/263 (61%), Gaps = 13/263 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTD-----QERVLVPEPDKPASLTA--VPPVDVFGD  165
            +V R V+  TR+L YT+QE++  D  +     +E  ++ E   P  + A   P  DV+GD
Sbjct  404  LVRRYVDPITRILHYTIQEMQLDDAMNVIEPRKEEAVLLEEITPLRIYAPLKPGADVYGD  463

Query  166  VFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMET  345
            +  LY+NVLL Y ES++V  A Q ILD+KHFVKEWP  D  + +L+F+C + PS I + +
Sbjct  464  LLSLYTNVLLNYPESELVRSATQAILDSKHFVKEWPIWDNSETVLQFVCRINPSLIGLRS  523

Query  346  VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
                 + P E + VPL +T+ DLK AI+   RDTYC +  FVV++I   E V +D     
Sbjct  524  EQMTELPPGELVTVPLQATVFDLKQAIEETFRDTYCILANFVVSEI---EEVTED---MS  577

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
            + ES + L ++G G+     LK +     W V+C C ARDDDGERMISCDVCE+WQHTRC
Sbjct  578  LTESCSALTVRGYGIDLESKLKCQGGCDTWMVRCICKARDDDGERMISCDVCEVWQHTRC  637

Query  706  VGIKDDKAVPPLFVCEVCCGRLA  774
             GI D   +PPLFVC  CC   A
Sbjct  638  CGIDDSDTLPPLFVCSNCCEEFA  660



>ref|XP_008343056.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Malus 
domestica]
Length=288

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 165/262 (63%), Gaps = 12/262 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP-ASLTAVPPVDVFGDVFCL  177
            +++V RAVN ATRVLEYT+ +L +        V V EP +   S T VP VDV+ DV  L
Sbjct  34   NHIVCRAVNPATRVLEYTIHDLADG-------VKVSEPAQSFQSATLVPGVDVYNDVLYL  86

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y +VLL Y ES+ + LA Q +L  KHFVKE   RD+ +  L   C ++    DME V  +
Sbjct  87   YEHVLLEYPESEQMVLATQRLLGAKHFVKECSHRDDEEQSLTIFCQLL---TDMEFVFKR  143

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E +V+PLH+T+ +LK A ++A+RDTY   E F V  I+GL  + D E +FG+ ES
Sbjct  144  ELPPGEVVVLPLHATVRELKRAAESALRDTYFITERFEVMAIEGLXEMEDXEPLFGVAES  203

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G  + ++G G+     L++E  +  W V C CGA DDDGERM++CD+CE+WQHTRC GI+
Sbjct  204  GVVVGVRGSGIDLDTPLRYEGGSDIWIVSCDCGATDDDGERMVACDLCEVWQHTRCRGIE  263

Query  718  DDKAVPPLFVCEVCCGRLA-PT  780
            D   VPP+F C  CC  LA PT
Sbjct  264  DADTVPPVFFCSACCAXLASPT  285



>gb|KDO60815.1| hypothetical protein CISIN_1g041583mg, partial [Citrus sinensis]
Length=586

 Score =   218 bits (556),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 166/257 (65%), Gaps = 14/257 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +VHR +N AT++ E++L++  N  +  Q R    EP+   S T +P  DV+ DV  LY N
Sbjct  343  IVHRKINPATKLAEFSLEDDAN-GEVIQTRT---EPEYHTS-TLMPGQDVYADVLTLYKN  397

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRD-ELDDLLRFICIVVPSSIDMETVLPKGI  363
            VLLGY ES  VSLAA+ ILD K+F KEW F++ E D+L+R  C V PS  ++ T L + +
Sbjct  398  VLLGYPESHTVSLAARAILDCKNFAKEWQFKESEDDNLMRLKCRVSPSYNELATQLTRPL  457

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
             P E IV P   T+ +LKL ++ ++RDTYC ME+ VV +IK    +G ++V +G      
Sbjct  458  PPAELIVAPKDVTVDELKLIVECSLRDTYCMMEKVVVKEIK----MGQNQVFWG----AG  509

Query  544  QLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
             ++++G GL    +L+FE  A +WTV C CGA+DDDGERM++CD+C++WQHTRC  I D+
Sbjct  510  DVWVRGWGLDLDTELRFEGGADDWTVDCVCGAKDDDGERMVACDICQVWQHTRCNSIADN  569

Query  724  KAVPPLFVCEVCCGRLA  774
            + VP +F C  C   +A
Sbjct  570  EVVPSVFKCRACTAAVA  586



>ref|XP_006469331.1| PREDICTED: PHD finger protein At2g01810-like [Citrus sinensis]
Length=646

 Score =   219 bits (559),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 165/259 (64%), Gaps = 18/259 (7%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRD--QTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +VHR +N AT++ E+ L++  N +  QT  E    PE   P   T +P  DV+ DV  LY
Sbjct  396  IVHRKINPATKLAEFALEDDANGEVIQTRTE----PEYHIP---TLMPGQDVYADVLTLY  448

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRD-ELDDLLRFICIVVPSSIDMETVLPK  357
             NVLLGY ES  VSLAA+ ILD K+F KEW F++ E D+L+R  C V PS  ++ T L +
Sbjct  449  KNVLLGYPESHTVSLAARAILDCKNFAKEWQFKESEDDNLMRLKCRVSPSYNELATQLTR  508

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E IV P   T+ +LKL ++ ++RDTYC ME+ VV +IK    +G ++V +G    
Sbjct  509  PLPPAELIVAPKDVTVDELKLIVECSLRDTYCMMEKVVVKEIK----MGQNQVFWG----  560

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
               ++++G GL     L+FE  A +WTV C CGA+DDDGERM++CD+C++WQHTRC  I 
Sbjct  561  AGDVWVRGWGLDLDTQLRFEGGADDWTVDCVCGAKDDDGERMVACDICQVWQHTRCNSIA  620

Query  718  DDKAVPPLFVCEVCCGRLA  774
            D++AVP +F C  C   +A
Sbjct  621  DNEAVPSVFKCRACTAAVA  639



>ref|XP_006448127.1| hypothetical protein CICLE_v10017749mg [Citrus clementina]
 gb|ESR61367.1| hypothetical protein CICLE_v10017749mg [Citrus clementina]
Length=646

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 165/259 (64%), Gaps = 18/259 (7%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRD--QTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +VHR +N AT++ E+ L++  N +  QT  E    PE   P   T +P  DV+ DV  LY
Sbjct  396  IVHRKINPATKLAEFALEDDANGEVIQTRTE----PEYHIP---TLMPGQDVYADVLTLY  448

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRD-ELDDLLRFICIVVPSSIDMETVLPK  357
             NVLLGY ES  VSLAA+ ILD K+F KEW F++ E D+L+R  C V PS  ++ T L +
Sbjct  449  KNVLLGYPESHTVSLAARAILDCKNFAKEWQFKESEDDNLMRLKCRVSPSYNELATQLTR  508

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E IV P   T+ +LKL ++ ++RDTY  ME+ VV +IK    +G ++V +G    
Sbjct  509  PLPPAELIVAPKDVTVDELKLIVECSLRDTYYMMEKVVVKEIK----MGQNQVFWG----  560

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
               ++++G GL    +L+FE  A +WTV C CGA+DDDGERM++CD+C++WQHTRC  I 
Sbjct  561  AGDVWVRGWGLDLDTELRFEGGADDWTVDCVCGAKDDDGERMVACDICQVWQHTRCNSIA  620

Query  718  DDKAVPPLFVCEVCCGRLA  774
            D++AVP +F C  C   +A
Sbjct  621  DNEAVPSVFKCRACTAAVA  639



>ref|XP_008353887.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Malus 
domestica]
Length=648

 Score =   214 bits (546),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 165/262 (63%), Gaps = 12/262 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP-ASLTAVPPVDVFGDVFCL  177
            +++V RAVN ATRVLEYT+ +L +        V V EP +   S T VP VDV+ DV  L
Sbjct  394  NHIVCRAVNPATRVLEYTIHDLADG-------VKVSEPAQSFQSATLVPGVDVYNDVLYL  446

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y +VLL Y ES+ + LA Q +L  KHFVKE   RD+ +  L   C ++    DME V  +
Sbjct  447  YEHVLLEYPESEQMVLATQRLLGAKHFVKECSHRDDEEQSLTIFCQLL---TDMEFVFKR  503

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E +V+PLH+T+ +LK A ++A+RDTY   E F V  I+GL  + D E +FG+ ES
Sbjct  504  ELPPGEVVVLPLHATVRELKRAAESALRDTYFITERFEVMAIEGLXEMEDXEPLFGVAES  563

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G  + ++G G+     L++E  +  W V C CGA DDDGERM++CD+CE+WQHTRC GI+
Sbjct  564  GVVVGVRGSGIDLDTPLRYEGGSDIWIVSCDCGATDDDGERMVACDLCEVWQHTRCRGIE  623

Query  718  DDKAVPPLFVCEVCCGRLA-PT  780
            D   VPP+F C  CC  LA PT
Sbjct  624  DADTVPPVFFCSACCAXLASPT  645



>ref|XP_008343055.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Malus 
domestica]
Length=654

 Score =   214 bits (545),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 165/262 (63%), Gaps = 12/262 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP-ASLTAVPPVDVFGDVFCL  177
            +++V RAVN ATRVLEYT+ +L +        V V EP +   S T VP VDV+ DV  L
Sbjct  400  NHIVCRAVNPATRVLEYTIHDLADG-------VKVSEPAQSFQSATLVPGVDVYNDVLYL  452

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y +VLL Y ES+ + LA Q +L  KHFVKE   RD+ +  L   C ++    DME V  +
Sbjct  453  YEHVLLEYPESEQMVLATQRLLGAKHFVKECSHRDDEEQSLTIFCQLL---TDMEFVFKR  509

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E +V+PLH+T+ +LK A ++A+RDTY   E F V  I+GL  + D E +FG+ ES
Sbjct  510  ELPPGEVVVLPLHATVRELKRAAESALRDTYFITERFEVMAIEGLXEMEDXEPLFGVAES  569

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G  + ++G G+     L++E  +  W V C CGA DDDGERM++CD+CE+WQHTRC GI+
Sbjct  570  GVVVGVRGSGIDLDTPLRYEGGSDIWIVSCDCGATDDDGERMVACDLCEVWQHTRCRGIE  629

Query  718  DDKAVPPLFVCEVCCGRLA-PT  780
            D   VPP+F C  CC  LA PT
Sbjct  630  DADTVPPVFFCSACCAXLASPT  651



>gb|KDP38152.1| hypothetical protein JCGZ_04795 [Jatropha curcas]
Length=668

 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 164/258 (64%), Gaps = 8/258 (3%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            ++ RA N  +R+LE++L  + +   TD+ +V   EP    +L   P +DV+ D+  LY N
Sbjct  398  IILRATN-TSRLLEFSLANISDA-VTDERKV---EPRTNNTLAPQPGLDVYKDLLYLYKN  452

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPKGI  363
            VL+GY E   VS+AA+ ILD+KHFVKE  F+   +D LLR IC V PS  ++   L + +
Sbjct  453  VLMGYPEYHAVSIAAKVILDSKHFVKERQFKSSNEDMLLRLICQVRPSYDELVNDLTRPL  512

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG--DDEVIFGIVES  537
             P E +     +T+ +LK+ +Q A+RDTYC ME FVV DI+  E V   D +++   VE 
Sbjct  513  PPGEIVTAQERTTVCELKMIVQYALRDTYCIMENFVVKDIQIGELVTKEDQDLVKCGVEQ  572

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
            G Q++++G GL     ++++   ++WTV C+CGA+DDDGERM++CDVC +WQHTRC  IK
Sbjct  573  GMQVWVRGHGLDLGTKMRYQGGDNDWTVDCRCGAKDDDGERMVACDVCHVWQHTRCNNIK  632

Query  718  DDKAVPPLFVCEVCCGRL  771
            D  A P LF C +C  R+
Sbjct  633  DGDAPPSLFQCRLCSSRM  650



>ref|XP_010470485.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Camelina 
sativa]
Length=702

 Score =   212 bits (540),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 156/261 (60%), Gaps = 12/261 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELK---NRDQTDQERVLVPEPDKPASLT--AVPPVDVFGDVF  171
            +V R V+  TR+L YT+QEL    N  +  +E  ++ E   P  +   + P  DV+ D+ 
Sbjct  403  LVRRYVDPITRILHYTIQELDDAMNVIEPKKEEAVLLEEITPLRIYTPSKPGADVYRDLL  462

Query  172  CLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVL  351
             LY+ VL  Y ES++V  A Q ILD+KHFVKEWP  D  + +L+F+C + PS I + +  
Sbjct  463  LLYT-VLFTYPESELVRSATQAILDSKHFVKEWPIWDNSETVLQFVCRINPSLIGLRSEQ  521

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
               + P E + VPL +TI DLK AI+   RDTYC +  FVV++I   E V +D     + 
Sbjct  522  ITELPPGELVTVPLQATIFDLKQAIEETFRDTYCILANFVVSEI---EEVTED---MSLT  575

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            ES + L ++G G+     LK +     W VKC C ARDDDGERMISCDVCE+WQHTRC G
Sbjct  576  ESCSALTVRGYGIDLESKLKCQGGCDTWMVKCICRARDDDGERMISCDVCEVWQHTRCCG  635

Query  712  IKDDKAVPPLFVCEVCCGRLA  774
            I D   +PPLFVC  CC   A
Sbjct  636  IDDSDTLPPLFVCSNCCEEFA  656



>ref|XP_010068687.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Eucalyptus 
grandis]
 gb|KCW64468.1| hypothetical protein EUGRSUZ_G02081 [Eucalyptus grandis]
Length=692

 Score =   212 bits (540),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 160/256 (63%), Gaps = 8/256 (3%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            S +V R +N  T+ L +T+QE+   ++ +    L     +  S       D++ D+ CLY
Sbjct  434  SQIVRRKMNPQTKTLVFTVQEVGKEEKLEDRNSL-----RLCSPVVEQEFDIYEDLLCLY  488

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPK  357
             N+L GY +S  VSLA Q ILD+KHFVKEW + +  D+   R  C V+P+  ++ + L +
Sbjct  489  ENILFGYPDSHPVSLATQVILDSKHFVKEWKYANAKDEKFTRITCRVMPTYAELVSHLTR  548

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLE-GVGDDE-VIFGIV  531
             + P E IVVP   T G+LKL +Q A+RDTY  M++F+V ++K  E  V DD+ V   ++
Sbjct  549  PLPPGELIVVPQCVTTGELKLVVQRALRDTYIIMDQFIVREMKACEMQVRDDQQVQHRVL  608

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            ES  ++ ++G GL    +L++E    NW V C CGARDDDGERM++CDVC++WQHT C G
Sbjct  609  ESQMEVLVRGQGLDLESELRYEGGTDNWMVDCVCGARDDDGERMVACDVCQVWQHTLCAG  668

Query  712  IKDDKAVPPLFVCEVC  759
            I+DD+ VP +F+C  C
Sbjct  669  IEDDEEVPSMFICGRC  684



>gb|AAG51303.1|AC026480_10 PHD-finger protein, putative [Arabidopsis thaliana]
Length=653

 Score =   203 bits (517),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 162/261 (62%), Gaps = 11/261 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKN----RDQTDQERVLVPEPDKPASLTAVPP-VDVFGDVF  171
            +V R V+  TR+L YT+Q+L +    ++   +E V++ E      LT + P  DV+GD+ 
Sbjct  353  LVRRYVDPITRILHYTIQDLDDAVKAKEPKKKEAVVLEEITPLRILTPLKPGADVYGDLL  412

Query  172  CLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVL  351
             LY+NVLL Y ES++V  A Q ILD+KHF+KEWP  D  D +L+F+C + PS +D+ +  
Sbjct  413  LLYTNVLLNYPESELVRSATQAILDSKHFIKEWPIWDNNDTVLQFLCRINPSLVDVRSEQ  472

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
               + P E + VPL +T+ DLK AI+   RDTYC +  FVVT+I  +E   +D  + G  
Sbjct  473  TTELPPGELVTVPLQATVYDLKQAIEETFRDTYCILSNFVVTEIDEVE---EDMSLIG--  527

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
             S + L ++G G+     LK +     W VKC C ARDDDGERMISCDVCE+WQHTRC G
Sbjct  528  -SCSALTVRGHGIDLESKLKCQGGCDTWMVKCICRARDDDGERMISCDVCEVWQHTRCCG  586

Query  712  IKDDKAVPPLFVCEVCCGRLA  774
            I D   +PPLFVC  CC   A
Sbjct  587  IDDSDTLPPLFVCSNCCEEFA  607



>ref|NP_176791.2| PHD finger protein MALE MEIOCYTE DEATH 1 [Arabidopsis thaliana]
 sp|Q7X6Y7.1|MMD1_ARATH RecName: Full=PHD finger protein MALE MEIOCYTE DEATH 1 [Arabidopsis 
thaliana]
 gb|AAO16873.1| male meiotic MMD1 [Arabidopsis thaliana]
 gb|AAP69944.1| male meiotic chromosome organization protein [Arabidopsis thaliana]
 gb|AEE34471.1| male meiotic MMD1 PHD-finger protein [Arabidopsis thaliana]
Length=704

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 162/261 (62%), Gaps = 11/261 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKN----RDQTDQERVLVPEPDKPASLTAVPP-VDVFGDVF  171
            +V R V+  TR+L YT+Q+L +    ++   +E V++ E      LT + P  DV+GD+ 
Sbjct  404  LVRRYVDPITRILHYTIQDLDDAVKAKEPKKKEAVVLEEITPLRILTPLKPGADVYGDLL  463

Query  172  CLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVL  351
             LY+NVLL Y ES++V  A Q ILD+KHF+KEWP  D  D +L+F+C + PS +D+ +  
Sbjct  464  LLYTNVLLNYPESELVRSATQAILDSKHFIKEWPIWDNNDTVLQFLCRINPSLVDVRSEQ  523

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
               + P E + VPL +T+ DLK AI+   RDTYC +  FVVT+I  +E   +D  + G  
Sbjct  524  TTELPPGELVTVPLQATVYDLKQAIEETFRDTYCILSNFVVTEIDEVE---EDMSLIG--  578

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
             S + L ++G G+     LK +     W VKC C ARDDDGERMISCDVCE+WQHTRC G
Sbjct  579  -SCSALTVRGHGIDLESKLKCQGGCDTWMVKCICRARDDDGERMISCDVCEVWQHTRCCG  637

Query  712  IKDDKAVPPLFVCEVCCGRLA  774
            I D   +PPLFVC  CC   A
Sbjct  638  IDDSDTLPPLFVCSNCCEEFA  658



>ref|XP_009127470.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Brassica 
rapa]
Length=720

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 158/268 (59%), Gaps = 19/268 (7%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVP---------PVDVF  159
            +V R V+  TR+L YT+QEL      D    LV E  K A + AVP            V 
Sbjct  406  LVQRYVDPLTRILHYTIQEL------DDATKLV-EQKKDAVIEAVPLRVVSESKAGGHVH  458

Query  160  GDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFIC-IVVPSSID  336
            GD+  LY+NVLL Y +S+ V  AAQ +LD+KHFVKEWP RD  D + RF+C I  PS ID
Sbjct  459  GDLLLLYTNVLLNYPKSESVRSAAQVVLDSKHFVKEWPLRDNDDKIFRFVCRINNPSLID  518

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLE--GVGDD  510
            + T     + P E + V L +T+ DLK AI+   RDTYC +  F V +I  L+     D 
Sbjct  519  LRTEQVTELPPGELVTVSLQATVFDLKQAIEETFRDTYCILTNFEVNEIDELKEDDDDDS  578

Query  511  EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIW  690
             ++FG +E  + L ++G G+     LKF+  +  W VKC C ARDDDGERMISCDVCE+W
Sbjct  579  NLLFGKLEPCSALTVRGDGIDLESTLKFQGGSDTWMVKCVCRARDDDGERMISCDVCEVW  638

Query  691  QHTRCVGIKDDKAVPPLFVCEVCCGRLA  774
            QHTRC GI D   +PPL+VC  CC   A
Sbjct  639  QHTRCCGIDDSDTLPPLYVCSSCCDEFA  666



>ref|XP_010511544.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Camelina 
sativa]
Length=705

 Score =   202 bits (514),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 159/262 (61%), Gaps = 12/262 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNR----DQTDQERVLVPEPDKPASLTAVPP-VDVFGDVF  171
            +V R V+  TR+L YT+QEL +     +   +E VL+ E       T + P  DV+GD+ 
Sbjct  404  LVRRYVDPVTRILHYTIQELDDAMNVIEPKKEEAVLLEEITPLRIYTPLKPGADVYGDLL  463

Query  172  CLYSNVLLGYKESDV-VSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
             LY+NVLL Y ES++ V  A Q ILD+KHFVKEWP  D  + +L+F+C + PS I + + 
Sbjct  464  LLYTNVLLNYPESELLVRSATQAILDSKHFVKEWPIWDNSETVLQFVCRINPSLIGLRSE  523

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI  528
                + P E + VPL +T+ DLK AI+   RDTYC +  FVV++I   E V +D     +
Sbjct  524  QMTELPPGELVTVPLQATVFDLKQAIEETFRDTYCILANFVVSEI---EEVTED---MSL  577

Query  529  VESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
             ES + L ++G G+     LK +     W V+C C ARDDDGERMISCDVCE+WQHTRC 
Sbjct  578  TESCSALTVRGYGIDLESKLKCQGGCDTWMVRCICRARDDDGERMISCDVCEVWQHTRCC  637

Query  709  GIKDDKAVPPLFVCEVCCGRLA  774
            GI D   +PPLFVC  CC   A
Sbjct  638  GIDDSDTLPPLFVCSNCCEEFA  659



>ref|XP_006302059.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
 gb|EOA34957.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
Length=540

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 159/262 (61%), Gaps = 13/262 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQEL----KNRDQTDQERVLVPEPDKPASLTAVPP-VDVFGDVF  171
            +V R V+  TR+L YT+QEL    K  +   +E V++ E       T + P  DV+GD+ 
Sbjct  239  LVRRYVDPITRILHYTIQELGDAMKAIEPKKEEAVVLAEITPLRIFTPLKPGADVYGDLL  298

Query  172  CLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVL  351
             LY+NVLL Y ES+ V  A Q ILD+K F+KEW   D  + +L+++C + PS +D  +  
Sbjct  299  LLYTNVLLNYPESEQVRSATQAILDSKFFIKEWSIWDNNETVLQYVCRINPSLLDFRSEQ  358

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL-EGVGDDEVIFGI  528
               + P E + VP+ +T+ DLK AI+   RDTYC +E FVV++I+ + EG+       G+
Sbjct  359  ATELPPGELVTVPIQATVFDLKRAIEETFRDTYCILENFVVSEIEEIKEGM-------GL  411

Query  529  VESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
             ES + L ++G G+    +LK +     W VKC C ARDDDGERMISCDVCE+WQHTRC 
Sbjct  412  TESCSALTVRGHGIDLESNLKCQGGCDTWMVKCVCRARDDDGERMISCDVCEVWQHTRCC  471

Query  709  GIKDDKAVPPLFVCEVCCGRLA  774
             I D   +PPLFVC  CC   A
Sbjct  472  EIDDSDTLPPLFVCSNCCEEFA  493



>ref|XP_006826580.1| hypothetical protein AMTR_s00138p00033180 [Amborella trichopoda]
 gb|ERM93817.1| hypothetical protein AMTR_s00138p00033180 [Amborella trichopoda]
Length=699

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 158/268 (59%), Gaps = 12/268 (4%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQ-----ELKNRD-QTDQERVLVPEPDKPAS-LTAVPPVDVFG  162
            +++ R VN  T+VLEY+L      EL N D +   E       D P + L      ++  
Sbjct  423  HLIRRTVNPKTKVLEYSLSSLSSTELDNWDGEAATENRKYESGDHPQNQLQVGRRSEIER  482

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            D+  +Y  VL G     VV  A + +LDTKHF KEWP RD  D+ LRF+  VV +  D  
Sbjct  483  DLEYVYRRVLEGGLGGKVVEAARRVVLDTKHFTKEWPIRDA-DEQLRFMVSVVVAE-DEA  540

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG--VGDDEV  516
             +  + I P E +VVPLH+T+GDL+   + A RDTYC ME F   D+    G  + + E+
Sbjct  541  GMFSRAIPPPELVVVPLHATVGDLRAEAEHAFRDTYCIMEGFAAEDLIWPHGQEISESEL  600

Query  517  IFGIVESGTQLFMKGLGLAFAGD-LKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQ  693
            +FG+ ESG  ++++G G     + L++E  A  W V+C+CGARDDDGERM++CDVCE+WQ
Sbjct  601  LFGVAESGMGVWVRGRGAERGEERLRYEGGAEEWRVECECGARDDDGERMVACDVCEVWQ  660

Query  694  HTRCVGIKDDKAVPPLFVCEVCCGRLAP  777
            HTRC+GI D +AVP LF C  C   L P
Sbjct  661  HTRCLGIADAEAVPQLFFCARCGSALLP  688



>ref|XP_006302058.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
 gb|EOA34956.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
Length=584

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 159/262 (61%), Gaps = 13/262 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQEL----KNRDQTDQERVLVPEPDKPASLTAVPP-VDVFGDVF  171
            +V R V+  TR+L YT+QEL    K  +   +E V++ E       T + P  DV+GD+ 
Sbjct  283  LVRRYVDPITRILHYTIQELGDAMKAIEPKKEEAVVLAEITPLRIFTPLKPGADVYGDLL  342

Query  172  CLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVL  351
             LY+NVLL Y ES+ V  A Q ILD+K F+KEW   D  + +L+++C + PS +D  +  
Sbjct  343  LLYTNVLLNYPESEQVRSATQAILDSKFFIKEWSIWDNNETVLQYVCRINPSLLDFRSEQ  402

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL-EGVGDDEVIFGI  528
               + P E + VP+ +T+ DLK AI+   RDTYC +E FVV++I+ + EG+       G+
Sbjct  403  ATELPPGELVTVPIQATVFDLKRAIEETFRDTYCILENFVVSEIEEIKEGM-------GL  455

Query  529  VESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
             ES + L ++G G+    +LK +     W VKC C ARDDDGERMISCDVCE+WQHTRC 
Sbjct  456  TESCSALTVRGHGIDLESNLKCQGGCDTWMVKCVCRARDDDGERMISCDVCEVWQHTRCC  515

Query  709  GIKDDKAVPPLFVCEVCCGRLA  774
             I D   +PPLFVC  CC   A
Sbjct  516  EIDDSDTLPPLFVCSNCCEEFA  537



>ref|XP_002888484.1| hypothetical protein ARALYDRAFT_894251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64743.1| hypothetical protein ARALYDRAFT_894251 [Arabidopsis lyrata subsp. 
lyrata]
Length=705

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 160/267 (60%), Gaps = 22/267 (8%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPV----------DV  156
            +V R V+  TR+L YT+QEL      D  + + P+ ++   L  + P+          DV
Sbjct  404  LVRRYVDPITRILHYTIQELD-----DAVKAIEPKKEEAVVLEEITPLRIFTPLKAGADV  458

Query  157  FGDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSI  333
            +GD+  LY+NVLL Y +S++V  A Q ILD+KHFVKEWP  D+ +D +L+F+C + PS I
Sbjct  459  YGDLLLLYTNVLLNYPDSELVRSATQAILDSKHFVKEWPLWDDNNDKVLQFVCRINPSLI  518

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
            D+ +     + P + + VPL +T+ DLK AI+   RDTYC +   VV++I   E V +D 
Sbjct  519  DLRSEQITELPPGDLVTVPLQATVFDLKQAIEDTFRDTYCILSNLVVSEI---EEVKED-  574

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQ  693
                + ES + L + G G+     LK +     W VKC C ARDDDGERMISCDVCE+WQ
Sbjct  575  --MSLTESCSALTVTGHGIDLESKLKCQGGCDTWMVKCICRARDDDGERMISCDVCEVWQ  632

Query  694  HTRCVGIKDDKAVPPLFVCEVCCGRLA  774
            HTRC GI D   +PPLFVC  CC   A
Sbjct  633  HTRCCGIDDSDTLPPLFVCSNCCEEFA  659



>ref|XP_011024453.1| PREDICTED: PHD finger protein At2g01810 [Populus euphratica]
Length=661

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 164/256 (64%), Gaps = 13/256 (5%)
 Frame = +1

Query  10   VHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPP-VDVFGDVFCLYSN  186
            +HR VN  TR L  +LQ++ +  +++++       +  A + A+ P +DV  D+  LY+ 
Sbjct  406  IHRVVNPVTRKLVISLQDVVHEGKSEKKM------ESQADILALEPGLDVNKDLHFLYNY  459

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFR--DELDDLLRFICIVVPSSIDMETVLPKG  360
            VLLGY +S  V+LA + ILD+KHF K+W F+  ++ D  L  +  + PS  ++   L + 
Sbjct  460  VLLGYPDSHSVTLAIRAILDSKHFAKQWQFKGNNDQDSFLGLVLRLRPSYNELVKELTRP  519

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI---V  531
            + P E +VVP ++T+ +LKL +Q  +RDTY  M++FVV DI+ +  + + E   G+   V
Sbjct  520  LPPGELLVVPEYATVDELKLMVQCLLRDTYYVMDKFVVKDIQ-IGKIEEKEYQDGVMCEV  578

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            E G Q++++G GL     L+++  A +WTV C+CGA+DDDGERM++CDVC +WQHTRC  
Sbjct  579  EQGVQVWVRGCGLDLDTKLRYQGGADDWTVDCRCGAKDDDGERMVACDVCHVWQHTRCNS  638

Query  712  IKDDKAVPPLFVCEVC  759
            IKD++A P +FVC  C
Sbjct  639  IKDNEAAPRMFVCCRC  654



>ref|XP_006395850.1| hypothetical protein EUTSA_v10003728mg [Eutrema salsugineum]
 gb|ESQ33136.1| hypothetical protein EUTSA_v10003728mg [Eutrema salsugineum]
Length=708

 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 154/260 (59%), Gaps = 7/260 (3%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNR---DQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +V R  N  +R+L+++L+++  R   DQ  ++R      D     +  P +D + D+F L
Sbjct  436  IVQRFTNPESRMLQFSLRKINARGGLDQDAKKRKKTKPRDANERTSTTPGLDPYEDIFYL  495

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRD-ELDDLLRFICIVVPSSIDMETVLP  354
            Y N+LL Y +SD+ S A++ IL+ K FVKEWP    +  + L   C V+P+  ++     
Sbjct  496  YKNLLLTYPDSDIYSDASEDILNCKSFVKEWPLPSYQEQNSLTVSCQVLPNHQELLRDFT  555

Query  355  KGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVE  534
            + + P E ++VP ++TI +LK A + A+RDTYC ME F V +IK  E    DE      E
Sbjct  556  RQLPPGELVIVPKNATIRELKSAAEKALRDTYCIMERFEVWEIKSKELEKMDETSCLKTE  615

Query  535  ---SGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
               S T+  + G GL    +L++E    +W V CKCGARDDDGERM++CD C++W HT+C
Sbjct  616  GDKSKTEFLVTGFGLDTGTELRYEAGFDDWIVNCKCGARDDDGERMVACDACKVWHHTKC  675

Query  706  VGIKDDKAVPPLFVCEVCCG  765
              I+DD+AVP +F+C  C G
Sbjct  676  NSIEDDEAVPSVFLCNRCFG  695



>ref|XP_002311539.2| PHD finger family protein [Populus trichocarpa]
 gb|EEE88906.2| PHD finger family protein [Populus trichocarpa]
Length=662

 Score =   195 bits (496),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 159/256 (62%), Gaps = 12/256 (5%)
 Frame = +1

Query  10   VHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNV  189
            +HR VN  TR L  +LQ++ +  ++  E+ +    D PA     P +DV  D+  LY+ V
Sbjct  406  IHRVVNPVTRKLVISLQDVVHEGKS--EKKMESHADIPA---LEPGLDVNKDLHFLYNYV  460

Query  190  LLGYKESDVVSLAAQTILDTKHFVKEWPFR---DELDDLLRFICIVVPSSIDMETVLPKG  360
            LLGY +S  V+LA + ILD+KHF K+W F+   D  D  L  +  + PS  ++   L + 
Sbjct  461  LLGYPDSHSVTLAIRAILDSKHFAKQWQFKGNNDHEDSFLGLVLRLRPSYNELVKELTRP  520

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI---V  531
            + P E +VVP ++T+ +LKL +Q A+RDTY  M++F V D++ +  + + E   G+   V
Sbjct  521  LPPGELLVVPQYATVDELKLMVQCALRDTYYVMDKFAVKDVQ-IGKIEEKEYQDGVMCEV  579

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            E G Q++++G GL     L+++  A +WTV C CGA+DDDGERM++CDVC +WQH RC  
Sbjct  580  EQGVQVWVRGCGLDLDTKLRYQGGADDWTVDCGCGAKDDDGERMVACDVCHVWQHRRCNS  639

Query  712  IKDDKAVPPLFVCEVC  759
            IKD++A P +FVC  C
Sbjct  640  IKDNEAAPRMFVCCRC  655



>ref|XP_010502170.1| PREDICTED: PHD finger protein At2g01810-like [Camelina sativa]
Length=691

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 160/258 (62%), Gaps = 10/258 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNR---DQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +V R  N  +R+L+++L+ + +R    +  ++R L P+     + T  P +  + D+F L
Sbjct  426  IVQRFNNPKSRMLQFSLRTINSRVLEQERKKKRKLKPQETSEWAST-TPGLSPYDDIFYL  484

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y N+LL Y +SD  S A+Q IL+ K FVKEW ++++  + L   C V+P+  D+     +
Sbjct  485  YQNLLLAYPDSDSYSEASQVILNCKSFVKEWSYQEQ--NPLTVSCQVLPNHEDLLRDFTR  542

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG--LEGVGDDEVIFGIV  531
             + P E +VVP ++TI +LK A + A+RDTYC ME F + +I+   LE + DD  +    
Sbjct  543  LLPPGELVVVPENATIRELKSAAEKALRDTYCIMETFEMLEIRNMYLEKLHDDLSLES--  600

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            +  T+  +KG GL    +L++E    +WTV C+CGARDDDGERM++CDVC++WQHT C  
Sbjct  601  QGKTEFLVKGFGLDTGTELRYEGGFDDWTVACECGARDDDGERMVACDVCKVWQHTLCNS  660

Query  712  IKDDKAVPPLFVCEVCCG  765
            I+DD+AVP +F+C  C  
Sbjct  661  IEDDEAVPSVFLCNRCSA  678



>ref|XP_010424952.1| PREDICTED: PHD finger protein At2g01810-like [Camelina sativa]
Length=691

 Score =   194 bits (492),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 159/258 (62%), Gaps = 10/258 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNR---DQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +V R  N  +R+L+++L+ + +R    +  ++R L P+     + T  P +  + D+F L
Sbjct  426  IVQRFNNPKSRMLQFSLRTINSRVLEQERKKKRKLKPQETSEWTST-TPGLSPYDDIFYL  484

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y N+LL Y +SD  S A+Q IL  K FVKEW ++++  + L   C V+P+  D+     +
Sbjct  485  YQNLLLAYPDSDSYSEASQVILSCKSFVKEWAYQEQ--NPLTVSCQVLPNHEDLLRDFTR  542

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG--LEGVGDDEVIFGIV  531
             + P E +VVP ++TI +LK A + A+RDTYC M+ F V +I+   LE + DD  +    
Sbjct  543  LLPPGELVVVPENATIRELKSAAEKALRDTYCIMDTFEVLEIRNMYLEKLHDD--LSRES  600

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            +  T+  +KG GL    +L++E    +WTV C+CGARDDDGERM++CDVC++WQHT C  
Sbjct  601  QGKTEFLVKGFGLDTGTELRYEGGFDDWTVACECGARDDDGERMVACDVCKVWQHTLCNS  660

Query  712  IKDDKAVPPLFVCEVCCG  765
            I+DD+AVP +F+C  C  
Sbjct  661  IEDDEAVPSVFLCNRCSA  678



>ref|XP_006826579.1| hypothetical protein AMTR_s00138p00031220 [Amborella trichopoda]
 gb|ERM93816.1| hypothetical protein AMTR_s00138p00031220 [Amborella trichopoda]
Length=697

 Score =   193 bits (490),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 150/266 (56%), Gaps = 10/266 (4%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVL----VPEPDKPASLTAVPP-VDVFGDV  168
            +++ R VN  T+VLEY+L     RD  D E           D P +   V    ++  D+
Sbjct  423  HLIRRTVNPKTKVLEYSLLSTTERDYWDGEAATKTGKYGSGDHPQNQIQVGRRSEIERDL  482

Query  169  FCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
              +Y  VL G     VV  A + +LDTKH  KE P RD  D+ LRF+  VV +  D   +
Sbjct  483  EYVYRTVLEGGLGGKVVEAARRVVLDTKHLTKECPIRDA-DEQLRFMVSVVVAE-DGAGM  540

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG--VGDDEVIF  522
              +G  P E +VVPLH+T+GDL    + A RDTYC ME F   D+    G  V + E++F
Sbjct  541  FSRGTPPPELVVVPLHATVGDLCAEAERAFRDTYCVMEGFAAEDLIWPHGQEVSESELLF  600

Query  523  GIVESGTQLFMKGLGLAFA-GDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHT  699
            G+ ESG  ++++G G       L++E     W V+C+CGARDDDGERM++CDVCE+WQHT
Sbjct  601  GVAESGMGVWVRGRGAERGEARLRYEGGVEEWRVECECGARDDDGERMVACDVCEVWQHT  660

Query  700  RCVGIKDDKAVPPLFVCEVCCGRLAP  777
            RC+GI D + VP LF C  C   L P
Sbjct  661  RCLGIADAEVVPQLFFCARCGSALLP  686



>ref|XP_002527531.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF34840.1| DNA binding protein, putative [Ricinus communis]
Length=679

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 159/263 (60%), Gaps = 11/263 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            V+ RA    +++LE++L+++   D    E+      D     T    ++V  D+  LY N
Sbjct  402  VIVRANKPVSKLLEFSLEDIS--DGATLEKKAQSHTDIS---TLKLGLNVRKDLLFLYKN  456

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD-LLRFICIVVPSSIDMETVLPKGI  363
            VLLGY +   V++AA+ ILD KHF KEW ++   +D LL  IC V PS  ++   L   +
Sbjct  457  VLLGYPDYHAVAIAARVILDCKHFFKEWQYKSSNEDALLTLICQVRPSYDELANELTWPL  516

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIK--GL--EGVGDDEVIFGIV  531
             P E ++ P  +T+ +LKL +Q A+RDTYC M+ FVV DI+  GL     G D +  G+ 
Sbjct  517  PPGEPVMAPECATVFELKLTVQCALRDTYCVMDNFVVNDIEIGGLVAREEGQDLLKCGL-  575

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            E G +++++G GL     L+++   ++WTV CKCGA+DDDGERM++CD C +WQHTRC  
Sbjct  576  EDGMKVWVRGSGLDLDTKLRYQGGDNDWTVDCKCGAKDDDGERMVACDACHVWQHTRCNS  635

Query  712  IKDDKAVPPLFVCEVCCGRLAPT  780
            IKDD + P LF+C +C  R+  +
Sbjct  636  IKDDASPPTLFLCRMCNCRMKKS  658



>ref|XP_009405163.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 156/264 (59%), Gaps = 25/264 (9%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKN------------RDQTDQERVLVPEPDKPASLTAVPP  147
            ++V R  N  +RVLE++L+E  +            + + +++ V+V  P  P +L     
Sbjct  392  HLVRRTSNPTSRVLEFSLEEFPSPAPAAAAAAAAAKTEQNEDVVVVARPAWPGAL-----  446

Query  148  VDVFGDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPS  327
              V  D+  +Y ++L    E      AA  +LD KH+VK+W  +D++DD LRF+ + VP+
Sbjct  447  -QVERDLLTVYRSMLAAQPE------AAGKVLDAKHWVKQWGLQDDVDDRLRFLVMWVPN  499

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
              ++E  L + + P E +VV   +++G+L+   + AMRDTYC ME F V +++G+EG   
Sbjct  500  QEELEE-LTRALPPPEVVVVEATASVGELRAEAERAMRDTYCVMEGFRVEEMEGVEGKDW  558

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
            + V+ G  ESG  ++++G G      L++E  A  W+V C CGA+DDDGERM++CD C++
Sbjct  559  EPVLLGGAESGALVWVRGDGTDMDSVLRYEGGADTWSVGCACGAQDDDGERMVACDACDM  618

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            W HTRC GI D + VPPLF C  C
Sbjct  619  WHHTRCAGIGDGEPVPPLFFCARC  642



>emb|CDY50318.1| BnaCnng19010D [Brassica napus]
Length=625

 Score =   187 bits (474),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 119/188 (63%), Gaps = 2/188 (1%)
 Frame = +1

Query  217  VSLAAQTILDTKHFVKEWPFRDELDDLLRFIC-IVVPSSIDMETVLPKGIIPKEHIVVPL  393
            V  AAQ +LD+KHFVKEWP  D  D + RF+C I  PS ID+ T     + P E + V L
Sbjct  384  VRSAAQVVLDSKHFVKEWPLWDNDDKIFRFVCRINNPSLIDLRTEQVTELPPGELVKVSL  443

Query  394  HSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD-EVIFGIVESGTQLFMKGLGL  570
             +T+ DLK AI+   RDTYC +  F V +I  L+   DD  ++FG +ES + L ++G G+
Sbjct  444  QATVFDLKQAIEETFRDTYCILTNFEVNEIDELKEDDDDSNLLFGKLESCSALTVRGGGI  503

Query  571  AFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVC  750
                 LKF+  +  W VKC C ARDDDGERMISCDVCE+WQHTRC GI D   +PPL+VC
Sbjct  504  DLESTLKFQGGSDTWMVKCVCRARDDDGERMISCDVCEVWQHTRCCGIDDSDTLPPLYVC  563

Query  751  EVCCGRLA  774
              CC   A
Sbjct  564  SSCCDEFA  571



>gb|EMS67490.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Triticum urartu]
Length=527

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 147/260 (57%), Gaps = 18/260 (7%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +++V R  +  TRVL ++L+E     Q D E V    P  P   T    VDV  D+  +Y
Sbjct  268  NHIVRRLPSTVTRVLTFSLEEWGEPVQMDVE-VQNTRPAAPWPST----VDVERDLRAVY  322

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPS---SIDMETVL  351
              ++      + +S AAQ +LD KH+VK W   DE DD LRF+    P    + ++   L
Sbjct  323  RAMV------EALSGAAQAVLDCKHWVKCWGLGDESDDQLRFLVEWRPQPWEAAELTRPL  376

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
            P G I    +VVP+H++IG+L +  + A+RDTYC  EEF    + G+ G   D V+ G  
Sbjct  377  PSGEI----VVVPIHTSIGELIIEAERALRDTYCFFEEFQAETLDGITGEKWDPVVLGGA  432

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            ESG  + + G G      L+ E     W V+C CGARDDDGERM++CD C++W HTRCVG
Sbjct  433  ESGDTIGVHGHGADMETGLRCEGGLDMWEVRCVCGARDDDGERMVACDACDVWHHTRCVG  492

Query  712  IKDDKAVPPLFVCEVCCGRL  771
            I D  AVPPLF+C +C G L
Sbjct  493  IADSDAVPPLFLCILCGGAL  512



>ref|XP_006293073.1| hypothetical protein CARUB_v10019360mg [Capsella rubella]
 gb|EOA25971.1| hypothetical protein CARUB_v10019360mg [Capsella rubella]
Length=696

 Score =   184 bits (468),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 153/258 (59%), Gaps = 10/258 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP---ASLTAVPPVDVFGDVFCL  177
            +V R  N  TR+L++ L+ + +R   +QER    +          +  P +  + D+  L
Sbjct  432  IVQRFTNSKTRMLQFALRTINSR-VAEQERKKKRKLKPQKIRKWTSTTPGLSPYDDILYL  490

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y N+LL Y   D+ S A+Q IL+ K FVKEW ++++  + L   C V+P+  ++     +
Sbjct  491  YQNLLLTYLHPDIYSEASQVILNCKSFVKEWSYKEQ--NPLTVSCQVLPNHEEILRDFTR  548

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG--LEGVGDDEVIFGIV  531
             + P E +VVP ++TI +LK A + A+RDTYC ME F V +I+   LE + DD  +  + 
Sbjct  549  LLPPGELVVVPGNATIRELKSAAEKALRDTYCIMETFEVLEIRNRYLEKLEDDLRLESL-  607

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
               T+  +KG GL    +L++E    +WTV CKCGA DDDGERM++CDVC++W HT C  
Sbjct  608  -GKTEFLVKGFGLDICTELRYEGGFDDWTVDCKCGAMDDDGERMVACDVCKVWHHTLCYS  666

Query  712  IKDDKAVPPLFVCEVCCG  765
            I+DD+AVP +F+C  C G
Sbjct  667  IEDDEAVPSVFLCYRCSG  684



>ref|NP_178290.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
 sp|Q9ZUA9.1|Y2181_ARATH RecName: Full=PHD finger protein At2g01810 [Arabidopsis thaliana]
 gb|AAD12714.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05502.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
Length=697

 Score =   184 bits (468),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 156/257 (61%), Gaps = 8/257 (3%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPE-PDKPASLTAVPP-VDVFGDVFCLY  180
            +V R+ N  +R+L+++L+ + +R Q  + +      P + +  T+  P +  + D+  LY
Sbjct  432  IVQRSTNPKSRMLQFSLRTINSRVQEQKRKKKRKVKPQETSECTSTTPGLSPYDDILYLY  491

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKG  360
             N+LL Y +SD+ S A+Q IL  K FVKEW ++++  + L   C V+P+  ++     + 
Sbjct  492  QNLLLTYPDSDLYSEASQVILKCKSFVKEWSYQEQ--NHLTVSCQVLPNHEELLRDFTRL  549

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG--LEGVGDDEVIFGIVE  534
            + P + + VP ++TI +LK A +  +RDTYC  E F V +I+   LE + D+  +    +
Sbjct  550  LPPGDLVAVPENATIRELKSAAEKVLRDTYCITETFEVLEIRNRYLEKLDDNVSLKS--Q  607

Query  535  SGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGI  714
              T+  +KG GL    +L++E    +WTV CKCGARDDDGERM++CD C++W HT C  I
Sbjct  608  GNTEFMVKGFGLDIGTELRYEGGFDDWTVDCKCGARDDDGERMVACDACKVWHHTLCNSI  667

Query  715  KDDKAVPPLFVCEVCCG  765
            +DD+AVP +F+C +C G
Sbjct  668  EDDEAVPSVFLCNMCYG  684



>ref|XP_008777846.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Phoenix 
dactylifera]
Length=651

 Score =   184 bits (467),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/255 (40%), Positives = 149/255 (58%), Gaps = 9/255 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            VV R  N  TRVLE++L+E+ + D  D    +  E      L    P  V  D+  +Y +
Sbjct  396  VVRRVSNPKTRVLEFSLEEVPHGD--DLAAAVAEEARSDEVLVWPDPKQVERDLQVIYRS  453

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII  366
            V+ G  E      AA+T+LD KH+VK W  RD+ DD LRF  +  P   +M   L +   
Sbjct  454  VVAGRAE------AARTVLDCKHWVKAWGLRDDADDRLRFFAMWQPREEEM-GALTRPPP  506

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQ  546
            P E +VV  H+++G+L+   + A+RD+Y  +E F    ++G++G   D V+ G  ESG+ 
Sbjct  507  PPEVVVVEAHASVGELRAEAERALRDSYYVLEGFRAAAVEGIQGEEWDPVLLGGAESGSV  566

Query  547  LFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDK  726
            ++++G G      L++E  A  W+V C CGARDDDGERM++CDVC++W HTRC+GI D +
Sbjct  567  VWIRGEGADMGCKLRYEGGADTWSVGCSCGARDDDGERMVACDVCDVWHHTRCIGIADGE  626

Query  727  AVPPLFVCEVCCGRL  771
             VPP+F+C  C   L
Sbjct  627  PVPPIFLCARCGSSL  641



>ref|XP_010513908.1| PREDICTED: PHD finger protein At2g01810-like [Camelina sativa]
Length=691

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/255 (39%), Positives = 155/255 (61%), Gaps = 7/255 (3%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNR--DQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +V R  N  +R+L+++L+ + +R  +Q  +++  +   +     +  P +  + D+  LY
Sbjct  425  IVQRFNNPKSRMLQFSLRTINSRVLEQERKKKRKLKPLETSEWTSTTPGLSPYDDILYLY  484

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKG  360
             N+LL Y +SD  S A+Q IL+ K FVKEW ++++    +   C V+P   D+     + 
Sbjct  485  QNLLLAYPDSDTYSEASQVILNCKSFVKEWSYQEQNPSTV-VSCQVMPDHEDLLRDFTRL  543

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG--LEGVGDDEVIFGIVE  534
            + P E +VVP ++TI +LK A + A+RDTYC ME F V +I+   LE + DD +I G  +
Sbjct  544  LPPGELVVVPENATIRELKSAAEKALRDTYCIMETFEVLEIRNRYLEKLHDD-LILG-SQ  601

Query  535  SGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGI  714
              T+  +KG GL    +L++E    +WTV C+CGARDDDGERM++CD C++WQHT C  I
Sbjct  602  GKTEFLVKGFGLDMCTELRYEGGFDDWTVACECGARDDDGERMVACDDCKVWQHTLCNSI  661

Query  715  KDDKAVPPLFVCEVC  759
             DD+AVP  F+C  C
Sbjct  662  DDDEAVPSEFLCNRC  676



>ref|XP_010229496.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Brachypodium 
distachyon]
Length=653

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/257 (41%), Positives = 148/257 (58%), Gaps = 12/257 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            ++VV R  N  TRVL+++L+E +   Q D E V    P+     T    VD   D+  +Y
Sbjct  394  NHVVRRLPNAVTRVLQFSLEEYEEPVQMDAE-VEGTRPEAQWQST----VDAERDMRAVY  448

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKG  360
              ++      D +S AAQ +LD+KH+VK W   DE DD LRF+    P   +    L + 
Sbjct  449  RAMV------DALSEAAQAVLDSKHWVKCWGLDDESDDQLRFLVEWRPQPREAAE-LTRP  501

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
            + P E +VVPLH++IG+L +  + A+ DTYC  EEF    + G+ G   D V+ G  ESG
Sbjct  502  MPPGEIVVVPLHTSIGELLVEAEHALSDTYCFFEEFQAEALDGISGEKWDPVVLGGAESG  561

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
              + + G G      L+ +     W V C CGA+DDDGERM++CD C++W HTRCVGI D
Sbjct  562  DTIGVHGHGADMETLLRCQGGLDMWEVGCVCGAKDDDGERMVACDACDVWHHTRCVGIAD  621

Query  721  DKAVPPLFVCEVCCGRL  771
            D++VPPLF+C +C G L
Sbjct  622  DQSVPPLFLCILCGGAL  638



>emb|CDY17644.1| BnaA06g34630D [Brassica napus]
Length=656

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/261 (38%), Positives = 156/261 (60%), Gaps = 11/261 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELK--NRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +V R  N  +R+L+++L+++     D+  ++R    E D+  S T  P +D + D+  LY
Sbjct  386  IVQRFTNPESRMLQFSLRKITPPALDREAKKRRKTQETDEWRSTT--PGLDPYEDILYLY  443

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPF-RDELDDLLRFICIVVPSSIDMETVLPK  357
             N+ L Y +++V S A++ IL+ K FVKEWP    +  D L   C V+P+  ++     +
Sbjct  444  QNLFLTYPDTEVYSDASEVILNCKGFVKEWPLPSHQEQDTLTVSCQVLPNHEEVLRDFTR  503

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E ++VP ++TI +LK A + A+RDTY  ME F V +IK  +    DE   G+   
Sbjct  504  KLPPGELVMVPQNATIRELKSAAEKALRDTYFVMENFEVLEIKKKDLEKIDETT-GVKSD  562

Query  538  GTQLFMK-----GLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G ++ M      G GL    +L++E    +WTV+C+CGARDDDGERM++CD C++W HT+
Sbjct  563  GNKIMMTEFLVTGFGLDTGTELRYEGGFDDWTVECRCGARDDDGERMVACDACKVWHHTK  622

Query  703  CVGIKDDKAVPPLFVCEVCCG  765
            C  I+DD+AVP +F+C  C G
Sbjct  623  CHSIEDDEAVPKVFLCNRCFG  643



>ref|XP_009101316.1| PREDICTED: PHD finger protein At2g01810 [Brassica rapa]
Length=706

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/261 (38%), Positives = 156/261 (60%), Gaps = 11/261 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELK--NRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +V R  N  +R+L+++L+++     D+  ++R    E D+  S T  P +D + D+  LY
Sbjct  436  IVQRFTNPESRMLQFSLRKITPPALDREAKKRRKTQETDEWRSTT--PGLDPYEDILYLY  493

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPF-RDELDDLLRFICIVVPSSIDMETVLPK  357
             N+ L Y +++V S A++ IL+ K FVKEWP    +  D L   C V+P+  ++     +
Sbjct  494  QNLFLTYPDTEVYSDASEVILNCKGFVKEWPLPSHQEQDTLTVSCQVLPNHEEVLRDFTR  553

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E ++VP ++TI +LK A + A+RDTY  ME F V +IK  +    DE   G+   
Sbjct  554  KLPPGELVMVPQNATIRELKSAAEKALRDTYFVMENFEVLEIKKKDLEKIDETT-GVKSD  612

Query  538  GTQLFMK-----GLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G ++ M      G GL    +L++E    +WTV+C+CGARDDDGERM++CD C++W HT+
Sbjct  613  GNKIMMTEFLVTGFGLDTGTELRYEGGFDDWTVECRCGARDDDGERMVACDACKVWHHTK  672

Query  703  CVGIKDDKAVPPLFVCEVCCG  765
            C  I+DD+AVP +F+C  C G
Sbjct  673  CHSIEDDEAVPKVFLCNRCFG  693



>ref|XP_010554390.1| PREDICTED: PHD finger protein At2g01810 [Tarenaya hassleriana]
Length=680

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/257 (39%), Positives = 155/257 (60%), Gaps = 12/257 (5%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            VVHR  N  TR+LE++L+      +  ++R  +P  +   S  + P  DV+ DV  LY N
Sbjct  416  VVHRCTNPNTRMLEFSLRSSPGAAEEPRKRRKLPITNDRTS--SAPGRDVYKDVSFLYEN  473

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEW---PFRDELDDLLRFICIVVPSSIDMETVLPK  357
            +LL Y +SD++  A++ +++ K F KE+   P  D  ++ L   C V+P+  ++     +
Sbjct  474  LLLDYPDSDILGQASEVVMNCKSFAKEFHLLPSSDHHNNRLTVQCQVIPNHDELLADFTR  533

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG--LEGVGDDEVIFGIV  531
             +   E +V+P +ST+ +LK   + A+RDTYC ME F V +I+   LE + + EV    V
Sbjct  534  PLPQGELVVLPQNSTVRELKSETEKALRDTYCVMETFEVLEIRNRELEKIDEGEV----V  589

Query  532  ESGTQLFM-KGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
             S T++ M +G GL    +L++E    +WTV+C+CGARDDDGERM++CD C +W HT C 
Sbjct  590  GSETEVVMVRGFGLDRCTELRYEGGFDDWTVECRCGARDDDGERMVACDSCRVWHHTLCN  649

Query  709  GIKDDKAVPPLFVCEVC  759
             I+DD+AVP +F+C  C
Sbjct  650  SIEDDEAVPSVFLCSKC  666



>emb|CDY16433.1| BnaA02g12370D [Brassica napus]
Length=626

 Score =   181 bits (460),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 117/189 (62%), Gaps = 3/189 (2%)
 Frame = +1

Query  217  VSLAAQTILDTKHFVKEWPFRDELDDLLRFIC-IVVPSSIDMETVLPKGIIPKEHIVVPL  393
            V  AAQ +LD+KHFVKEWP  D  D + RF+C I  PS ID+ T     + P E + V L
Sbjct  384  VRSAAQVVLDSKHFVKEWPLWDNDDKIFRFVCRINNPSLIDLRTEQVTELPPGELVTVSL  443

Query  394  HSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLE--GVGDDEVIFGIVESGTQLFMKGLG  567
             +T+ DLK AI+   RDTYC +  F V +I  L+     D  ++FG +E  + L ++G G
Sbjct  444  QATVFDLKQAIEETFRDTYCILTNFEVNEIDELKEDDDDDSNLLFGKLEPCSALTVRGDG  503

Query  568  LAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFV  747
            +     LKF+  +  W VKC C ARDDDGERMISCDVCE+WQHTRC GI D   +PPL+V
Sbjct  504  IDLESTLKFQGGSDTWMVKCVCRARDDDGERMISCDVCEVWQHTRCCGIDDSDTLPPLYV  563

Query  748  CEVCCGRLA  774
            C  CC   A
Sbjct  564  CSSCCDEFA  572



>ref|XP_006651751.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Oryza 
brachyantha]
Length=545

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/259 (39%), Positives = 144/259 (56%), Gaps = 12/259 (5%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEP-DKPASLTAVPPVDVFGDVFCL  177
            +Y+V R  +  TRVL ++L+E +            P P D     T  PPV  +  +  +
Sbjct  289  NYIVRRVPDAETRVLHFSLEEYEES---------TPAPLDVEVECTPSPPVVRWPSILEV  339

Query  178  YSNVLLGYKES-DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLP  354
              ++   Y+   +  S AAQ++LD KH+VK W   DE DD LRF     P   +    L 
Sbjct  340  ERDLRAVYRAMVEACSEAAQSVLDCKHWVKWWGLGDESDDQLRFFVEWQPKPWEAAE-LT  398

Query  355  KGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVE  534
            + + P E +VVPLH+++G+L +  + A+RDTYC  EEF    + G+ G   D V+ G  E
Sbjct  399  RPMPPGEIVVVPLHASMGELLVESEHALRDTYCFFEEFQAEVLHGIAGEKWDPVMLGGAE  458

Query  535  SGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGI  714
            SG  + + G G      L+ +     W V+C CGARDDDGERM++CD C++W HTRCVGI
Sbjct  459  SGDTISVYGNGADMETGLRCQGGLDLWEVRCVCGARDDDGERMVACDACDVWHHTRCVGI  518

Query  715  KDDKAVPPLFVCEVCCGRL  771
             D + VPPLF+C +C G L
Sbjct  519  ADSEQVPPLFLCVLCGGAL  537



>emb|CDY36263.1| BnaC07g21170D [Brassica napus]
Length=707

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 156/261 (60%), Gaps = 11/261 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELK--NRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +V R  N  +R+L+++L+++     ++  ++R    E D+  S T  P +D + D+  LY
Sbjct  437  IVQRFTNPESRMLQFSLRKITPPALEREAKKRRKTQETDESRSTT--PGLDPYEDILYLY  494

Query  181  SNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELD-DLLRFICIVVPSSIDMETVLPK  357
             N+LL Y +++V S A++ IL+ K FVKEWP     + + L   C V+P+  ++     +
Sbjct  495  QNLLLSYHDTEVYSDASEVILNCKGFVKEWPLLSHQEKNSLTVSCQVLPNHKEVLRDFTR  554

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVES  537
             + P E ++VP ++TI +LK A + A+RDTY  ME F V +I+  +    DE   G+   
Sbjct  555  KLPPGELVMVPQNATIRELKSAAEKALRDTYFVMENFEVLEIRKKDLEKIDETS-GVKSD  613

Query  538  GTQLFMK-----GLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            G ++ M      G GL    +L++E    +WTV+C+CGARDDDGERM++CD C++W HT+
Sbjct  614  GNKIMMTEFLVTGFGLDTGTELRYEGGFDDWTVECRCGARDDDGERMVACDACKVWHHTK  673

Query  703  CVGIKDDKAVPPLFVCEVCCG  765
            C  I+DD+ VP +F+C  C G
Sbjct  674  CHSIEDDEVVPQVFLCNRCFG  694



>ref|XP_004236465.1| PREDICTED: PHD finger protein At2g01810-like [Solanum lycopersicum]
Length=735

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/253 (39%), Positives = 147/253 (58%), Gaps = 17/253 (7%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            ++ R+ N +T+ +E+  +++      D  RV   E            V++  D+  LY  
Sbjct  495  IIFRSKNPSTKRIEFAFEDI-----VDTNRVENIELH----------VNIDQDLVYLYET  539

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII  366
            VLL Y  SD VSLA   +LD+K FVKEW   D+   ++   C V+PS  ++E+ L + + 
Sbjct  540  VLLSYPGSDSVSLATGVVLDSKKFVKEWNLEDQEHQIMALTCKVLPSFDELESELTRPLS  599

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQ  546
            P   + VP   TIG+LK  IQ A+RDTYC M+ FVVT I GL+G+ DD ++   V    Q
Sbjct  600  PGVVVFVPPWITIGELKGVIQYALRDTYCIMQNFVVTQIGGLKGIEDDRMLSCAVGRDAQ  659

Query  547  LFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD--  720
            ++++G GL    + ++E  A    V C CGARDDDGERM++CD C++W H+ C GI D  
Sbjct  660  VWVRGCGLDLDTEHRYEGGAIKLKVDCICGARDDDGERMVNCDACQVWFHSMCTGIDDHE  719

Query  721  DKAVPPLFVCEVC  759
            ++ +P +F+CE C
Sbjct  720  EEVIPEIFLCESC  732



>ref|NP_001170504.1| uncharacterized protein LOC100384509 [Zea mays]
 gb|ACR33888.1| unknown [Zea mays]
Length=478

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 144/270 (53%), Gaps = 12/270 (4%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQ-----ERVLVPEPDKPASLTAVPPVDVFGD  165
            +++V R  +   RVL ++L+E    +   Q     E V +   + P ++      +   D
Sbjct  216  NHIVRRVPDPENRVLHFSLEEYAEPEPQPQADHELEPVELDAENTPPAVRWPNAAEAERD  275

Query  166  VFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMET  345
            +  +Y  ++    E      AAQ +LD KH+VK W  RDE DD LRF+    P   +  T
Sbjct  276  LRAVYRAMVGARSE------AAQAVLDCKHWVKWWGLRDESDDQLRFLVEWRPQPWEA-T  328

Query  346  VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
             L + + P + +VVPLH++IG+L +  + A+RDTYC  E F    + G+ G   D V+ G
Sbjct  329  ELTRPMPPGDIVVVPLHASIGELLVEAEHALRDTYCFFENFQAESLDGITGDKWDPVMLG  388

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
              ESG  + + G G      L+ +  A  W V+C CGA+DDDGERM++CD C +W HTRC
Sbjct  389  GAESGDTIGVHGHGADMETGLRCQGGADAWEVQCVCGAQDDDGERMVACDACNVWHHTRC  448

Query  706  VGIKDDKAVPPLFVCEVCCGRLAPTRTLGG  795
            VGI D   VPPLF+C  C G L     + G
Sbjct  449  VGIADGAPVPPLFLCISCSGALMAAGPISG  478



>ref|XP_002875094.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51353.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 154/256 (60%), Gaps = 10/256 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQ---ERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +V R  N  +R+L+++L+ + +  Q  +   +R + P+     + T  P +  + D+  L
Sbjct  434  IVQRFTNSKSRMLQFSLRTINSHVQEQERKKKRKMKPQEINEWTST-TPGLSPYDDILYL  492

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPK  357
            Y N+LL + +SD  S A+Q IL+ K F+KEW ++++  + L   C V+P+  ++     +
Sbjct  493  YQNILLTHLDSDTYSEASQIILNCKSFIKEWSYQEQ--NPLTVSCQVLPNHEELLRDFTR  550

Query  358  GIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG--LEGVGDDEVIFGIV  531
             + P E +VVP ++TI +LK A + A+RDTY   E F V +I+   LE + D+  +    
Sbjct  551  LLPPGELVVVPENATIKELKFAAEKALRDTYFITETFEVLEIRNRYLEKLDDNLALKS--  608

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
            +  T+  +KG GL    +L++E    +WTV CKCGARDDDGERM++CD C++W HT C  
Sbjct  609  QRITEFLVKGFGLDIGTELRYEGGFDDWTVDCKCGARDDDGERMVACDACKVWHHTLCNS  668

Query  712  IKDDKAVPPLFVCEVC  759
            I+DD+AVP +F+C  C
Sbjct  669  IEDDEAVPSVFLCNRC  684



>gb|KFK41037.1| hypothetical protein AALP_AA2G077200 [Arabis alpina]
Length=675

 Score =   179 bits (454),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 138/265 (52%), Gaps = 52/265 (20%)
 Frame = +1

Query  16   RAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVP---------PVDVFGDV  168
            R V+  TR+L YT+QEL      D E  L+ EP K   L AVP           DV GD+
Sbjct  406  RYVDPLTRILHYTIQEL------DDELKLI-EPMKETVLEAVPLRIVAESKPGADVHGDL  458

Query  169  FCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
              LY+NVLL Y ES+    A Q ILD +  V E P                         
Sbjct  459  LVLYTNVLLDYPESESARSATQAILDKQ--VTELP-------------------------  491

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGV---GDDEVI  519
                  P E + V + +T+ DLK AI+   RDTYC +  F V +I  L      GD +++
Sbjct  492  ------PGEIVTVSVQATVFDLKQAIEETFRDTYCILTNFEVNEIDELREDMEDGDRKLV  545

Query  520  FGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHT  699
            FG +ESG  + ++G+G+     LKF+     W VKC C ARDDDGERM++CDVCE+WQHT
Sbjct  546  FGRIESGCAITVRGIGIELESKLKFQGGCDTWMVKCVCRARDDDGERMVACDVCEVWQHT  605

Query  700  RCVGIKDDKAVPPLFVCEVCCGRLA  774
            RC GI+D   +PPLFVC  CC   A
Sbjct  606  RCCGIEDSDTLPPLFVCSNCCDEFA  630



>ref|XP_006851141.1| hypothetical protein AMTR_s00043p00045130 [Amborella trichopoda]
 gb|ERN12722.1| hypothetical protein AMTR_s00043p00045130 [Amborella trichopoda]
Length=361

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 150/271 (55%), Gaps = 16/271 (6%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNR-DQTDQERVLVPEP----DKPASLTAVPPVDVFGDV  168
            +++ R VN  T+VLEY+L  +    D  D E   +       D+  +   V   +V  D+
Sbjct  83   HLIRRTVNPKTKVLEYSLSLVSTELDYCDGEAATITRKSESGDRRQNQIQVGRSEVERDL  142

Query  169  FCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETV  348
              +Y  VL G     VV  A   +LDTKH  K WP RD+   L   + +V+  S +   +
Sbjct  143  EYVYKRVLKGGLGGMVVEAARHVVLDTKHLAKVWPIRDDDGKLWFMVSMVL--SEEEAGM  200

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDI---KGLEGVGDDEVI  519
                  P E +V+PLH+++GDL+   +  +R+TYC ME FV  D+    GLE V + E++
Sbjct  201  FSYVTTPPELVVIPLHASVGDLRAVAERTLRNTYCVMEGFVAQDLIWPHGLE-VSEMELL  259

Query  520  FGIVESGTQLFM----KGLGLAFAGD-LKFEDRAHNWTVKCKCGARDDDGERMISCDVCE  684
            F + +SG  + M    +G G     + L++E  A  W V+C+CGARDDDGERM++CD+CE
Sbjct  260  FRVAQSGMGMGMGVWVRGKGAERGAESLRYEGGAEEWRVECECGARDDDGERMVACDLCE  319

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVCCGRLAP  777
            +WQ+TRC+GI D + V  LF C+ C   L P
Sbjct  320  VWQYTRCLGIPDAEEVAHLFFCDRCGSALLP  350



>ref|XP_008644163.1| PREDICTED: uncharacterized protein LOC100384509 isoform X1 [Zea 
mays]
 gb|AFW67807.1| hypothetical protein ZEAMMB73_623721 [Zea mays]
 gb|AIB04710.1| PHD transcription factor, partial [Zea mays]
Length=689

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 144/270 (53%), Gaps = 12/270 (4%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQ-----ERVLVPEPDKPASLTAVPPVDVFGD  165
            +++V R  +   RVL ++L+E    +   Q     E V +   + P ++      +   D
Sbjct  427  NHIVRRVPDPENRVLHFSLEEYAEPEPQPQADHELEPVELDAENTPPAVRWPNAAEAERD  486

Query  166  VFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMET  345
            +  +Y  ++    E      AAQ +LD KH+VK W  RDE DD LRF+    P   +  T
Sbjct  487  LRAVYRAMVGARSE------AAQAVLDCKHWVKWWGLRDESDDQLRFLVEWRPQPWEA-T  539

Query  346  VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
             L + + P + +VVPLH++IG+L +  + A+RDTYC  E F    + G+ G   D V+ G
Sbjct  540  ELTRPMPPGDIVVVPLHASIGELLVEAEHALRDTYCFFENFQAESLDGITGDKWDPVMLG  599

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
              ESG  + + G G      L+ +  A  W V+C CGA+DDDGERM++CD C +W HTRC
Sbjct  600  GAESGDTIGVHGHGADMETGLRCQGGADAWEVQCVCGAQDDDGERMVACDACNVWHHTRC  659

Query  706  VGIKDDKAVPPLFVCEVCCGRLAPTRTLGG  795
            VGI D   VPPLF+C  C G L     + G
Sbjct  660  VGIADGAPVPPLFLCISCSGALMAAGPISG  689



>emb|CDP05546.1| unnamed protein product [Coffea canephora]
Length=683

 Score =   177 bits (448),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 131/200 (66%), Gaps = 1/200 (1%)
 Frame = +1

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRD-ELDDLLRFICIVVPSSIDM  339
            D   LY +VL GY+++  +SLA + I+D+K+FVKEW F++  LD L+   C+ +PS  ++
Sbjct  477  DALYLYRSVLFGYRDTHPLSLATKAIMDSKYFVKEWCFKEHNLDPLIALSCLFLPSFDEL  536

Query  340  ETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVI  519
            ET L + + P   + VPL STIG+LK+  QAA RDTYC M++FV + I GL+ + +++V+
Sbjct  537  ETELMRPLSPAVVVAVPLSSTIGELKVVAQAAFRDTYCIMDKFVASQIGGLKKIDENKVV  596

Query  520  FGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHT  699
               +E  + ++++G GL     L++ED A   TV C CGA+ DDGER+ +C+VC + QHT
Sbjct  597  CHSIEPSSPVWVRGSGLDLGTTLRYEDGAQRLTVDCCCGAKYDDGERLATCEVCNVSQHT  656

Query  700  RCVGIKDDKAVPPLFVCEVC  759
            RC GI + +     F+C  C
Sbjct  657  RCSGIAEKEGALSDFLCSDC  676



>ref|XP_010916807.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Elaeis guineensis]
Length=649

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/256 (39%), Positives = 150/256 (59%), Gaps = 11/256 (4%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVP-PVDVFGDVFCLYS  183
            VV R  N  TRVLE++L+E  + D       +V E  +   + A P P  V  D+  +Y 
Sbjct  394  VVRRVSNPKTRVLEFSLEEPTHGDNLA---AVVAEEARSDEVWAWPSPKHVEEDMQGVYR  450

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGI  363
            +V+ G  E       A ++LD K +VK W   D+ DD LRF+ + +P   +M   L + +
Sbjct  451  SVVAGRAE------VAGSVLDCKRWVKAWGLGDDADDRLRFLAMWLPREEEM-GALTRPL  503

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
             P E +VV  H+++G+L++  + A+RD+Y  +E F    ++G+EG   D V+ G VESG+
Sbjct  504  PPPEVVVVEAHASVGELRVEAERALRDSYYVLEGFRAAAVEGIEGQERDPVLLGGVESGS  563

Query  544  QLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
             ++++G G      L++E     W V C CGARDDDGERM++CDVC++W HTRC+GI D 
Sbjct  564  VVWIRGEGADMGCKLRYEGGPDTWAVGCSCGARDDDGERMVACDVCDVWHHTRCIGIADG  623

Query  724  KAVPPLFVCEVCCGRL  771
            + VPP+F+C  C   L
Sbjct  624  EPVPPIFLCARCGSSL  639



>ref|XP_002463991.1| hypothetical protein SORBIDRAFT_01g010120 [Sorghum bicolor]
 gb|EER90989.1| hypothetical protein SORBIDRAFT_01g010120 [Sorghum bicolor]
Length=697

 Score =   176 bits (445),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/276 (37%), Positives = 146/276 (53%), Gaps = 24/276 (9%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDV---FGDVF  171
            +++V R  +   RVL ++L+E  +           PEP +P +   + PV++        
Sbjct  435  NHIVRRVPDPENRVLHFSLEEYAD-----------PEP-QPQADHELEPVEIDAEHSPPA  482

Query  172  CLYSNVLLGYKESDVV--------SLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPS  327
              + N     ++   V        S AAQ +LD KH+VK W  RDE DD LRF+    P 
Sbjct  483  VRWPNTAEAERDLRAVCRAMVEARSEAAQAVLDCKHWVKWWGLRDESDDQLRFLVEWRPQ  542

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
              +  T L K + P + +VVPLH++IG+L +  + A+RDTYC  E+F    + G+ G   
Sbjct  543  PWEA-TELTKPMPPGDIVVVPLHTSIGELLVEAEHALRDTYCFFEDFQAESLDGIAGDKW  601

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
            D V+ G  ESG  + + G G      L+ +  A  W V+C CGA+DDDGERM++CD C +
Sbjct  602  DPVMLGGAESGDTIGVHGHGADMETGLRCQGGADAWEVQCVCGAQDDDGERMVACDACNV  661

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLGG  795
            W HTRCVGI D   VPPLF+C  C G L     + G
Sbjct  662  WHHTRCVGIADGAPVPPLFLCISCSGALMAAGPISG  697



>dbj|BAK03548.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=683

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 153/261 (59%), Gaps = 20/261 (8%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQE-RVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            ++VV R  N ATRVLE++L+EL+   Q D E +   P    P++      VDV  D+  +
Sbjct  424  NHVVRRLHNTATRVLEFSLEELEEPVQMDVEVQNTRPAAQWPSA------VDVERDLRAV  477

Query  178  YSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPS---SIDMETV  348
            Y  ++      + +S AAQ +LD KH+VK W   DE DD LRF+    P    + ++   
Sbjct  478  YRAMV------EALSDAAQAVLDCKHWVKCWGLGDESDDQLRFLVEWRPQPWEAAELTRP  531

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGI  528
            LP G I    IVVP+H++IG+L +  + A+RDTYC  EEF    + G+ G   D V+ G 
Sbjct  532  LPSGEI----IVVPVHTSIGELIIQAEHALRDTYCFFEEFQAETLDGITGEKWDPVVLGG  587

Query  529  VESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCV  708
             ESG  + + G G      L+ +     W V+C CGA+DDDGERM++CD C++W HTRCV
Sbjct  588  AESGDTIGVHGHGADMETGLRCQGGLDTWEVRCVCGAQDDDGERMVACDACDVWHHTRCV  647

Query  709  GIKDDKAVPPLFVCEVCCGRL  771
            GI D +AVPPLF+C +C G L
Sbjct  648  GIADSEAVPPLFLCILCGGAL  668



>ref|XP_009620363.1| PREDICTED: PHD finger protein At2g01810-like [Nicotiana tomentosiformis]
Length=736

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 143/251 (57%), Gaps = 15/251 (6%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            ++ R+ N +T+ +E+  +++      D  RV   E D           ++  D+  LY  
Sbjct  498  IIFRSKNPSTKRIEFAFEDI-----VDASRVDNIELD----------FNIDQDLEYLYET  542

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII  366
            VLL Y  SD VSLA + +LD+K FVK+W   ++   ++   C V+PS  ++E+ L + + 
Sbjct  543  VLLSYPGSDSVSLATRVVLDSKKFVKKWKLENQESQIMALTCKVLPSFDELESELTRPLS  602

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQ  546
            P   + VP   TI +LK   Q A+RDTYC M+ FVVT I GL+G+ D  ++   V     
Sbjct  603  PGVVVFVPPWITIRELKGVAQFALRDTYCIMQNFVVTQIGGLKGIEDKRMLSCAVGRDAH  662

Query  547  LFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDK  726
            ++++G GL    +L++E       V C CGARDDDGERM++CD C++W HT C GI D +
Sbjct  663  VWVRGRGLDLDTELRYEGGPIKLKVDCICGARDDDGERMVNCDACQVWFHTVCTGIDDHE  722

Query  727  AVPPLFVCEVC  759
             VP +F+CE C
Sbjct  723  EVPAIFLCESC  733



>ref|XP_009770533.1| PREDICTED: PHD finger protein At2g01810-like [Nicotiana sylvestris]
Length=738

 Score =   174 bits (441),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 143/251 (57%), Gaps = 15/251 (6%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            ++ R+ N +T+ +E+  +++      D  RV   E D           ++  D+  LY  
Sbjct  498  IIFRSKNPSTKRIEFAFEDI-----VDASRVDNIELD----------FNIDQDLEYLYET  542

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII  366
            VLL Y  SD VSLA + +LD+K FVK+W   ++   ++   C V+PS  ++E+ L + + 
Sbjct  543  VLLSYPGSDSVSLATRVVLDSKKFVKKWKLENQESQIMALTCKVLPSFDELESELTRPLS  602

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQ  546
            P   + VP   TI +LK   Q A+RDTYC M+ FVVT I GL+G+ D  ++   V     
Sbjct  603  PGVVVYVPPWITIRELKGVAQFALRDTYCIMQNFVVTQIGGLKGIEDKRMLSCAVGRDAH  662

Query  547  LFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDK  726
            ++++G GL    +L++E       V C CGARDDDGERM++CD C++W HT C GI D +
Sbjct  663  VWVRGRGLDLDTELRYEGGPIKLKVDCICGARDDDGERMVNCDACQVWFHTMCSGIDDHE  722

Query  727  AVPPLFVCEVC  759
             VP +F+CE C
Sbjct  723  EVPAVFLCESC  733



>ref|XP_001780078.1| predicted protein [Physcomitrella patens]
 gb|EDQ55087.1| predicted protein [Physcomitrella patens]
Length=663

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/288 (39%), Positives = 152/288 (53%), Gaps = 36/288 (13%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQT--DQERVLVPEPDKPASLTAVPPVDVFGDVFC  174
            +++V RAVN  T+VLEY+L++         DQ R   PE     +   V    V  D+  
Sbjct  386  NHIVRRAVNPITKVLEYSLEDAITAAGVVRDQSRCQAPE-----TACEVGRTQVLKDIVY  440

Query  175  LYSNVLLGYKES---------DVVSLAAQTILDTKHFVKEWPFRDEL-------------  288
            +Y NVL  YK +           +  AA+ ILDTK F+K+  +R EL             
Sbjct  441  IYKNVLENYKPARTSGIKHMLTAIPTAARIILDTKQFIKD--YRGELTRKSANNDWNMDD  498

Query  289  DDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEF  468
            D+LLR +C VV +  D     P         V+P H+T+ DLKL  Q A R+TY  M  F
Sbjct  499  DELLRVMCTVVLNDDDPMRNRPSPPPELV--VLPPHATVRDLKLEAQRAFRETYYIMHSF  556

Query  469  VVTDIKGLEGVGDDE-VIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARD  645
             V  I  L  VGDDE ++FG +ESG+ + + G+G+    D ++E    +WTV C CG +D
Sbjct  557  CVESIPDL--VGDDEDLLFGAIESGSHVRIDGIGIHTRHDWRYEGGIESWTVDCPCGTKD  614

Query  646  DDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            DDGERMI+CDVCE+WQHTRC GI D   +P  F+C  C   L    T+
Sbjct  615  DDGERMIACDVCEVWQHTRCGGISDMDVIPQRFLCHRCSVNLNFYHTM  662



>gb|EAZ28373.1| hypothetical protein OsJ_12353 [Oryza sativa Japonica Group]
Length=639

 Score =   170 bits (430),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 146/266 (55%), Gaps = 26/266 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEP---DKPASLTAVPPVDVFGDVF  171
            +Y+V R  +  TRVL ++L+E +            P P   D     T +PPV  +    
Sbjct  383  NYIVRRVPDAETRVLHFSLEEYEE-----------PTPALLDVEVECTPLPPVVRWPSTV  431

Query  172  CLYSNVLLGYKES-DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDM-ET  345
             +  ++   Y+   +V S AAQ +LD KH+VK W   DE DD LRF     P   +  E 
Sbjct  432  EVERDLRAVYRAMVEVRSEAAQAVLDCKHWVKWWGLGDESDDQLRFFVEWQPQPWEAAEL  491

Query  346  VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
            + P  +   E +VVPLH+++G+L +  + A+RDTY   EEF    + G+ G   D V+ G
Sbjct  492  IRPMPL--GEIVVVPLHASMGELLVESEHALRDTYYFFEEFQAEGLHGIAGEKWDPVMLG  549

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHN----WTVKCKCGARDDDGERMISCDVCEIWQ  693
              E+G  + + G G     D++ E R H     W V+C CGA+DDDGERMI+CD C++W 
Sbjct  550  GAENGDTISVYGNG----ADMETELRCHGGLDLWEVRCVCGAQDDDGERMIACDACDVWH  605

Query  694  HTRCVGIKDDKAVPPLFVCEVCCGRL  771
            HTRCVGI D + VPPLF+C +C G L
Sbjct  606  HTRCVGIADSEPVPPLFLCVLCGGAL  631



>gb|AAL58226.1|AC090882_29 putative collagen [Oryza sativa Japonica Group]
 gb|ABF98555.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 gb|EAY91653.1| hypothetical protein OsI_13292 [Oryza sativa Indica Group]
Length=697

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 146/266 (55%), Gaps = 26/266 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEP---DKPASLTAVPPVDVFGDVF  171
            +Y+V R  +  TRVL ++L+E +            P P   D     T +PPV  +    
Sbjct  441  NYIVRRVPDAETRVLHFSLEEYEE-----------PTPALLDVEVECTPLPPVVRWPSTV  489

Query  172  CLYSNVLLGYKES-DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDM-ET  345
             +  ++   Y+   +V S AAQ +LD KH+VK W   DE DD LRF     P   +  E 
Sbjct  490  EVERDLRAVYRAMVEVRSEAAQAVLDCKHWVKWWGLGDESDDQLRFFVEWQPQPWEAAEL  549

Query  346  VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
            + P  +   E +VVPLH+++G+L +  + A+RDTY   EEF    + G+ G   D V+ G
Sbjct  550  IRPMPL--GEIVVVPLHASMGELLVESEHALRDTYYFFEEFQAEGLHGIAGEKWDPVMLG  607

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHN----WTVKCKCGARDDDGERMISCDVCEIWQ  693
              E+G  + + G G     D++ E R H     W V+C CGA+DDDGERMI+CD C++W 
Sbjct  608  GAENGDTISVYGNG----ADMETELRCHGGLDLWEVRCVCGAQDDDGERMIACDACDVWH  663

Query  694  HTRCVGIKDDKAVPPLFVCEVCCGRL  771
            HTRCVGI D + VPPLF+C +C G L
Sbjct  664  HTRCVGIADSEPVPPLFLCVLCGGAL  689



>ref|XP_001781922.1| predicted protein [Physcomitrella patens]
 gb|EDQ53287.1| predicted protein [Physcomitrella patens]
Length=663

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/288 (39%), Positives = 156/288 (54%), Gaps = 36/288 (13%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQT--DQERVLVPEPDKPASLTAVPPVDVFGDVFC  174
            +++V RAVN  T+VLEY+L++         DQ R   PE     +   +   +V  D+  
Sbjct  386  NHIVRRAVNPITKVLEYSLEDAATAAGAVRDQSRCQAPE-----TTCEIGRTEVLKDIVY  440

Query  175  LYSNVLLGYKES---------DVVSLAAQTILDTKHFVKEWPFRDEL-------------  288
            +Y NVL  YK +           +  A + ILDTK F+K+  +R EL             
Sbjct  441  IYKNVLENYKPARTSGIKHMLTAIPTATRIILDTKQFIKD--YRGELTRKSANNDWNMDD  498

Query  289  DDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEF  468
            D+LLR +C VV +  D + V  +   P E +V+P H+T+ DLKL  Q A R+TY  M  F
Sbjct  499  DELLRVMCTVVLN--DEDPVRNRPSPPPELVVLPPHATVRDLKLEAQRAFRETYFIMHSF  556

Query  469  VVTDIKGLEGVGDDE-VIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARD  645
             V  I  L  V DDE ++FG +ESG+ + ++G G+    D ++E    +WTV C CG +D
Sbjct  557  CVESIPDL--VCDDEDLLFGTIESGSHVRVEGSGIHTCHDWRYEGGMESWTVDCPCGTKD  614

Query  646  DDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            DDGERMI+CDVCE+WQHTRC GI D   +P  F+C  C   L    T+
Sbjct  615  DDGERMIACDVCEVWQHTRCGGISDMDVIPQRFLCHRCSINLTFYHTM  662



>ref|XP_004986276.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Setaria 
italica]
Length=710

 Score =   162 bits (409),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 110/184 (60%), Gaps = 1/184 (1%)
 Frame = +1

Query  220  SLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHS  399
            S AAQ +LD KH+VK W   DE DD LRF+    P   +    L + + P + +VVPLH+
Sbjct  511  SEAAQAVLDCKHWVKWWGLGDESDDQLRFLVEWRPRPWEANE-LTRPMPPGDIVVVPLHA  569

Query  400  TIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFA  579
            +IG+L +  + A+RDTYC  + F    + G+ G   D V+ G  ESG  + + G G+   
Sbjct  570  SIGELLVEAEHALRDTYCFFDGFKAESLDGIAGEKWDPVMLGGAESGDTISVHGHGVDME  629

Query  580  GDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
              L+ +     W V+C CGA+DDDGERM++CD C +W HTRCVGI D   VPPLF+C  C
Sbjct  630  TGLRCQGGVDAWEVQCVCGAQDDDGERMVACDACNVWHHTRCVGIADGVPVPPLFLCMSC  689

Query  760  CGRL  771
             G L
Sbjct  690  GGAL  693



>ref|XP_002281717.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Vitis vinifera]
 emb|CBI26773.3| unnamed protein product [Vitis vinifera]
Length=646

 Score =   159 bits (401),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/266 (35%), Positives = 151/266 (57%), Gaps = 18/266 (7%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++     +D+   L     K  +   +  + +  D+F LY
Sbjct  375  NYLVRRSLNPVTKVLEYCLEDISTVFPSDEG--LAMNDSKLKARYKITRIQLMKDMFYLY  432

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVKEW--PFRDELDDLLRFICIVVPSSID  336
             N+L   K++        + +AA+ ILDTK+ +KE+      E+   L+  C VV  + D
Sbjct  433  KNILKEQKQTVATGIFSTIPVAARVILDTKYLIKEYCGGQPSEVKVGLKLYCTVVSRNND  492

Query  337  MET-VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
             +   + K + P E I+   +ST+ +LKL ++   R+ Y  +  F V  I  L   G D 
Sbjct  493  EDDDGIEKALPPFECIIFKDNSTVNELKLEVERNFREIYWGLRSFCVESIVNLNAKGSD-  551

Query  514  VIFGIVESGTQLFMKG----LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVC  681
            ++FG+VE+G++L  +G    +G+   G   +E   +N TV C CGA+DDDGERMISCD+C
Sbjct  552  LVFGLVEAGSELLFEGNDSKVGINNEG--IYESGHNNCTVDCPCGAKDDDGERMISCDIC  609

Query  682  EIWQHTRCVGIKDDKAVPPLFVCEVC  759
            E+WQHTRC  I +++ +P +F+C  C
Sbjct  610  EVWQHTRCAQIPNNEEIPHIFLCNQC  635



>ref|XP_003518728.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Glycine 
max]
 gb|KHN12208.1| PHD finger protein MALE STERILITY 1 [Glycine soja]
Length=656

 Score =   155 bits (393),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/274 (33%), Positives = 154/274 (56%), Gaps = 27/274 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++ N    D E +++   +K      +    +  D+  LY
Sbjct  378  NYLVRRSLNPVTKVLEYCLEDISNVHPYDNEGLVMS--NKVKDKYKITRAQLMKDMLYLY  435

Query  181  SNVL------LGYKESDVVSLAAQTILDTKHFVKEW----PFRDEL--DDLLRFIC-IVV  321
              +L      +G +    + LAA+ ILDTK+F+K++    P++ EL  +D L   C I +
Sbjct  436  KYILIDPKPMMGSEFLSAIPLAARIILDTKYFIKDYFGDIPYQVELGSNDKLNLYCTIWL  495

Query  322  PSSIDMETVLPKGIIP-KEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG  498
             +++  +  L K I+P  E   +  ++TI DLKL ++   R+ Y  +  FVV   + L  
Sbjct  496  RNNVGSDEYLNKAIMPPHECFTLKRNATINDLKLEVERNFREIYWGLRSFVVESFRNLSV  555

Query  499  VGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF-------EDRAHNWTVKCKCGARDDDGE  657
              + E++FG++E G ++ ++G    + GD+         E   +N  + C CG  +DDGE
Sbjct  556  NNETEMVFGLIEVGGKVVLEG----WQGDIGINMIEQICESDPNNGIMDCTCGTIEDDGE  611

Query  658  RMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            RM+SCD+CEIWQH+RCV I +D+ +P +F+C+ C
Sbjct  612  RMVSCDICEIWQHSRCVRIPNDEEIPHIFLCKKC  645



>ref|XP_006851143.1| hypothetical protein AMTR_s00043p00048200 [Amborella trichopoda]
 gb|ERN12724.1| hypothetical protein AMTR_s00043p00048200 [Amborella trichopoda]
Length=301

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 128/231 (55%), Gaps = 7/231 (3%)
 Frame = +1

Query  115  DKPASLTAVPPVDVFGDVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDD  294
            D P +   V   +   D+  +Y  V  G    +VV  A + +LDTKH  KEWP RD+ D 
Sbjct  67   DHPQNQIQVGRSEFERDLEYVYRRVREGGLGGEVVEAARRMVLDTKHLAKEWPIRDD-DG  125

Query  295  LLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVV  474
             LRF+  VV +  +   +      P E +V+PLH+++GDL+   +  + DTYC ME FV 
Sbjct  126  KLRFMVSVVVAE-EEAGIFSCATPPPELVVLPLHASVGDLRAKPERILCDTYCVMEGFVA  184

Query  475  TDIKGLEG--VGDDEVIFGIVESGTQL--FMKGLGLAF-AGDLKFEDRAHNWTVKCKCGA  639
             D+   +G  V + E++F + + G  +  +++G    + A  L++E  A    V+C CG 
Sbjct  185  QDLIWAQGLKVSEMELLFHMAQLGMGMGVWVRGKQAEWGAACLRYEGGAEERRVECTCGE  244

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLG  792
            RDDDGERM++CD+CE+WQHT C+GI D + V  L  C+ C   L P   L 
Sbjct  245  RDDDGERMVACDLCEVWQHTWCLGIPDVEEVAHLLFCDRCASALLPPDMLA  295



>ref|XP_004490060.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Cicer arietinum]
Length=664

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 151/277 (55%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++ N      E +++   +K      +    +  D+ CLY
Sbjct  378  NYLVRRSLNPVTKVLEYCLEDISNVYPC-HEGLILSNSNKVKDKYKITRGQLMKDMICLY  436

Query  181  SNVLL------GYKESDVVSLAAQTILDTKHFVKEW----PFRDELDDLLRF--ICIVVP  324
              +L+      G +    + LAA+ ILDTK+ +K++    P + EL    +F   C ++ 
Sbjct  437  KYILIDTKPIIGSEFLSAIPLAARIILDTKYLIKDYGEIIPLQVELGSQGKFNLYCTILL  496

Query  325  SSI-----DMETVLPKGI--IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDI  483
             ++     D +  L K +  +P E I +   +TI DLKL ++   R+ Y  +  FVV   
Sbjct  497  RNVNNVENDHDYYLNKSLPMLPYECIALKNCATINDLKLEVERNFREIYWGLRNFVVESS  556

Query  484  KGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF-----EDRAHNWTVKCKCGARDD  648
              L  V  +E++FG++E G +L ++G   +  G  K      E   +   V+C CG ++D
Sbjct  557  GNLMNVKGNEMVFGMIEVGGKLVVEGWHGSDIGINKMVEQICERDPNKGIVECTCGTKED  616

Query  649  DGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            DGERM+SCD+CEIWQHTRCV I +D+ VP +F+C+ C
Sbjct  617  DGERMVSCDICEIWQHTRCVRIPNDEQVPHIFLCKRC  653



>ref|XP_002964302.1| hypothetical protein SELMODRAFT_31177, partial [Selaginella moellendorffii]
 gb|EFJ34635.1| hypothetical protein SELMODRAFT_31177, partial [Selaginella moellendorffii]
Length=648

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 139/274 (51%), Gaps = 27/274 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
             +VV RAVN  T+VLEY+L+     D T  +   V      A+   +   DV  D+  +Y
Sbjct  375  GHVVRRAVNPITKVLEYSLE-----DVTAVKGGEVAAAVAAAAACDISRSDVQRDIVYMY  429

Query  181  SNVLLGYKESD----------VVSLAAQTILDTKHFVKEW-------PFRDELDDLLRFI  309
             NVL  YK +            +  A++ ILDTK  ++++                    
Sbjct  430  KNVLESYKPASKRGGGKSILTALPTASRIILDTKQLIRDYCGHKTRKAAAAAAAASAAAG  489

Query  310  CIVVPSSIDMETVLPKG----IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVT  477
                 +S    T +  G      P E +V+P H+TIGDLKL  Q   RDTY  M  F V 
Sbjct  490  LAGGSTSRGGSTTIAGGGGNEAPPPELVVLPPHATIGDLKLEAQRGFRDTYHIMRGFRVD  549

Query  478  DIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGE  657
             I  LEG  +D ++FG +ESG+ L ++G G+    + ++E    +W V C CGA+DDDGE
Sbjct  550  TIPELEGDNED-LLFGAIESGSTLIVQGSGVDVYNEWRYEGGNDSWIVDCPCGAKDDDGE  608

Query  658  RMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            RMI+CDVCE+WQHTRC GI D   +P  F+C  C
Sbjct  609  RMIACDVCEVWQHTRCGGIADPDPIPARFLCARC  642



>ref|XP_003613773.1| Histone-lysine N-methyltransferase MLL5 [Medicago truncatula]
 gb|AES96731.1| PHD finger protein MALE sterility-like protein [Medicago truncatula]
Length=666

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/277 (33%), Positives = 147/277 (53%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEP-DKPASLTAVPPVDVFGDVFCL  177
            +Y+V R++N  T+VLEY L+++ N     +  V+     +K      +    +  D+ CL
Sbjct  380  NYLVRRSLNPVTKVLEYCLEDISNVYPCHEGLVMSSSSSNKVKDKYKITRGQLMKDMICL  439

Query  178  YSNVLL------GYKESDVVSLAAQTILDTKHFVKEW---PFRDEL--DDLLRFICIVVP  324
            Y  +L+      G +    + LAA+ ILDTKH +K++   P + EL   +     C ++ 
Sbjct  440  YKYILIDTKPIIGSEFLSAIPLAARIILDTKHLIKDYGEVPLQVELGSKEKCNLYCTILL  499

Query  325  SSID-----METVLPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDI  483
             +++      E  L K I   P E I +   +TI DLKL ++   R+ Y  +  FVV   
Sbjct  500  RNVNNVGHNHEYYLNKDIPMPPYECITLKSCATINDLKLEVERNFREIYWGLRSFVVQPN  559

Query  484  KGLEGVGDDEVIFGIVESGTQLFMKG-----LGLAFAGDLKFEDRAHNWTVKCKCGARDD  648
              L     +E++FG++E G +L ++G     +G+    D   E       V+C CG +++
Sbjct  560  GNLMNAKGNEMVFGMIEVGGKLVLEGWHGDEMGINMV-DQICERDPKKGIVECICGTKEN  618

Query  649  DGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            DGERM+SCD+CEIWQHTRCV I +D+ VP +F+C+ C
Sbjct  619  DGERMVSCDICEIWQHTRCVRIPNDEEVPHIFLCKRC  655



>ref|XP_002967734.1| hypothetical protein SELMODRAFT_31178, partial [Selaginella moellendorffii]
 gb|EFJ31081.1| hypothetical protein SELMODRAFT_31178, partial [Selaginella moellendorffii]
Length=648

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 140/274 (51%), Gaps = 27/274 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
             +VV RAVN  T+VLEY+L+     D T  +   V      A++  +   DV  D+  +Y
Sbjct  375  GHVVRRAVNPITKVLEYSLE-----DVTAVKGGEVAAAVAAAAVCDISRGDVQRDIVYMY  429

Query  181  SNVLLGYKESD----------VVSLAAQTILDTKHFVKEW-------PFRDELDDLLRFI  309
             NVL  YK +            +  A++ ILDTK  ++++                    
Sbjct  430  KNVLESYKPASKRGGGKSILTALPTASRIILDTKQLIRDYCGHKTRKAAAAAAAASAAAG  489

Query  310  CIVVPSSIDMETVLPKG----IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVT  477
                 SS    T +  G      P E +V+P H+TIGDLKL  Q   RDTY  M  F V 
Sbjct  490  LAGGSSSRGGSTTIAAGGANEAPPPELVVLPPHATIGDLKLEAQRGFRDTYHIMRGFRVD  549

Query  478  DIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGE  657
             I  LEG  +D ++FG +ESG+ L ++G G+    + ++E    +W V C CGA+DDDGE
Sbjct  550  TIPELEGDNED-LLFGAIESGSTLIVQGSGVDVYNEWRYEGGNDSWIVDCPCGAKDDDGE  608

Query  658  RMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            RMI+CDVCE+WQHTRC GI D   +P  F+C  C
Sbjct  609  RMIACDVCEVWQHTRCGGIADPDPIPARFLCARC  642



>ref|XP_009414350.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   139 bits (351),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/276 (32%), Positives = 140/276 (51%), Gaps = 20/276 (7%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +YVV R VN  T+VLEY L+++ N   T  + +      K      +    +  D+F LY
Sbjct  194  NYVVRRTVNPITKVLEYCLEDISNV-FTGHDNLASGNHSKSRIRLQLTRTQLMRDMFYLY  252

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVKEW-----PFRDE-LDDLLRFICIVVP  324
             N+L     +      D + +A + ++DTK  VKE+     P + E     L+  C +  
Sbjct  253  KNILKEPSSAAATGMLDAIPVAVRMVMDTKQLVKEYQQGPPPEKAEGSHGYLKLSCSIRM  312

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
            +  D+E        P E ++VP H+TIG+LK  +    R  Y  ++ FV   I G+    
Sbjct  313  NGADVERT-----PPHETVIVPAHATIGELKREVGRHFRAVYWGLKSFVADSIVGVR-CR  366

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKFED-RAHNWTVKCKCGARDDDGERMISCDVC  681
            D +++  +++SG+ + ++G      G+  +E     N  V C CG +++DGE MI CD+C
Sbjct  367  DSDLVHELMQSGSSIVVEGRMEGDDGEEIYEGGNGGNKIVDCLCGGKEEDGEPMIFCDIC  426

Query  682  EIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            E+WQHTRCVGI D   +PP+F+C  C   +   R L
Sbjct  427  EVWQHTRCVGIPDKDDIPPVFLCGRCENDMLALRNL  462



>emb|CAN78037.1| hypothetical protein VITISV_041469 [Vitis vinifera]
Length=705

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 140/249 (56%), Gaps = 22/249 (9%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++     +D+   L     K  +   +  + +  D+F LY
Sbjct  375  NYLVRRSLNPVTKVLEYCLEDISTVFPSDEG--LXMNDSKLKARYKITRIQLMKDMFYLY  432

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVKEW----PFRDELDDLLRFICIVVPSS  330
             N+L   K++        + +AA+ ILDTK+ +KE+    P   E+   L+  C VV  +
Sbjct  433  KNILKEQKQTVATGIFSTIPVAARVILDTKYLIKEYCGGQP--SEVKVGLKLYCTVVSRN  490

Query  331  IDMET-VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
             D +   + K + P E I+   +ST+ +LKL ++   R+ Y  +  F V  I  L   G 
Sbjct  491  NDEDDDGIEKALPPFECIIFKDNSTVNELKLEVERNFREIYWGLRSFCVESIVNLNAKGS  550

Query  508  DEVIFGIVESGTQLFMKG----LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCD  675
            D ++FG+VE+G++L  +G    +G+   G   +E   +N TV C CGA+DDDGERMISCD
Sbjct  551  D-LVFGLVEAGSELLFEGNDSKVGINNEG--IYESGHNNCTVDCPCGAKDDDGERMISCD  607

Query  676  VCEIWQHTR  702
            +CE+WQHTR
Sbjct  608  ICEVWQHTR  616



>ref|XP_002315838.1| hypothetical protein POPTR_0010s11170g [Populus trichocarpa]
 gb|EEF02009.1| hypothetical protein POPTR_0010s11170g [Populus trichocarpa]
Length=647

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 141/271 (52%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R +N  T+VLEY L+++ N     Q  V+     K       P   +  D+  LY
Sbjct  369  NYLVRRCLNPVTKVLEYCLEDVSNVHPEQQGLVINNSKMKGRYRMTRP--QLMKDMLYLY  426

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVKEW----PFR------DELDDLLRFIC  312
              +L   K +        +  A + ILDTK+ VKE+    P++      +E   +  +  
Sbjct  427  RCILKDQKPTMNQGILSAIPAATRIILDTKYLVKEYNGELPWKIHHTGHEEAGKMTLYCT  486

Query  313  IVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL  492
            + +    +   V+ K + P E I +  ++T  +LKL ++   R+ Y  ++ FVV  I  L
Sbjct  487  VFLRDKQESNEVMKKAMPPLECITLKNNATFNELKLEVERKFRELYWGLKSFVVESIMNL  546

Query  493  EGVGDDEVIFGIVESGTQLFMKGLGLAFA--GDLKFEDRAHNWTVKCKCGARDDDGERMI  666
               G D ++  +VE G ++ ++G         +L +E   +N  V C CGA++DDGERMI
Sbjct  547  NVKGTD-LVSEVVEVGQKIVLEGSNAESGTINELIYECGVNNRVVDCACGAKEDDGERMI  605

Query  667  SCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            SCD+CE+WQH+RCV I +++ +PP+F+C  C
Sbjct  606  SCDICEVWQHSRCVQIPNNQEMPPIFLCSRC  636



>ref|XP_007157621.1| hypothetical protein PHAVU_002G085000g [Phaseolus vulgaris]
 gb|ESW29615.1| hypothetical protein PHAVU_002G085000g [Phaseolus vulgaris]
Length=598

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 143/265 (54%), Gaps = 17/265 (6%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++      +Q  V+    +K      +    +  D+  LY
Sbjct  328  NYLVRRSLNPVTKVLEYCLEDISKLYTCNQSLVM---SNKVKDKFKITRTQLIKDMLYLY  384

Query  181  SNVL------LGYKESDVVSLAAQTILDTKHFVKEW--PFRDELD----DLLRFICIVVP  324
            + +L      +G +    + LAA+ ILDTK+F+K++   F  +LD    D L   C ++ 
Sbjct  385  NYILVDPKPIMGSEFLSAIPLAARIILDTKYFIKDYFGDFSYQLDLGSQDKLNLYCTILM  444

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
             + D E +    + P E I +   +TI DLKL ++ + R+ Y  +  FVV  I+ L    
Sbjct  445  RNGD-EYLNKAFMPPHECITLKTTATINDLKLEVERSFREMYWGLRSFVVESIQNLSVNN  503

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCE  684
              +++FG+ + G ++  +G        +   D  ++  V C CG  +DDGERM+SCD+CE
Sbjct  504  GTDMVFGLTKVGEKVVAEGRHTNMIEQICERD-PNSGVVDCGCGTIEDDGERMVSCDICE  562

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVC  759
            I QHTRCV I +D+ +P +F+C+ C
Sbjct  563  ILQHTRCVRIPNDQDIPHIFLCKKC  587



>ref|XP_011021716.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Populus euphratica]
Length=647

 Score =   139 bits (349),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 143/271 (53%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R +N  T+VLEY L+++ N     +++ LV    K      +    +  D+  LY
Sbjct  369  NYLVRRCLNPVTKVLEYCLEDVSN--VYPEQQGLVTNNSKMKGRYRMTRPQLMKDMLYLY  426

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVKEW----PFR------DELDDLLRFIC  312
              +L   K +        +  A + ILDTK+ VKE+    P++      +E   +  +  
Sbjct  427  RCILKDQKPAMNQGILSAIPAATRIILDTKYLVKEYNGELPWKIHHTGHEEAGKMTLYCT  486

Query  313  IVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL  492
            + +    +   V+ K + P E I +  ++T  +LKL ++   R+ Y  ++ FVV  I  L
Sbjct  487  VFLIDKQESNEVMKKEMPPLECITLKNNATFNELKLEVERKFRELYWGLKSFVVESIMNL  546

Query  493  EGVGDDEVIFGIVESGTQLFMKGLGLAFA--GDLKFEDRAHNWTVKCKCGARDDDGERMI  666
               G D ++  +VE G ++ ++G         +L +E  A+N  V C CGA +DDGERMI
Sbjct  547  NVKGTD-LVSELVEVGQRIVLEGSNAKSGTINELIYECGANNRVVDCACGANEDDGERMI  605

Query  667  SCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            SCD+CE+WQH+RCV I +++ +PP+F+C  C
Sbjct  606  SCDICEVWQHSRCVQIPNNQEMPPIFLCSRC  636



>ref|XP_006355027.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Solanum 
tuberosum]
Length=672

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 141/271 (52%), Gaps = 20/271 (7%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R +N  T+VLEY L+++ ++    Q++       K      +  V +  D++ LY+
Sbjct  392  YLVRRCLNPITKVLEYCLEDI-SKAFPKQDQGFRVNDSKGKQQYKITWVQLMKDIYFLYN  450

Query  184  NVLLGYKESD--------VVSLAAQTILDTKHFVKEWPFRDELD-----DLLRFICIVVP  324
            N+L  +K            +  A++ ILDTK+F+KE+    E D     D  +  C ++ 
Sbjct  451  NILKEHKGLTSNYKGVFATIPTASRIILDTKYFLKEYKGVSEPDSRIEADKSKIYCAIML  510

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG-V  501
            ++ D   V  K + P E  ++    T  +LK+ ++    D Y  +  F    I  L   +
Sbjct  511  ATNDGFGVEEKVMTPFECFLMRNDVTFDELKIEVEKTFGDMYLGLRNFTTRSINNLMSPI  570

Query  502  GDDEVIFGIVESGTQLFMKGLGLAFAGDLK-----FEDRAHNWTVKCKCGARDDDGERMI  666
               E++F +++ G+++ + G+ ++   D+      FE   +N  V C CG +D+DGERMI
Sbjct  571  SGIELVFNVMKPGSKIILGGVIMSNNDDININGEIFEGIKNNIIVNCLCGTKDEDGERMI  630

Query  667  SCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
             CD+CE+WQHTRCV I + +A+P +F+C  C
Sbjct  631  CCDICEVWQHTRCVNIPNHEAIPDIFLCNKC  661



>ref|XP_007226344.1| hypothetical protein PRUPE_ppa022178mg [Prunus persica]
 gb|EMJ27543.1| hypothetical protein PRUPE_ppa022178mg [Prunus persica]
Length=691

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 146/287 (51%), Gaps = 34/287 (12%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNR-DQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +Y+V R +N  T+VLEY L+++ N     +Q+ +L   P   A+   +    +  D+F L
Sbjct  403  NYLVRRTLNPVTKVLEYCLEDISNHVSPNNQDGLLRNNPKMKAAWYKISKFQLMKDMFYL  462

Query  178  YSNVLLGYKES----DVVSLAAQTILDTKHFVKEW-----PFRDEL--DDLLRFICIVVP  324
            Y ++L   K S      + +A + I+D+K+ VK++     P   EL         C VV 
Sbjct  463  YKHILKDQKLSTGIFSAIPMAVRIIIDSKYLVKDYCCGEVPMEVELGLQGKSNIYCTVVL  522

Query  325  SSIDMETV---------------LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAM  459
            +  D E +               LP    P E + +  ++T+ +LK  ++   R+ Y  +
Sbjct  523  THPDDEEIDHDQNYNKIISNNATLP----PYECLSLKNNATVDELKKEVEWNFREIYWGL  578

Query  460  EEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLK---FEDRAHNWTVKCK  630
              FVV  I  L+     ++IFG+VE+G ++ ++G      G +K   +E     + V C 
Sbjct  579  RGFVVEAIGNLKNAKGTDMIFGLVEAGQKIVVEGSNKDMRGLVKQEMYECGRREYVVDCP  638

Query  631  CGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRL  771
            CGA++DDGERM+ CD+CE+ QHT CV I +++ VP +F+C  C G +
Sbjct  639  CGAKEDDGERMVGCDICEVRQHTLCVRIPNNEQVPNIFLCNRCEGEI  685



>ref|XP_007040228.1| RING/FYVE/PHD zinc finger superfamily protein [Theobroma cacao]
 gb|EOY24729.1| RING/FYVE/PHD zinc finger superfamily protein [Theobroma cacao]
Length=659

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 139/271 (51%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R +N  T+VLEY L+++       +  +L     KP     +    +  D+  L+
Sbjct  381  NYLVRRCLNPVTKVLEYCLEDISTVFPNPETLLLNNSKVKPR--CKITKAQLMKDISFLF  438

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVKEWP------FRDELDDLLRFIC-IVV  321
             ++L   K +        + +AA+ ILDTK   KE+        +  L+   +  C +++
Sbjct  439  KHILKEQKPTLSTGIFSSIPMAARIILDTKFLAKEYSEELSMKVKSSLNGKFKLFCTVIL  498

Query  322  PSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGV  501
             +  +++  L K ++P E + +   +TI DLKL ++   R  Y  +  FVV  I  L   
Sbjct  499  RNDEEIDEGLKKPMLPCECVTLQETATINDLKLEVEKNFRQVYWRLRSFVVETIVNLNAK  558

Query  502  GDDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNW-----TVKCKCGARDDDGERMI  666
            G D ++ G VE G  + + G      G +  E     W      V+C CGAR+DDGER+I
Sbjct  559  GSD-LVLGSVEMGQTIVVVGSNDDQTGMIMNEVMMCEWGLNSRIVECPCGAREDDGERLI  617

Query  667  SCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            SCD+CE+WQHTRCV I +++ +P +F+C+ C
Sbjct  618  SCDICEVWQHTRCVRIPNNEEIPHVFLCKQC  648



>ref|XP_006492305.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Citrus sinensis]
Length=650

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 146/277 (53%), Gaps = 36/277 (13%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R++N  T+VLEY L+++ N      E+ LV    K  +   +    +  DV  LY 
Sbjct  374  YLVRRSLNPVTKVLEYCLEDISN---VFPEQDLVLGNSKTKTRYKISVAQLMKDVRILYK  430

Query  184  NVLLGYKESDV------VSLAAQTILDTKHFVKEWPFRDE---------LDDLLRFICIV  318
             +L   K +        +S+A++ ILDTK+FVKE   RD+         L+  L+  C V
Sbjct  431  LILHDQKPATSSGIFSGISVASRIILDTKYFVKECC-RDQVSSTKPGLDLEGKLKLYCTV  489

Query  319  VPSSIDMETVLPKG------IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTD  480
            +    D E   P G      + P E + +  ++T  +LKL +Q   R+ Y  +  FV+  
Sbjct  490  ILR--DSEN--PNGGRNNSAMQPYECVTIKNNATFDELKLEVQRNFRELYWGLRSFVIES  545

Query  481  IKGLEGVGDDEVIFGIVESGTQLFMKG----LGLAFAGDLKFEDRAHNWTVKCKCGARDD  648
            I  +   G D ++ G VE G ++  +G     G+ + G + +E+   N  V+C CGA +D
Sbjct  546  IVNVNATGTD-LVCGFVEVGRRIVFEGSNSERGIVY-GQI-YENGMVNCVVECACGADED  602

Query  649  DGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            DGERM+SCD+CE+WQHTRC  I +++ +P +F+C  C
Sbjct  603  DGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRC  639



>gb|KDO40585.1| hypothetical protein CISIN_1g040083mg, partial [Citrus sinensis]
Length=635

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 146/277 (53%), Gaps = 36/277 (13%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R++N  T+VLEY L+++ N      E+ LV    K  +   +    +  DV  LY 
Sbjct  359  YLVRRSLNPVTKVLEYCLEDISN---VFPEQDLVLGNSKTKTRYRISVAQLMKDVRILYK  415

Query  184  NVLLGYKESDV------VSLAAQTILDTKHFVKEWPFRDE---------LDDLLRFICIV  318
             +L   K +        +S+A++ ILDTK+FVKE   RD+         L+  L+  C V
Sbjct  416  LILHDQKPATSSGIFSGISVASRIILDTKYFVKE-CCRDQVCSTKPGLDLEGKLKLYCTV  474

Query  319  VPSSIDMETVLPKG------IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTD  480
            +    D E   P G      + P E + +  ++T  +LKL +Q   R+ Y  +  FV+  
Sbjct  475  ILR--DGEN--PNGGRSNSAMQPYECVTIKNNATFDELKLEVQRNFRELYWGLRSFVIES  530

Query  481  IKGLEGVGDDEVIFGIVESGTQLFMKG----LGLAFAGDLKFEDRAHNWTVKCKCGARDD  648
            I  +   G D ++ G VE G ++  +G     G+ + G + +E+   N  V+C CGA +D
Sbjct  531  IVNVNATGTD-LVCGFVEVGRRIVFEGSNSERGIVY-GQI-YENGMVNCVVECACGADED  587

Query  649  DGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            DGERM+SCD+CE+WQHTRC  I +++ +P +F+C  C
Sbjct  588  DGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRC  624



>emb|CDY68248.1| BnaC02g47750D [Brassica napus]
Length=435

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 111/203 (55%), Gaps = 29/203 (14%)
 Frame = +1

Query  163  DVFCLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            D+  LY N+LL Y +S+V S A++ IL+ K F K+              C V+P+  ++ 
Sbjct  243  DILYLYRNLLLTYPDSEVYSDASEIILNCKSFFKD--------------CQVLPNHEELL  288

Query  343  TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDI--KGLEGVGDDEV  516
              L + + P E + V  ++TI  LK A++ A+RDTYC ME F V +I  K LE +G++  
Sbjct  289  RDLTRKLPPGELVTVSRNATIRVLKSAVEKALRDTYCVMESFEVLEIRNKDLEKIGENSG  348

Query  517  IFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQH  696
            +    E G ++             ++E    NWTV CKCGA DDDGERM++CD C++W H
Sbjct  349  LES--EGGNKI-----------RTEYEGGFDNWTVDCKCGAIDDDGERMVACDACKVWHH  395

Query  697  TRCVGIKDDKAVPPLFVCEVCCG  765
            T+   I+D   VP  F C  C G
Sbjct  396  TKFHSIEDGDDVPSAFSCYRCFG  418



>ref|XP_010454488.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Camelina 
sativa]
Length=675

 Score =   133 bits (334),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 92/300 (31%), Positives = 151/300 (50%), Gaps = 46/300 (15%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNR-DQTDQERVLVPEPDKPASLTA-----VPPVDVFG  162
            +Y+V R++N   +VLEY L+++ N     + E V +   +    +T      +    V  
Sbjct  384  NYLVRRSLNPVKKVLEYCLEDISNLLPSNNNELVTLQNQNSTGKMTTNGHNKITRGQVMK  443

Query  163  DVFCLYSNVLLGYKES--------DVVSLAAQTILDTKHFVKEWPF-RD------ELD--  291
            D+F  Y ++L+ YK          + + +A++ ILD K+F+KE+ + RD       LD  
Sbjct  444  DMFYFYKHILMDYKGVLSPTGGILNQIGMASRAILDAKYFIKEYHYIRDTSAKTLHLDGG  503

Query  292  DLLRFICIVVPS--SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEE  465
            D LR  C +V      + E  +P    P+E IVV   +T+ ++    +   RD Y  + +
Sbjct  504  DKLRIFCTIVRKYHHHNNEIAMP----PQECIVVNKDATLSEVYGEAERVFRDIYWELRD  559

Query  466  FVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLK----------FED--RAH  609
             VV  +      G  E+I  + E  T L     GL   G++           +ED  +  
Sbjct  560  VVVESVAD----GQKEIITRVDEMVT-LMNGNKGLVLEGNVGMMMNVEVMKCYEDDNKKK  614

Query  610  NWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            +  ++C+CGA+D+DGERM+ CD+CEIWQHTRCVG++ ++ VP +F+C+ C   L P   L
Sbjct  615  DKRIECECGAKDEDGERMVCCDICEIWQHTRCVGVQHNEEVPGIFLCQSCDQHLIPLSFL  674



>ref|XP_006448066.1| hypothetical protein CICLE_v10017892mg, partial [Citrus clementina]
 gb|ESR61306.1| hypothetical protein CICLE_v10017892mg, partial [Citrus clementina]
Length=644

 Score =   132 bits (333),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 146/277 (53%), Gaps = 36/277 (13%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R++N  T+VLEY L+++ N      E+ LV    K  +   +    +  DV  LY 
Sbjct  368  YLVRRSLNPVTKVLEYCLEDISN---VFPEQELVLGNSKTETRYRISVAQLMKDVRILYK  424

Query  184  NVLLGYKESDV------VSLAAQTILDTKHFVKEWPFRDE---------LDDLLRFICIV  318
             +L   K +        +S+A++ ILDTK+FVKE   RD+         L+  L+  C V
Sbjct  425  LILHDQKPATSSGIFSGISVASRIILDTKYFVKE-CCRDQVCSTKPGLDLEGKLKLYCTV  483

Query  319  VPSSIDMETVLPKG------IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTD  480
                 D E   P G      + P E + +  ++T  +LKL +Q   R+ Y  ++ FV+  
Sbjct  484  TLR--DGEN--PNGGRNNSAMQPYECVTIKNNATFDELKLEVQRNFRELYWGLKSFVIES  539

Query  481  IKGLEGVGDDEVIFGIVESGTQLFMKG----LGLAFAGDLKFEDRAHNWTVKCKCGARDD  648
            I  +   G D ++ G VE G ++  +G     G+ + G + +E+   N  V+C CGA +D
Sbjct  540  IVNVNATGTD-LVCGFVEVGRRIVFEGSNSERGIVY-GQI-YENGMVNCVVECACGADED  596

Query  649  DGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            DGERM+SCD+CE+WQHTRC  I +++ +P +F+C  C
Sbjct  597  DGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRC  633



>ref|XP_008381804.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Malus domestica]
Length=692

 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/280 (30%), Positives = 142/280 (51%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTD-QERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +Y+V R +N  T+VLEY L+++ N    + ++  L+  P   A+   +    +  D+F +
Sbjct  403  NYLVRRTLNPVTKVLEYCLEDISNHASPNHRDGFLMHSPKAKAAWYKLSKFRLMKDMFYM  462

Query  178  YSNVLLGYKESDV-----VSLAAQTILDTKHFVKEW-----PFRDE---LDDLLRFICIV  318
            Y  +L   K S+      + +A + IL++K+ VK++     P + E   +D      C +
Sbjct  463  YKYILKDQKMSNAGIFSAIPMAVRIILNSKYLVKDYCGEVVPMKVEYLSMDGESNIYCTI  522

Query  319  VPSSIDME---------TVLPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEE  465
               +   E               II  P E + +  ++T  DLK  ++   ++ Y  +  
Sbjct  523  TLKNNSKEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVERNFKEIYWGLRG  582

Query  466  FVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLK--FEDRAHNWTVKCKCGA  639
            FVV  I  L      +++FG+VE G ++ ++G      G ++  +E  A N+ V C CGA
Sbjct  583  FVVDSIANLNNAKGTDLVFGMVEVGQKIVLEGRSSKKMGGVREMYECGAVNYVVDCPCGA  642

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            ++DDGERM+SCD+CE+ QHT CV I D + VP +F+C  C
Sbjct  643  KEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  682



>gb|KDP38178.1| hypothetical protein JCGZ_04821 [Jatropha curcas]
Length=678

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/269 (32%), Positives = 137/269 (51%), Gaps = 19/269 (7%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++ N     QE + +    K  +   +    V  D++  Y
Sbjct  402  NYLVRRSLNPVTKVLEYCLEDVSNIFPA-QESININN-SKVKARYKITRCQVMKDMYYFY  459

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVK----EWPFRDEL--DDLLRFICIVVP  324
              V+   K++        +  A++ ILDTK   K    E+P R EL  +  L+  C V  
Sbjct  460  KYVVKDQKQTVNMGILTAIQAASRIILDTKFLAKDYYTEFPCRVELGLEGKLKLYCTVFL  519

Query  325  SSID--METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG  498
             + +      + K + P E I +  ++T  +LK  ++   ++ Y     F V  I  L  
Sbjct  520  RNNEEIANEGINKAMPPFECITLKSNATFDELKQQVERNFKELYWGFRGFAVESILNLNA  579

Query  499  VGDDEVIFGIVESGTQLFMKGLGL--AFAGDLKFEDRAHNWTVKCKCGARDDDGERMISC  672
             G D ++FG+VE G ++  +G         +L +E   +N  V C CG +DDDGERM+SC
Sbjct  580  KGSD-LVFGLVEVGQKMVFEGSNRERGMINELIYESGNNNRVVDCPCGTKDDDGERMVSC  638

Query  673  DVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            D+CE+WQHTRCV I   + +P +F+C  C
Sbjct  639  DICEVWQHTRCVRIPYHQEIPHIFLCSRC  667



>ref|XP_008220957.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Prunus mume]
Length=682

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/287 (30%), Positives = 144/287 (50%), Gaps = 40/287 (14%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNR-DQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +Y+V R +N  T+VLEY L+++ N     +Q+ +L   P   A+   +    +  D+F L
Sbjct  392  NYLVRRTLNPVTKVLEYCLEDISNHVSPNNQDGLLRNNPKMKAAWYKISKFQLMKDMFYL  451

Query  178  YSNVLLGYKESDV-----VSLAAQTILDTKHFVKEW------PFRDEL--DDLLRFICIV  318
            Y ++L   K S       + +A + I+D+K+ VK++      P   EL         C V
Sbjct  452  YKHILKDQKLSSTGIFSAIPMAVRIIIDSKYLVKDYCGGGEVPMEVELGLQGKSNIYCTV  511

Query  319  VPSSIDME---------------TVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYC  453
            + ++ D E                 LP    P E + +  ++T+ +LK  ++   R+ Y 
Sbjct  512  MLTNTDQEELDHDQNYNKIISNNATLP----PYECLTLKNNATVDELKKEVERNFREIYW  567

Query  454  AMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKFE-----DRAHNWT  618
             +  FVV  I  L+     +++FG+VE+G ++ ++G      G +K E      R H   
Sbjct  568  GLRGFVVETIGNLKNAKGTDMVFGLVEAGQKIVVEGSNKDTRGLVKQEMYECGRREH--V  625

Query  619  VKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            V C CGA++DDGERM+ CD+CE+ QHT CV I +++ VP +F+C  C
Sbjct  626  VDCPCGAKEDDGERMVGCDICEVRQHTLCVRIPNNEQVPHIFLCNRC  672



>ref|XP_008348744.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Malus domestica]
Length=701

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/280 (30%), Positives = 142/280 (51%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTD-QERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +Y+V R +N  T+VLEY L+++ N    + ++  L+  P   A+   +    +  D+F +
Sbjct  403  NYLVRRTLNPVTKVLEYCLEDISNHASPNHRDGFLMHSPKAKAAWYKLSKFRLMKDMFYM  462

Query  178  YSNVLLGYKESDV-----VSLAAQTILDTKHFVKEW-----PFRDE---LDDLLRFICIV  318
            Y  +L   K S+      + +A + IL++K+ VK++     P + E   +D      C +
Sbjct  463  YKYILKDQKMSNAGIFSAIPMAVRIILNSKYLVKDYCGEVVPMKVEYLSMDGESNIYCTI  522

Query  319  VPSSIDME---------TVLPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEE  465
               +   E               II  P E + +  ++T  DLK  ++   ++ Y  +  
Sbjct  523  TLKNNSKEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVERNFKEIYWGLRG  582

Query  466  FVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLK--FEDRAHNWTVKCKCGA  639
            FVV  I  L      +++FG+VE G ++ ++G      G ++  +E  A N+ V C CGA
Sbjct  583  FVVDSIANLNNAKGTDLVFGMVEVGQKIVLEGRSSKKMGGVREMYECGAVNYVVDCPCGA  642

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            ++DDGERM+SCD+CE+ QHT CV I D + VP +F+C  C
Sbjct  643  KEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  682



>ref|XP_010493299.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Camelina sativa]
Length=676

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 148/297 (50%), Gaps = 47/297 (16%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKP------ASLTAVPPVDVFG  162
            +Y+V R++N   +VLEY L+++ N   +    ++ P+               +    V  
Sbjct  384  NYLVRRSLNPVKKVLEYCLEDISNLLPSSNNELVTPQNQSSIGKMTTNGHNKITRGQVMK  443

Query  163  DVFCLYSNVLLGYKES--------DVVSLAAQTILDTKHFVKEWPF-RD------ELD--  291
            D+F  Y ++L+ YK          + + +A++ ILD K+F+KE+ + RD       LD  
Sbjct  444  DMFYFYKHILMDYKGVLSPTGGILNQIGMASRAILDAKYFIKEYHYIRDTSAKTLHLDGG  503

Query  292  DLLRFICIVVPS---SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAME  462
            D L   C + P      + E  +P    P+E IVV   +T+ ++    + A RD Y  + 
Sbjct  504  DKLGIFCTIAPKYHHHHNNEITMP----PQECIVVNKDATLSEVYGEAERAFRDIYWELR  559

Query  463  EFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLK----------FED--RA  606
            + VV  +      G  E+I  + E  T L     GL   G++           +ED  + 
Sbjct  560  DVVVESVAD----GQKEIITRVDEMAT-LMNGNKGLVLEGNVGMMMNVEVMKCYEDDNKK  614

Query  607  HNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAP  777
             +  ++C+CGA+++DGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P
Sbjct  615  KDKRIECECGAKEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIP  671



>ref|XP_002521912.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF40548.1| DNA binding protein, putative [Ricinus communis]
Length=652

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 135/269 (50%), Gaps = 20/269 (7%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++ N     +   L     K      +    V  D++  Y
Sbjct  377  NYLVRRSLNPVTKVLEYCLEDVSNVFPAQES--LSINNSKVKGRYKITKSQVIRDIYYFY  434

Query  181  SNVLLGYKES------DVVSLAAQTILDTKHFVKEW----PFRDELD--DLLRFICIVVP  324
              +L   K++        +  AA+ ILDTK   K++    P R +L     L+  C VV 
Sbjct  435  KYILKDQKQTLNLGIFTAIQAAARIILDTKFLAKDYHIELPSRIDLGLGGKLKLYCTVVL  494

Query  325  SSIDMETV--LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG  498
             + D ET   + K + P E I +  ++T  +LK  ++    + Y  +  F+   I  L  
Sbjct  495  RN-DEETSEGINKAMPPFERITMKANATFDELKQEVEKHFSELYWGLRSFIAESILNLNT  553

Query  499  VGDDEVIFGIVESGTQLFMKGLG--LAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISC  672
             G D ++FG VE G ++ ++G          L +E   ++    C CG +DDDGERM+SC
Sbjct  554  NGSD-LVFGQVEMGQKIVVEGSNNERGMINQLIYESGLNSKIFDCPCGTKDDDGERMVSC  612

Query  673  DVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            D+CE+WQHTRCV I + + +P +F+C  C
Sbjct  613  DICEVWQHTRCVRIPNHQEIPHIFLCSRC  641



>ref|XP_010271105.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Nelumbo nucifera]
Length=654

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 145/268 (54%), Gaps = 18/268 (7%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L+++ +    +QE + + +P K  +   +    +  D+  LY
Sbjct  379  NYMVRRSLNPVTKVLEYCLEDISS-TYLNQEGLSLNDP-KGKACHKITRAQLMNDIAYLY  436

Query  181  SNVL------LGYKESDVVSLAAQTILDTKHFVKEW-----PFRD-ELDDLLRFICI-VV  321
             ++L      L       + LA + ILD+K  +K +     P  +  ++  L F+C  ++
Sbjct  437  RSILNEQRSVLTSGIFTSIPLATRIILDSKGLIKNYGGEVAPSDNVGVEGNLTFLCTALL  496

Query  322  PSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGV  501
             + +D E    + + P E I++PL +TI +LK   +   R+TY  +  F++  I G+   
Sbjct  497  KNKLDGEEEKIRTLPPYELIILPLDATIEELKKETERVFRETYWGLRSFIIESISGVNAK  556

Query  502  GDDEVIFGIVESGTQLFMKGLGL--AFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCD  675
              D +IF +VE    L M+G  +      D  +E    +  V C CGA++DDGERMISCD
Sbjct  557  ESD-MIFRLVELCCCLVMEGRMVEEGIGIDDIYESGRDDCIVDCPCGAKEDDGERMISCD  615

Query  676  VCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            +CE+WQHTRCV I + + +P +F+C  C
Sbjct  616  ICEVWQHTRCVRIPNGEDIPHIFLCSRC  643



>ref|XP_007048632.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX92789.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
Length=491

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 114/215 (53%), Gaps = 13/215 (6%)
 Frame = +1

Query  175  LYSNVLLGYK---ESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMET  345
            L+   +L Y      ++ + +A+ +LD K FVK +      + L     +VV  S  +E 
Sbjct  258  LHPQTMLSYGPDLTGNLATSSAEKLLDCKQFVKVYKH----EKLSSGNDVVVCLSCQLEL  313

Query  346  VLPKGII----PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
            V     I    P E +V+PL++T+ DLK+    A ++ Y A   F   ++ G  GV D  
Sbjct  314  VDQSEEIGPDPPAELVVLPLNATVSDLKMEASKAFQEVYLAFRRFQAEELLGYGGVEDST  373

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
             +  ++ S   + ++G  L   G  KF  E     WTV C CGA+DDDGERM++CDVC +
Sbjct  374  QVKHLLGSTESVRVRGRCLGKNGLSKFRAERGIERWTVDCICGAKDDDGERMLACDVCGV  433

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLG  792
            WQHTRC GIKD +AVP  FVC  C   L  TRT G
Sbjct  434  WQHTRCSGIKDSEAVPAKFVCYRCRESLYMTRTGG  468



>gb|KGN50860.1| hypothetical protein Csa_5G291680 [Cucumis sativus]
Length=517

 Score =   128 bits (322),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 143/282 (51%), Gaps = 38/282 (13%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R +N  T+VLEY LQ++ +  +            KP     V  V++  D+  LY
Sbjct  254  NYLVRRTLNPVTKVLEYCLQDVCSSVEM-----------KPR--CKVGRVELAKDISNLY  300

Query  181  SNVLLGYKESDV------VSLAAQTILDTKHFVKEW------PFRDELDDLLRFICIVVP  324
              +L   K          +++A++ ILD+K  VKE+       F  E++  L  +C +  
Sbjct  301  KYILGDQKPLQAKGILPNLTIASEIILDSKFLVKEYMSEPQTKFELEIEGKLNLLCTIRV  360

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
               +  T+LP      E I +  + TI +LK  ++   ++ Y  +  FVV  I  LE  G
Sbjct  361  KRQETTTILPY-----ECIALKNNGTIDELKKEVERNFKEIYWGLRSFVVKKIVDLEAKG  415

Query  505  DDEVIFGIVESGTQLFMKGLG-------LAFAGDLKFEDRAHNWTVKCKCGARDDDGERM  663
            +D ++FG+VE G +L  +G G       +    +       +   ++C CGA +DDGERM
Sbjct  416  ND-LVFGLVEVGGKLVFEGSGEDEGSFFMNNNNNTNNNGGMNKKIMECICGAMEDDGERM  474

Query  664  ISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            ++CD+CEIWQHTRCV I +++ VP +F+C  C   +A   +L
Sbjct  475  VACDICEIWQHTRCVQIPNEQQVPHIFICNRCDQEIALLHSL  516



>ref|XP_009350911.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Pyrus x 
bretschneideri]
Length=691

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/280 (30%), Positives = 141/280 (50%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTD-QERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +Y+V R +N  T+VLEY L+++ N    + ++ +L+  P   A+   +    +  D+F +
Sbjct  402  NYLVRRTLNPVTKVLEYCLEDISNHASPNHRDGLLMHSPKAKAAWYKLSKFRLMKDMFYM  461

Query  178  YSNVLLGYKESDV-----VSLAAQTILDTKHFVKEW-----PFRDE---LDDLLRFICIV  318
            Y  VL   K S+      + +A + IL++K+ VK++     P + E   +D      C +
Sbjct  462  YKYVLKDQKMSNAGIFSAIPMAVRIILNSKYLVKDYCSEVVPMKVEYLSMDGESNIYCTI  521

Query  319  VPSSIDME---------TVLPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEE  465
               +   E               II  P E + +  ++T  DLK  ++   ++ Y  +  
Sbjct  522  SLKNNSEEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVERNFKEIYWGLRG  581

Query  466  FVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLK--FEDRAHNWTVKCKCGA  639
            FVV  I  L      +++FG+VE G ++ ++G      G +   +E  A  + V C CGA
Sbjct  582  FVVDSIANLNNAKGKDLVFGMVEVGQKIVLEGRSSKRMGGVSEIYECGAAYYVVDCPCGA  641

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            ++DDGERM+SCD+CE+ QHT CV I D + VP +F+C  C
Sbjct  642  KEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  681



>ref|XP_001417810.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96103.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=795

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 116/256 (45%), Gaps = 49/256 (19%)
 Frame = +1

Query  148  VDVFGDVFCLYSNVLLGYKESDVVSLAAQ--------------TILDTKHFVKEW-PFRD  282
             +V  D+  LY +VL  YK + +   A Q              T+LDTK FVK + P  D
Sbjct  523  AEVDRDLLTLYHDVLESYKPARLQKNAGQRVTVKGAPLIEAARTLLDTKQFVKIYTPVED  582

Query  283  ELD------------DLLRFICIVVPSSIDMETVLPK---------------GII---PK  372
             LD            +  + I I+V + ID     P                G I   P 
Sbjct  583  LLDSTPASKLVKPAPNAQKAIRIIVTAVIDTRNQGPLLSGLGANNGKSRQRIGTITRPPP  642

Query  373  EHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLF  552
            E + +P   T+GDLK     A RD Y  + +F VT +KG EGV D   +      G  + 
Sbjct  643  EMVWLPSDPTLGDLKRVASKAFRDLYVVLSDFKVTRVKGYEGVSDKTRLGWRKMHGAFVE  702

Query  553  MKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAV  732
            + G G     + +++     WTVKC CG  DDDGERMI+CD C IW HTRCVGIKD    
Sbjct  703  VHGEGADLESEFRYQGGLEQWTVKCMCGTGDDDGERMIACDECGIWMHTRCVGIKDSAKA  762

Query  733  PPLFVCEVCCGRLAPT  780
            P  ++C  C    APT
Sbjct  763  PSNWICPKC----APT  774



>ref|XP_003079461.1| putative male sterility 1 protein (ISS) [Ostreococcus tauri]
 emb|CAL54119.1| Zinc finger, PHD-finger [Ostreococcus tauri]
Length=996

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 116/256 (45%), Gaps = 45/256 (18%)
 Frame = +1

Query  127  SLTAVPPVDVFGDVFCLYSNVLLGYKESDVVSL--------------AAQTILDTKHFVK  264
            S+  +   +V  D+  LY +VL  YK +                   AA+ +LDTK FVK
Sbjct  717  SIDELTAAEVDRDLLALYHDVLENYKPARAQQKDGQRVTVKGAPLVDAARILLDTKQFVK  776

Query  265  EWPFRDELDDL----------------LRFICIVV---------PSSIDMETVLPKGII-  366
             +   D+L D                 +R I   V         PS +       +  I 
Sbjct  777  IYTAVDDLLDTTPASKLTKPAANAQKAIRIIATAVIHTRSQGPAPSGLGPNVAKSRQKIG  836

Query  367  -----PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
                 P E + +P   T+GDLK     A RD Y  + +F VT +KG EG  D   +    
Sbjct  837  TITRPPPELVFLPSEPTLGDLKRVTSKAFRDLYVVLSDFKVTRVKGHEGQSDKTRLGWRK  896

Query  532  ESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVG  711
              G  + ++G G   A +L+++     WTV+C CG  DDDGERMI+CD C +W HTRCVG
Sbjct  897  MHGASVEVQGDGADVASELRYQGGFEQWTVQCMCGTGDDDGERMIACDKCGVWMHTRCVG  956

Query  712  IKDDKAVPPLFVCEVC  759
            IKD+K  P  ++C  C
Sbjct  957  IKDNKNAPSHWICPNC  972



>ref|XP_007048631.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX92788.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
Length=700

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 114/215 (53%), Gaps = 13/215 (6%)
 Frame = +1

Query  175  LYSNVLLGYK---ESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMET  345
            L+   +L Y      ++ + +A+ +LD K FVK +      + L     +VV  S  +E 
Sbjct  467  LHPQTMLSYGPDLTGNLATSSAEKLLDCKQFVKVYKH----EKLSSGNDVVVCLSCQLEL  522

Query  346  VLPKGII----PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
            V     I    P E +V+PL++T+ DLK+    A ++ Y A   F   ++ G  GV D  
Sbjct  523  VDQSEEIGPDPPAELVVLPLNATVSDLKMEASKAFQEVYLAFRRFQAEELLGYGGVEDST  582

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
             +  ++ S   + ++G  L   G  KF  E     WTV C CGA+DDDGERM++CDVC +
Sbjct  583  QVKHLLGSTESVRVRGRCLGKNGLSKFRAERGIERWTVDCICGAKDDDGERMLACDVCGV  642

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLG  792
            WQHTRC GIKD +AVP  FVC  C   L  TRT G
Sbjct  643  WQHTRCSGIKDSEAVPAKFVCYRCRESLYMTRTGG  677



>emb|CDP05466.1| unnamed protein product [Coffea canephora]
Length=657

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 140/269 (52%), Gaps = 21/269 (8%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNR-DQTDQERVLVPEPD-KPASLTAVPPVDVFGDVFCL  177
            Y+V R +N  T+VLEY L+++ +   + D    L+  PD K      +    +  D+F L
Sbjct  382  YLVRRCLNPVTKVLEYCLEDISHAFPRRDGYSRLISTPDSKLKPRYKITWAQLMKDLFRL  441

Query  178  YSNVLLGYKESDVVS---------LAAQTILDTKHFVKEWPFRDE--LDDLLRFICIVVP  324
            Y  +L   KE++ +S         +A++ ILDTK F+K++       LD  +    IV+ 
Sbjct  442  YKLIL---KENNAMSSTGILASIPIASRIILDTKLFIKDYSEESTSILDKSVLHCSIVLT  498

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
            ++ D  +     I P E  ++   +T  +LKL ++   RD Y  M  FV   +  L+  G
Sbjct  499  TNTDRGSTNKVVITPYEFFMLRNTATFDELKLEVERKFRDLYWGMRNFVAESLANLDAKG  558

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGD---LKFEDRAHN-WTVKCKCGARDDDGERMISC  672
             D ++F ++++GT++  +G     + D   + FE    N   V C CG + DDGERM+SC
Sbjct  559  SD-LVFKLIKAGTKIVFEGKISGESADICGMMFESFESNALVVDCICGTKIDDGERMVSC  617

Query  673  DVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            D+CE+ QH RCV + + + +P +F+C  C
Sbjct  618  DICEVRQHARCVHVSNIEEIPTIFLCNSC  646



>ref|XP_004140423.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Cucumis 
sativus]
Length=643

 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 143/282 (51%), Gaps = 38/282 (13%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R +N  T+VLEY LQ++ +  +            KP     V  V++  D+  LY
Sbjct  380  NYLVRRTLNPVTKVLEYCLQDVCSSVEM-----------KPR--CKVGRVELAKDISNLY  426

Query  181  SNVLLGYKESDV------VSLAAQTILDTKHFVKEW------PFRDELDDLLRFICIVVP  324
              +L   K          +++A++ ILD+K  VKE+       F  E++  L  +C +  
Sbjct  427  KYILGDQKPLQAKGILPNLTIASEIILDSKFLVKEYMSEPQTKFELEIEGKLNLLCTIRV  486

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
               +  T+LP      E I +  + TI +LK  ++   ++ Y  +  FVV  I  LE  G
Sbjct  487  KRQETTTILPY-----ECIALKNNGTIDELKKEVERNFKEIYWGLRSFVVKKIVDLEAKG  541

Query  505  DDEVIFGIVESGTQLFMKGLG-------LAFAGDLKFEDRAHNWTVKCKCGARDDDGERM  663
            +D ++FG+VE G +L  +G G       +    +       +   ++C CGA +DDGERM
Sbjct  542  ND-LVFGLVEVGGKLVFEGSGEDEGSFFMNNNNNTNNNGGMNKKIMECICGAMEDDGERM  600

Query  664  ISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            ++CD+CEIWQHTRCV I +++ VP +F+C  C   +A   +L
Sbjct  601  VACDICEIWQHTRCVQIPNEQQVPHIFICNRCDQEIALLHSL  642



>ref|XP_008456986.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Cucumis melo]
Length=644

 Score =   127 bits (320),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 88/284 (31%), Positives = 142/284 (50%), Gaps = 40/284 (14%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R +N  T+VLEY LQ++ +  +            KP     V  V++  D+  LY
Sbjct  379  NYLVRRTLNPVTKVLEYCLQDVCSSVEM-----------KPR--CKVGRVELAKDISNLY  425

Query  181  SNVLLGYKESD------VVSLAAQTILDTKHFVKEW------PFRDELDDLLRFICIVVP  324
              +L   K          +++A++ ILD+K  VKE+       F  E++  L  +C +  
Sbjct  426  KYILGDQKPLQAKGILPTLTMASEIILDSKFLVKEYMSEPQTKFELEIEGKLNLLCTIRL  485

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
               +  T+LP      E I +  + TI +LK  ++   ++ Y  +  FVV  I  LE  G
Sbjct  486  KRQETTTILPY-----ECIALKNNGTIDELKKEVERNFKEIYWGLRSFVVKKIVDLEAKG  540

Query  505  DDEVIFGIVESGTQLFMKGLG---------LAFAGDLKFEDRAHNWTVKCKCGARDDDGE  657
            +D ++FG+VE G +L  +G G              +       +   ++C CGA +DDGE
Sbjct  541  ND-LVFGLVEVGGKLVFEGSGEDEGSFFMNNNNNNNTNNNGGMNKRIMECICGAMEDDGE  599

Query  658  RMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            RM++CD+CEIWQHTRCV I +++ VP +F+C  C   +A   +L
Sbjct  600  RMVACDICEIWQHTRCVQIPNEQQVPHIFICNRCDQEIALLHSL  643



>ref|XP_010043916.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Eucalyptus grandis]
 gb|KCW85943.1| hypothetical protein EUGRSUZ_B02649 [Eucalyptus grandis]
Length=652

 Score =   127 bits (320),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 137/267 (51%), Gaps = 18/267 (7%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R++N  T+VLEY L+++       +  V      +  S   +    +  D+FC+Y 
Sbjct  378  YLVRRSLNPVTKVLEYCLEDVSKASVESEGSVASSSNLRTGS--KITRAQLMKDMFCVYK  435

Query  184  NVL----LGYKE--SDVVSLAAQTILDTKHFVKEW----PFRDELD--DLLRFICIVVPS  327
            +      LG     SD VSL A+ ILD+++ +KE+    P + EL      +  C V+  
Sbjct  436  HTFKEHELGSHTHISDNVSLMARIILDSRYLIKEYNGDLPSKLELGLGGKFKLFCTVLLR  495

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
                     K + P E IV+  ++T+ +LK+ ++   R+ Y  ++ FV   I  L   G 
Sbjct  496  DYVRCEWKTKLMPPYECIVLKENATVNELKVKVERNFRELYWGLKSFVAESIVNLNTSGL  555

Query  508  DEVIFGIVESGTQLFMKGL---GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDV  678
             E +FG+VE G +L ++G      + A D+          V C CG ++DDGERMI+C V
Sbjct  556  -ETVFGLVEVGRRLVLEGSVRDQGSTARDVYECGADGGRVVDCACGTKEDDGERMIACAV  614

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            CE+WQHT CV I + + VP +F+C+ C
Sbjct  615  CEVWQHTWCVQIPNSEEVPGIFICKRC  641



>ref|XP_010536249.1| PREDICTED: PHD finger protein MALE STERILITY 1, partial [Tarenaya 
hassleriana]
Length=625

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/296 (30%), Positives = 142/296 (48%), Gaps = 56/296 (19%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N   +VLEY L+++ N   +  E + +  P        +    V  D+  LY
Sbjct  352  NYLVRRSLNPVKKVLEYCLEDISNLLPSHHELITLQNPTGKNGHNKMTRGQVTKDMLYLY  411

Query  181  SNVLLGYKES-------DVVSLAAQTILDTKHFVKEWPFRD----------ELDDLLRFI  309
             ++L+ YK +       + + +A++TILD K+F+KE+  RD           L++ L  +
Sbjct  412  KHILMDYKGALGPIGILNQIGMASRTILDAKYFIKEYN-RDGVQAKISRVANLEEELGML  470

Query  310  CIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEF-------  468
            C +          LP    P E IVV  ++T G+L    +   R+ Y  + +        
Sbjct  471  CTISIKGHHGRDQLP----PYECIVVRKNATFGELYAETERVFREMYWELRDVVVVESSV  526

Query  469  ---VVTDIKG----LEG-VGDDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVK  624
                 T + G    LEG VGD+     IVE G                 F++   N  V+
Sbjct  527  DVGAATTLAGRRIVLEGRVGDNNSNI-IVEKG-----------------FDENGRNKVVE  568

Query  625  CK-CGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            C  CGA ++DGERM+SCD+CE+WQHTRCVGI +   VP +F+C+ C   + P  +L
Sbjct  569  CGGCGANEEDGERMVSCDICEVWQHTRCVGIPNHSQVPHIFLCKRCDQHILPLTSL  624



>gb|EYU30216.1| hypothetical protein MIMGU_mgv1a002812mg [Erythranthe guttata]
Length=635

 Score =   127 bits (318),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/264 (32%), Positives = 134/264 (51%), Gaps = 29/264 (11%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y V R +N  T+VLEY L+++ +R    QE +LV    K      V    +  D+F +Y 
Sbjct  378  YFVRRCLNPVTKVLEYCLEDV-SRAFPMQEPLLVKAQHK------VSWAQLMKDMFYMYV  430

Query  184  NVLLGYKESD-----VVSLAAQTILDTKHFVKEW----PFRDELDDLLRFICIVVPSSID  336
            N+L   +  +      + +A++ ILD+K+ VKE+       DE +      C VV   I+
Sbjct  431  NILRDDRHQNGSVFATIGVASRIILDSKYLVKEYHAVKAMNDETNKTKIVYCAVV--LIN  488

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEV  516
             +        P     +   +   DLK  ++   R+TY  +  FV T I+ +   G D +
Sbjct  489  EQEQETTTTTPYHCFALRNSAIFDDLKYEVEKMFRETYLGLRNFVATSIRNMNPKGSD-L  547

Query  517  IFGIVESGTQL---FMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
            +F  V+SG+++    ++ LG+   G    +       V C CGA++DDGERM++CDVC++
Sbjct  548  VFKAVKSGSKIEFECIQELGIICEGLTTMD-------VDCVCGAKEDDGERMVACDVCQV  600

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            WQHTRCV I +   VP +F+C  C
Sbjct  601  WQHTRCVQIPESDQVPTIFLCSAC  624



>ref|XP_011070712.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Sesamum indicum]
Length=637

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 137/279 (49%), Gaps = 29/279 (10%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPD-KPASLTAVPPVDVFGDVFCLY  180
            Y V R +N  T+VLEY L+++       +    + EP  KP     +    +  D+FC+Y
Sbjct  370  YFVRRCLNPVTKVLEYCLEDVSRPFPKQEAAFPISEPRLKPQQ--TISRAQLVKDMFCMY  427

Query  181  SNVLLGY------KESDVVSLAAQTILDTKHFVKEW----PFRDELDDLLRFICIVVPSS  330
             N+L  +      +    + +AA+ ILD+KH VKE+      ++   +     C V+ ++
Sbjct  428  KNILGNHNVITNTRVLGTIPMAARVILDSKHLVKEYYSGETSKNYETNKQTIYCSVILAN  487

Query  331  IDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD  510
                T   +   P    V+  ++   +L+  ++   R+ Y  +  F+   ++ +   G D
Sbjct  488  GGTSTGPDEVATPYHRFVLRNNAAFDELRCEVEKTFREIYFGLRNFIAESVRNMNFKGSD  547

Query  511  EVIFGIVESGTQLFMKG-----LGLAFAGDLKFEDRAHNWTVKCKCGARDDD-GERMISC  672
             ++F  V+ G+++  +G      G+   G +          V C CGA+DDD GERM+SC
Sbjct  548  -LVFKTVKPGSKIAFEGKQEGTYGVICEGLM---------AVDCVCGAKDDDDGERMVSC  597

Query  673  DVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            DVC++WQHTRCV + +D  +P +FVC  C   +   R+L
Sbjct  598  DVCQVWQHTRCVQVPEDDEIPNVFVCSACEKHILSFRSL  636



>ref|XP_010319373.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Solanum lycopersicum]
Length=678

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/274 (30%), Positives = 140/274 (51%), Gaps = 23/274 (8%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R +N  T+VLEY L+++ ++    Q++       K      +    +  D+  LY+
Sbjct  395  YLVRRCLNPVTKVLEYCLEDI-SKAFPKQDQGFRVNDSKGKQQYKITLAQLMKDIHFLYN  453

Query  184  NVLLGYKE--------SDVVSLAAQTILDTKHFVKEWPFRDELD-----DLLRFICIVVP  324
            N+L  +K            +  A++ ILDTK+F+KE+    E D     D  +  C ++ 
Sbjct  454  NILKEHKGLMSNYTGVFATIPTASRIILDTKYFLKEYREVSEPDTRIEPDKSKIYCAIML  513

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL-EGV  501
            +  D   V  K + P E  ++    T  +LK+ ++ A  D Y  +  F    I  L   +
Sbjct  514  AIKDGFGVEEKVMTPFECFLMRKDVTFDELKIEVEKAFGDIYLGLRNFTTRSINNLISPI  573

Query  502  GDDEVIFGIVESGTQLFMKGLGLAFAGDLK-------FED-RAHNWTVKCKCGARDDDGE  657
               E++F +V+ G+++ + G+ ++   D+        FE  + +N  + C CG +D+DGE
Sbjct  574  SGIELVFNVVKPGSKIVLGGVIMSNNDDINIINNGGIFEGIKNNNIIMDCICGTKDEDGE  633

Query  658  RMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            RMI CD+CE+WQHTRCV I + +A+P +F+C  C
Sbjct  634  RMICCDICEVWQHTRCVNIPNHEAIPDIFLCNKC  667



>ref|XP_006289308.1| hypothetical protein CARUB_v10002790mg [Capsella rubella]
 gb|EOA22206.1| hypothetical protein CARUB_v10002790mg [Capsella rubella]
Length=670

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/292 (29%), Positives = 145/292 (50%), Gaps = 43/292 (15%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNR-DQTDQERVLVPEPDKPASLTA-----VPPVDVFG  162
            +Y+V R++N   +VLEY L+++ N    ++ E V +   +    +T      +    V  
Sbjct  384  NYLVRRSLNPVKKVLEYCLEDISNLLPSSNNELVPLQNQNSMGKMTTNGHNKITRGQVMK  443

Query  163  DVFCLYSNVLLGYKES----DVVSLAAQTILDTKHFVKEWPF-RD------ELD--DLLR  303
            D+F  Y ++L+ +K      + + +A++ ILD K+F KE+ + RD       LD  D L 
Sbjct  444  DMFYFYKHILMDHKGVGGILNQIGMASRAILDAKYFFKEYHYIRDTSAKTLHLDEGDKLG  503

Query  304  FICIVVPS--SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVT  477
              C +       + E  +P    P+E IVV   +T+ ++    +   RD Y  + + VV 
Sbjct  504  IFCTIARKYHHHNNEMTMP----PQECIVVSKDATLSEVYGEAERVFRDIYWELRDVVV-  558

Query  478  DIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF------------EDRAHNWTV  621
                 E V D +     V+   +L     GL   G +              +++  +  +
Sbjct  559  -----ESVADGQREITRVDEMAKLMSGNKGLVLEGSVGMMMNIEVMKCYADDNKKKDKRI  613

Query  622  KCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAP  777
            +C+CGA+++DGERM+ CD+CE+WQHTRCVG+K ++ VP +F+C+ C   L P
Sbjct  614  ECECGAKEEDGERMVCCDICEVWQHTRCVGVKHNEEVPRIFLCQSCDQHLIP  665



>ref|XP_009775431.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Nicotiana sylvestris]
Length=666

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 136/266 (51%), Gaps = 17/266 (6%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R +N  T+VLEY L+++ ++     ++       K      +  V +  D++ LY 
Sbjct  393  YLVRRCLNPVTKVLEYCLEDI-SKAFPKHDQGFSVNDSKGNQQYKITWVQLMKDIYFLYK  451

Query  184  NVLLGYKE-SDVVSL------AAQTILDTKHFVKEWPFRDELD-----DLLRFICIVVPS  327
            N+L   K  S+  S+      A++ ILDTK+F+KE  ++ E D     D  +  C ++  
Sbjct  452  NILKELKGMSNYTSIFATIPTASRIILDTKYFLKE--YKGEADSRIEVDKSKIYCAIMLV  509

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
            + +   V  K + P E  ++    T  +LK+ +     + Y  +  F +  I  L  +  
Sbjct  510  TKNGFGVEEKVMTPFECFILRKDVTFDELKIEVVRTFGNIYWGLRNFAIRSINNLSPIIG  569

Query  508  DEVIFGIVESGTQLFMKGL--GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVC  681
             E++F +++ G ++ + G+   +        E    N  V C CGA+D+DGERM+ CD+C
Sbjct  570  TELVFNVMKPGNKIVLGGIMSNIDHNNIGISEGIKDNIVVDCLCGAKDEDGERMVCCDIC  629

Query  682  EIWQHTRCVGIKDDKAVPPLFVCEVC  759
            E+WQHTRCV I + +A+P +F+C  C
Sbjct  630  EVWQHTRCVNIPNQEAIPDIFLCSEC  655



>ref|XP_009351795.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Pyrus x 
bretschneideri]
Length=691

 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 140/280 (50%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTD-QERVLVPEPDKPASLTAVPPVDVFGDVFCL  177
            +Y+V R +N  T+VLEY L+++ N    + ++ +L+  P   A+   +    +  D+F +
Sbjct  402  NYLVRRTLNPVTKVLEYCLEDISNHASPNHRDGLLMHSPKAKAAWYKLSKFRLMKDMFYM  461

Query  178  YSNVLLGYKESDV-----VSLAAQTILDTKHFVKEW-----PFRDE---LDDLLRFICIV  318
            Y  VL   K S+      + +A + IL++K+ VK++     P + E   +D      C +
Sbjct  462  YKYVLKDQKMSNAGIFSAIPMAVRIILNSKYLVKDYCSEMVPMKVEYLSMDGESNIYCTI  521

Query  319  VPSSIDME---------TVLPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEE  465
               +   E               II  P E + +  ++T  DLK  ++   ++ Y  +  
Sbjct  522  SLKNNSEEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVERNFKEIYWGLRG  581

Query  466  FVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLK--FEDRAHNWTVKCKCGA  639
            FVV  I  L      +++F +VE G ++ ++G      G +   +E  A  + V C CGA
Sbjct  582  FVVDSIANLNNAKGTDLVFDMVEVGQKIVLEGRSSKRMGGVSEIYECGAVYYVVDCPCGA  641

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            ++DDGERM+SCD+CE+ QHT CV I D + VP +F+C  C
Sbjct  642  KEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  681



>ref|XP_006851139.1| hypothetical protein AMTR_s00043p00044190 [Amborella trichopoda]
 gb|ERN12720.1| hypothetical protein AMTR_s00043p00044190 [Amborella trichopoda]
Length=168

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 101/164 (62%), Gaps = 8/164 (5%)
 Frame = +1

Query  298  LRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVT  477
            +RF+  VV +  + E +      P E +V+PLH+++GDL+   +  + +TY  ME FV  
Sbjct  1    MRFMVSVVAAE-EEEGIFSSATTPPELVVLPLHASVGDLRAKAERILCNTYYLMEGFVEQ  59

Query  478  DI---KGLEGVGDDEVIFGIVESGTQL--FMKG-LGLAFAGDLKFEDRAHNWTVKCKCGA  639
            D+   +GLE V + E++F + + G  +  +++G  G + A  L++E  A  W ++C+CGA
Sbjct  60   DLIWPQGLE-VSEVELLFHVAQLGMGMGVWVRGKRGESGAASLRYEGGAEEWRMECECGA  118

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRL  771
            RDDDGERM++ D+CE+WQHT C+GI D + V  L  C+ C   L
Sbjct  119  RDDDGERMVASDLCEVWQHTWCLGIPDAEEVAHLCFCDRCASAL  162



>ref|XP_010999680.1| PREDICTED: PHD finger protein At1g33420-like [Populus euphratica]
Length=692

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 128/265 (48%), Gaps = 20/265 (8%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            VV    N ++   EY L+            +  P     + +T     ++  D+  LY N
Sbjct  424  VVRSRCNPSSGAFEYRLEP-------GNPSLNSPATTGSSVITCPSEGNLIQDLRFLYDN  476

Query  187  VL-----LGY---KESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            +L     + Y     SD +S +A+ +LD K F+K++   +          I +   +++ 
Sbjct  477  MLHPQTMMSYGPEATSDAIS-SARKLLDCKQFMKDYNKCETTASASNPPTICLSCEVEIV  535

Query  343  TVLPKGI--IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEV  516
              L + +  +P E IV+P ++T+ DLKL    A +D Y     F   ++ G  GV D   
Sbjct  536  DQLEENVPDLPPEIIVLPSNATVFDLKLEASRAFQDVYLMFRRFHAEELLGYSGVDDSTQ  595

Query  517  IFGIVESGTQLFMKG--LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIW  690
            +  ++ S   + +KG  LG    G  + E     WTV C+CGA+DDDGERM++CDVC +W
Sbjct  596  VKLLIGSTESVRVKGRCLGKNGLGKFRMERGTERWTVDCRCGAKDDDGERMLACDVCGVW  655

Query  691  QHTRCVGIKDDKAVPPLFVCEVCCG  765
            QHTRC GI D   VP  FVC  C G
Sbjct  656  QHTRCSGIPDSDPVPAKFVCVGCRG  680



>gb|KFK26332.1| hypothetical protein AALP_AA8G234100 [Arabis alpina]
Length=666

 Score =   124 bits (311),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 147/288 (51%), Gaps = 35/288 (12%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNR-DQTDQERVLVPEPDKPASLTA-----VPPVDVFG  162
            +Y+V R++N   +VLEY L+++ N     + E + +   ++ A  T      +    V  
Sbjct  380  NYLVRRSLNPVKKVLEYCLEDISNLLPSGNNELITIQNQNQMAKSTTNGHNKITRGQVMK  439

Query  163  DVFCLYSNVLLGYKES-------DVVSLAAQTILDTKHFVKEWPF----------RDELD  291
            D+   Y ++L+ YK         + + +A++ ILDTK+F+KE+ +           D  D
Sbjct  440  DMVYFYKHILMDYKGVLGPIGILNQIGMASRVILDTKYFIKEYHYIRDTSGKTFQLDRGD  499

Query  292  DLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFV  471
             L  F  I        E  +P    P+E IVV  ++ + ++    +   RD Y  + + V
Sbjct  500  KLGIFCTIARKCHHHNEIKMP----PQECIVVNKNAALSEVYGEAERVFRDIYWELRDVV  555

Query  472  V-TDIKGLEGVGD-DEVIF----GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKC  633
            V + + G + +   DE++     G+V  G    M  + +    D  ++++     ++C+C
Sbjct  556  VESTVDGQKDISRVDEMVLNGKKGLVLEGNVGMMMNIEVMKCYD--YDNKKKEKRIECEC  613

Query  634  GARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAP  777
            GA+++DGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P
Sbjct  614  GAKEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIP  661



>ref|XP_004156135.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Cucumis 
sativus]
Length=643

 Score =   124 bits (310),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 141/282 (50%), Gaps = 38/282 (13%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R +N  T+VLEY LQ++ +  +            KP     V  V++  D+  LY
Sbjct  380  NYLVRRTLNPVTKVLEYCLQDVCSSVEM-----------KPR--CKVGRVELAKDISNLY  426

Query  181  SNVLLGYKESDV------VSLAAQTILDTKHFVKEW------PFRDELDDLLRFICIVVP  324
              +L   K          +++A++ ILD+K  V E+          E++  L  +C +  
Sbjct  427  KYILGDQKPLQAKGILPNLTIASEIILDSKFLVNEYMSEPQTKLELEIEGKLNLLCTIRV  486

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
               +  T+LP      E I +  + TI +LK  ++   ++ Y  +  FVV  I  LE  G
Sbjct  487  KRQETTTILPY-----ECIALKNNGTIDELKKEVERNFKEIYWGLRSFVVKKIVDLEAKG  541

Query  505  DDEVIFGIVESGTQLFMKGLG-------LAFAGDLKFEDRAHNWTVKCKCGARDDDGERM  663
            +D ++FG+VE G +L  +G G       +    +       +   ++C CGA +DDGERM
Sbjct  542  ND-LVFGLVEVGGKLVFEGSGEDEGSFFMNNNNNTNNNGGMNKKIMECICGAMEDDGERM  600

Query  664  ISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            ++CD+CEIWQHTRCV I +++ VP +F+C  C   +A   +L
Sbjct  601  VACDICEIWQHTRCVQIPNEQQVPHIFICNRCDQEIALLHSL  642



>ref|XP_011005581.1| PREDICTED: PHD finger protein At1g33420-like isoform X2 [Populus 
euphratica]
Length=570

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 116/226 (51%), Gaps = 31/226 (14%)
 Frame = +1

Query  151  DVFGDVFCLYSNVLL-------GYK-ESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRF  306
            ++  D+  LY N+LL       G++  SD   ++A+ +LD K F+K++       +    
Sbjct  352  NLIQDLRFLYENMLLPQTMLSFGHEVTSDARIISARKLLDCKQFMKDY-------NKCET  404

Query  307  ICIVVPSSIDM----------ETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCA  456
              + VP+SI +          E  +P   +P E +V+P  +T+ DLK     A +D Y  
Sbjct  405  TVVSVPNSISLSCEVVIVDRLEENVPN--LPPETVVLPSSATVFDLKREASRAFQDVYLM  462

Query  457  MEEFVVTDIKGLEGVGDD---EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKC  627
               F   ++ G  GV D    +++ G  ES  QL  + LG    G  + E     WTV C
Sbjct  463  FRRFHAEELLGYSGVDDSTQVKLLIGSTES-VQLRGRCLGKNGLGKFRMERGTEGWTVDC  521

Query  628  KCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCG  765
             CGA+DDDGERM++CDVC +WQHTRC GI D  +VP  FVC  C G
Sbjct  522  CCGAKDDDGERMLACDVCGVWQHTRCSGIPDSDSVPTKFVCLRCRG  567



>ref|XP_011005579.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Populus 
euphratica]
Length=676

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 116/226 (51%), Gaps = 31/226 (14%)
 Frame = +1

Query  151  DVFGDVFCLYSNVLL-------GYK-ESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRF  306
            ++  D+  LY N+LL       G++  SD   ++A+ +LD K F+K++       +    
Sbjct  458  NLIQDLRFLYENMLLPQTMLSFGHEVTSDARIISARKLLDCKQFMKDY-------NKCET  510

Query  307  ICIVVPSSIDM----------ETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCA  456
              + VP+SI +          E  +P   +P E +V+P  +T+ DLK     A +D Y  
Sbjct  511  TVVSVPNSISLSCEVVIVDRLEENVPN--LPPETVVLPSSATVFDLKREASRAFQDVYLM  568

Query  457  MEEFVVTDIKGLEGVGDD---EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKC  627
               F   ++ G  GV D    +++ G  ES  QL  + LG    G  + E     WTV C
Sbjct  569  FRRFHAEELLGYSGVDDSTQVKLLIGSTES-VQLRGRCLGKNGLGKFRMERGTEGWTVDC  627

Query  628  KCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCG  765
             CGA+DDDGERM++CDVC +WQHTRC GI D  +VP  FVC  C G
Sbjct  628  CCGAKDDDGERMLACDVCGVWQHTRCSGIPDSDSVPTKFVCLRCRG  673



>ref|XP_007143927.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
 gb|ESW15921.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
Length=499

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 111/203 (55%), Gaps = 11/203 (5%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-PFRDELDDL--LRFICIVVPSSID  336
            L+  +++ Y E+   +LA    Q + D K FVK++ P    L DL  LR  C V    + 
Sbjct  261  LHPQMMVNYVEAGTRTLAMSSVQKLFDCKQFVKDYSPELLPLSDLHKLRISCQV---ELV  317

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEV  516
             E+  P+ I P E IV+P+++T+ +LK     A +D Y     F V +++G  GV D  +
Sbjct  318  DESEDPEVIAPPELIVLPMNATVAELKSQAANAFQDVYLMFRRFQVDELEGYSGVEDSTL  377

Query  517  IFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIW  690
            +  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C +W
Sbjct  378  VKLLLGSKDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICGVW  437

Query  691  QHTRCVGIKDDKAVPPLFVCEVC  759
            +HTRC  I D   VP  FVC  C
Sbjct  438  RHTRCSDIHDTDPVPARFVCLKC  460



>gb|KEH42842.1| PHD finger plant-like protein [Medicago truncatula]
Length=537

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 19/207 (9%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-----PFRDELDDLLRFICIV--VP  324
            L+  ++L Y + +  +LA   AQ +LD K  VK++     P  D     LR  C V  V 
Sbjct  298  LHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYCSEMLPVSDLYK--LRISCQVELVD  355

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
             S D E       IP E IV+P+++T+ DLK+    A ++ Y    +F V ++ G  GV 
Sbjct  356  QSEDTEAK-----IPPEIIVLPMNATVSDLKIEAAKAFQEVYLMFRKFQVDELVGYGGVE  410

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDV  678
            D   +  ++ S   + ++G      G  KF  E     WTV+C CGA+DDDGERM++CD+
Sbjct  411  DSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMERGLERWTVECSCGAKDDDGERMMACDM  470

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            C +W+HTRC GI D   VP  FVC  C
Sbjct  471  CGVWRHTRCFGIPDTAPVPARFVCSRC  497



>gb|KEH42841.1| PHD finger plant-like protein [Medicago truncatula]
Length=565

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 19/207 (9%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-----PFRDELDDLLRFICIV--VP  324
            L+  ++L Y + +  +LA   AQ +LD K  VK++     P  D     LR  C V  V 
Sbjct  326  LHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYCSEMLPVSDLYK--LRISCQVELVD  383

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
             S D E       IP E IV+P+++T+ DLK+    A ++ Y    +F V ++ G  GV 
Sbjct  384  QSEDTEAK-----IPPEIIVLPMNATVSDLKIEAAKAFQEVYLMFRKFQVDELVGYGGVE  438

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDV  678
            D   +  ++ S   + ++G      G  KF  E     WTV+C CGA+DDDGERM++CD+
Sbjct  439  DSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMERGLERWTVECSCGAKDDDGERMMACDM  498

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            C +W+HTRC GI D   VP  FVC  C
Sbjct  499  CGVWRHTRCFGIPDTAPVPARFVCSRC  525



>ref|XP_004956970.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Setaria 
italica]
Length=665

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 135/284 (48%), Gaps = 40/284 (14%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAV------PPVDVFG  162
            +YVV RA+N  T+VLEY L+++ +        VL      P+    V          +  
Sbjct  380  NYVVRRAMNPVTKVLEYCLEDVSS--------VLPAAGSVPSGGCKVRVRFQLTRAQLMR  431

Query  163  DVFCLYSNVL------LGYKESDVVSLAAQTILDTKHFVKEW--PFRDELDDLLRFICIV  318
            D+  LY +VL      L       + +A + +LDTKHFVK++   F          + I 
Sbjct  432  DLAHLYRHVLKEPSQALTAGALGAIPVAVRMVLDTKHFVKDYHEGFAPVSSVGAGHVHIS  491

Query  319  VPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG  498
            +  ++ +    P+ + P E + +P H+T+G+LK  +Q   R+ Y  +  F    + G+ G
Sbjct  492  LCCTLLVRDGTPELVAPYETVTLPAHATVGELKWEVQRLFREMYLGLRTFTAESVVGV-G  550

Query  499  VGDDEV-IFGIVESGTQLFMKG--------LGLAFAGDLKFEDRAH--------NWTVKC  627
            V  D   + G+++ G+ + ++G        L  A  G L   + A            V C
Sbjct  551  VSQDACPVLGLIDVGSAVVVEGYVGEQQQQLAAADEGVLPGNEVAAVSEGGCDGERVVDC  610

Query  628  KCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
             CGA DDDGERM  CD+CE WQHTRC GIKD   VP +FVC  C
Sbjct  611  VCGADDDDGERMACCDICEAWQHTRCAGIKDTDDVPHVFVCSRC  654



>ref|XP_009604856.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Nicotiana tomentosiformis]
Length=670

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/266 (28%), Positives = 130/266 (49%), Gaps = 17/266 (6%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R +N  T+VLEY L+++        +   V +  K      +  V +  D++ LY 
Sbjct  397  YLVRRCLNPVTKVLEYCLEDISKAFPKHDQGFWVND-SKGNQQYKITWVQLMKDIYFLYK  455

Query  184  NVLLGYKES-------DVVSLAAQTILDTKHFVKEWPFRDELD-----DLLRFICIVVPS  327
            N+L   K           +   ++ ILD K+F+KE  ++ E D     D  +  C ++  
Sbjct  456  NILKEIKGMPNYTGIFAAIPTTSRIILDAKYFLKE--YKGESDSRIEVDKSKIYCAIMLV  513

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
            + +   V  K + P E  ++    T  +L + ++    + Y  +  F +  I  L  +  
Sbjct  514  TKNGFGVEEKVMTPFECFILRKDVTFDELMIEVERTFGNIYWGLRNFAIRSINNLSPIIG  573

Query  508  DEVIFGIVESGTQLFMKGL--GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVC  681
             E++F +++ G ++ + G+   +       FE    N  V C CG +D+DGERM+ CD+C
Sbjct  574  TELVFNVMKPGNKIVLGGVMSNIDHNNIGIFEGIKDNIVVDCLCGTKDEDGERMVCCDIC  633

Query  682  EIWQHTRCVGIKDDKAVPPLFVCEVC  759
            E+WQHTRCV I + +A+P +F+C  C
Sbjct  634  EVWQHTRCVNIPNQEAIPDIFLCSKC  659



>ref|XP_002325292.2| hypothetical protein POPTR_0019s00330g [Populus trichocarpa]
 gb|EEE99673.2| hypothetical protein POPTR_0019s00330g [Populus trichocarpa]
Length=683

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/265 (31%), Positives = 126/265 (48%), Gaps = 20/265 (8%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +V    N ++   EY L+            +  P     + +T     ++  D+  LY N
Sbjct  415  IVRSRCNPSSGAFEYRLEP-------GNPSLNSPATTGSSVITCPSEGNLIQDLRFLYDN  467

Query  187  VLLGY--------KESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDME  342
            +L             SD +S +A+ +LD K F+K++   +          I +   +++ 
Sbjct  468  MLHPQTMMSSGPEATSDAIS-SARKLLDCKQFMKDYNKCETTSSPSNPPTICLSCQVEIV  526

Query  343  TVLPKGI--IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEV  516
              L + +  +P E IV+P ++T+ DLKL    A +D Y     F   ++ G  GV D   
Sbjct  527  DQLEENVPDLPPEIIVLPSNATVFDLKLEASRAFQDVYLMFRRFHAEELLGYSGVDDSTQ  586

Query  517  IFGIVESGTQLFMKG--LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIW  690
            +  ++ S   + ++G  LG    G  + E     WTV C+CGA+DDDGERM++CDVC +W
Sbjct  587  VKLLIGSTESVRVQGRCLGKNGLGKFRMERGTERWTVDCRCGAKDDDGERMLACDVCGVW  646

Query  691  QHTRCVGIKDDKAVPPLFVCEVCCG  765
            QHTRC GI D   VP  FVC  C G
Sbjct  647  QHTRCSGIPDSDPVPAKFVCVGCRG  671



>gb|KEH42843.1| PHD finger plant-like protein [Medicago truncatula]
Length=707

 Score =   122 bits (305),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 19/207 (9%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-----PFRDELDDLLRFICIV--VP  324
            L+  ++L Y + +  +LA   AQ +LD K  VK++     P  D     LR  C V  V 
Sbjct  468  LHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYCSEMLPVSDLYK--LRISCQVELVD  525

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
             S D E       IP E IV+P+++T+ DLK+    A ++ Y    +F V ++ G  GV 
Sbjct  526  QSEDTEAK-----IPPEIIVLPMNATVSDLKIEAAKAFQEVYLMFRKFQVDELVGYGGVE  580

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDV  678
            D   +  ++ S   + ++G      G  KF  E     WTV+C CGA+DDDGERM++CD+
Sbjct  581  DSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMERGLERWTVECSCGAKDDDGERMMACDM  640

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            C +W+HTRC GI D   VP  FVC  C
Sbjct  641  CGVWRHTRCFGIPDTAPVPARFVCSRC  667



>ref|XP_010421013.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Camelina sativa]
Length=684

 Score =   121 bits (304),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 146/306 (48%), Gaps = 57/306 (19%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPAS------LTAVPPVDVFG  162
            +Y+V R++N   +VLEY L+++ N   +    ++ P+               +    V  
Sbjct  384  NYLVRRSLNPVKKVLEYCLEDISNLLPSSNNELITPQNQNSMGKMTTNGHNKITRGQVMK  443

Query  163  DVFCLYSNVLLGYKES--------DVVSLAAQTILDTKHFVKEWPF-RD------ELD--  291
            D+F  Y ++L+ YK          + + +A++ ILD K+F+KE+ + RD       LD  
Sbjct  444  DMFYFYKHILMDYKGVLCPTGGILNQIGMASRAILDAKYFIKEYHYIRDTSTKTLHLDGG  503

Query  292  DLLRFICIVV---PSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAME  462
            D L   C +        + E  +P    P+E IVV   +T+ ++ +  +   RD Y  + 
Sbjct  504  DKLGIFCTIARKYHHHHNNEIAMP----PQECIVVNKDATLSEVYVEAERVFRDIYWELR  559

Query  463  EFVVTDIKGLEGVGDDEVIFGIVESGTQL--------FMKGL-GLAFAGDLKF-------  594
            + VV      E V D +     V+   ++         M G  GL   G++         
Sbjct  560  DVVV------ESVADGQREITRVDGQREITRVDEMVTLMNGTKGLVLEGNIGMMMNVEVM  613

Query  595  -----EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
                 +++     ++C+CGA+++DGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C
Sbjct  614  KCYENDNKKKVKRIECECGAKEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSC  673

Query  760  CGRLAP  777
               L P
Sbjct  674  DQHLIP  679



>ref|XP_007143926.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
 gb|ESW15920.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
Length=712

 Score =   121 bits (304),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 111/203 (55%), Gaps = 11/203 (5%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-PFRDELDDL--LRFICIVVPSSID  336
            L+  +++ Y E+   +LA    Q + D K FVK++ P    L DL  LR  C V    + 
Sbjct  474  LHPQMMVNYVEAGTRTLAMSSVQKLFDCKQFVKDYSPELLPLSDLHKLRISCQV---ELV  530

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEV  516
             E+  P+ I P E IV+P+++T+ +LK     A +D Y     F V +++G  GV D  +
Sbjct  531  DESEDPEVIAPPELIVLPMNATVAELKSQAANAFQDVYLMFRRFQVDELEGYSGVEDSTL  590

Query  517  IFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIW  690
            +  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C +W
Sbjct  591  VKLLLGSKDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICGVW  650

Query  691  QHTRCVGIKDDKAVPPLFVCEVC  759
            +HTRC  I D   VP  FVC  C
Sbjct  651  RHTRCSDIHDTDPVPARFVCLKC  673



>ref|XP_003622362.1| PHD finger protein [Medicago truncatula]
Length=655

 Score =   121 bits (303),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 19/207 (9%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-----PFRDELDDLLRFICIV--VP  324
            L+  ++L Y + +  +LA   AQ +LD K  VK++     P  D     LR  C V  V 
Sbjct  416  LHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYCSEMLPVSDLYK--LRISCQVELVD  473

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
             S D E       IP E IV+P+++T+ DLK+    A ++ Y    +F V ++ G  GV 
Sbjct  474  QSEDTEAK-----IPPEIIVLPMNATVSDLKIEAAKAFQEVYLMFRKFQVDELVGYGGVE  528

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDV  678
            D   +  ++ S   + ++G      G  KF  E     WTV+C CGA+DDDGERM++CD+
Sbjct  529  DSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMERGLERWTVECSCGAKDDDGERMMACDM  588

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            C +W+HTRC GI D   VP  FVC  C
Sbjct  589  CGVWRHTRCFGIPDTAPVPARFVCSRC  615



>ref|XP_010917298.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Elaeis guineensis]
Length=653

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 143/265 (54%), Gaps = 17/265 (6%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +V R VN  T+VLEY L+++ +    + + +    P K      +  V +  D+  LY +
Sbjct  380  IVRRMVNPVTKVLEYCLEDIPSVF-PNLDGLPSGGPAKTRVGFQITRVQIMRDMLYLYKH  438

Query  187  VLLGYKES------DVVSLAAQTILDTKHFVKEW-----PFRD-ELDDLLRFICIV-VPS  327
            +L   + +        + +A + ILD KH VK++     P R+ E +  ++ +C V + +
Sbjct  439  ILKEQRPTIATGIFGAIPMAVRMILDIKHLVKDYGERFPPIREVESNGPMKLMCKVRIRN  498

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGD-LKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
                E  + K + P + + VP+H+ IG+ LK  ++   R+TY  ++ F    +  ++G  
Sbjct  499  DQTKEESIMKELPPYDTVAVPIHARIGNYLKEEVERYFRETYWGLKSFTAEKLIDVKG-K  557

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCE  684
            D +++   ++ G+ + ++G  +    +  +E    N  V C CGAR++DGERM+ CD+CE
Sbjct  558  DSDLVSEEIKPGSSIIVEGR-IEKNDEEIYEGGKLNGMVDCLCGAREEDGERMVCCDICE  616

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVC  759
            IWQHTRCV I +++ +P +F+C  C
Sbjct  617  IWQHTRCVRIPNNEDIPHVFLCSPC  641



>ref|XP_003622361.1| PHD finger protein [Medicago truncatula]
Length=797

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 19/207 (9%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-----PFRDELDDLLRFICIV--VP  324
            L+  ++L Y + +  +LA   AQ +LD K  VK++     P  D     LR  C V  V 
Sbjct  558  LHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYCSEMLPVSDLYK--LRISCQVELVD  615

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
             S D E       IP E IV+P+++T+ DLK+    A ++ Y    +F V ++ G  GV 
Sbjct  616  QSEDTEAK-----IPPEIIVLPMNATVSDLKIEAAKAFQEVYLMFRKFQVDELVGYGGVE  670

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDV  678
            D   +  ++ S   + ++G      G  KF  E     WTV+C CGA+DDDGERM++CD+
Sbjct  671  DSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMERGLERWTVECSCGAKDDDGERMMACDM  730

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            C +W+HTRC GI D   VP  FVC  C
Sbjct  731  CGVWRHTRCFGIPDTAPVPARFVCSRC  757



>ref|XP_002305350.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa]
 gb|EEE85861.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa]
Length=688

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 118/219 (54%), Gaps = 17/219 (8%)
 Frame = +1

Query  151  DVFGDVFCLYSNVLL-------GYK-ESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRF  306
            ++  D+  LY N+LL       G++  SD   ++A+ +LD K F+K++   ++ +  +  
Sbjct  470  NLIQDLRFLYENMLLPQTMLSFGHEVTSDAGIISARKLLDCKQFMKDY---NKCETTVAS  526

Query  307  ICIVVPSSIDMETV--LPKGI--IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVV  474
            +   +  S ++E V  L + +  +P E +V+P ++T+ DLK     A +D Y     F  
Sbjct  527  VPNTIFLSCEVEIVDQLEENVPNLPPETVVLPSNATVFDLKREASRAFQDVYLMFRRFHA  586

Query  475  TDIKGLEGVGDDEVIFGIVESGTQLFMKG--LGLAFAGDLKFEDRAHNWTVKCKCGARDD  648
             ++ G  GV D   +  ++ S   +  +G  LG    G  + E     WTV C CGA+DD
Sbjct  587  EELLGYSGVDDSTQVKLLIGSAESVQFRGRCLGKNGLGKFRMERGTEGWTVDCCCGAKDD  646

Query  649  DGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCG  765
            DGERM++CDVC +WQHTRC GI D  +VP  FVC  C G
Sbjct  647  DGERMLACDVCGVWQHTRCSGIPDSDSVPAKFVCLRCRG  685



>ref|XP_008806642.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Phoenix dactylifera]
Length=652

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/278 (30%), Positives = 142/278 (51%), Gaps = 40/278 (14%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPD--------KPASLTAVPPVDV  156
            +Y+V R VN  T+VLEY L+++ +         + P  D        K      +  V +
Sbjct  378  NYIVRRMVNPVTKVLEYCLEDISS---------VFPNLDGLPSGGHWKARVGFQITRVQI  428

Query  157  FGDVFCLYSNVLLGYKES------DVVSLAAQTILDTKHFVK--EWPFRD----ELDDLL  300
              D+  LY ++L   + +        + +A + ILD KH VK  E PF      E    +
Sbjct  429  MRDMLYLYKHILKEQRPTTATGIFGAIPMAVRMILDIKHLVKDCEEPFPSVREVESKGHM  488

Query  301  RFICIVV--PSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFV-  471
            +  C+V        +E  + K + P + + +P+H+ + +LK  ++   R+TY  ++ FV 
Sbjct  489  KLTCMVRIRNDQTKVENTM-KELPPYDIVAIPIHARMANLKEDVERYFRETYWGLKSFVA  547

Query  472  --VTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARD  645
              + D KG     D +++   ++SGT + ++G  +    +  +E   +N  V C CGAR+
Sbjct  548  EMLIDAKG----EDSDLVSEEIKSGTSIIVEGR-IEKDEEEIYECGKNNGMVDCPCGARE  602

Query  646  DDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            +DGERM+ CD+CE+WQHTRCV I +D+ +P +F+C  C
Sbjct  603  EDGERMVCCDICEVWQHTRCVRIPNDEDIPHVFLCRQC  640



>ref|XP_010112064.1| PHD finger protein [Morus notabilis]
 gb|EXC32483.1| PHD finger protein [Morus notabilis]
Length=732

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/266 (32%), Positives = 124/266 (47%), Gaps = 32/266 (12%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            VVH   N  +  +EY L+ L + +       + P  ++           V  D+  LY +
Sbjct  433  VVHSHCNPTSSTIEYRLEPLSSTNARSGVNFVYPSEEQ-----------VLRDLRFLYES  481

Query  187  VL-----LGYKES---DVVSLAAQTILDTKHFVKEWPFRD---ELDDLLRFICIVVPSSI  333
             L     + YK     D V  +A  +LD K FVK +       E    +   C V  S  
Sbjct  482  FLHPDTMVSYKPQRIRDQVIDSATKLLDCKQFVKVYVSETAAVESPQAIHLWCDVQLSD-  540

Query  334  DMETVLPKG--IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
                  PKG  ++P E IV+PL++ +  LK A+  A R+ Y   + F   ++ G   + D
Sbjct  541  -----QPKGEPVVPPELIVLPLNANVAGLKSAVTQAFREVYPMFKRFQAEELVGYGSIDD  595

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVC  681
               +  +V +G  + + G   A  G  +F  E    +WTV C CGA+DDDGERM++CD C
Sbjct  596  SITVKFLVGTGGSVRLAGKCAAKHGLNRFRMERGIESWTVSCSCGAKDDDGERMLACDTC  655

Query  682  EIWQHTRCVGIKDDKAVPPLFVCEVC  759
             +WQH RCVGI +   +P  FVC  C
Sbjct  656  GVWQHIRCVGIANSDEIPAKFVCLKC  681



>ref|XP_006589256.1| PREDICTED: PHD finger protein At1g33420-like isoform X2 [Glycine 
max]
Length=566

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 107/204 (52%), Gaps = 14/204 (7%)
 Frame = +1

Query  175  LYSNVLLGYKESD--VVSLAAQTILDTKHFVKEW-----PFRDELDDLLRFICIVVPSSI  333
            L+  +++ Y+     +V  +AQ + D K FVK++     P  D    + R  C V    +
Sbjct  330  LHPQMMVNYEAGTRTLVMSSAQKLFDCKQFVKDYNPEMLPLSDS--QMFRLSCHV---EL  384

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
              E    + I P E IV+PL++T+ +LK     A +D Y     F V ++ G  GV D  
Sbjct  385  VDEFEDSEAITPPELIVLPLNATVAELKNQAANAFQDVYLMFRRFQVDELHGYSGVDDST  444

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
            ++  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C +
Sbjct  445  LVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICGV  504

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            W+HTRC  I D   VP  FVC+ C
Sbjct  505  WRHTRCSDIHDTDPVPARFVCQKC  528



>ref|XP_011070715.1| PREDICTED: PHD finger protein At2g01810 [Sesamum indicum]
Length=582

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 110/198 (56%), Gaps = 25/198 (13%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            +V RA+N  +R+ E+++ E                  +P +   +   D+  DV  L  N
Sbjct  389  IVRRAINPFSRLAEFSIHE-----------------TQPGTCIELR-FDLSQDVRFLCDN  430

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII  366
            VL GY E+ +V       L +  FVKEWP + E  + ++  C V+P+  ++ET   +   
Sbjct  431  VLAGYSETRLV-------LCSNSFVKEWPVKGETTNQMKLTCKVLPTFDELETQFTRPSS  483

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQ  546
            P E +VV    TIGDLK+  Q AMRDTYC M+EFVV+ I GL  + D++V+  +V+ G Q
Sbjct  484  PGEIVVVEPWITIGDLKMVAQWAMRDTYCIMDEFVVSQIGGLRKIDDEKVVRSMVDDGAQ  543

Query  547  LFMKGLGLAFAGDLKFED  600
            ++++G GL ++  LK+ED
Sbjct  544  VWVRGYGLDWSTSLKYED  561



>gb|KHN30528.1| PHD finger protein [Glycine soja]
Length=589

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 107/204 (52%), Gaps = 14/204 (7%)
 Frame = +1

Query  175  LYSNVLLGYKESD--VVSLAAQTILDTKHFVKEW-----PFRDELDDLLRFICIVVPSSI  333
            L+  +++ Y+     +V  +AQ + D K FVK++     P  D    + R  C V    +
Sbjct  353  LHPQMMVNYEAGTRTLVMSSAQKLFDCKQFVKDYNPEMLPLSDS--QMFRLSCHV---EL  407

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
              E    + I P E IV+PL++T+ +LK     A +D Y     F V ++ G  GV D  
Sbjct  408  VDEFEDSEAITPPELIVLPLNATVAELKNQAANAFQDVYLMFRRFQVDELHGYSGVDDST  467

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
            ++  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C +
Sbjct  468  LVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICGV  527

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            W+HTRC  I D   VP  FVC+ C
Sbjct  528  WRHTRCSDIHDTDPVPARFVCQKC  551



>ref|XP_002518819.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43744.1| DNA binding protein, putative [Ricinus communis]
Length=677

 Score =   119 bits (298),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 101/188 (54%), Gaps = 7/188 (4%)
 Frame = +1

Query  211  DVVSLAAQTILDTKHFVKEWPFRD-ELDDLLRFICIVVPSSI--DMETVLPKGIIPKEHI  381
            D  S +A+ +LD K FVKE+   +         +C+     I  +ME   P    P E I
Sbjct  480  DFASGSAEKLLDCKQFVKEYMAENIPPTTNPSVLCLSCNVEIMDEMEENSPNH--PPELI  537

Query  382  VVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKG  561
            V+P ++T+ DLKL    A ++ Y   + F   ++ G  GV D   +  ++ES   + ++G
Sbjct  538  VLPPNATVSDLKLEASRAFQEVYLMFKRFRGEELLGYSGVDDSTQVKLLLESVECVVVRG  597

Query  562  --LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVP  735
              LG    G  + E     WT+ C CGA++DDGERM++CDVC +WQHTRC GI D  +VP
Sbjct  598  RCLGKNGLGKYRMERGIERWTIDCSCGAKNDDGERMLACDVCGVWQHTRCSGILDSDSVP  657

Query  736  PLFVCEVC  759
              F+C  C
Sbjct  658  AKFICRRC  665



>ref|XP_004288656.1| PREDICTED: PHD finger protein At1g33420-like [Fragaria vesca 
subsp. vesca]
Length=700

 Score =   119 bits (298),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 106/197 (54%), Gaps = 4/197 (2%)
 Frame = +1

Query  211  DVVSLAAQTILDTKHFVKEW-PFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVV  387
            D+    A+ +LD K FVK++ P R    D     C++       E+     + P   ++V
Sbjct  479  DLAVSCAEKLLDCKQFVKDYKPERMSTKDP-SLTCVLCRVEFTDESEEYSTLDPPPELIV  537

Query  388  PLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLG  567
              ++T+ DLK+A   A +D Y  ++ F   ++    GV +   +  ++ SG  + ++G  
Sbjct  538  LTNATVSDLKVAASKAFQDVYLVLKRFQAEELVDYGGVDESTQVKKLLGSGEYVRVRGRC  597

Query  568  LAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPL  741
             A +G  KF  E     WTV+C CGA+DDDGERM++CD+C +W+HTRC GI D  +VP  
Sbjct  598  NAKSGWSKFSMERGMERWTVECSCGAKDDDGERMMACDLCGVWRHTRCSGIPDSDSVPAS  657

Query  742  FVCEVCCGRLAPTRTLG  792
            FVC+ C   +  T+  G
Sbjct  658  FVCQGCKNSVPVTQNAG  674



>ref|XP_002460302.1| hypothetical protein SORBIDRAFT_02g026200 [Sorghum bicolor]
 gb|EER96823.1| hypothetical protein SORBIDRAFT_02g026200 [Sorghum bicolor]
Length=668

 Score =   119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 130/283 (46%), Gaps = 43/283 (15%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAV----PPVDVFGDV  168
            +YVV RA+N  T+VLEY L+++ +         ++P          V        +  D+
Sbjct  387  NYVVRRAMNPVTKVLEYCLEDVSS---------VLPAVGGGGGKMRVRFQLTRAQLMRDL  437

Query  169  FCLYSNVL------LGYKESDVVSLAAQTILDTKHFVKEW-----PFRD--ELDDLLRFI  309
              LY +VL      L       + +AA+ +LDTKHFVK++     P          +   
Sbjct  438  THLYRHVLREPSQALTTGAFGAIPVAARMVLDTKHFVKDYHEGFAPINSVGAGHVHMNLC  497

Query  310  CIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKG  489
            C ++  +   E V P    P E + +P H+T+G+LK  +Q   R+ Y  +  F    + G
Sbjct  498  CTLLVRNGSPELVAP----PYETVTLPAHATVGELKWEVQRLFREMYLGLRTFTAESVAG  553

Query  490  LEGVGDDEVIFGIVESGTQLFMKGL-----GLAFAGDLKFEDRA--------HNWTVKCK  630
            +    D   + G+++ G+ + ++G       LA  G     + A            V C 
Sbjct  554  VGVSKDACPVLGLIDVGSAVVIEGTVVEQQQLADEGVQPGNEAAAVSEGGGDSERIVDCA  613

Query  631  CGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            CGA D+DGERM  CD+CE WQHTRC GIKD    P +FVC  C
Sbjct  614  CGADDEDGERMACCDICEAWQHTRCAGIKDTDDAPHVFVCNRC  656



>ref|XP_009366883.1| PREDICTED: PHD finger protein At1g33420 [Pyrus x bretschneideri]
Length=665

 Score =   119 bits (297),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 101/189 (53%), Gaps = 9/189 (5%)
 Frame = +1

Query  226  AAQTILDTKHFVKEW-PFR--DELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLH  396
            AA  +LD K FVK++ P++  +E    +   C V  S    +      ++P E IV+PL 
Sbjct  478  AATKLLDCKQFVKDYKPYKMAEESSFGIHLWCHVALSDESKDDF----VLPPELIVLPLS  533

Query  397  STIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAF  576
            +T+ DLK     A ++ Y   + F V ++ G   + D   +  ++ S   + +KG  LA 
Sbjct  534  ATVADLKREATTAFQEVYAMFKRFEVEELLGYGSIKDSFTVKLLLGSCGSIPLKGRCLAK  593

Query  577  AGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVC  750
             G  +F  E    +WTV C CGA+DDDGERM++CD C +WQHTRC GI     +P  FVC
Sbjct  594  HGLNRFRMERGIESWTVDCTCGAKDDDGERMLACDTCGVWQHTRCAGIHSSDEMPAKFVC  653

Query  751  EVCCGRLAP  777
              C  + +P
Sbjct  654  MRCVSQESP  662



>ref|XP_003536185.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Glycine 
max]
Length=707

 Score =   119 bits (297),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 107/204 (52%), Gaps = 14/204 (7%)
 Frame = +1

Query  175  LYSNVLLGYKESD--VVSLAAQTILDTKHFVKEW-----PFRDELDDLLRFICIVVPSSI  333
            L+  +++ Y+     +V  +AQ + D K FVK++     P  D    + R  C V    +
Sbjct  471  LHPQMMVNYEAGTRTLVMSSAQKLFDCKQFVKDYNPEMLPLSDS--QMFRLSCHV---EL  525

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDE  513
              E    + I P E IV+PL++T+ +LK     A +D Y     F V ++ G  GV D  
Sbjct  526  VDEFEDSEAITPPELIVLPLNATVAELKNQAANAFQDVYLMFRRFQVDELHGYSGVDDST  585

Query  514  VIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
            ++  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C +
Sbjct  586  LVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICGV  645

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            W+HTRC  I D   VP  FVC+ C
Sbjct  646  WRHTRCSDIHDTDPVPARFVCQKC  669



>ref|XP_007514134.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15571.1| predicted protein [Bathycoccus prasinos]
Length=1020

 Score =   119 bits (298),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 116/257 (45%), Gaps = 47/257 (18%)
 Frame = +1

Query  127  SLTAVPPVDVFGDVFCLYSNVLLGYKESDV--------------VSLAAQTILDTKHFVK  264
            +++ +   DV  D+  +Y + L  YK + V              ++ AA+ +LDTK FVK
Sbjct  742  AISELTAYDVDKDLRAVYRDCLESYKPARVQIGNKIRVTCKGAHLTNAARVLLDTKQFVK  801

Query  265  EWPFRDELDDLLRFIC-----------IVVPSSIDMETVLPK-----GII----------  366
             +    ++DDLL               ++V + ID     PK     G I          
Sbjct  802  TY---IDIDDLLHLSVPANVKNLKPTRVLVTAIIDRSNSGPKVSGLGGAIMGKNRRKLGV  858

Query  367  ----PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVE  534
                P E +++P+  T+G+LK     A  D Y  + +F VT IKG E + D   +     
Sbjct  859  ESKPPPEIVLLPVPCTLGELKKEATKAFADLYVILSKFKVTAIKGYENLPDSTRLNKNSL  918

Query  535  SGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGI  714
                  + G G     + +++     W V C CG  DDDGERMI+CD CEIW HTRCVGI
Sbjct  919  QYAHAEVMGEGADLESEYRYQGGLDQWVVNCHCGTNDDDGERMIACDRCEIWMHTRCVGI  978

Query  715  KDDKAVPPLFVCEVCCG  765
            +D+   P  F C  C G
Sbjct  979  EDEAKTPKRFTCHECEG  995



>ref|XP_004298641.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Fragaria 
vesca subsp. vesca]
Length=698

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 84/291 (29%), Positives = 137/291 (47%), Gaps = 41/291 (14%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N  T+VLEY L +L N        V+     K      +    +  D+F LY
Sbjct  401  NYLVRRSLNPVTKVLEYCLDDLSNVSPNQDGNVMTN--SKVKGWYKISRFQLMKDMFYLY  458

Query  181  SNVLLGYKES--------DVVSLAAQTILDTKHFVKEWP-----FRDEL--DDLLRFICI  315
              +L     S          + +A + IL +K+ VK++       + EL  +      C 
Sbjct  459  KYILKDQNLSTSATTGIFSAIPMAVRIILHSKYLVKDYSGGLPQVKLELGPEGKSNIYCT  518

Query  316  VVPSS----IDMETVLPKGII---PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVV  474
            V+  +     D   ++    I   P E I +  ++TI DLKL ++   ++ Y  ++ FVV
Sbjct  519  VMIRNSTQVFDHNKMISSNEIALPPYECITLKNNATINDLKLEVERNFKEIYWGLKSFVV  578

Query  475  TDIKG--LEGVGDDEVIFGIVESGTQLFMKG--------------LGLAFAGDLKFEDRA  606
              I    ++     + +FG+VE G ++ ++G              L     G +  E  +
Sbjct  579  ETIANSIMDNANGTDTVFGLVEVGGKIVLEGSNKDMRGGGVGGVGLDRELEGPIS-ECGS  637

Query  607  HNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
             N  V C CGA+DDDGERM+ CD+CE+WQHT CV I +++ VP +F+C  C
Sbjct  638  GNCIVDCPCGAKDDDGERMVCCDICEVWQHTLCVRIPNNEQVPHIFLCNRC  688



>ref|XP_010674317.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Beta vulgaris 
subsp. vulgaris]
Length=676

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/283 (28%), Positives = 140/283 (49%), Gaps = 45/283 (16%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y+V R++N  T+VLEY L+++        +  L+    K +++  V    +  D+  LY 
Sbjct  396  YLVRRSLNPVTKVLEYCLEDI----SLSHDHGLMMSESK-SNMIPVTRAQLAKDILYLYK  450

Query  184  NVLLGYK----ESDVVSLAAQTILDTKHFVKEWPFRDEL---------DDLLRFICIVVP  324
            + L   K    +   + +A++ ILDTKH  K++ +   L         D+L+   C +  
Sbjct  451  STLREKKPISGQGSTILIASRVILDTKHLSKDFNYHQNLPLGNKFSIGDELVDLFCTL--  508

Query  325  SSIDMETVLPKGII-PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGV  501
                   +  K I+ P EH+ V  + TI +LK  ++   +D Y  ++  V+  I  +   
Sbjct  509  ------QLKDKQIMEPYEHVKVKGNITIEELKREVEKWFKDMYWGLKGLVIQSIVNVNA-  561

Query  502  GDDEVIFGIVESGTQLFMK------------GLGLAFAGDLKFE--DRAHNWT---VKCK  630
             + + + G++E    + ++            G G    G  ++E  + +HN     + C 
Sbjct  562  NETDFVCGVIEEAKDIILEAGFIGDGSRNENGNGSLMQGWNRYELKNYSHNQGYGCIDCA  621

Query  631  CGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            CG ++DDGERM++CD+CE+WQHTRCV I +++ VP +F C+ C
Sbjct  622  CGTKEDDGERMVACDICEVWQHTRCVRIPNNEEVPRIFFCDRC  664



>ref|XP_006826582.1| hypothetical protein AMTR_s00138p00035380 [Amborella trichopoda]
 gb|ERM93819.1| hypothetical protein AMTR_s00138p00035380 [Amborella trichopoda]
Length=236

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 107/205 (52%), Gaps = 9/205 (4%)
 Frame = +1

Query  22   VNRATRVLEYTLQ--ELKNRDQTDQERVLVPEP-DKPASLTAVPP-VDVFGDVFCLYSNV  189
            VN  T+VLEY+L   EL   D  +       E  D P +   V    ++  D+  +Y  V
Sbjct  31   VNPKTKVLEYSLSTTELDYWDGEEATETRKYESQDHPQNQIQVGRRSEIERDLEYVYRTV  90

Query  190  LLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIP  369
            L G     VV  A + +LD KHF KEWP RD  D+ LRF+   V +  D   +  +   P
Sbjct  91   LEGGLGGKVVEAATRVVLDMKHFAKEWPIRD-ADEQLRFMVSAVAAE-DEAGMFSRATPP  148

Query  370  KEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG--VGDDEVIFGIVESGT  543
             E +VVPLH+T+GDL+   + A RDTYC ME F   D+    G  + + E+++G+ ESG 
Sbjct  149  PELVVVPLHATVGDLRAEAEHAFRDTYCIMEGFAAEDLIWPHGQEISESELLYGVAESGM  208

Query  544  QLFMKGLGLAF-AGDLKFEDRAHNW  615
             ++++G G    A  L++E  A  W
Sbjct  209  GVWVRGRGAERGAARLRYEGGAEEW  233



>ref|XP_007019721.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 ref|XP_007019722.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 ref|XP_007019723.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 ref|XP_007019724.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16946.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16947.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16948.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16949.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
Length=474

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/261 (33%), Positives = 127/261 (49%), Gaps = 34/261 (13%)
 Frame = +1

Query  70   NRDQTDQERVLVPEPDKP--ASLTAVPPVD--VFGDVFCLYSNVL-----LGYKES---D  213
            N + +D E  L P    P  +SL +  P +  + GD+  L+ ++L     L Y+     +
Sbjct  190  NPNSSDIEFRLQPLSSVPNESSLYSNCPSEEHIKGDLKFLFDSLLHPETMLTYRPQATRE  249

Query  214  VVSLAAQTILDTKHFVKEW------PFRDELDDLLRFICIVVPSSIDMETVLPKG--IIP  369
             V  +A  +LD K FVK++      PF          IC+     +  +   PK   + P
Sbjct  250  CVIDSATKLLDCKQFVKDYKPYAYNPFA---------ICVWCHLELSDQ---PKDDPVPP  297

Query  370  KEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQL  549
             E IV+PL++TIGDLK     A  D Y   + F V  +     V D+  +  +V +   +
Sbjct  298  PELIVLPLNATIGDLKSEATNAFEDVYAMFKRFQVEHLLDYGSVEDNITLKLLVGTTGSI  357

Query  550  FMKGLGLAFAG--DLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
             +KG   +  G    + E    NWTV C CGA+DDDGERM++CD+C +WQHTRC GI + 
Sbjct  358  QVKGRCPSKHGLNRYRLERGTDNWTVDCTCGAKDDDGERMLACDICGVWQHTRCAGIDNA  417

Query  724  KAVPPLFVCEVCCGRLAPTRT  786
             A+P  F+C  C   L    T
Sbjct  418  DAIPAKFICMRCANSLHKKST  438



>ref|NP_197618.1| PHD finger protein MALE STERILITY 1 [Arabidopsis thaliana]
 sp|Q9FMS5.1|MS1_ARATH RecName: Full=PHD finger protein MALE STERILITY 1 [Arabidopsis 
thaliana]
 dbj|BAB08324.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED93002.1| PHD finger protein MALE STERILITY 1 [Arabidopsis thaliana]
Length=672

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/292 (28%), Positives = 145/292 (50%), Gaps = 33/292 (11%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA------VPPVDVFG  162
            +Y+V R++N   +VLEY+L+++ N   +    ++  +        A      +    V  
Sbjct  384  NYLVRRSLNPVKKVLEYSLEDISNLLPSSNNELITLQNQNSMGKMATNGHNKITRGQVMK  443

Query  163  DVFCLYSNVLLGYKES--------DVVSLAAQTILDTKHFVKEWPF-RD------ELD--  291
            D+F  Y ++L+ YK          + + +A++ ILD K+F+KE+ + RD       LD  
Sbjct  444  DMFYFYKHILMDYKGVLGPIGGILNQIGMASRAILDAKYFIKEYHYIRDTSAKTLHLDRG  503

Query  292  DLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFV  471
            + L   C +          +   + P+E IVV   +T+ ++    +   RD Y  + + V
Sbjct  504  EELGIFCTIAWKCHHHNNEIK--VPPQECIVVKKDATLSEVYGEAERVFRDIYWELRDVV  561

Query  472  VTDIKG--LEGVGDDEVIF----GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKC  633
            V  + G  +E    DE+      G+V  G    M  + +      + +D+  +  ++C+C
Sbjct  562  VESVVGGQIEITRVDEMALNGNKGLVLEGNVGMM--MNIEVTKCYEDDDKKKDKRIECEC  619

Query  634  GARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            GA ++DGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P   L
Sbjct  620  GATEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIPLSFL  671



>emb|CAC69663.1| male sterility 1 protein [Arabidopsis thaliana]
 emb|CAC69664.1| male sterility 1 protein [Arabidopsis thaliana]
Length=672

 Score =   116 bits (290),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 147/294 (50%), Gaps = 37/294 (13%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA------VPPVDVFG  162
            +Y+V R++N   +VLEY+L+++ N   +    ++  +        A      +    V  
Sbjct  384  NYLVRRSLNPVKKVLEYSLEDISNLLPSGNNELITLQNQNSMGKMATNGHNKITRGQVMK  443

Query  163  DVFCLYSNVLLGYKES--------DVVSLAAQTILDTKHFVKEWPF-RD------ELD--  291
            D+F  Y ++L+ YK          + + +A++ ILD K+F+KE+ + RD       LD  
Sbjct  444  DMFYFYKHILMDYKGVLGPIGGILNQIGMASRAILDAKYFIKEYHYIRDTSAKTLHLDRG  503

Query  292  DLLRFICIVVPS--SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEE  465
            + L   C +       + E  +P    P+E IVV   +T+ ++    +   RD Y  + +
Sbjct  504  EELGIFCTIAWKCHHHNNEIKVP----PQECIVVKKDATLSEVYGEAERVFRDIYWELRD  559

Query  466  FVVTDIKG--LEGVGDDEVIF----GIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKC  627
             VV  + G  +E    DE+      G+V  G    M  + +      + +D+  +  ++C
Sbjct  560  VVVESVVGGQIEITRVDEMALNGNKGLVLEGNVGMM--MNIEVTKCYEDDDKKKDKRIEC  617

Query  628  KCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            +CGA ++DGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P   L
Sbjct  618  ECGATEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIPLSFL  671



>ref|XP_010927813.1| PREDICTED: PHD finger protein At1g33420-like [Elaeis guineensis]
Length=717

 Score =   116 bits (290),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/269 (32%), Positives = 128/269 (48%), Gaps = 28/269 (10%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVLLGYK  204
            N  T  +EY L+E  N+ Q+ Q         +P +   +  +    D   L    +  YK
Sbjct  428  NAETSAMEYRLEEASNQMQSTQYL------SRPTADQLLHDLKFLYDAI-LNPTTMQSYK  480

Query  205  ---ESDVVSLAAQTILDTKHFVKEW--PFRDELDD---LLRFICIVVPSSIDMETVLPKG  360
                +D V  +A  +LD K F+K +  P    L     +LR  C V    ID     PK 
Sbjct  481  PQATNDSVRSSASKLLDCKQFIKHYDDPASGWLSSGPFVLRIWCHV--ELIDH----PKD  534

Query  361  II--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG-VGDDEVIFGIV  531
                P E +++P+ +T+ DLK  +  A ++TY   + F V  +    G +G+  ++  I 
Sbjct  535  YTASPPELLILPMSATVADLKQQVARAFQETYLVFQRFQVEQLILDRGDIGELTLVKHIF  594

Query  532  ESGTQLFMKGLGLA---FAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
                   ++G  +      G  + E    NW V C CGA+DDDGERM++CD C +WQHTR
Sbjct  595  GPNEIAMIRGKCVGDDRRLGQFRMERGLENWIVDCYCGAKDDDGERMMACDTCGVWQHTR  654

Query  703  CVGIKDDKAVPPLFVCEVC-CGRLAPTRT  786
            C+GI D + VP  FVC+ C C R +  R+
Sbjct  655  CIGISDYEEVPAKFVCKKCNCMRKSKGRS  683



>ref|XP_007019720.1| DNA binding protein, putative isoform 2, partial [Theobroma cacao]
 gb|EOY16945.1| DNA binding protein, putative isoform 2, partial [Theobroma cacao]
Length=564

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 86/261 (33%), Positives = 127/261 (49%), Gaps = 34/261 (13%)
 Frame = +1

Query  70   NRDQTDQERVLVPEPDKP--ASLTAVPPVD--VFGDVFCLYSNVL-----LGYKES---D  213
            N + +D E  L P    P  +SL +  P +  + GD+  L+ ++L     L Y+     +
Sbjct  280  NPNSSDIEFRLQPLSSVPNESSLYSNCPSEEHIKGDLKFLFDSLLHPETMLTYRPQATRE  339

Query  214  VVSLAAQTILDTKHFVKEW------PFRDELDDLLRFICIVVPSSIDMETVLPKG--IIP  369
             V  +A  +LD K FVK++      PF          IC+     +  +   PK   + P
Sbjct  340  CVIDSATKLLDCKQFVKDYKPYAYNPFA---------ICVWCHLELSDQ---PKDDPVPP  387

Query  370  KEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQL  549
             E IV+PL++TIGDLK     A  D Y   + F V  +     V D+  +  +V +   +
Sbjct  388  PELIVLPLNATIGDLKSEATNAFEDVYAMFKRFQVEHLLDYGSVEDNITLKLLVGTTGSI  447

Query  550  FMKGLGLAFAG--DLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
             +KG   +  G    + E    NWTV C CGA+DDDGERM++CD+C +WQHTRC GI + 
Sbjct  448  QVKGRCPSKHGLNRYRLERGTDNWTVDCTCGAKDDDGERMLACDICGVWQHTRCAGIDNA  507

Query  724  KAVPPLFVCEVCCGRLAPTRT  786
             A+P  F+C  C   L    T
Sbjct  508  DAIPAKFICMRCANSLHKKST  528



>ref|XP_010542547.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein At1g33420 
[Tarenaya hassleriana]
Length=701

 Score =   115 bits (289),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 128/269 (48%), Gaps = 17/269 (6%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            S++V  + N AT   E+ L  + +   +D      PE   P+       +    D F L+
Sbjct  407  SHIVCSSFNAATNDFEFRLVPVSSIRLSDD-----PEEKYPSEEHVKRDIRYLYD-FLLH  460

Query  181  SNVLLGYKES---DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVL  351
               +  ++     D +  AA  ILD KHF+K++         +   C V  S  D     
Sbjct  461  PQTMAKFRSQVTRDKMMDAATKILDCKHFMKDYLPSGANPFAINLWCHVELS--DQSKEC  518

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
            P   +P E +V+P+++T+ DLK+    A ++ Y   + F V ++ G   + D   +  +V
Sbjct  519  P--ALPPELLVLPMNATVSDLKIEAAKAFQEVYAMFKRFEVEELLGYGSLEDSITLKFLV  576

Query  532  ESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
             +   + +KG   +  G L++  E    NW V C CG +DDDGERM+SCD C +W HTRC
Sbjct  577  GTSGMVRIKGRCSSKHGLLRYRMERGVENWKVDCICGTKDDDGERMLSCDACGVWHHTRC  636

Query  706  VGIKDDKAVPPLFVCEVCCG--RLAPTRT  786
             GI++  A+P  F C  C    R  P R+
Sbjct  637  AGIENSDALPSKFHCFRCIKLYRKKPKRS  665



>ref|XP_006426400.1| hypothetical protein CICLE_v10025026mg [Citrus clementina]
 gb|ESR39640.1| hypothetical protein CICLE_v10025026mg [Citrus clementina]
Length=709

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 109/209 (52%), Gaps = 18/209 (9%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-PFR-DELDD--LLRFIC---IVVP  324
            L+   +L Y    +  LA   A  ++D K F+K++ P +   ++D   +R  C   ++ P
Sbjct  472  LHPQTMLNYGPEAIRDLAISSATKLIDCKQFMKDYKPEKTSSINDSYTIRLSCQLELMDP  531

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
            S    E  +P    P E IV+P ++T+ DLK    +A +D Y     F   ++ G  GV 
Sbjct  532  S----EDNVPDP--PSEIIVLPRNATVSDLKTEASSAFQDVYLVFRRFQADELLGYSGVD  585

Query  505  DDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDV  678
            D   +  ++ +   + ++G  L   G  K+  E     WTV C CGA+DDDGERM +CDV
Sbjct  586  DSTQVKLLLGAAESVRVRGRCLGKNGLSKYRMERGIERWTVDCICGAKDDDGERMFACDV  645

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVCCG  765
            C +WQHTRC GI D  AVP  FVC  C G
Sbjct  646  CGVWQHTRCSGIHDSDAVPARFVCCRCRG  674



>ref|XP_006606403.1| PREDICTED: PHD finger protein At1g33420-like isoform X2 [Glycine 
max]
Length=566

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 104/205 (51%), Gaps = 16/205 (8%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKE-----WPFRDELDDLLRFICIVVPSS  330
            L+  +++ Y E+   +LA   AQ + D K FVK+     WP  D    + R  C V    
Sbjct  330  LHPQMMVNY-EAGTRTLAMNSAQKLFDCKQFVKDYNPEMWPLSDS--QMFRLSCHV---E  383

Query  331  IDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD  510
            +  E    + I P E +V+PL++T+ +LK     A +D Y       V  + G  GV D 
Sbjct  384  LVDEFEDSEAITPPELVVLPLNATVAELKNQAANAFQDVYLRFRRLQVDGLHGYSGVDDS  443

Query  511  EVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCE  684
              +  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C 
Sbjct  444  TQVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICG  503

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVC  759
            +W+HTRC  I D   VP  FVC  C
Sbjct  504  VWRHTRCSDIHDTDPVPARFVCLKC  528



>ref|XP_007019719.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY16944.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
Length=703

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/261 (33%), Positives = 127/261 (49%), Gaps = 34/261 (13%)
 Frame = +1

Query  70   NRDQTDQERVLVPEPDKP--ASLTAVPPVD--VFGDVFCLYSNVL-----LGYKES---D  213
            N + +D E  L P    P  +SL +  P +  + GD+  L+ ++L     L Y+     +
Sbjct  419  NPNSSDIEFRLQPLSSVPNESSLYSNCPSEEHIKGDLKFLFDSLLHPETMLTYRPQATRE  478

Query  214  VVSLAAQTILDTKHFVKEW------PFRDELDDLLRFICIVVPSSIDMETVLPKG--IIP  369
             V  +A  +LD K FVK++      PF          IC+     +  +   PK   + P
Sbjct  479  CVIDSATKLLDCKQFVKDYKPYAYNPFA---------ICVWCHLELSDQ---PKDDPVPP  526

Query  370  KEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQL  549
             E IV+PL++TIGDLK     A  D Y   + F V  +     V D+  +  +V +   +
Sbjct  527  PELIVLPLNATIGDLKSEATNAFEDVYAMFKRFQVEHLLDYGSVEDNITLKLLVGTTGSI  586

Query  550  FMKGLGLAFAG--DLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
             +KG   +  G    + E    NWTV C CGA+DDDGERM++CD+C +WQHTRC GI + 
Sbjct  587  QVKGRCPSKHGLNRYRLERGTDNWTVDCTCGAKDDDGERMLACDICGVWQHTRCAGIDNA  646

Query  724  KAVPPLFVCEVCCGRLAPTRT  786
             A+P  F+C  C   L    T
Sbjct  647  DAIPAKFICMRCANSLHKKST  667



>ref|NP_564424.1| PHD finger protein [Arabidopsis thaliana]
 sp|Q9C810.1|Y1342_ARATH RecName: Full=PHD finger protein At1g33420 [Arabidopsis thaliana]
 gb|AAG51204.1|AC051630_1 hypothetical protein; 47104-44821 [Arabidopsis thaliana]
 gb|AAK59559.1| unknown protein [Arabidopsis thaliana]
 gb|AAK93738.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31592.1| PHD finger protein [Arabidopsis thaliana]
Length=697

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 97/180 (54%), Gaps = 7/180 (4%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTI  405
            AA  ILD KHF+K++         +   C V  S    E+  P    P E +V+PL++T+
Sbjct  476  AATKILDCKHFIKDYLSSTVNPVAINLWCCVELSDELKESPAP----PPERLVLPLNATV  531

Query  406  GDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGD  585
             DLK+    A ++ Y   + F V ++ G   + D   +  +V +   + +KG   +  G 
Sbjct  532  SDLKIEAAKAFQEVYAMFKRFEVEELLGYGSIDDSITLKFLVGTNGVIRIKGR-CSKHGL  590

Query  586  LKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            L++  E    NW V CKCG +DDDGERM++CD C +W HTRC+GI +  A+P  F+C  C
Sbjct  591  LRYRMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRC  650



>ref|XP_004495439.1| PREDICTED: PHD finger protein At1g33420-like [Cicer arietinum]
Length=718

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 105/202 (52%), Gaps = 9/202 (4%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDM--  339
            L+  ++L Y + +  +LA   AQ +LD K  VK++    E+  +     I +   +++  
Sbjct  473  LHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYSL--EMLPVSDLYKIRISCQVELVD  530

Query  340  ETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVI  519
            +        P E IV+P ++T+ DLK+      +D Y     F V ++ G   V D+  +
Sbjct  531  QPEDSAARTPPEIIVLPSNATLSDLKIEATNVFQDVYLMFRRFQVDELLGYSSVNDNTQV  590

Query  520  FGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQ  693
              ++ S   + ++G  +   G  KF  E     WTV+C CG +DDDGERM++CD+C +W+
Sbjct  591  KLLLGSNDAVCVRGRCIGKNGLSKFRMERGLERWTVECSCGTKDDDGERMMACDICGVWR  650

Query  694  HTRCVGIKDDKAVPPLFVCEVC  759
            HTRC GI D   VP  FVC  C
Sbjct  651  HTRCSGIHDTAPVPARFVCSRC  672



>ref|XP_006606402.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Glycine 
max]
Length=707

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 104/205 (51%), Gaps = 16/205 (8%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKE-----WPFRDELDDLLRFICIVVPSS  330
            L+  +++ Y E+   +LA   AQ + D K FVK+     WP  D    + R  C V    
Sbjct  471  LHPQMMVNY-EAGTRTLAMNSAQKLFDCKQFVKDYNPEMWPLSDS--QMFRLSCHV---E  524

Query  331  IDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD  510
            +  E    + I P E +V+PL++T+ +LK     A +D Y       V  + G  GV D 
Sbjct  525  LVDEFEDSEAITPPELVVLPLNATVAELKNQAANAFQDVYLRFRRLQVDGLHGYSGVDDS  584

Query  511  EVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCE  684
              +  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C 
Sbjct  585  TQVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICG  644

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVC  759
            +W+HTRC  I D   VP  FVC  C
Sbjct  645  VWRHTRCSDIHDTDPVPARFVCLKC  669



>ref|XP_010252344.1| PREDICTED: PHD finger protein At1g33420 [Nelumbo nucifera]
Length=718

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/259 (33%), Positives = 124/259 (48%), Gaps = 20/259 (8%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVL----  192
            N  T  +E+ L+    R  T+ + V     D+ A+   +    +  D+  LY ++L    
Sbjct  423  NPDTDAVEFKLESASCR--TNDDGVAGVSSDELANSNCLSEDHLLRDLRFLYESLLHPHT  480

Query  193  -LGYKESDVVSLA---AQTILDTKHFVKEW-PFRDELDD---LLRFICIVVPSSIDMETV  348
               Y+      LA   A  +LD K FVK++ P    L +    +R  C+V       +  
Sbjct  481  MTSYRPQSTRELAISSAAKLLDCKQFVKDYEPIHKALVNNPFAIRLSCLVELVDQPKDYT  540

Query  349  LPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD-EVIFG  525
             P    P E IV+PL++T+ DLK     A ++ Y   + F   ++     V D   V F 
Sbjct  541  AP----PPELIVLPLNATVADLKDEAAKAFQEVYVMFKRFQAEEVLDYGFVDDSTHVKFL  596

Query  526  IVESG-TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTR  702
            I  SG  ++  + LG       + E    +WTV C CGARDDDGERM++CD C +WQHTR
Sbjct  597  IGVSGLVRVRGRCLGKHGLNRFRMERGTESWTVDCTCGARDDDGERMLACDTCGVWQHTR  656

Query  703  CVGIKDDKAVPPLFVCEVC  759
            C GI D +AVP  F+C  C
Sbjct  657  CAGIDDFEAVPARFICGRC  675



>ref|XP_008803796.1| PREDICTED: PHD finger protein At1g33420-like [Phoenix dactylifera]
Length=717

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 93/285 (33%), Positives = 131/285 (46%), Gaps = 44/285 (15%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            VV    N  T  +EY L E   R   D+     P  D+           +  D+  LY  
Sbjct  422  VVAVRCNAETSAIEYRL-EAAPRQTMDKPYFSRPMADQ-----------LLHDLKFLYDA  469

Query  187  VL-----LGYK---ESDVVSLAAQTILDTKHFVKEWPFRDELDD--------LLRFICIV  318
            +L       YK    +D    +A  +LD K F+K +   D+LD         +LR  C V
Sbjct  470  ILNPTTMQSYKPQATNDSAHSSASKLLDCKQFIKHY---DDLDSSWLPSSPLVLRIWCHV  526

Query  319  VPSSIDMETVLPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL  492
                ID     PK     P E +++P+++T+ DLK     A ++TY   + F V  +   
Sbjct  527  --ELIDH----PKDYTASPPELLILPIYATVADLKQQATRAFQETYLIFQRFQVEQLILD  580

Query  493  EG-VGDDEVIFGIVESGTQLFMKGLGLA---FAGDLKFEDRAHNWTVKCKCGARDDDGER  660
             G VGD  ++  I+ S     ++G  +      G  + E    NW V C CGA+DDDGER
Sbjct  581  RGDVGDFTLVKHILGSNEIAIIRGRCVGDVQRLGQFRMERGLENWIVDCDCGAKDDDGER  640

Query  661  MISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC-CGRLAPTRTLG  792
            M++CD C +WQHTRC GI D   VP  FVC+ C C R +  R+ G
Sbjct  641  MMACDTCGVWQHTRCTGISDYDEVPAKFVCKKCICIRKSKGRSSG  685



>gb|KHN05025.1| PHD finger protein [Glycine soja]
Length=870

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 104/205 (51%), Gaps = 16/205 (8%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKE-----WPFRDELDDLLRFICIVVPSS  330
            L+  +++ Y E+   +LA   AQ + D K FVK+     WP  D    + R  C V    
Sbjct  634  LHPQMMVNY-EAGTRTLAMNSAQKLFDCKQFVKDYNPEMWPLSDS--QMFRLSCHV---E  687

Query  331  IDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD  510
            +  E    + I P E +V+PL++T+ +LK     A +D Y       V  + G  GV D 
Sbjct  688  LVDEFEDSEAITPPELVVLPLNATVAELKNQAANAFQDVYLRFRRLQVDGLHGYSGVDDS  747

Query  511  EVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCE  684
              +  ++ S   + ++G  +   G  KF  E     WTV C CGA+DDDGERM++CD+C 
Sbjct  748  TQVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTVDCSCGAKDDDGERMLACDICG  807

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVC  759
            +W+HTRC  I D   VP  FVC  C
Sbjct  808  VWRHTRCSDIHDTDPVPARFVCLKC  832



>gb|EYU30150.1| hypothetical protein MIMGU_mgv1a019304mg, partial [Erythranthe 
guttata]
Length=543

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 112/202 (55%), Gaps = 21/202 (10%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            ++ RA+N  +++ E+ ++        DQE       +   S+     + +  D+  LY N
Sbjct  359  IIRRAINPYSKLAEFNIR--------DQE-----ASNGATSVRLRLGLSLSRDIRFLYEN  405

Query  187  VLLGYKESDVVSLAAQTILDTKHFVKEWPFRDEL--DDLLRFICIVVPSSIDMETVLPKG  360
            VL  Y ES         + +  HFVKEW  + E+  ++ +   C V+PS  +MET L + 
Sbjct  406  VLSEYIESHFF------LTNNYHFVKEWTIKREITKNNKMELTCKVLPSFDEMETELTRR  459

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
            + P E +VV    TIG+L++A Q A+RDTYC M+EF VT I GL  + D++V++G V  G
Sbjct  460  LPPGEMVVVDPWITIGELRVAAQWALRDTYCVMDEFEVTQIGGLRRIEDEKVVYGTVGPG  519

Query  541  TQLFMKGLGLAFAGDLKFEDRA  606
            ++++++G G  F+  +++ED  
Sbjct  520  SEVWVRGRGFDFSTVIRYEDEG  541



>ref|XP_010027490.1| PREDICTED: PHD finger protein At1g33420-like [Eucalyptus grandis]
 gb|KCW54032.1| hypothetical protein EUGRSUZ_I00019 [Eucalyptus grandis]
Length=710

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 109/225 (48%), Gaps = 11/225 (5%)
 Frame = +1

Query  103  VPEPDKPASLTAVPPVD-VFGDVFCLYSNVLL-------GYKESDVVSLAAQTILDTKHF  258
            V    K +S  + P  D +  D+  LY ++L        G   +D V  AAQ +LD K F
Sbjct  442  VNTSGKKSSFISRPSEDNLIRDLRYLYDSILHPRTMLNEGTHATDYVE-AAQRLLDCKQF  500

Query  259  VKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAM  438
            +K++   +       F   ++      +  +   I P E I +   +T+ DLK  +  A 
Sbjct  501  MKDYRAEEAPSTANPFSISLLCQVEVADHAMSSTICPPEIINLSPDATVSDLKHEVSRAF  560

Query  439  RDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHN  612
            RD Y     F   D+    GV D  ++  +      + ++G      G  K+  E    N
Sbjct  561  RDVYLMYRRFQADDLLDHRGVDDSTLVKHLTGVTNLVRVRGRCFVKNGVSKYRMERGLEN  620

Query  613  WTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFV  747
            WTV CKCGA+DDDGERM++CDVC +WQHTRC GI D ++VP  F+
Sbjct  621  WTVDCKCGAKDDDGERMLACDVCGVWQHTRCSGIDDSESVPASFI  665



>ref|XP_002874056.1| hypothetical protein ARALYDRAFT_489076 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50315.1| hypothetical protein ARALYDRAFT_489076 [Arabidopsis lyrata subsp. 
lyrata]
Length=673

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 144/295 (49%), Gaps = 38/295 (13%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA------VPPVDVFG  162
            +Y+V R++N   +VLEY L+++ N   +    ++  +        A      +    V  
Sbjct  384  NYLVRRSLNPVKKVLEYCLEDISNLLPSSNNELITLQNQNSMGKMATNGHNKITRGQVMK  443

Query  163  DVFCLYSNVLLGYKES--------DVVSLAAQTILDTKHFVKEWPF-RD------ELD--  291
            D+F  Y ++L+ YK          + + +A++ ILD K+F+KE+ + RD       LD  
Sbjct  444  DMFYFYKHILMDYKGVLGPIGGILNQIGMASRAILDAKYFIKEYHYIRDTSAKTLHLDRG  503

Query  292  DLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFV  471
            + L   C +          +   I P+E IVV   +T+ ++    +   R+ Y  + + V
Sbjct  504  NKLGIFCTIAWKCHHHNNEIK--IPPQECIVVKKDATLSEVYGEAERVFREIYWELRDVV  561

Query  472  VTDIKGLEGVGDDEVI----FGIVESGTQLFMKG-----LGLAFAGDLKFEDRAHNWTVK  624
            V  +      G  E+I      ++     L ++G     + +      + +D+  +  ++
Sbjct  562  VESLAD----GQREIIRVDEMAMMNWNKGLVLEGNVGMMMNIEVMKCYEDDDKKKDKRIE  617

Query  625  CKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            C+CGA+++DGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P   L
Sbjct  618  CECGAKEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIPLSFL  672



>ref|XP_004980335.1| PREDICTED: PHD finger protein At1g33420-like [Setaria italica]
Length=691

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 114/255 (45%), Gaps = 24/255 (9%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVLLGYK  204
            N  T  LEY L +         E VL+P    P        +    DV  L+ + +  YK
Sbjct  410  NDETNTLEYRLTD---------ETVLLPNVSMPTRDHLRRDIKFLHDVL-LHPHTMNPYK  459

Query  205  ---ESDVVSLAAQTILD----TKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGI  363
               + +    +A  +LD    TKH+  E  F  +   +L   C V    +D    LP   
Sbjct  460  PEKDYEHAKRSAMILLDCKQLTKHYDLEQEFLPQNPSMLHIWCHV--ELLDQVGDLPS--  515

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
            IP+E + +P  +T+ DLKL      RD Y  ++ FV   +       +   +  +  +  
Sbjct  516  IPQELLTLPQTATVADLKLEATKTFRDIYLMLQTFVANQLLDCGTASESTQLKLLFGANG  575

Query  544  QLFMKGL---GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGI  714
             + ++G    G    G  + E     WTV C CGA DDDGERM+SCD C +WQHTRC GI
Sbjct  576  NVRVQGKCIGGERRVGIYRMERGVDKWTVSCSCGATDDDGERMLSCDSCHVWQHTRCAGI  635

Query  715  KDDKAVPPLFVCEVC  759
             D   VP  +VC+ C
Sbjct  636  SDFHQVPKRYVCKSC  650



>ref|XP_006400732.1| hypothetical protein EUTSA_v10012892mg [Eutrema salsugineum]
 gb|ESQ42185.1| hypothetical protein EUTSA_v10012892mg [Eutrema salsugineum]
Length=669

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 141/299 (47%), Gaps = 46/299 (15%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPAS-----LTAVPPVDVFGD  165
            +Y+V R++N   +VLEY L+++ N   +  + ++  +   P        T +    V  D
Sbjct  380  NYLVRRSLNPVKKVLEYCLEDISNLLPSSNQELIALQNQNPMGKMTTTTTKITRGQVMKD  439

Query  166  VFCLYSNVLLGYKES-------DVVSLAAQTILDTKHFVKEWPF-RD--------ELDDL  297
            +   Y ++L+ YK         + + +A++ ILD K+F+KE+ + RD        +  D 
Sbjct  440  MVYFYKHILMDYKGVLGPISILNQIGMASRAILDAKYFIKEYHYIRDTSTKTIHSDRGDK  499

Query  298  LRFICIVV---PSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEF  468
            L   C +        + E  +P    P+E IVV   +T+ ++    +   R+ Y  + + 
Sbjct  500  LGIFCTIARKCHHHHNNEMKMP----PQECIVVNKDATMSEVYGEAERVFREIYWELRDV  555

Query  469  VVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF------------EDRAHN  612
            VV      E + D +           L     GL   G++              + +  +
Sbjct  556  VV------ESMADGQREINTRVDDMALNGNNKGLVLQGNVGMMMNIEVMKCYDDDSKKKD  609

Query  613  WTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
              ++C+CGA+++DGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P   L
Sbjct  610  KRIECECGAKEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIPLSFL  668



>ref|XP_004512621.1| PREDICTED: PHD finger protein At1g33420-like [Cicer arietinum]
Length=706

 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 122/258 (47%), Gaps = 8/258 (3%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNR---DQTDQERVLVPEPDKPASLTAVPPVDVFGDVF  171
            S +V+   N  T  LEY L+   N      ++   +    P K + L  +  +  +    
Sbjct  413  SMIVNTRHNPETGALEYRLEAANNSCDGKTSNNYSLGSKRPSKESLLYDLKYLYGYLLNS  472

Query  172  CLYSNVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVL  351
             +  N +    +  V+S +AQ +L+ K  VK+  +R E+  +  F  I     +++    
Sbjct  473  PMMQNCVPEGIQIPVMS-SAQKLLNCKQLVKD--YRPEMLPMKDFYKIRFSCHVELIDES  529

Query  352  PKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIV  531
                IP E +V+P+++TI DLK     A  D Y     FVV  + G   V D   I  ++
Sbjct  530  ENPTIPAELVVLPINATISDLKNEAVNAFEDVYLMFRRFVVDGLLGYNDVDDSTQIKLLL  589

Query  532  ESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
             S   + ++G  ++  G  KF  E     WTV C CGA+DDDGERM++CD C +WQHT C
Sbjct  590  GSAEVVCIRGRCISKNGLSKFKMERGLERWTVDCSCGAKDDDGERMLACDKCGVWQHTIC  649

Query  706  VGIKDDKAVPPLFVCEVC  759
              I D + VP  F C  C
Sbjct  650  SNIHDSQPVPTHFTCPKC  667



>ref|XP_009120674.1| PREDICTED: PHD finger protein MALE STERILITY 1 isoform X2 [Brassica 
rapa]
Length=562

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 141/287 (49%), Gaps = 32/287 (11%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA--------VPPVDV  156
            +Y+V R++N   +VLEY L+++ N   +    +   +       T         +    V
Sbjct  275  NYLVRRSLNPVKKVLEYCLEDISNLLPSSNHELTTLQNQYQMGKTTTATNGHNKITRGQV  334

Query  157  FGDVFCLYSNVLLGYKES-------DVVSLAAQTILDTKHFVKEWPF-RD------ELDD  294
              D+   Y ++L+ YK         + + +A++ ILD K+F+KE+ + RD      +LD 
Sbjct  335  MKDMVYFYRHILMDYKGVLGPIGILNQIGMASRAILDAKYFIKEYHYMRDTSMKTIQLDG  394

Query  295  --LLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEF  468
               L   C +   S      +   + P+E IVV   +T+ +L    +   R+ Y  + + 
Sbjct  395  GGKLGIFCTIAWKSHHHNNDIK--MPPQECIVVSKSATMSELCREAERVFREIYWELRDV  452

Query  469  VVTDIKGLEGVGDDEVIFG----IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCG  636
            VV + + +    D+  + G    +++    + M    + +  D   + +     ++C+CG
Sbjct  453  VVDNQREMTTRVDEMALNGNKGLVLDGNVGVMMNIEVMKYYDDEDSKKKDKR--IECECG  510

Query  637  ARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAP  777
            A++DDGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P
Sbjct  511  AKEDDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIP  557



>ref|XP_006466218.1| PREDICTED: PHD finger protein At1g33420-like [Citrus sinensis]
Length=709

 Score =   112 bits (281),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 107/209 (51%), Gaps = 18/209 (9%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEW-PFR-DELDD--LLRFIC---IVVP  324
            L+   +L Y    +  LA   A  ++D K F+K++ P +   ++D   +R  C   ++ P
Sbjct  472  LHPQTMLNYGPEAIRDLAISSATKLIDCKQFMKDYKPEKTSSINDSYTIRLSCQLELMDP  531

Query  325  SSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVG  504
            S    E  +P    P E IV+P ++T+ DLK    +A +D Y     F   ++ G  GV 
Sbjct  532  S----EDNVPDP--PSEIIVLPRNATVSDLKTEASSAFQDVYLVFRRFQAEELLGYSGVD  585

Query  505  DDEVIFGIVESGTQLFMKGL--GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDV  678
            D   +  ++ +   + ++G   G       + E     WTV C CGA+DDDGERM +CDV
Sbjct  586  DSTQVKLLLGAAESVRVRGRCPGKNGLSKYRMERGIERWTVDCICGAKDDDGERMFACDV  645

Query  679  CEIWQHTRCVGIKDDKAVPPLFVCEVCCG  765
            C +WQHTRC GI D  AVP  FVC  C G
Sbjct  646  CGVWQHTRCSGIHDSDAVPARFVCCRCRG  674



>ref|XP_010237811.1| PREDICTED: PHD finger protein At1g33420-like [Brachypodium distachyon]
Length=715

 Score =   112 bits (281),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 101/210 (48%), Gaps = 24/210 (11%)
 Frame = +1

Query  175  LYSNVLLGYKESDV---VSLAAQTILDTKHFVKEWPFRDEL----DDLLRFICIVVPSSI  333
            LY + +  YK   +      +A  +LD K F+K +   ++       +L   C V    +
Sbjct  478  LYPHTMHPYKPEQIHEGAKKSAMILLDCKQFIKHYDLEEDFLPQNPSMLHIWCQV--ELL  535

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD-  510
            D  T  P   +P E + +P  +T+ DLK+      RD Y  ++ FVVT +       D  
Sbjct  536  DQVTDPP--CLPAELLTLPPTATVADLKVEATRTFRDMYLMLQSFVVTQLLDCASASDTT  593

Query  511  --EVIFGIVESGTQLFMKGLGLAFAGD-----LKFEDRAHNWTVKCKCGARDDDGERMIS  669
              +++FG   S     ++  G    G+      + E     WTVKC CGA+DDDGERM+S
Sbjct  594  QLKLLFGANGS-----VRIQGKCVGGERRVTIYRMERGVEKWTVKCSCGAKDDDGERMLS  648

Query  670  CDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            CD C +WQHTRC GI D   VP  +VC  C
Sbjct  649  CDSCHVWQHTRCAGISDFDQVPKRYVCASC  678



>emb|CDX98585.1| BnaC05g37900D [Brassica napus]
Length=638

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/283 (26%), Positives = 139/283 (49%), Gaps = 45/283 (16%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +Y+V R++N   +VLEY L+++ N                      +P   V  D+   Y
Sbjct  380  NYLVRRSLNPVKKVLEYCLEDISN---------------------LLPSSQVMKDLVYFY  418

Query  181  SNVLLGYKES-------DVVSLAAQTILDTKHFVKEWPF-RDELDDLLRF--------IC  312
             ++L+ YK         + + +A++ ILD K+F+KE+ + RD L   ++          C
Sbjct  419  KHILMDYKGVLGPIGILNQIGMASRAILDAKYFIKEYHYIRDTLMKTIQLDGGGKLGIFC  478

Query  313  IVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGL  492
             +   S      +   + P+E IVV  ++T+ ++    +   R+ Y  + + VV + + +
Sbjct  479  TIAWKSHHHNNDIK--MPPQECIVVNKNATMSEVYREAERVFREIYWELRDVVVDNQREM  536

Query  493  EGVGDDEVIFG----IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGER  660
                D+  + G    +++    + M    + +  D   + +     ++C+CGA+++DGER
Sbjct  537  APWVDEMALNGNKGLVLDGNVGVMMNIEVMKYYDDEDSKKKDKR--IECECGAKEEDGER  594

Query  661  MISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTL  789
            M+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P   L
Sbjct  595  MVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIPLSFL  637



>ref|XP_008657002.1| PREDICTED: PHD finger protein At1g33420 [Zea mays]
Length=713

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 124/265 (47%), Gaps = 41/265 (15%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVD-VFGDVFCLYSNVL---  192
            N  T  +EY L           E   V  P   A+    P VD +  D+  LY  +L   
Sbjct  421  NAGTSAIEYRL-----------ESSSVRSPANAATFG--PSVDQLLHDLRFLYDALLNPE  467

Query  193  -LGYKESDVVSLAAQT----ILDTKHFVKEW---PFRDELDDLLRFICIVVPSSIDMETV  348
             +   + +VV  +A +    I+D K F+K +     R   +  L    + V  SI++   
Sbjct  468  SMLSSQPEVVGASAHSAAAKIIDCKQFIKHYDEHALRTPSNPFL----LCVRCSIELLD-  522

Query  349  LPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIF  522
             PK     P+E +++P  +T+GDLK+    A ++TY   + F    +       D   + 
Sbjct  523  HPKDYTTPPEELVLLPASATLGDLKVQASKAFQETYLMFQSFQTEQLPDFPNFSDTTPVK  582

Query  523  GIVESGTQLFMKGLGLAFAGD------LKFEDRAHNWTVKCKCGARDDDGERMISCDVCE  684
             ++ SG  L ++G      GD       + E    NWTV C CGA+DDDGERM++CD+C 
Sbjct  583  HVLGSGQLLRVRG---RCTGDYRRIVQFRMERGLENWTVDCSCGAKDDDGERMLACDICG  639

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVC  759
            +WQHTRC GI D + VP  F+C  C
Sbjct  640  VWQHTRCSGISDFEEVPENFICRKC  664



>gb|EAZ09313.1| hypothetical protein OsI_31586 [Oryza sativa Indica Group]
Length=683

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/280 (28%), Positives = 122/280 (44%), Gaps = 30/280 (11%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +YVV R +N  T+VLEY L+++ +          VP   K      +    +  D+  LY
Sbjct  395  NYVVRRTMNPVTKVLEYCLEDVSSVLPAVAAGGGVPAQGKMRVRFQLTRAQLMRDLVHLY  454

Query  181  SNVL------LGYKESDVVSLAAQTILDTKHFVKEW-----PFRDELDDLLRFICIVVPS  327
             +VL      L       + +A + +LD KHFVK++                   I +  
Sbjct  455  RHVLKEPSQALTGGAFGAIPVAVRMVLDIKHFVKDYHEGQAAASSNGGGGFGHPHINLCC  514

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
            ++ +    P+   P E + +P H+T+G+LK   Q    + Y  +  F    + G+    +
Sbjct  515  TLLVSNGSPELAPPYETVTLPAHATVGELKWEAQRVFSEMYLGLRSFAADSVVGVGADQE  574

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNW----------------TVKCKCGA  639
               + G+V+ G+ + ++G   +    +  ED                      V C CGA
Sbjct  575  GLPVLGLVDVGSAVVVQG---SVGEQINGEDHERKEEAAAAAVCEGSGGGERVVDCACGA  631

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
             DDDGERM  CD+CE WQHTRC GI D +  P +F+C  C
Sbjct  632  VDDDGERMACCDICEAWQHTRCAGIADTEDAPHVFLCSRC  671



>ref|NP_001063319.2| Os09g0449000 [Oryza sativa Japonica Group]
 dbj|BAD37958.1| putative male sterility 1 protein [Oryza sativa Japonica Group]
 gb|EAZ44935.1| hypothetical protein OsJ_29577 [Oryza sativa Japonica Group]
 dbj|BAF25233.2| Os09g0449000 [Oryza sativa Japonica Group]
 gb|ADD91695.1| PHD domain protein [Oryza sativa Japonica Group]
Length=679

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/280 (28%), Positives = 122/280 (44%), Gaps = 30/280 (11%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLY  180
            +YVV R +N  T+VLEY L+++ +          VP   K      +    +  D+  LY
Sbjct  391  NYVVRRTMNPVTKVLEYCLEDVSSVLPAVAAGGGVPAQGKMRVRFQLTRAQLMRDLVHLY  450

Query  181  SNVL------LGYKESDVVSLAAQTILDTKHFVKEW-----PFRDELDDLLRFICIVVPS  327
             +VL      L       + +A + +LD KHFVK++                   I +  
Sbjct  451  RHVLKEPSQALTGGAFGAIPVAVRMVLDIKHFVKDYHEGQAAASSNGGGGFGHPHINLCC  510

Query  328  SIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGD  507
            ++ +    P+   P E + +P H+T+G+LK   Q    + Y  +  F    + G+    +
Sbjct  511  TLLVSNGSPELAPPYETVTLPAHATVGELKWEAQRVFSEMYLGLRSFAADSVVGVGADQE  570

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNW----------------TVKCKCGA  639
               + G+V+ G+ + ++G   +    +  ED                      V C CGA
Sbjct  571  GLPVLGLVDVGSAVVVQG---SVGEQINGEDHERKEEAAAAAVCEGSGGGERVVDCACGA  627

Query  640  RDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
             DDDGERM  CD+CE WQHTRC GI D +  P +F+C  C
Sbjct  628  VDDDGERMACCDICEAWQHTRCAGIADTEDAPHVFLCSRC  667



>ref|XP_009120673.1| PREDICTED: PHD finger protein MALE STERILITY 1 isoform X1 [Brassica 
rapa]
Length=667

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 141/287 (49%), Gaps = 32/287 (11%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA--------VPPVDV  156
            +Y+V R++N   +VLEY L+++ N   +    +   +       T         +    V
Sbjct  380  NYLVRRSLNPVKKVLEYCLEDISNLLPSSNHELTTLQNQYQMGKTTTATNGHNKITRGQV  439

Query  157  FGDVFCLYSNVLLGYKES-------DVVSLAAQTILDTKHFVKEWPF-RD------ELDD  294
              D+   Y ++L+ YK         + + +A++ ILD K+F+KE+ + RD      +LD 
Sbjct  440  MKDMVYFYRHILMDYKGVLGPIGILNQIGMASRAILDAKYFIKEYHYMRDTSMKTIQLDG  499

Query  295  --LLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEF  468
               L   C +   S      +   + P+E IVV   +T+ +L    +   R+ Y  + + 
Sbjct  500  GGKLGIFCTIAWKSHHHNNDIK--MPPQECIVVSKSATMSELCREAERVFREIYWELRDV  557

Query  469  VVTDIKGLEGVGDDEVIFG----IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCG  636
            VV + + +    D+  + G    +++    + M    + +  D   + +     ++C+CG
Sbjct  558  VVDNQREMTTRVDEMALNGNKGLVLDGNVGVMMNIEVMKYYDDEDSKKKDKR--IECECG  615

Query  637  ARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVCCGRLAP  777
            A++DDGERM+ CD+CE+WQHTRCVG++ ++ VP +F+C+ C   L P
Sbjct  616  AKEDDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSCDQHLIP  662



>ref|XP_004236973.1| PREDICTED: PHD finger protein At1g33420 [Solanum lycopersicum]
Length=703

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 96/185 (52%), Gaps = 11/185 (6%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDEL----DDLLRFICIV-VPSSIDMETVLPKGIIPKEHIVVP  390
            +A T+LD K F+K +     L     D ++ +C V +    D+ +  P    P E +++P
Sbjct  492  SATTVLDCKQFLKVYQPEKFLPILKSDAIQVLCEVDIIEQSDVHSRNP----PPELLILP  547

Query  391  LHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKG--L  564
              +TI DLK       +D Y   + F   ++ G  GV +   I  ++ S   + ++G  L
Sbjct  548  SDATISDLKAEASRMFQDVYLMFKRFQADELVGYGGVNESTQIKLLLGSAEFVTVRGKFL  607

Query  565  GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLF  744
            G       + E     WTV C CGA+DDDGERM++CDVC +WQHTRC GI D  AVP  F
Sbjct  608  GKNGLSKYRMERGMERWTVDCFCGAKDDDGERMLACDVCSVWQHTRCAGIPDLDAVPARF  667

Query  745  VCEVC  759
            +C  C
Sbjct  668  ICLKC  672



>ref|XP_002456731.1| hypothetical protein SORBIDRAFT_03g041550 [Sorghum bicolor]
 gb|EES01851.1| hypothetical protein SORBIDRAFT_03g041550 [Sorghum bicolor]
Length=710

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 97/189 (51%), Gaps = 19/189 (10%)
 Frame = +1

Query  226  AAQTILDTKHFVKEW---PFRDELDDLLRFICIVVPSSIDMETVLPKGII--PKEHIVVP  390
            AA  I+D K F+K +     R   +  L    + V  SI++    PK     P+E +++P
Sbjct  482  AAAKIIDCKQFIKHYDEHALRTPSNPYL----LCVRCSIELLD-HPKDYTTPPEELVLLP  536

Query  391  LHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGL  570
              +T+GDLK+    A ++TY   + F    +       D   +  ++ SG  L ++G   
Sbjct  537  ASATLGDLKVQASKAFQETYLMFQSFQTEQLPDFPNFSDTTPVNHVLGSGQLLRVRG---  593

Query  571  AFAGD------LKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAV  732
               GD       + E    NWTV C CGA+DDDGERM++CD+C +WQHTRC GI D + V
Sbjct  594  RCTGDYRRIVQFRMERGLENWTVDCSCGAKDDDGERMLACDICGVWQHTRCSGISDFEEV  653

Query  733  PPLFVCEVC  759
            P  F+C  C
Sbjct  654  PENFICRKC  662



>ref|XP_008449753.1| PREDICTED: PHD finger protein At1g33420 [Cucumis melo]
Length=702

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 111/219 (51%), Gaps = 14/219 (6%)
 Frame = +1

Query  175  LYSNVLLGY-----KESDVVSLAAQTILDTKHFVKEWPFRDELDDLLR--FICIVVPSSI  333
            L+ N ++ Y     +E+ V S  A  ++D K FVK++   ++L  +L    IC++    +
Sbjct  477  LHPNSMVNYGPQATREAAVSS--ALKLIDCKQFVKDYK-PEKLSTMLNPFSICLLCEVEV  533

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD-  510
              ++       P E +++P ++T+ DLKL    A +D Y     F   +I    GV D  
Sbjct  534  VEDSKDNSSRPPPELVILPSNATMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDST  593

Query  511  --EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCE  684
              +++FG  ES  ++  K          + E     WTV C CGA+DDDGERM++CD+C 
Sbjct  594  QVKLLFGQTES-VRIRGKCQVKTALNRFRMERGVERWTVDCSCGAKDDDGERMLACDLCG  652

Query  685  IWQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGFE  801
            +W+HTRC GI+D   VP  FVC  C   +    T G  E
Sbjct  653  VWRHTRCSGIQDSDDVPGKFVCYKCRSSIVSMNTNGETE  691



>ref|XP_006836898.1| hypothetical protein AMTR_s00099p00124180 [Amborella trichopoda]
 gb|ERM99751.1| hypothetical protein AMTR_s00099p00124180 [Amborella trichopoda]
Length=681

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/226 (32%), Positives = 111/226 (49%), Gaps = 11/226 (5%)
 Frame = +1

Query  109  EPDKPASLTAVPPVDVFGDVFCLYSNVLL-GYKESDVVSLAAQTILDTKHFVKEWPFR-D  282
            +P   AS   +P   +  D+  +Y +        ++    AA  ILD KHF+K++  +  
Sbjct  412  DPSSRASTLPLPKDQLLNDLCLIYRSFHPETMPSTEPYKSAAIKILDCKHFIKDYQAQVP  471

Query  283  ELDDLL----RFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTY  450
            +L  LL      + + V   I+     P  + P E + +P   T+ DLKL      ++ Y
Sbjct  472  KLAPLLAPSKNQVTLWVRCQINDTKTYP--LPPPELVSLPPTGTVADLKLEAAKIFQEVY  529

Query  451  CAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGL---GLAFAGDLKFEDRAHNWTV  621
               + F   DI  L GV DD  +  +V     + + G    G++     + E     W V
Sbjct  530  IFFKRFQPEDILDLWGVKDDTQVNLLVGPNASVTVIGRVLGGVSGISRFRLEKGIDTWVV  589

Query  622  KCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            +C CGARDDDGERM++CD C +WQHTRCVG++D +  P  F+C+ C
Sbjct  590  ECSCGARDDDGERMLACDGCGVWQHTRCVGLEDSQPEPDWFLCKRC  635



>ref|XP_009587240.1| PREDICTED: PHD finger protein At1g33420 [Nicotiana tomentosiformis]
Length=712

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 99/192 (52%), Gaps = 11/192 (6%)
 Frame = +1

Query  205  ESDVVSLAAQTILDTKHFVKEWPFRDEL----DDLLRFICIV-VPSSIDMETVLPKGIIP  369
            + +V   +A+ +LD K F+KE+     L     D ++ +C V +    D+ +  P    P
Sbjct  491  KREVAVRSARIVLDCKQFMKEYQPERFLPIPKSDAIQLLCEVDIMEQSDVHSRNP----P  546

Query  370  KEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQL  549
             E +++P  +TI DLK       +D Y     F   ++ G  G+ +   +  ++ S   +
Sbjct  547  PELMILPSDATISDLKAEATRTFQDVYLMFRRFQADELVGYSGLKEATQVKLLLGSAEFV  606

Query  550  FMKG--LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDD  723
             ++G  LG       + E     WTV C CGA+DDDGERM++CDVC +WQHTRC GI D 
Sbjct  607  TVRGKFLGKNALSRYRMERGVERWTVDCFCGAKDDDGERMLACDVCGVWQHTRCAGIPDL  666

Query  724  KAVPPLFVCEVC  759
             AVP  F+C  C
Sbjct  667  DAVPARFICLRC  678



>ref|XP_010096402.1| PHD finger protein [Morus notabilis]
 gb|EXB64073.1| PHD finger protein [Morus notabilis]
Length=645

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 98/198 (49%), Gaps = 3/198 (2%)
 Frame = +1

Query  211  DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVP  390
            D+   +A+ +LD K FVKE+      +    F  +     +  E      I P E +++ 
Sbjct  421  DLAISSAEKLLDCKQFVKEYETEKISNTSPSFTLLSCQVELVDEIEEISTIPPPELVILS  480

Query  391  LHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGL  570
             ++T+ DLKL    A +D Y   + F   ++    GV +   +  ++ S   + ++G   
Sbjct  481  ANATVSDLKLEASKAFQDVYLMFKRFHADELLDYSGVDESTQVKCLLGSTGFVRLRGRCH  540

Query  571  AFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLF  744
               G  +F  E     WTV C CGA+DDDGERM++CD C +WQHTRC GI D + VP  F
Sbjct  541  VKHGLSRFRMERGVERWTVDCSCGAKDDDGERMLACDACGVWQHTRCSGISDSELVPARF  600

Query  745  VCEVCCGRLAPTRTLGGF  798
            VC  C   L   +T G F
Sbjct  601  VCRRCRSALLTPKT-GAF  617



>ref|XP_008786465.1| PREDICTED: PHD finger protein At1g33420-like [Phoenix dactylifera]
Length=674

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 99/191 (52%), Gaps = 20/191 (10%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDELDDL-------LRFICIVVPSSIDMETVLPKGIIPKEHIV  384
            AA  +LD K F+K +   D++DDL       +R  C V       +   P    P E +V
Sbjct  457  AASKLLDCKQFIKHY---DKMDDLGASNPFAVRICCRVELVDRPKDYTAP----PPELLV  509

Query  385  VPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIK-GLEGVGDDEVIFGIVESGTQLFMKG  561
            +P  +T+ DLK  +  A ++TY   + F    +     GVGD   I  I+ S   + ++G
Sbjct  510  LPTAATVADLKSEVTKAFQETYLIFKNFQAEQVLVDHRGVGDATRIKHILRSNEIVRVRG  569

Query  562  LGLAFAGD----LKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD-DK  726
              LA   D     + E     W V C CGA+DDDGERM++CD+C +WQHTRC GI D D+
Sbjct  570  RCLAGDEDRLEHFRMERGMDEWIVDCICGAKDDDGERMLACDMCGVWQHTRCSGISDLDE  629

Query  727  AVPPLFVCEVC  759
             VP  FVC +C
Sbjct  630  EVPAQFVCRLC  640



>ref|XP_007131323.1| hypothetical protein PHAVU_011G004000g [Phaseolus vulgaris]
 gb|ESW03317.1| hypothetical protein PHAVU_011G004000g [Phaseolus vulgaris]
Length=707

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 100/186 (54%), Gaps = 9/186 (5%)
 Frame = +1

Query  217  VSLAAQTILDTKHFVKEW-PFRD--ELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVV  387
            V+ +A+ +LD K F+K++ P+    EL  ++R  C V  S    E   P    P E IV+
Sbjct  475  VADSARKLLDCKQFMKDYKPYEMAIELPSVIRLWCHVELSDQPKEDPCP----PPELIVL  530

Query  388  PLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLG  567
            PL++T+ +LK    +A ++ Y   + F   ++ G   + D   +  ++ +   + ++G  
Sbjct  531  PLNATVAELKSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTVKLLLGTSGSVRIQGKC  590

Query  568  LAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPL  741
             A  G  +F  E     W V C CGA+DDDGE+M++CD C +WQHTRC GI +   +P  
Sbjct  591  PAKHGLSRFRMERGTEAWKVDCTCGAKDDDGEKMLACDTCGVWQHTRCAGIDNSDGMPSK  650

Query  742  FVCEVC  759
            FVC  C
Sbjct  651  FVCMRC  656



>gb|EPS71344.1| hypothetical protein M569_03413 [Genlisea aurea]
Length=695

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 93/188 (49%), Gaps = 6/188 (3%)
 Frame = +1

Query  208  SDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVV  387
            SD  + +A+ ILD K FVK+  FR E  D      + V   +D+  +      P E +++
Sbjct  487  SDFAAASARRILDCKQFVKD--FRPEKADSKESNAVRVLCEMDLSELSDLDPPPPELLLL  544

Query  388  PLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGL-  564
               +T+ DLKL    A R+ Y     F   +I G  G+ D   +  +  S   + ++G  
Sbjct  545  SPDATLADLKLEATTAFREVYLMFRRFRALEIMGYGGLDDSTQLRLLFGSSGSVRIRGKF  604

Query  565  ---GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVP  735
                 +  G  + E     W V C CGA+DDDGERM++CD C IW HTRC GI D   VP
Sbjct  605  AWKNSSSVGRYRLERGVERWVVDCSCGAKDDDGERMLACDGCSIWLHTRCAGIPDSDGVP  664

Query  736  PLFVCEVC  759
              F+C VC
Sbjct  665  AKFMCYVC  672



>ref|XP_006304773.1| hypothetical protein CARUB_v10012280mg [Capsella rubella]
 gb|EOA37671.1| hypothetical protein CARUB_v10012280mg [Capsella rubella]
Length=704

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 93/180 (52%), Gaps = 7/180 (4%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTI  405
            AA  ILD KHF+K++         +   C V  S    +   P    P E +V+PL++T+
Sbjct  483  AATKILDCKHFIKDYLSSTVNPFAINIWCCVELSDESKDCPSP----PSELLVLPLNATV  538

Query  406  GDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGD  585
             DLK+    A ++ Y   + F V +  G   + D   +  +V +   + +KG      G 
Sbjct  539  SDLKIEAAKAFQEVYAMFKRFEVEEFLGYGSIDDSITLKFLVGTNAAVQIKGRCYKH-GL  597

Query  586  LKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            L++  E    NW V CKCG +DDDGERM++CDVC +W HTRC GIK+   +P  F C  C
Sbjct  598  LRYRMERGVDNWKVDCKCGTKDDDGERMLACDVCGVWCHTRCAGIKNADELPSTFHCFRC  657



>ref|XP_006360454.1| PREDICTED: PHD finger protein At1g33420-like [Solanum tuberosum]
Length=705

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 95/185 (51%), Gaps = 11/185 (6%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDEL----DDLLRFICIV-VPSSIDMETVLPKGIIPKEHIVVP  390
            +A T+LD K F+K +     L     D ++ +C V +    D+ +  P    P E +++P
Sbjct  494  SATTVLDCKQFLKVYQPERFLPIPKSDAIQVLCEVDIMEQSDVHSRNP----PPELLILP  549

Query  391  LHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKG--L  564
              +TI DLK       +D Y     F   ++ G  GV +   +  ++ S   + ++G  L
Sbjct  550  SDATISDLKAEASRTFQDVYLMFRRFQADELVGYGGVNESTQVKLLLGSAEFVTVRGKFL  609

Query  565  GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLF  744
            G       + E     WTV C CGA+DDDGERM++CDVC +WQHTRC GI D  AVP  F
Sbjct  610  GKNGLSKYRMERGMERWTVDCFCGAKDDDGERMLACDVCSVWQHTRCAGIPDLDAVPAKF  669

Query  745  VCEVC  759
            +C  C
Sbjct  670  ICLRC  674



>ref|NP_001051078.2| Os03g0716200 [Oryza sativa Japonica Group]
 dbj|BAF12992.2| Os03g0716200 [Oryza sativa Japonica Group]
Length=657

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 115/227 (51%), Gaps = 26/227 (11%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEP---DKPASLTAVPPVDVFGDVF  171
            +Y+V R  +  TRVL ++L+E +            P P   D     T +PPV  +    
Sbjct  441  NYIVRRVPDAETRVLHFSLEEYEE-----------PTPALLDVEVECTPLPPVVRWPSTV  489

Query  172  CLYSNVLLGYKES-DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDM-ET  345
             +  ++   Y+   +V S AAQ +LD KH+VK W   DE DD LRF     P   +  E 
Sbjct  490  EVERDLRAVYRAMVEVRSEAAQAVLDCKHWVKWWGLGDESDDQLRFFVEWQPQPWEAAEL  549

Query  346  VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
            + P  +   E +VVPLH+++G+L +  + A+RDTY   EEF    + G+ G   D V+ G
Sbjct  550  IRPMPL--GEIVVVPLHASMGELLVESEHALRDTYYFFEEFQAEGLHGIAGEKWDPVMLG  607

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHN----WTVKCKCGARDDDG  654
              E+G  + + G G     D++ E R H     W V+C CGA+DDDG
Sbjct  608  GAENGDTISVYGNG----ADMETELRCHGGLDLWEVRCVCGAQDDDG  650



>dbj|BAK05033.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=668

 Score =   110 bits (275),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 83/290 (29%), Positives = 125/290 (43%), Gaps = 51/290 (18%)
 Frame = +1

Query  1    SYVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTA----------VPPV  150
            +YVV RA+N  T+VLEY L+++ +        VL       A + A          +   
Sbjct  381  NYVVRRAMNPVTKVLEYCLEDVSS--------VLPASVGAGAGVPAGHGKMRVRFHLTRA  432

Query  151  DVFGDVFCLYSNVL------LGYKESDVVSLAAQTILDTKHFVKEW--PFRDELDDLLRF  306
             +  D+  LY +VL      L       + +A + ILD KHFVK++          ++  
Sbjct  433  QLMRDLVHLYRHVLKEPSQALTTGAFGAIPVAVRMILDIKHFVKDYHEGMTGTNSGVVGH  492

Query  307  ICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIK  486
            + I +  ++ +     + + P E + VP H+T+G+LK  +Q   RD Y  +  F    + 
Sbjct  493  VYISLCCTLIVRNGSSELVPPYETVTVPAHATVGELKWEVQRLFRDMYLGLRTFTAECVV  552

Query  487  GLEGVGDDEVIFGIV-------------------ESGTQLFMKGLGLAFAGDLKFEDRAH  609
            G+    D     G++                   E G Q           GD+       
Sbjct  553  GIGAGLDASPALGLIGVGSTVVVEGVVGEQQEPAEEGDQRKKAAAVCEGGGDVG------  606

Query  610  NWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
               V C CGA DDDGERM  CD+CE WQHTRC G+ D + VP +F+C  C
Sbjct  607  ERVVDCVCGADDDDGERMACCDICEAWQHTRCAGVADTEDVPHVFLCSRC  656



>ref|XP_009783934.1| PREDICTED: PHD finger protein At1g33420 [Nicotiana sylvestris]
Length=712

 Score =   110 bits (275),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 96/185 (52%), Gaps = 11/185 (6%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDEL----DDLLRFICIV-VPSSIDMETVLPKGIIPKEHIVVP  390
            +A+ +LD K F+KE+     L     D ++ +C V +    D+ +  P    P E +++P
Sbjct  498  SARIVLDCKQFMKEYQPERFLPIPKSDSIQLLCEVDIMEHSDVHSRNP----PPELMILP  553

Query  391  LHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKG--L  564
              +TI DLK       +D Y     F   ++ G  G+ +   +  ++ S   + ++G  L
Sbjct  554  SDATISDLKAEATRTFQDVYLMFRRFQADELVGYSGLKEATQVKLLLGSAEFVTVRGKFL  613

Query  565  GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLF  744
            G       + E     WTV C CGA+DDDGERM++CDVC +WQHTRC GI D  AVP  F
Sbjct  614  GKNALSRYRMERGVERWTVDCFCGAKDDDGERMLACDVCGVWQHTRCAGIPDLDAVPARF  673

Query  745  VCEVC  759
            +C  C
Sbjct  674  ICLRC  678



>ref|XP_007199715.1| hypothetical protein PRUPE_ppa002124mg [Prunus persica]
 gb|EMJ00914.1| hypothetical protein PRUPE_ppa002124mg [Prunus persica]
Length=713

 Score =   110 bits (275),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 95/183 (52%), Gaps = 9/183 (5%)
 Frame = +1

Query  226  AAQTILDTKHFVKEW---PFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLH  396
            AA  +LD K FVK++       E    +   C V  S    + +    ++P E IV+PL+
Sbjct  483  AATKLLDCKQFVKDYMPDKMAAESSCGIHLWCHVELSDEPKDDL----VLPPELIVLPLN  538

Query  397  STIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAF  576
            +T+ DLK     A ++ Y   + F V ++     + D   +  +V +   + +KG   A 
Sbjct  539  ATVADLKREATMAFQEVYAMFKRFEVEELLEYGSINDSFTVKLLVGTCGSIRLKGRCPAK  598

Query  577  AGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVC  750
             G  +F  E    +WTV C CGA+DDDGERM++CD C +WQHTRC GI    A+P  FVC
Sbjct  599  HGLNRFRMERGLESWTVDCTCGAKDDDGERMLACDTCGVWQHTRCAGIHSSDAIPARFVC  658

Query  751  EVC  759
              C
Sbjct  659  MRC  661



>ref|XP_008237816.1| PREDICTED: PHD finger protein At1g33420 [Prunus mume]
Length=712

 Score =   110 bits (274),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 97/183 (53%), Gaps = 9/183 (5%)
 Frame = +1

Query  226  AAQTILDTKHFVKEW-PFRDELDDLL--RFICIVVPSSIDMETVLPKGIIPKEHIVVPLH  396
            AA  +LD K FVK++ P +   +  L     C V  S    + +    ++P E IV+PL+
Sbjct  482  AATKLLDCKQFVKDYMPDKMAAESSLGIHLWCHVELSDEPKDDL----VLPPELIVLPLN  537

Query  397  STIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAF  576
            +T+ DLK     A ++ Y   + F V ++     + D   +  +V +   + +KG   A 
Sbjct  538  ATVADLKREATIAFQEVYAMFKRFEVEELLEYGSINDSFTVKLLVGTCGSIRLKGRCPAK  597

Query  577  AGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVC  750
             G  +F  E    +WTV C CGA+DDDGERM++CD C +WQHTRC GI    A+P  FVC
Sbjct  598  HGLNRFRMERGLESWTVDCTCGAKDDDGERMLACDTCGVWQHTRCAGIHSSDAIPARFVC  657

Query  751  EVC  759
              C
Sbjct  658  MRC  660



>ref|XP_006849470.1| hypothetical protein AMTR_s00024p00102300 [Amborella trichopoda]
 gb|ERN11051.1| hypothetical protein AMTR_s00024p00102300 [Amborella trichopoda]
Length=455

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 129/277 (47%), Gaps = 34/277 (12%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            V+ R +N  T+VLEY L++L     +  E  +        + + +    V  D+  LY N
Sbjct  176  VIRRVLNPVTKVLEYRLEDLCRNPFSGPENYI---SGVKMAHSQISRSQVAKDLAYLYKN  232

Query  187  VLL------GYKESDV----VSLAAQTILDTKHFVKEWPFRDELDD------LLRFICIV  318
            VL       G+  + +    +  A + +LD KH VK++    +         ++R +C V
Sbjct  233  VLRDNGRNSGFPATGIHLPAIKEAVRAVLDAKHLVKDYEAATDRGGSSHEGAMVRVLCSV  292

Query  319  VPSSIDMET---------VLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFV  471
               + D+                +IP E + +P  +++GDLK  +++A  + Y  +    
Sbjct  293  SLENGDISADGEISGARVSAESVVIPAEFVSIPARASVGDLKRELESAFGEIYFGLRGIF  352

Query  472  VTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKFE-DRAHNWTVKCKCGARDD  648
            V ++ G       + +  +V+SG ++  +G      G +  E  R     V C CGAR++
Sbjct  353  VAEVVGARA---SDPVGRMVKSGHEVVARGR--VPGGSVWCEGKREKGGVVDCLCGAREE  407

Query  649  DGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            DGERM+ CDVCE+WQH RC  +  D  +P +F+C  C
Sbjct  408  DGERMVCCDVCEVWQHARCSRVDGDDVIPTIFLCTRC  444



>ref|XP_004144350.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus]
Length=668

 Score =   109 bits (273),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 107/218 (49%), Gaps = 12/218 (6%)
 Frame = +1

Query  175  LYSNVLLGY-----KESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRF-ICIVVPSSID  336
            L+ N ++ Y     +E+ V S  A  ++D K FVK++        L  F IC++    + 
Sbjct  443  LHPNSMVNYGPQATREAAVSS--ALKLIDCKQFVKDYEPEKLSTKLNPFSICLLCEVEVV  500

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD--  510
             ++       P E +++P ++T+ DLKL    A +D Y     F   +I    GV D   
Sbjct  501  EDSKDNSSRPPPELVILPSNATMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDSTQ  560

Query  511  -EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
             +++FG  ES        +  A     + E     WTV C CGA+DDDGERM++CD+C +
Sbjct  561  VKLLFGQTESVRVRGRCQVKTAL-NRFRMERGVERWTVDCSCGAKDDDGERMLACDLCGV  619

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGFE  801
            W+HTRC GI+D   VP  FVC  C   +    T G  E
Sbjct  620  WRHTRCSGIQDSDDVPGKFVCYKCRSSIVAMNTNGETE  657



>gb|KGN54749.1| hypothetical protein Csa_4G443130 [Cucumis sativus]
Length=705

 Score =   110 bits (274),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 107/218 (49%), Gaps = 12/218 (6%)
 Frame = +1

Query  175  LYSNVLLGY-----KESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRF-ICIVVPSSID  336
            L+ N ++ Y     +E+ V S  A  ++D K FVK++        L  F IC++    + 
Sbjct  480  LHPNSMVNYGPQATREAAVSS--ALKLIDCKQFVKDYEPEKLSTKLNPFSICLLCEVEVV  537

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD--  510
             ++       P E +++P ++T+ DLKL    A +D Y     F   +I    GV D   
Sbjct  538  EDSKDNSSRPPPELVILPSNATMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDSTQ  597

Query  511  -EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
             +++FG  ES        +  A     + E     WTV C CGA+DDDGERM++CD+C +
Sbjct  598  VKLLFGQTESVRVRGRCQVKTAL-NRFRMERGVERWTVDCSCGAKDDDGERMLACDLCGV  656

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGFE  801
            W+HTRC GI+D   VP  FVC  C   +    T G  E
Sbjct  657  WRHTRCSGIQDSDDVPGKFVCYKCRSSIVAMNTNGETE  694



>ref|XP_004165011.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus]
Length=668

 Score =   109 bits (273),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 107/218 (49%), Gaps = 12/218 (6%)
 Frame = +1

Query  175  LYSNVLLGY-----KESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRF-ICIVVPSSID  336
            L+ N ++ Y     +E+ V S  A  ++D K FVK++        L  F IC++    + 
Sbjct  443  LHPNSMVNYGPQATREAAVSS--ALKLIDCKQFVKDYEPEKLSTKLNPFSICLLCEVEVV  500

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD--  510
             ++       P E +++P ++T+ DLKL    A +D Y     F   +I    GV D   
Sbjct  501  EDSKDNSSRPPPELVILPSNATMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDSTQ  560

Query  511  -EVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
             +++FG  ES        +  A     + E     WTV C CGA+DDDGERM++CD+C +
Sbjct  561  VKLLFGQTESVRVRGRCQVKTAL-NRFRMERGVERWTVDCSCGAKDDDGERMLACDLCGV  619

Query  688  WQHTRCVGIKDDKAVPPLFVCEVCCGRLAPTRTLGGFE  801
            W+HTRC GI+D   VP  FVC  C   +    T G  E
Sbjct  620  WRHTRCSGIQDSDDVPGKFVCYKCRSSIVAMNTNGETE  657



>gb|KDP24219.1| hypothetical protein JCGZ_25876 [Jatropha curcas]
Length=677

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 5/182 (3%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDELDDLLR--FICIVVPSSIDMETVLPKGIIPKEHIVVPLHS  399
            +A+ +LD K FVKE+   +++  +     +C++    I   T       P E IV+P ++
Sbjct  486  SAERLLDCKQFVKEYA-AEKMSSITNPPVMCLLCDVEIMDLTEENATSHPPELIVLPQNA  544

Query  400  TIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGL--GLA  573
            T+ DLKL    A ++ Y   + F   ++ G  GV D   +  ++ S   + ++G   G  
Sbjct  545  TVYDLKLEASKAFQEVYLMFKRFQAEELLGYRGVDDSTQVKLLLGSTEFVKVRGRCHGKN  604

Query  574  FAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCE  753
                 + E     WTV C CGA+DDDGERM++CDVC +WQHTRC  I D ++VP  FVC 
Sbjct  605  ALSKFRMERGIERWTVDCICGAKDDDGERMLACDVCGVWQHTRCSHIPDVESVPAKFVCR  664

Query  754  VC  759
             C
Sbjct  665  RC  666



>ref|XP_008802928.1| PREDICTED: PHD finger protein At1g33420-like [Phoenix dactylifera]
Length=709

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/274 (31%), Positives = 122/274 (45%), Gaps = 45/274 (16%)
 Frame = +1

Query  7    VVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSN  186
            VV    N  T  +EY L+   N  QT   R L     +P++   +  +    D   L   
Sbjct  416  VVAARRNAETSAIEYRLEAASN--QTMTTRYL----SRPSADQLLQDLKFLYDAL-LSPA  468

Query  187  VLLGYKES---DVVSLAAQTILDTKHFVKEW--PFRDEL---DDLLRFICIVVPSSIDME  342
             +  Y+     +  S +A  +LD K F+K +  P  ++L     +L   C V    ID  
Sbjct  469  TMQSYRPQATEEAASSSASKLLDCKQFIKHYDEPASNQLPSGQSMLPIWCHV--ELIDH-  525

Query  343  TVLPKGII--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFV----------VTD--  480
               PKG    P E +++P+ +T+ DLK     A ++TY   + F           V+D  
Sbjct  526  ---PKGYTTPPPELLILPMTATVADLKQQATRAFQETYLIFQRFQAEQLILDRGDVSDFA  582

Query  481  -IKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGE  657
             ++ + G+ +   I G      Q F         G  + E    NW V C CGA+DDDGE
Sbjct  583  LVRHILGLNEIAKIRGTCSGVDQRF---------GQFRMERGLENWIVDCDCGAKDDDGE  633

Query  658  RMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            RM++CD C +WQHTRC GI D   VP  +VC  C
Sbjct  634  RMMACDACGVWQHTRCAGISDHDEVPAKYVCRKC  667



>ref|XP_004970770.1| PREDICTED: PHD finger protein At1g33420-like [Setaria italica]
Length=713

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 95/186 (51%), Gaps = 13/186 (7%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII--PKEHIVVPLHS  399
            AA  ILD K F+K +  +  L        + V  SI++    PK     P+E +++P  +
Sbjct  484  AAAKILDCKQFIKHYD-KHALRTPSNPFLLSVRCSIELLD-HPKDYTAPPEELVLLPASA  541

Query  400  TIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFA  579
            T+ +LK+    A ++TY   + F    +       D   +  ++ SG  + ++G      
Sbjct  542  TLAELKVQASRAFQETYLMFQSFQAEQLPDFPNFSDTTPVKHVLGSGQLVRLRG---RCT  598

Query  580  GD------LKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPL  741
            GD       + E    NWTV C CGA+DDDGERM++CDVC +WQHTRC GI D + VP  
Sbjct  599  GDYRRIVQFRMERGLENWTVDCSCGAKDDDGERMLACDVCGVWQHTRCSGISDFEEVPEN  658

Query  742  FVCEVC  759
            F+C  C
Sbjct  659  FICRKC  664



>gb|EPS66457.1| hypothetical protein M569_08321 [Genlisea aurea]
Length=648

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/253 (29%), Positives = 127/253 (50%), Gaps = 13/253 (5%)
 Frame = +1

Query  4    YVVHRAVNRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYS  183
            Y + R +N  T+VLEY L+++   D    +++L      P+S  A    D+      L+ 
Sbjct  397  YFIRRCLNPVTKVLEYCLEDVS--DAVVPQKLLRHHQLNPSS--AQIDKDIHQIYAALFG  452

Query  184  NVLLGYKESDVVSLAAQTILDTKHFVKEWPFRDE-LDDLLRFICIVVPSSIDMETVLPKG  360
            N++ G      +  A++ ILD+KH +K++   +   D+  +  C V+ ++   E      
Sbjct  453  NII-GDGALSKIPPASRIILDSKHLIKDYGGEEAPADNKWKVYCNVILTNDGEEEEEEVA  511

Query  361  IIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESG  540
              P+   ++   S   +LK  ++   R+TY  ++ F    I+     G D ++F  V+ G
Sbjct  512  ATPQHCFLLRNCSDFDELKSDVERVFRETYWELKNFSADTIRNANPKGSD-LVFKTVKPG  570

Query  541  TQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKD  720
            + +  +G   ++ G    ED      V+C CG +DDDGERM+ CDVC++ QH RCVGI +
Sbjct  571  SGVVFEG-KRSWEGGGGMED-----AVECVCGTKDDDGERMVPCDVCQVRQHARCVGIPE  624

Query  721  DKAVPPLFVCEVC  759
               +P +F+C  C
Sbjct  625  SDEIPSIFMCAGC  637



>ref|XP_011083217.1| PREDICTED: PHD finger protein At1g33420 [Sesamum indicum]
Length=710

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 98/196 (50%), Gaps = 10/196 (5%)
 Frame = +1

Query  226  AAQTILDTKHFVKEW-PFR---DELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPL  393
            +A  ILD K FVK++ P R      ++ ++ +C V       E        P E +V+  
Sbjct  491  SATKILDCKQFVKDYQPERLLSTSKENAVQLLCEVDLMEQPEECCHNP---PPELLVLSP  547

Query  394  HSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKG--LG  567
             +TI DLKL    A +D Y     F   ++ G  GV +   I  ++ S   + ++G  LG
Sbjct  548  DATIADLKLEAMRAFQDVYLMFRRFQADELVGYGGVDESTQIKLLLGSTEFVRVRGRFLG  607

Query  568  LAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFV  747
                G  + E     W V C CGA+DDDGERM++CDVC IWQHTRC GI D + VP  F 
Sbjct  608  KNGLGRFRMERGIERWIVDCLCGAKDDDGERMLACDVCSIWQHTRCSGIPDSEGVPAKFF  667

Query  748  CEVCCGRLAPTRTLGG  795
            C   C R+A T    G
Sbjct  668  CHR-CRRVAQTGKSNG  682



>ref|XP_003540842.1| PREDICTED: PHD finger protein At1g33420-like [Glycine max]
 gb|KHN32453.1| PHD finger protein [Glycine soja]
Length=708

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 102/187 (55%), Gaps = 10/187 (5%)
 Frame = +1

Query  217  VSLAAQTILDTKHFVKEW-PFRD--ELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVV  387
            V+ +A+ +LD K F+K++ P+    EL  ++R +C V  S    +   P    P E IV+
Sbjct  475  VADSARKLLDCKQFMKDYKPYEMAVELPSVIRLLCHVELSDQPKDDPSP----PPELIVL  530

Query  388  PLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLG  567
            PL++T+ DLK    +A ++ Y   + F   ++ G   + D   I  ++ +   + ++G  
Sbjct  531  PLNATVADLKSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTIKFLLGTSGSIQIQGRC  590

Query  568  LAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDK-AVPP  738
             A  G  +F  E     W V C CGA+DDDGE+M++CD C +WQHTRC GI ++   +P 
Sbjct  591  PAKHGLSRFRMERGTEVWKVDCICGAKDDDGEKMLACDTCGVWQHTRCAGIDNNTDGMPS  650

Query  739  LFVCEVC  759
             FVC  C
Sbjct  651  KFVCMRC  657



>emb|CDP21393.1| unnamed protein product [Coffea canephora]
Length=716

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 97/188 (52%), Gaps = 3/188 (2%)
 Frame = +1

Query  205  ESDVVSLAAQTILDTKHFVKEW-PFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHI  381
            + DV   +A+T+LD K FVK++ P +  L      I ++    +   +       P E +
Sbjct  492  KRDVAYDSARTLLDCKQFVKDYQPEKFLLASKPYAIQLLCEVDLMEHSDEHAKNPPPELL  551

Query  382  VVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKG  561
            ++   +TI DLKL      +D Y   + +   ++ G  GV D   +  ++     + ++G
Sbjct  552  ILSSDATISDLKLEASKVFQDVYLLFKRYQAEELVGYGGVVDSTQVKLLLGPAEFVRVRG  611

Query  562  --LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVP  735
               G +     + E     WTV C CGA+DDDGERM++CD C +WQHTRC GI+D +AVP
Sbjct  612  KCFGKSSLSKYRMERGVERWTVDCNCGAKDDDGERMLACDSCSVWQHTRCTGIQDSEAVP  671

Query  736  PLFVCEVC  759
              +VC  C
Sbjct  672  LKYVCLRC  679



>ref|XP_010674289.1| PREDICTED: PHD finger protein At1g33420 [Beta vulgaris subsp. 
vulgaris]
Length=712

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 96/193 (50%), Gaps = 20/193 (10%)
 Frame = +1

Query  226  AAQTILDTKHFVKEWPFRDELDDLL-------RFICIVVPSSIDMETVLPKGIIPKEHIV  384
            AA  +LD K FVK   ++ E    L        F  +  P  +  E V+     P E I 
Sbjct  490  AASKLLDCKQFVKN--YKPETTSSLVNSSAIYLFCQVEFPVHLSEEQVMRP---PPELIA  544

Query  385  VPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGL  564
               ++TI DLK  +    ++ Y  ++ F   ++    GV D   +  +  S   + ++G 
Sbjct  545  FSSNATISDLKAEVSKVFQEVYIMLKGFQAEELVDYRGVEDSTQVKLLFPSLVTVRIQGR  604

Query  565  -----GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKA  729
                 GL   G  + E     WTV+C CGARDDDGERM++CDVC +WQHTRC GI D +A
Sbjct  605  CPLKNGL---GRFRLERGVERWTVECSCGARDDDGERMLACDVCGVWQHTRCAGILDFEA  661

Query  730  VPPLFVCEVCCGR  768
            VP  F+C  C G+
Sbjct  662  VPAKFLCIRCGGK  674



>gb|EAY76692.1| hypothetical protein OsI_04645 [Oryza sativa Indica Group]
Length=716

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 122/261 (47%), Gaps = 34/261 (13%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVL----  192
            N  T  +EY L++  N +Q+       P  D            +  D+  LY+ +L    
Sbjct  425  NAETSAIEYRLED--NSNQSVDAAAFGPSVDH-----------LLHDLKFLYNALLNPET  471

Query  193  LGYKESDVVSL----AAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKG  360
            +   + +V+      AA  ILD K F+K +        L  F+ + V  SI++    PK 
Sbjct  472  MLASQPEVIGASSHSAAAKILDCKQFIKHYDQHTPRAPLNPFL-LSVRCSIELLD-HPKD  529

Query  361  II--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVE  534
                P E +++P  +T+ +LK+    A ++TY   + F V  +       D  ++  ++ 
Sbjct  530  YTAPPVELVLLPASATLAELKIQATRAFQETYLMFQSFQVEQLPDFPNFSDTTLVKHVLG  589

Query  535  SGTQLFMKGLGLAFAGD------LKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQH  696
            S   + ++G      GD       + E    NWTV C CGA+DDDGERM++CDVC +WQH
Sbjct  590  SSQLVRVRG---RCTGDNRRIVQFRMERGLENWTVDCTCGAKDDDGERMLACDVCGVWQH  646

Query  697  TRCVGIKDDKAVPPLFVCEVC  759
            TRC GI D   VP  F+C  C
Sbjct  647  TRCSGISDFDDVPEKFICRKC  667



>ref|XP_002267837.1| PREDICTED: PHD finger protein At1g33420 [Vitis vinifera]
 emb|CBI27702.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 99/194 (51%), Gaps = 19/194 (10%)
 Frame = +1

Query  211  DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGII--------  366
            D+   +A  +LD K FVK+  +R E     + + I  P  + +  ++    +        
Sbjct  483  DLAVSSAAKLLDCKQFVKD--YRPE-----KGLSITNPFGVHLSCLVELMELSEEGDTKP  535

Query  367  PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD---EVIFGIVES  537
            P E IV+  ++TI DLKL    A +D Y   + F   ++ G  GV +    +++ G +E+
Sbjct  536  PPELIVLSPNATISDLKLEASRAFQDVYLMFKRFKAEELVGYAGVDESTQLKLLLGSIET  595

Query  538  GTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
              ++  + LG       + E     WTV C CGA+DDDGERM++CD C +WQHTRC  I 
Sbjct  596  -VEVRGRCLGKNGLSRFRMERGQERWTVDCSCGAKDDDGERMLACDGCGVWQHTRCAEIP  654

Query  718  DDKAVPPLFVCEVC  759
            D  AVP  F+C  C
Sbjct  655  DSAAVPARFICWRC  668



>gb|EYU31209.1| hypothetical protein MIMGU_mgv1a026000mg, partial [Erythranthe 
guttata]
Length=685

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 103/206 (50%), Gaps = 17/206 (8%)
 Frame = +1

Query  202  KESDVVSLAAQTILDTKHFVKEWPFRDEL----DDLLRFICIV--VPSSIDMETVLPKGI  363
            K +  VS A Q ILD K FVK++     L    ++ ++ +C +  +    D  +  P   
Sbjct  484  KRNLAVSSAMQ-ILDCKQFVKDYHPGHFLSVPKENAVQVLCEIDLLEHHPDEHSHNP---  539

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
             P E +V+   +TI DLK     A +D Y     F V +I G  GV +   I  ++ S  
Sbjct  540  -PPELLVLSPDATIADLKQEAMRAFQDVYLMFRRFQVDEIVGYGGVDESTQIKLLLGSME  598

Query  544  QLFMKG--LGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
             + ++G  LG       + E     W V C CGA+DDDGERM++CDVC IWQHTRC GI 
Sbjct  599  FVRIRGQFLGKNGLSRYRMERGNERWIVDCLCGAKDDDGERMLACDVCSIWQHTRCCGIP  658

Query  718  DDKAVPPLFVCEVCCGRLAPTRTLGG  795
            D + VP  F C+ C     PT  + G
Sbjct  659  DSEGVPARFFCQRC----RPTTKMNG  680



>ref|NP_001159230.1| hypothetical protein [Zea mays]
 ref|XP_008677468.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008677469.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25519.1| unknown [Zea mays]
 gb|AFW60509.1| hypothetical protein ZEAMMB73_506546 [Zea mays]
Length=591

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/264 (30%), Positives = 108/264 (41%), Gaps = 42/264 (16%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVLLGYK  204
            N  T  LEY L +         E +++P    P        +    D   L+ + +  YK
Sbjct  307  NSDTNTLEYRLMD---------EPIVLPNVSMPTQDHLRRDIKFLHDAL-LHPHTMHPYK  356

Query  205  ESDVV---SLAAQTILDTKHFVKEWPFRDEL----DDLLRFICIVVPSSIDMETVLPKGI  363
              +       +A  +LD K F K +    E       +L   C V      ++ V     
Sbjct  357  PENCYEHGKRSAMVLLDCKQFTKHYDLEQEFLPQNPSMLHLWCQVEV----LDQVGDPPC  412

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVV------------TDIKGLEGVGD  507
            IP E + +P  +T+ DLK+      R  Y  +  FV             T +K L G   
Sbjct  413  IPPELLTLPQTATVSDLKVEATRTFRGIYLMLHSFVADRLVDCGTASESTQLKLLFGANG  472

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
               + G   SG +           G  + E     WTV+C CGA+DDDGERM+SCD C +
Sbjct  473  TVRVQGRCASGERR---------VGIYRMERGVDKWTVRCSCGAKDDDGERMLSCDSCHV  523

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            WQHTRCVGI D   VP  +VC  C
Sbjct  524  WQHTRCVGISDFDQVPKKYVCNSC  547



>ref|XP_003056829.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58474.1| predicted protein [Micromonas pusilla CCMP1545]
Length=361

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 110/258 (43%), Gaps = 57/258 (22%)
 Frame = +1

Query  154  VFGDVFCLYSNVLLGYKE----------------------SDVVSLAAQTILDTKHFVKE  267
            +  DV  +Y N+L  YK                       SD++  AA+ +LDTK FVK 
Sbjct  61   ISNDVKVVYKNLLESYKPARARPGRPLKGTAPGEPKKCHGSDLIH-AARVLLDTKQFVKT  119

Query  268  WPFRDELDDLL-----------------RFICIVVPSSIDMETVLPK-------------  357
            +    ++  L                  + + ++V + ID     PK             
Sbjct  120  YCSTSDMLALRPPASATAGKSGRPPMVSKGVRVMVTAVIDSRNKGPKVSGLSIKEKKKLK  179

Query  358  -GI---IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFG  525
             GI    P E I++P    + DLK A+     D Y  + ++ V  + G E   +   +  
Sbjct  180  YGIETKPPPEVILLPPEPMLCDLKNAVNKVFSDLYVVLAKYRVRHVIGFESTQEKARLNA  239

Query  526  IVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRC  705
               +G  L + G G     D +++     W V+C CG  DDDGERMI+CDVCE+W HTRC
Sbjct  240  KKIAGASLEVLGDGADLESDFRYQGGLDQWIVRCVCGTCDDDGERMIACDVCEVWMHTRC  299

Query  706  VGIKDDKAVPPLFVCEVC  759
            VGI D +  P  + C+ C
Sbjct  300  VGISDSENTPRRWTCKEC  317



>ref|XP_008677465.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008677466.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008677467.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=619

 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/264 (30%), Positives = 108/264 (41%), Gaps = 42/264 (16%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVLLGYK  204
            N  T  LEY L +         E +++P    P        +    D   L+ + +  YK
Sbjct  335  NSDTNTLEYRLMD---------EPIVLPNVSMPTQDHLRRDIKFLHDAL-LHPHTMHPYK  384

Query  205  ESDVV---SLAAQTILDTKHFVKEWPFRDEL----DDLLRFICIVVPSSIDMETVLPKGI  363
              +       +A  +LD K F K +    E       +L   C V      ++ V     
Sbjct  385  PENCYEHGKRSAMVLLDCKQFTKHYDLEQEFLPQNPSMLHLWCQVEV----LDQVGDPPC  440

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVV------------TDIKGLEGVGD  507
            IP E + +P  +T+ DLK+      R  Y  +  FV             T +K L G   
Sbjct  441  IPPELLTLPQTATVSDLKVEATRTFRGIYLMLHSFVADRLVDCGTASESTQLKLLFGANG  500

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
               + G   SG +           G  + E     WTV+C CGA+DDDGERM+SCD C +
Sbjct  501  TVRVQGRCASGERR---------VGIYRMERGVDKWTVRCSCGAKDDDGERMLSCDSCHV  551

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            WQHTRCVGI D   VP  +VC  C
Sbjct  552  WQHTRCVGISDFDQVPKKYVCNSC  575



>ref|XP_008227667.1| PREDICTED: PHD finger protein At1g33420-like [Prunus mume]
Length=712

 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 104/209 (50%), Gaps = 10/209 (5%)
 Frame = +1

Query  163  DVFCLYSNVL--------LGYKESDVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIV  318
            D+ CLY  +L        +     D+   +A+ +L  K FVK++       +     C++
Sbjct  464  DMRCLYEAMLQPQTMMKNVPQVTRDLTISSAEKLLYCKQFVKDYKPEKMSTNDPSVTCVL  523

Query  319  VPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEG  498
                   E+     I P   ++V  ++T+ DLK+A   A +D Y  ++ F   ++    G
Sbjct  524  CRVEFTDESEEYASINPPPELIVLSNATVSDLKIAASKAFQDVYLILKRFKAEELLDYGG  583

Query  499  VGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISC  672
            V +   I  ++ S   + ++G   A +   K+  E     WTV C CGA+DDDGERM +C
Sbjct  584  VDESTQIKHLLGSTESVRVRGRCNAKSVWSKYMMERGIERWTVDCSCGAKDDDGERMFTC  643

Query  673  DVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
            DVC +W+HT+C GI D  +VP  FVC+ C
Sbjct  644  DVCGVWRHTKCSGIPDSDSVPAKFVCDRC  672



>ref|XP_008394231.1| PREDICTED: PHD finger protein At1g33420-like [Malus domestica]
Length=710

 Score =   106 bits (265),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 94/185 (51%), Gaps = 2/185 (1%)
 Frame = +1

Query  211  DVVSLAAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVP  390
            D+   +A+ +LD K FVK++       +     C++       E+     I P   ++V 
Sbjct  487  DLAISSAEKLLDCKQFVKDYKPEKMSANDPSVTCVLCSVEFIDESEECSFINPPPELIVL  546

Query  391  LHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGL  570
             ++ + DLKLA   A +D Y  ++ F   ++     V +   +  ++ S   + ++G   
Sbjct  547  SNAAVSDLKLAASKAFQDVYLILKRFQAEELLDCGDVDESTQVKHLLGSAEHVRVRGRCN  606

Query  571  AFA--GDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLF  744
            A +     + E     WTV C CGA+DDDGERM++CD C +W+HTRC GI D  +VP  F
Sbjct  607  AKSVWSKFRMERGTERWTVDCTCGAKDDDGERMLACDCCGVWRHTRCTGIPDSDSVPAKF  666

Query  745  VCEVC  759
            +CE C
Sbjct  667  LCERC  671



>ref|XP_010063730.1| PREDICTED: PHD finger protein At1g33420 [Eucalyptus grandis]
Length=721

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = +1

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
            +P+E IV+PL++T+ DLK  +  A +D Y   + F          + D   +  +     
Sbjct  534  LPQELIVLPLNATVADLKAKVTKAFQDVYAMFKRFQAVGFPEYGHIEDSLSVKLLTGLNG  593

Query  544  QLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
             + + G  L+  G  +F  E    NWTV C CGA+DDDGERM++CD C +WQHTRC GI 
Sbjct  594  SIRVHGKCLSMHGLNRFRMERGIENWTVDCDCGAKDDDGERMLACDTCGVWQHTRCAGID  653

Query  718  DDKAVPPLFVCEVC  759
            +  +VP  +VC+ C
Sbjct  654  NSDSVPLKYVCKRC  667



>gb|KCW70986.1| hypothetical protein EUGRSUZ_F04095 [Eucalyptus grandis]
Length=714

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = +1

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGT  543
            +P+E IV+PL++T+ DLK  +  A +D Y   + F          + D   +  +     
Sbjct  527  LPQELIVLPLNATVADLKAKVTKAFQDVYAMFKRFQAVGFPEYGHIEDSLSVKLLTGLNG  586

Query  544  QLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIK  717
             + + G  L+  G  +F  E    NWTV C CGA+DDDGERM++CD C +WQHTRC GI 
Sbjct  587  SIRVHGKCLSMHGLNRFRMERGIENWTVDCDCGAKDDDGERMLACDTCGVWQHTRCAGID  646

Query  718  DDKAVPPLFVCEVC  759
            +  +VP  +VC+ C
Sbjct  647  NSDSVPLKYVCKRC  660



>ref|NP_001067563.1| Os11g0234200 [Oryza sativa Japonica Group]
 gb|AAX94898.1| PHD-finger, putative [Oryza sativa Japonica Group]
 gb|AAX96648.1| PHD-finger, putative [Oryza sativa Japonica Group]
 gb|ABA92270.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF27926.1| Os11g0234200 [Oryza sativa Japonica Group]
 dbj|BAG97251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=715

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 102/234 (44%), Gaps = 31/234 (13%)
 Frame = +1

Query  133  TAVPPVDV--------FGDVFCLYSNVLLGY--------KESDVVSLAAQTILDTKHFVK  264
            T  PP +V        F D+  LY  +L  Y        +       +A  +LD K F+K
Sbjct  445  TLFPPNNVCTLTQDHLFRDIKFLYDALLYPYTMHPYMPEENYQHAKRSAMILLDCKQFIK  504

Query  265  EWPFRDEL----DDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQA  432
             +   ++        L   C V  +    + V     IP E I +P  +TI DLK     
Sbjct  505  HYDLEEDFLPQNPSQLHIWCQVELA----DQVDDPPCIPAELITLPQAATIADLKGEAAR  560

Query  433  AMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF-----E  597
            A RD Y  ++ FV   +       D   I  +  +   + +KG      G+ +F     E
Sbjct  561  AFRDIYLMLQSFVADQLLDCATASDTTQIKLLFGAKGAVHIKGR--CIGGERRFAIYRME  618

Query  598  DRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
                 WTVKC CGA DDDGERM+SCD C +W HTRC GI D   VP  +VC+ C
Sbjct  619  RGVDKWTVKCSCGATDDDGERMLSCDTCHMWMHTRCAGISDFDRVPKRYVCKSC  672



>ref|XP_008677464.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60510.1| hypothetical protein ZEAMMB73_506546 [Zea mays]
Length=697

 Score =   106 bits (265),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 78/264 (30%), Positives = 108/264 (41%), Gaps = 42/264 (16%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVLLGYK  204
            N  T  LEY L +         E +++P    P        +    D   L+ + +  YK
Sbjct  413  NSDTNTLEYRLMD---------EPIVLPNVSMPTQDHLRRDIKFLHDAL-LHPHTMHPYK  462

Query  205  ESDVV---SLAAQTILDTKHFVKEWPFRDEL----DDLLRFICIVVPSSIDMETVLPKGI  363
              +       +A  +LD K F K +    E       +L   C V      ++ V     
Sbjct  463  PENCYEHGKRSAMVLLDCKQFTKHYDLEQEFLPQNPSMLHLWCQVEV----LDQVGDPPC  518

Query  364  IPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVV------------TDIKGLEGVGD  507
            IP E + +P  +T+ DLK+      R  Y  +  FV             T +K L G   
Sbjct  519  IPPELLTLPQTATVSDLKVEATRTFRGIYLMLHSFVADRLVDCGTASESTQLKLLFGANG  578

Query  508  DEVIFGIVESGTQLFMKGLGLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCDVCEI  687
               + G   SG +           G  + E     WTV+C CGA+DDDGERM+SCD C +
Sbjct  579  TVRVQGRCASGERR---------VGIYRMERGVDKWTVRCSCGAKDDDGERMLSCDSCHV  629

Query  688  WQHTRCVGIKDDKAVPPLFVCEVC  759
            WQHTRCVGI D   VP  +VC  C
Sbjct  630  WQHTRCVGISDFDQVPKKYVCNSC  653



>ref|XP_008391867.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein At1g33420-like 
[Malus domestica]
Length=465

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 100/195 (51%), Gaps = 12/195 (6%)
 Frame = +1

Query  175  LYSNVLLGYKESDV---VSLAAQTILDTKHFVKEW-PFR--DELDDLLRFICIVVPSSID  336
            L+ + +L Y    +   +   A  +LD K F+K++ P++   E   ++   C V  S   
Sbjct  239  LHPDTMLSYTPQSMKERIIETATKLLDCKQFIKDYRPYKMAKEGSFVIHLWCHVELSDES  298

Query  337  METVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEV  516
             +      ++P E +V+PL++T+ DLK     A  + Y   + F V ++ G   + D   
Sbjct  299  EDDF----VMPPELLVLPLNATVADLKKEATKAFXEVYAMFKRFEVEELLGYGSIKDSFT  354

Query  517  IFGIVESGTQLFMKGLGLAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIW  690
            +  ++ S   + +KG  LA  G  +F  E    +WTV C CGA+DDDGERM +CD C +W
Sbjct  355  VKLLLGSCGSIRLKGRCLAKHGLNRFRKERGLESWTVDCTCGAKDDDGERMFACDTCGVW  414

Query  691  QHTRCVGIKDDKAVP  735
            QHTRC GI     +P
Sbjct  415  QHTRCAGIHSSDEIP  429



>gb|EAZ17917.1| hypothetical protein OsJ_33464 [Oryza sativa Japonica Group]
Length=682

 Score =   106 bits (264),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 102/234 (44%), Gaps = 31/234 (13%)
 Frame = +1

Query  133  TAVPPVDV--------FGDVFCLYSNVLLGY--------KESDVVSLAAQTILDTKHFVK  264
            T  PP +V        F D+  LY  +L  Y        +       +A  +LD K F+K
Sbjct  412  TLFPPNNVCTLTQDHLFRDIKFLYDALLYPYTMHPYMPEENYQHAKRSAMILLDCKQFIK  471

Query  265  EWPFRDEL----DDLLRFICIVVPSSIDMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQA  432
             +   ++        L   C V  +    + V     IP E I +P  +TI DLK     
Sbjct  472  HYDLEEDFLPQNPSQLHIWCQVELA----DQVDDPPCIPAELITLPQAATIADLKGEAAR  527

Query  433  AMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLGLAFAGDLKF-----E  597
            A RD Y  ++ FV   +       D   I  +  +   + +KG      G+ +F     E
Sbjct  528  AFRDIYLMLQSFVADQLLDCATASDTTQIKLLFGAKGAVHIKGR--CIGGERRFAIYRME  585

Query  598  DRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
                 WTVKC CGA DDDGERM+SCD C +W HTRC GI D   VP  +VC+ C
Sbjct  586  RGVDKWTVKCSCGATDDDGERMLSCDTCHMWMHTRCAGISDFDRVPKRYVCKSC  639



>ref|NP_001044975.1| Os01g0877500 [Oryza sativa Japonica Group]
 dbj|BAC07324.1| putative male sterility 1 protein [Oryza sativa Japonica Group]
 dbj|BAF06889.1| Os01g0877500 [Oryza sativa Japonica Group]
 gb|EAZ14357.1| hypothetical protein OsJ_04277 [Oryza sativa Japonica Group]
 dbj|BAG94898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=716

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/261 (30%), Positives = 122/261 (47%), Gaps = 34/261 (13%)
 Frame = +1

Query  25   NRATRVLEYTLQELKNRDQTDQERVLVPEPDKPASLTAVPPVDVFGDVFCLYSNVL----  192
            N  T  +EY L++  N +Q+       P  D            +  D+  LY+ +L    
Sbjct  425  NAETSAIEYRLED--NSNQSVDAAAFGPSVDH-----------LLHDLKFLYNALLNPET  471

Query  193  LGYKESDVVSL----AAQTILDTKHFVKEWPFRDELDDLLRFICIVVPSSIDMETVLPKG  360
            +   + +V+      AA  ILD K F+K +        L  F+ + V  SI++    PK 
Sbjct  472  MLASQPEVIGASSHSAAAKILDCKQFIKHYDQHTPRAPLNPFL-LSVRCSIELLD-HPKD  529

Query  361  II--PKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVE  534
                P E +++P  +T+ +LK+    A ++TY   + + V  +       D  ++  ++ 
Sbjct  530  YTAPPVELVLLPASATLAELKIQATRAFQETYLMFQSYQVEQLPDFPNFSDTTLVKHVLG  589

Query  535  SGTQLFMKGLGLAFAGD------LKFEDRAHNWTVKCKCGARDDDGERMISCDVCEIWQH  696
            S   + ++G      GD       + E    NWTV C CGA+DDDGERM++CDVC +WQH
Sbjct  590  SSQLVRVRG---RCTGDNRRIVQFRMERGLENWTVDCTCGAKDDDGERMLACDVCGVWQH  646

Query  697  TRCVGIKDDKAVPPLFVCEVC  759
            TRC GI D   VP  F+C  C
Sbjct  647  TRCSGISDFDDVPEKFICRKC  667



>dbj|BAK04913.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 101/208 (49%), Gaps = 20/208 (10%)
 Frame = +1

Query  175  LYSNVLLGYKESDVVSLA---AQTILDTKHFVKEWPFRDEL----DDLLRFICIVVPSSI  333
            L+ + +  YK   +   A   A  +LD K F+K +   ++     + +L   C V    +
Sbjct  419  LFRHTMQPYKPEQIHEHAKRHATILLDCKQFIKHYDLEEDFLPQNNSVLHIWCQV--ELL  476

Query  334  DMETVLPKGIIPKEHIVVPLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDD-  510
            D     P   +P E + +P  +T+GDLK+      R  Y  ++ FV   +       D  
Sbjct  477  DQAGDPPS--LPAELLTLPQTATVGDLKMEATRTFRSIYLMLQSFVANQLLDCSTADDTT  534

Query  511  --EVIFGIVESGTQLFMKGL---GLAFAGDLKFEDRAHNWTVKCKCGARDDDGERMISCD  675
              +++FG  E G+ + ++G    G       + E     WTV C CGA+DDDGERM+SCD
Sbjct  535  QVKLLFG--EKGS-VSIQGKCVGGERRVAIYRMERGVDKWTVDCSCGAKDDDGERMLSCD  591

Query  676  VCEIWQHTRCVGIKDDKAVPPLFVCEVC  759
             C +WQHTRC+GI D   VP  +VC  C
Sbjct  592  SCHVWQHTRCIGISDFDQVPKRYVCASC  619



>ref|XP_003534422.1| PREDICTED: PHD finger protein At1g33420-like [Glycine max]
Length=708

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 101/187 (54%), Gaps = 10/187 (5%)
 Frame = +1

Query  217  VSLAAQTILDTKHFVKEW-PFRD--ELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVV  387
            V+ +A+ +LD K F+K++ P+    EL  ++R  C V  S    +   P    P E I++
Sbjct  475  VADSARKLLDCKQFMKDYKPYEMAVELPSVIRLWCHVELSDQPKDDPSP----PPELIML  530

Query  388  PLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLG  567
            PL++T+ DL+    +A ++ Y   + F   ++ G   + D   I  ++ +   + ++G  
Sbjct  531  PLNATVADLRSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTIRFLLGTSGSIQIQGKC  590

Query  568  LAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDK-AVPP  738
             A  G  +F  E     W V C CGA+DDDGE+M++CD C +WQHTRC GI ++   +P 
Sbjct  591  PAKHGLSRFRMERGTEVWKVDCTCGAKDDDGEKMLACDTCGVWQHTRCAGIDNNTDGMPS  650

Query  739  LFVCEVC  759
             FVC  C
Sbjct  651  KFVCMGC  657



>gb|KHN11645.1| PHD finger protein [Glycine soja]
Length=708

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 101/187 (54%), Gaps = 10/187 (5%)
 Frame = +1

Query  217  VSLAAQTILDTKHFVKEW-PFRD--ELDDLLRFICIVVPSSIDMETVLPKGIIPKEHIVV  387
            V+ +A+ +LD K F+K++ P+    EL  ++R  C V  S    +   P    P E I++
Sbjct  475  VADSARKLLDCKQFMKDYKPYEMAVELPSVIRLWCHVELSDQPKDDPSP----PPELIML  530

Query  388  PLHSTIGDLKLAIQAAMRDTYCAMEEFVVTDIKGLEGVGDDEVIFGIVESGTQLFMKGLG  567
            PL++T+ DL+    +A ++ Y   + F   ++ G   + D   I  ++ +   + ++G  
Sbjct  531  PLNATVADLRSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTIRFLLGTSGSIQIQGKC  590

Query  568  LAFAGDLKF--EDRAHNWTVKCKCGARDDDGERMISCDVCEIWQHTRCVGIKDDK-AVPP  738
             A  G  +F  E     W V C CGA+DDDGE+M++CD C +WQHTRC GI ++   +P 
Sbjct  591  PAKHGLSRFRMERGTEVWKVDCTCGAKDDDGEKMLACDTCGVWQHTRCAGIDNNTDGMPS  650

Query  739  LFVCEVC  759
             FVC  C
Sbjct  651  KFVCMGC  657



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2302838196460