BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77551_g1_i1 len=606 path=[1:0-605]

Length=606
                                                                      Score     E

ref|XP_002268050.1|  PREDICTED: glutaredoxin-C13                        134   3e-36   Vitis vinifera
ref|XP_011082492.1|  PREDICTED: monothiol glutaredoxin-S9-like          130   5e-35   
ref|XP_008386625.1|  PREDICTED: monothiol glutaredoxin-S11              129   1e-34   
emb|CDP03539.1|  unnamed protein product                                129   2e-34   
ref|XP_003625870.1|  Glutaredoxin                                       127   1e-33   
ref|XP_007201438.1|  hypothetical protein PRUPE_ppa013777mg             127   1e-33   
ref|XP_008234999.1|  PREDICTED: glutaredoxin-C13-like                   126   2e-33   
ref|XP_008375847.1|  PREDICTED: monothiol glutaredoxin-S9-like          126   2e-33   
ref|XP_010523992.1|  PREDICTED: glutaredoxin-C14-like                   126   3e-33   
ref|XP_006397982.1|  hypothetical protein EUTSA_v10001691mg             126   3e-33   
ref|NP_182309.1|  glutaredoxin-C13                                      126   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295295.1|  hypothetical protein CARUB_v10024385mg             125   3e-33   
gb|KFK37539.1|  hypothetical protein AALP_AA4G270200                    125   4e-33   
ref|XP_006444242.1|  hypothetical protein CICLE_v10023018mg             125   4e-33   
ref|XP_007163065.1|  hypothetical protein PHAVU_001G203200g             125   4e-33   
ref|XP_009142495.1|  PREDICTED: glutaredoxin-C13                        125   6e-33   
ref|NP_001235478.1|  uncharacterized protein LOC100499748               125   6e-33   
gb|AFC01204.1|  glutaredoxin family protein                             125   8e-33   
ref|XP_009617055.1|  PREDICTED: monothiol glutaredoxin-S11-like         124   8e-33   
ref|NP_001275008.1|  glutaredoxin                                       124   8e-33   
ref|NP_001235876.1|  uncharacterized protein LOC100305984               124   9e-33   
emb|CDY27469.1|  BnaC04g51100D                                          124   1e-32   
gb|ADV56687.1|  glutaredoxin                                            125   1e-32   
ref|XP_010545042.1|  PREDICTED: glutaredoxin-C14                        124   1e-32   
emb|CDY55528.1|  BnaA04g29520D                                          124   1e-32   
gb|KHN03747.1|  Monothiol glutaredoxin-S9                               124   2e-32   
gb|ABK96409.1|  unknown                                                 124   2e-32   Populus trichocarpa x Populus deltoides
emb|CDX95739.1|  BnaC03g26200D                                          124   2e-32   
ref|XP_010518505.1|  PREDICTED: glutaredoxin-C13-like                   123   2e-32   
ref|XP_009118202.1|  PREDICTED: glutaredoxin-C13                        124   2e-32   
ref|XP_010507838.1|  PREDICTED: glutaredoxin-C13-like                   123   2e-32   
ref|XP_007050806.1|  Glutaredoxin                                       123   3e-32   
ref|XP_010506828.1|  PREDICTED: glutaredoxin-C13-like                   123   4e-32   
ref|XP_004494333.1|  PREDICTED: monothiol glutaredoxin-S11-like         123   4e-32   
ref|XP_006402322.1|  hypothetical protein EUTSA_v10006331mg             123   4e-32   
gb|AFK36241.1|  unknown                                                 122   4e-32   
ref|XP_009378906.1|  PREDICTED: monothiol glutaredoxin-S9-like          122   5e-32   
ref|XP_009797640.1|  PREDICTED: monothiol glutaredoxin-S11-like         122   5e-32   
ref|XP_009116964.1|  PREDICTED: glutaredoxin-C14                        122   5e-32   
ref|NP_001237832.1|  uncharacterized protein LOC100527558               122   6e-32   
ref|XP_010243569.1|  PREDICTED: monothiol glutaredoxin-S11-like         122   7e-32   
ref|NP_191855.1|  glutaredoxin-C14                                      122   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320361.1|  glutaredoxin family protein                        122   9e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009138699.1|  PREDICTED: glutaredoxin-C14-like                   122   1e-31   
emb|CDX76678.1|  BnaC08g32640D                                          122   1e-31   
ref|XP_011033601.1|  PREDICTED: glutaredoxin-C13                        121   2e-31   
ref|XP_006389677.1|  glutaredoxin family protein                        121   2e-31   
ref|XP_007144558.1|  hypothetical protein PHAVU_007G165900g             120   2e-31   
ref|XP_010069984.1|  PREDICTED: glutaredoxin-C13-like                   121   3e-31   
ref|XP_004240522.1|  PREDICTED: glutaredoxin-C13-like                   120   3e-31   
gb|KEH43252.1|  monothiol glutaredoxin-S2 protein                       119   7e-31   
ref|XP_007138394.1|  hypothetical protein PHAVU_009G205000g             119   1e-30   
gb|KEH43253.1|  monothiol glutaredoxin-S2 protein                       119   1e-30   
gb|EPS63131.1|  glutaredoxin                                            119   2e-30   
ref|XP_009758128.1|  PREDICTED: glutaredoxin-C13-like                   119   2e-30   
gb|KHN46591.1|  Glutaredoxin-C13                                        118   3e-30   
ref|XP_009104404.1|  PREDICTED: glutaredoxin-C14-like                   117   4e-30   
ref|XP_002881118.1|  glutaredoxin family protein                        117   5e-30   
gb|KFK35484.1|  hypothetical protein AALP_AA5G290300                    117   5e-30   
ref|XP_009621533.1|  PREDICTED: glutaredoxin-C13-like                   117   5e-30   
emb|CDY23990.1|  BnaC03g17010D                                          117   5e-30   
ref|NP_001238158.1|  uncharacterized protein LOC100500442               117   7e-30   
ref|XP_006410157.1|  hypothetical protein EUTSA_v10017804mg             117   7e-30   
ref|XP_004495992.1|  PREDICTED: monothiol glutaredoxin-S9-like          117   8e-30   
ref|XP_006304582.1|  hypothetical protein CARUB_v10011626mg             117   9e-30   
ref|XP_009119027.1|  PREDICTED: monothiol glutaredoxin-S11              116   1e-29   
ref|XP_009118476.1|  PREDICTED: monothiol glutaredoxin-S11-like         116   1e-29   
emb|CDY54881.1|  BnaA10g27940D                                          116   1e-29   
ref|XP_002889620.1|  glutaredoxin family protein                        116   1e-29   
gb|KDP28094.1|  hypothetical protein JCGZ_13865                         116   1e-29   
ref|XP_010486752.1|  PREDICTED: monothiol glutaredoxin-S11              116   2e-29   
ref|XP_010522020.1|  PREDICTED: monothiol glutaredoxin-S9               116   2e-29   
ref|XP_009141071.1|  PREDICTED: monothiol glutaredoxin-S9               115   2e-29   
emb|CDY10229.1|  BnaC05g04720D                                          115   2e-29   
ref|XP_009614874.1|  PREDICTED: glutaredoxin-C13-like                   115   3e-29   
ref|XP_010510342.1|  PREDICTED: monothiol glutaredoxin-S9               115   3e-29   
ref|NP_180612.1|  monothiol glutaredoxin-S9                             115   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144292.1|  PREDICTED: monothiol glutaredoxin-S9-like          115   3e-29   
ref|NP_172168.1|  monothiol glutaredoxin-S11                            115   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486713.1|  PREDICTED: monothiol glutaredoxin-S11-like         115   4e-29   
ref|XP_004309711.1|  PREDICTED: glutaredoxin-C13-like                   115   5e-29   
ref|XP_004136055.1|  PREDICTED: monothiol glutaredoxin-S11-like         114   7e-29   
ref|XP_009132744.1|  PREDICTED: monothiol glutaredoxin-S9-like          114   9e-29   
gb|KFK42997.1|  hypothetical protein AALP_AA1G066100                    114   9e-29   
ref|XP_010557174.1|  PREDICTED: monothiol glutaredoxin-S9-like          114   1e-28   
ref|XP_010241630.1|  PREDICTED: monothiol glutaredoxin-S11-like         114   1e-28   
ref|XP_010414255.1|  PREDICTED: monothiol glutaredoxin-S9-like          114   1e-28   
ref|XP_010666490.1|  PREDICTED: monothiol glutaredoxin-S9-like          114   1e-28   
emb|CDY52638.1|  BnaCnng23060D                                          114   1e-28   
ref|XP_009785800.1|  PREDICTED: glutaredoxin-C13-like                   114   2e-28   
ref|XP_002876697.1|  glutaredoxin family protein                        113   2e-28   
ref|XP_011009413.1|  PREDICTED: monothiol glutaredoxin-S9-like          113   2e-28   
emb|CDX84825.1|  BnaA03g14050D                                          113   2e-28   
ref|XP_006417875.1|  hypothetical protein EUTSA_v10009180mg             113   3e-28   
emb|CDX97824.1|  BnaC04g41150D                                          112   3e-28   
ref|XP_006296283.1|  hypothetical protein CARUB_v10025453mg             111   1e-27   
emb|CAH59431.1|  glutaredoxin 1                                         111   2e-27   Plantago major [cart-track plant]
ref|XP_011079732.1|  PREDICTED: monothiol glutaredoxin-S9-like          110   2e-27   
ref|XP_004247457.1|  PREDICTED: glutaredoxin-C13-like                   110   3e-27   
ref|XP_006359429.1|  PREDICTED: monothiol glutaredoxin-S9-like          109   7e-27   
ref|XP_010038171.1|  PREDICTED: glutaredoxin-C13-like                   109   7e-27   
ref|XP_006359428.1|  PREDICTED: monothiol glutaredoxin-S9-like          109   1e-26   
gb|EYU40529.1|  hypothetical protein MIMGU_mgv1a015649mg                110   1e-26   
gb|AFK47066.1|  unknown                                                 107   4e-26   
emb|CAJ38362.1|  glutaredoxin                                           107   6e-26   Plantago major [cart-track plant]
ref|XP_004139878.1|  PREDICTED: monothiol glutaredoxin-S9-like          102   4e-24   
emb|CDY71728.1|  BnaC04g56450D                                        99.4    1e-22   
ref|XP_010036905.1|  PREDICTED: monothiol glutaredoxin-S10-like       97.8    2e-22   
ref|XP_010024634.1|  PREDICTED: monothiol glutaredoxin-S10-like       95.1    2e-21   
ref|XP_010241661.1|  PREDICTED: monothiol glutaredoxin-S2-like        94.0    6e-21   
ref|XP_010241681.1|  PREDICTED: monothiol glutaredoxin-S2-like        94.0    6e-21   
ref|XP_010243566.1|  PREDICTED: monothiol glutaredoxin-S2-like        94.0    6e-21   
ref|XP_010273480.1|  PREDICTED: monothiol glutaredoxin-S2-like        92.8    1e-20   
ref|XP_011033600.1|  PREDICTED: glutaredoxin-C11                      92.8    2e-20   
ref|XP_009138702.1|  PREDICTED: glutaredoxin-C11                      92.4    2e-20   
ref|XP_006402323.1|  hypothetical protein EUTSA_v10006329mg           92.0    3e-20   
ref|XP_011071468.1|  PREDICTED: monothiol glutaredoxin-S10-like       92.0    3e-20   
ref|XP_010468903.1|  PREDICTED: glutaredoxin-C11-like                 91.7    4e-20   
gb|KFK35470.1|  hypothetical protein AALP_AA5G288300                  91.7    4e-20   
ref|NP_191854.1|  glutaredoxin-C11                                    91.7    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320360.1|  glutaredoxin family protein                      91.7    4e-20   Populus trichocarpa [western balsam poplar]
gb|AFK39077.1|  unknown                                               90.9    8e-20   
ref|XP_009419009.1|  PREDICTED: putative glutaredoxin-C14             90.9    8e-20   
ref|XP_002275384.1|  PREDICTED: monothiol glutaredoxin-S2             90.9    8e-20   Vitis vinifera
ref|XP_011016037.1|  PREDICTED: monothiol glutaredoxin-S10            90.9    9e-20   
gb|KDP40012.1|  hypothetical protein JCGZ_02010                       90.9    9e-20   
ref|XP_004492160.1|  PREDICTED: glutaredoxin-C3-like                  91.7    9e-20   
ref|XP_010272731.1|  PREDICTED: monothiol glutaredoxin-S2-like        90.9    1e-19   
ref|XP_007050807.1|  Thioredoxin superfamily protein                  90.5    1e-19   
ref|XP_010098329.1|  Monothiol glutaredoxin-S10                       90.5    1e-19   
ref|XP_006444243.1|  hypothetical protein CICLE_v10023999mg           90.5    1e-19   
ref|XP_003593970.1|  Monothiol glutaredoxin-S2                        90.1    1e-19   
ref|XP_011009412.1|  PREDICTED: glutaredoxin-C11-like                 90.1    1e-19   
ref|XP_006380203.1|  hypothetical protein POPTR_0008s22890g           90.1    1e-19   
gb|EYU45573.1|  hypothetical protein MIMGU_mgv1a019538mg              90.1    1e-19   
gb|AFK35832.1|  unknown                                               90.9    1e-19   
ref|XP_006419643.1|  hypothetical protein CICLE_v10006590mg           90.1    1e-19   
ref|XP_010649773.1|  PREDICTED: monothiol glutaredoxin-S10            90.1    2e-19   
ref|XP_008674047.1|  PREDICTED: glutaredoxin-C1                       90.1    2e-19   
ref|XP_007035504.1|  Glutaredoxin family protein                      90.1    2e-19   
ref|XP_010024635.1|  PREDICTED: monothiol glutaredoxin-S2-like        90.1    2e-19   
ref|XP_010024181.1|  PREDICTED: glutaredoxin-C1                       90.5    2e-19   
ref|XP_006389678.1|  glutaredoxin family protein                      89.7    2e-19   
ref|XP_011071467.1|  PREDICTED: monothiol glutaredoxin-S10-like       89.7    2e-19   
ref|XP_004962839.1|  PREDICTED: putative glutaredoxin-C14-like        89.7    2e-19   
ref|XP_010243565.1|  PREDICTED: monothiol glutaredoxin-S2             89.4    3e-19   
ref|XP_011082491.1|  PREDICTED: glutaredoxin-C11-like                 89.4    3e-19   
ref|XP_006359427.1|  PREDICTED: glutaredoxin-C11-like                 89.4    4e-19   
ref|XP_003546092.1|  PREDICTED: monothiol glutaredoxin-S2-like        89.4    4e-19   
ref|XP_002516882.1|  glutaredoxin, grx, putative                      89.0    4e-19   Ricinus communis
ref|XP_010545041.1|  PREDICTED: glutaredoxin-C11                      88.6    5e-19   
ref|NP_001043047.1|  Os01g0368900                                     88.6    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KCW84427.1|  hypothetical protein EUGRSUZ_B01275                   88.2    5e-19   
ref|XP_008222218.1|  PREDICTED: glutaredoxin-C1-like                  89.4    6e-19   
ref|XP_009414476.1|  PREDICTED: putative glutaredoxin-C14             88.6    6e-19   
ref|XP_002455626.1|  hypothetical protein SORBIDRAFT_03g014800        88.6    6e-19   Sorghum bicolor [broomcorn]
ref|XP_007227610.1|  hypothetical protein PRUPE_ppa021177mg           89.4    6e-19   
ref|XP_009411702.1|  PREDICTED: glutaredoxin-C1-like                  88.6    6e-19   
emb|CDP03538.1|  unnamed protein product                              88.6    6e-19   
ref|XP_004148005.1|  PREDICTED: glutaredoxin-C1-like                  89.4    6e-19   
emb|CAN67225.1|  hypothetical protein VITISV_043905                   88.6    6e-19   Vitis vinifera
ref|XP_008450140.1|  PREDICTED: glutaredoxin-C1-like                  89.4    6e-19   
ref|XP_003567688.1|  PREDICTED: glutaredoxin-C1                       88.6    6e-19   
gb|ACJ83991.1|  unknown                                               88.6    7e-19   Medicago truncatula
ref|XP_008799330.1|  PREDICTED: glutaredoxin-C1-like                  88.6    7e-19   
ref|XP_009116963.1|  PREDICTED: glutaredoxin-C11-like                 88.6    7e-19   
gb|KCW61086.1|  hypothetical protein EUGRSUZ_H03860                   89.7    7e-19   
ref|XP_010098332.1|  Monothiol glutaredoxin-S2                        88.2    7e-19   
ref|XP_009382560.1|  PREDICTED: glutaredoxin-C1-like                  88.2    8e-19   
ref|XP_002264542.2|  PREDICTED: glutaredoxin-C1-like                  89.0    8e-19   Vitis vinifera
ref|XP_009607405.1|  PREDICTED: monothiol glutaredoxin-S10            88.2    8e-19   
ref|XP_010250605.1|  PREDICTED: glutaredoxin-C1-like                  88.6    9e-19   
ref|XP_002315567.1|  glutaredoxin family protein                      87.8    1e-18   Populus trichocarpa [western balsam poplar]
ref|NP_001176691.1|  Os11g0656801                                     88.2    1e-18   
gb|EAZ19162.1|  hypothetical protein OsJ_34699                        87.8    1e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KDP28095.1|  hypothetical protein JCGZ_13866                       87.8    1e-18   
ref|XP_006292766.1|  hypothetical protein CARUB_v10019015mg           87.8    1e-18   
ref|XP_006844586.1|  hypothetical protein AMTR_s00016p00206670        87.8    1e-18   
ref|XP_003622060.1|  N-hydroxycinnamoyl/benzoyltransferase            90.9    2e-18   
ref|XP_006342768.1|  PREDICTED: monothiol glutaredoxin-S10-like       87.4    2e-18   
emb|CDP12908.1|  unnamed protein product                              87.0    2e-18   
ref|XP_004228854.1|  PREDICTED: glutaredoxin-C1-like                  87.8    2e-18   
ref|XP_006594494.1|  PREDICTED: monothiol glutaredoxin-S2-like        88.6    2e-18   
gb|EPS64181.1|  glutaredoxin                                          87.0    2e-18   
ref|XP_010249120.1|  PREDICTED: glutaredoxin-C1-like                  87.8    2e-18   
ref|XP_004247456.1|  PREDICTED: glutaredoxin-C11                      87.0    2e-18   
ref|XP_010492199.1|  PREDICTED: glutaredoxin-C8                       87.8    2e-18   
ref|XP_007147880.1|  hypothetical protein PHAVU_006G162700g           87.0    2e-18   
ref|XP_004968750.1|  PREDICTED: glutaredoxin-C1-like                  87.0    3e-18   
gb|KFK37654.1|  hypothetical protein AALP_AA3G011200                  87.8    3e-18   
ref|XP_007139286.1|  hypothetical protein PHAVU_008G016400g           87.8    3e-18   
ref|XP_008791106.1|  PREDICTED: glutaredoxin-C1-like                  87.4    3e-18   
ref|XP_009408234.1|  PREDICTED: putative glutaredoxin-C14             86.7    3e-18   
emb|CDM86171.1|  unnamed protein product                              86.7    3e-18   
ref|XP_010241641.1|  PREDICTED: monothiol glutaredoxin-S10-like       86.7    3e-18   
gb|KDP41803.1|  hypothetical protein JCGZ_26821                       87.4    3e-18   
gb|EYU45572.1|  hypothetical protein MIMGU_mgv1a023883mg              86.7    3e-18   
ref|XP_004310231.1|  PREDICTED: glutaredoxin-C1-like                  87.4    3e-18   
ref|XP_010243568.1|  PREDICTED: monothiol glutaredoxin-S10-like       86.7    3e-18   
ref|XP_010024636.1|  PREDICTED: monothiol glutaredoxin-S4-like        86.7    4e-18   
ref|XP_011005540.1|  PREDICTED: monothiol glutaredoxin-S2-like        86.3    4e-18   
gb|KCW61087.1|  hypothetical protein EUGRSUZ_H03861                   87.0    4e-18   
ref|XP_002520675.1|  glutaredoxin, grx, putative                      86.3    4e-18   Ricinus communis
ref|XP_010680093.1|  PREDICTED: glutaredoxin-C3                       86.7    4e-18   
ref|XP_009336451.1|  PREDICTED: glutaredoxin-C1-like                  87.0    4e-18   
ref|XP_011079731.1|  PREDICTED: glutaredoxin-C11                      86.3    4e-18   
ref|XP_008389917.1|  PREDICTED: glutaredoxin-C1-like                  87.0    4e-18   
gb|EMS46251.1|  Putative glutaredoxin-C14                             86.3    4e-18   
emb|CDO98900.1|  unnamed protein product                              86.3    4e-18   
gb|EAY81718.1|  hypothetical protein OsI_36892                        86.7    4e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004136054.1|  PREDICTED: glutaredoxin-C11-like                 86.3    4e-18   
sp|Q2R073.1|GRC12_ORYSJ  RecName: Full=Putative glutaredoxin-C12      86.7    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002514866.1|  glutaredoxin, grx, putative                      87.0    4e-18   Ricinus communis
ref|XP_008796225.1|  PREDICTED: glutaredoxin-C1-like                  86.3    5e-18   
emb|CDO98899.1|  unnamed protein product                              86.3    5e-18   
ref|NP_001176689.1|  Os11g0656000                                     86.3    5e-18   
ref|XP_009399249.1|  PREDICTED: glutaredoxin-C1-like                  86.3    5e-18   
ref|XP_003575739.1|  PREDICTED: putative glutaredoxin-C14             86.3    5e-18   
gb|KDP26855.1|  hypothetical protein JCGZ_18013                       86.7    5e-18   
ref|XP_006380199.1|  glutaredoxin family protein                      85.9    5e-18   
ref|XP_007161691.1|  hypothetical protein PHAVU_001G090300g           86.7    5e-18   
ref|XP_008390723.1|  PREDICTED: monothiol glutaredoxin-S10            85.9    6e-18   
gb|EPS63130.1|  hypothetical protein M569_11657                       85.9    6e-18   
gb|EAY81716.1|  hypothetical protein OsI_36890                        85.9    6e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004962842.1|  PREDICTED: putative glutaredoxin-C14-like        85.9    6e-18   
ref|XP_004962841.1|  PREDICTED: putative glutaredoxin-C14-like        85.9    6e-18   
gb|EYU34223.1|  hypothetical protein MIMGU_mgv1a023043mg              85.9    6e-18   
ref|XP_007035505.1|  Thioredoxin superfamily protein                  85.9    7e-18   
ref|XP_003521537.1|  PREDICTED: glutaredoxin-C11-like                 85.9    7e-18   
ref|XP_008802104.1|  PREDICTED: glutaredoxin-C1-like                  85.9    7e-18   
ref|XP_002455625.1|  hypothetical protein SORBIDRAFT_03g014790        85.5    7e-18   Sorghum bicolor [broomcorn]
gb|KHN47302.1|  Monothiol glutaredoxin-S4                             85.5    9e-18   
gb|EMS50255.1|  Putative glutaredoxin-C2                              85.5    9e-18   
gb|EMT00625.1|  hypothetical protein F775_42757                       85.5    1e-17   
ref|XP_002442257.1|  hypothetical protein SORBIDRAFT_08g017120        85.5    1e-17   Sorghum bicolor [broomcorn]
ref|XP_009386287.1|  PREDICTED: glutaredoxin-C1-like                  85.1    1e-17   
ref|XP_006342767.1|  PREDICTED: monothiol glutaredoxin-S3-like        85.1    1e-17   
ref|XP_006288869.1|  hypothetical protein CARUB_v10002222mg           86.3    1e-17   
ref|XP_002272852.1|  PREDICTED: glutaredoxin-C1                       85.9    1e-17   Vitis vinifera
ref|XP_006363784.1|  PREDICTED: glutaredoxin-C5-like                  85.5    1e-17   
ref|XP_008353233.1|  PREDICTED: monothiol glutaredoxin-S10-like       85.1    1e-17   
ref|XP_004486045.1|  PREDICTED: monothiol glutaredoxin-S2-like        85.1    1e-17   
gb|EPS67026.1|  hypothetical protein M569_07752                       85.1    1e-17   
ref|XP_006363780.1|  PREDICTED: glutaredoxin-C5-like                  85.5    1e-17   
ref|XP_004296803.1|  PREDICTED: monothiol glutaredoxin-S10-like       85.1    1e-17   
ref|XP_006380202.1|  hypothetical protein POPTR_0008s22870g           85.1    1e-17   
ref|XP_004229212.1|  PREDICTED: monothiol glutaredoxin-S10            85.1    1e-17   
ref|XP_004968749.1|  PREDICTED: glutaredoxin-C1-like                  85.1    1e-17   
ref|XP_002446324.1|  hypothetical protein SORBIDRAFT_06g014300        85.9    1e-17   Sorghum bicolor [broomcorn]
ref|XP_011020819.1|  PREDICTED: glutaredoxin-C1-like                  85.5    2e-17   
ref|XP_002300130.1|  glutaredoxin family protein                      85.1    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002303767.1|  hypothetical protein POPTR_0003s16540g           85.5    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011045755.1|  PREDICTED: glutaredoxin-C1                       85.1    2e-17   
ref|XP_002442259.1|  hypothetical protein SORBIDRAFT_08g017160        84.7    2e-17   Sorghum bicolor [broomcorn]
ref|XP_007225971.1|  hypothetical protein PRUPE_ppa013805mg           84.7    2e-17   
gb|ACJ85884.1|  unknown                                               84.7    2e-17   Medicago truncatula
ref|XP_007226534.1|  hypothetical protein PRUPE_ppa025150mg           84.7    2e-17   
ref|XP_003529587.1|  PREDICTED: monothiol glutaredoxin-S10-like       84.3    2e-17   
ref|NP_001274383.1|  monothiol glutaredoxin-S2-like                   84.3    2e-17   
tpg|DAA43403.1|  TPA: hypothetical protein ZEAMMB73_785146            84.7    2e-17   
emb|CDP12909.1|  unnamed protein product                              84.3    2e-17   
ref|XP_007163066.1|  hypothetical protein PHAVU_001G203300g           84.3    2e-17   
ref|XP_007043882.1|  Thioredoxin superfamily protein                  85.1    2e-17   
ref|XP_010420029.1|  PREDICTED: glutaredoxin-C8-like                  85.5    2e-17   
gb|KCW84428.1|  hypothetical protein EUGRSUZ_B01276                   84.0    2e-17   
ref|XP_010038172.1|  PREDICTED: glutaredoxin-C11-like                 84.3    2e-17   
ref|XP_004138799.1|  PREDICTED: glutaredoxin-C1-like                  84.7    2e-17   
gb|AGX01496.1|  glutaredoxin                                          84.7    2e-17   
gb|EAY77135.1|  hypothetical protein OsI_05100                        84.3    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002299331.2|  hypothetical protein POPTR_0001s13440g           84.7    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004229211.1|  PREDICTED: monothiol glutaredoxin-S3             84.3    3e-17   
ref|XP_007154237.1|  hypothetical protein PHAVU_003G101900g           84.3    3e-17   
emb|CDP13384.1|  unnamed protein product                              85.1    3e-17   
ref|XP_003553278.1|  PREDICTED: glutaredoxin-C3-like                  85.1    3e-17   
ref|NP_001238068.1|  uncharacterized protein LOC100305876             84.0    3e-17   
ref|XP_003548512.1|  PREDICTED: glutaredoxin-C5-like                  85.1    3e-17   
ref|XP_003575732.1|  PREDICTED: putative glutaredoxin-C14             84.0    3e-17   
ref|XP_009349478.1|  PREDICTED: glutaredoxin-C1-like                  84.7    3e-17   
ref|XP_010243570.1|  PREDICTED: glutaredoxin-C11-like                 84.0    3e-17   
ref|XP_011036126.1|  PREDICTED: glutaredoxin-C1-like                  84.3    3e-17   
ref|XP_011013421.1|  PREDICTED: monothiol glutaredoxin-S2-like        84.0    3e-17   
ref|XP_007031936.1|  Thioredoxin superfamily protein                  84.3    3e-17   
ref|XP_004171791.1|  PREDICTED: glutaredoxin-C1-like                  84.0    3e-17   
ref|XP_003575736.1|  PREDICTED: putative glutaredoxin-C14             83.6    4e-17   
ref|XP_008441305.1|  PREDICTED: glutaredoxin-C1-like                  84.3    4e-17   
gb|EPS67459.1|  hypothetical protein M569_07317                       84.0    4e-17   
ref|NP_001045325.2|  Os01g0936000                                     84.3    4e-17   
ref|XP_009383750.1|  PREDICTED: putative glutaredoxin-C14             83.6    4e-17   
gb|KFK39447.1|  hypothetical protein AALP_AA3G246300                  83.6    4e-17   
ref|NP_001275534.1|  monothiol glutaredoxin-S10-like                  83.6    4e-17   
ref|XP_009800086.1|  PREDICTED: monothiol glutaredoxin-S1-like        83.6    5e-17   
ref|XP_006575104.1|  PREDICTED: glutaredoxin-C11-like                 83.6    5e-17   
ref|XP_006664080.1|  PREDICTED: putative glutaredoxin-C14-like        83.6    5e-17   
ref|XP_007144557.1|  hypothetical protein PHAVU_007G165800g           84.7    5e-17   
ref|XP_009142497.1|  PREDICTED: putative glutaredoxin-C12             83.6    5e-17   
ref|XP_011090614.1|  PREDICTED: monothiol glutaredoxin-S2-like        83.2    5e-17   
ref|XP_009775406.1|  PREDICTED: monothiol glutaredoxin-S6-like        83.2    5e-17   
ref|XP_009761867.1|  PREDICTED: monothiol glutaredoxin-S6-like        83.2    5e-17   
ref|XP_009758132.1|  PREDICTED: glutaredoxin-C11-like                 83.2    6e-17   
gb|KDO63867.1|  hypothetical protein CISIN_1g033109mg                 84.0    6e-17   
ref|XP_006447012.1|  hypothetical protein CICLE_v10017534mg           84.0    6e-17   
ref|XP_008779419.1|  PREDICTED: glutaredoxin-C1-like                  83.6    6e-17   
ref|XP_008775588.1|  PREDICTED: glutaredoxin-C1-like                  83.6    6e-17   
ref|XP_002267962.1|  PREDICTED: glutaredoxin-C11                      83.2    7e-17   
ref|XP_007154238.1|  hypothetical protein PHAVU_003G102000g           83.2    7e-17   
ref|XP_004236715.1|  PREDICTED: monothiol glutaredoxin-S1-like        83.2    7e-17   
ref|XP_009615101.1|  PREDICTED: glutaredoxin-C11-like                 83.2    7e-17   
gb|KHN27195.1|  Glutaredoxin-C1                                       83.2    7e-17   
ref|XP_009762083.1|  PREDICTED: glutaredoxin-C11-like                 83.2    7e-17   
ref|XP_010241671.1|  PREDICTED: monothiol glutaredoxin-S6-like        83.2    7e-17   
ref|XP_004228431.1|  PREDICTED: glutaredoxin-C1-like                  83.6    7e-17   
ref|XP_008804595.1|  PREDICTED: glutaredoxin-C1                       85.1    7e-17   
ref|XP_010242707.1|  PREDICTED: monothiol glutaredoxin-S2-like        83.2    7e-17   
ref|XP_011090617.1|  PREDICTED: monothiol glutaredoxin-S1-like        82.8    7e-17   
ref|XP_008340253.1|  PREDICTED: glutaredoxin-C1-like                  83.6    7e-17   
ref|XP_006645296.1|  PREDICTED: putative glutaredoxin-C2-like         83.2    7e-17   
ref|XP_002863057.1|  glutaredoxin family protein                      82.8    7e-17   
ref|XP_002456905.1|  hypothetical protein SORBIDRAFT_03g045210        83.2    7e-17   
ref|XP_009758965.1|  PREDICTED: glutaredoxin-C1-like                  83.6    7e-17   
ref|XP_010435683.1|  PREDICTED: glutaredoxin-C7-like                  84.0    8e-17   
ref|XP_010496424.1|  PREDICTED: glutaredoxin-C7                       84.0    8e-17   
ref|XP_006574874.1|  PREDICTED: glutaredoxin-C3-like                  84.0    8e-17   
ref|XP_008223118.1|  PREDICTED: monothiol glutaredoxin-S2             82.8    8e-17   
gb|KDP40011.1|  hypothetical protein JCGZ_02009                       82.8    8e-17   
ref|XP_011086843.1|  PREDICTED: glutaredoxin-C5-like                  83.2    9e-17   
ref|XP_006603016.1|  PREDICTED: glutaredoxin-C5-like                  83.6    9e-17   
ref|XP_006359084.1|  PREDICTED: glutaredoxin-C5-like                  83.6    9e-17   
ref|XP_006408562.1|  hypothetical protein EUTSA_v10022308mg           83.6    9e-17   
ref|XP_010453518.1|  PREDICTED: glutaredoxin-C8-like                  83.6    9e-17   
ref|XP_011090618.1|  PREDICTED: monothiol glutaredoxin-S2-like        82.8    9e-17   
ref|XP_006830226.1|  hypothetical protein AMTR_s00130p00050470        82.8    1e-16   
emb|CDP12907.1|  unnamed protein product                              82.4    1e-16   
ref|XP_009593680.1|  PREDICTED: glutaredoxin-C1-like                  83.2    1e-16   
ref|XP_006663086.1|  PREDICTED: glutaredoxin-C13-like                 82.8    1e-16   
ref|XP_006284820.1|  hypothetical protein CARUB_v10006099mg           82.4    1e-16   
ref|XP_004160199.1|  PREDICTED: LOW QUALITY PROTEIN: monothiol gl...  82.8    1e-16   
emb|CDX91918.1|  BnaC03g32200D                                        83.6    1e-16   
ref|XP_009779593.1|  PREDICTED: monothiol glutaredoxin-S1-like        82.4    1e-16   
ref|NP_196911.1|  glutaredoxin ROXY2                                  83.6    1e-16   
ref|XP_004486046.1|  PREDICTED: monothiol glutaredoxin-S10-like       82.4    1e-16   
ref|XP_009612544.1|  PREDICTED: monothiol glutaredoxin-S1-like        82.4    1e-16   
ref|NP_182308.1|  putative glutaredoxin-C12                           82.4    1e-16   
gb|ADG38354.1|  AT3G02000-like protein                                82.0    1e-16   
ref|XP_009134575.1|  PREDICTED: glutaredoxin-C7                       83.6    1e-16   
ref|XP_008651112.1|  PREDICTED: glutaredoxin-C1-like                  84.7    1e-16   
ref|XP_008458480.1|  PREDICTED: monothiol glutaredoxin-S10            82.4    1e-16   
ref|NP_001150763.1|  Grx_C8 - glutaredoxin subgroup III               83.2    1e-16   
ref|XP_009381963.1|  PREDICTED: putative glutaredoxin-C14             82.4    1e-16   
ref|XP_009592444.1|  PREDICTED: glutaredoxin-C5-like                  83.2    1e-16   
gb|KHN46590.1|  Glutaredoxin-C11                                      82.4    1e-16   
ref|XP_009399247.1|  PREDICTED: putative glutaredoxin-C14             82.4    1e-16   
ref|XP_007216287.1|  hypothetical protein PRUPE_ppa020474mg           82.8    1e-16   
ref|NP_001066942.2|  Os12g0538600                                     82.4    1e-16   
ref|XP_004495991.1|  PREDICTED: glutaredoxin-C11-like                 82.0    1e-16   
ref|XP_009629061.1|  PREDICTED: monothiol glutaredoxin-S2             82.0    1e-16   
ref|XP_006346723.1|  PREDICTED: monothiol glutaredoxin-S1-like        82.0    1e-16   
ref|XP_004239526.1|  PREDICTED: glutaredoxin-C1                       82.8    1e-16   
ref|XP_010496441.1|  PREDICTED: glutaredoxin-C7                       82.0    2e-16   
emb|CDY53023.1|  BnaC04g00070D                                        82.0    2e-16   
ref|XP_009369117.1|  PREDICTED: monothiol glutaredoxin-S10-like       82.0    2e-16   
dbj|BAJ89491.1|  predicted protein                                    82.0    2e-16   
ref|XP_008674577.1|  PREDICTED: putative glutaredoxin-C2              82.0    2e-16   
gb|EMT12568.1|  Glutaredoxin-C1                                       82.0    2e-16   
ref|XP_009344217.1|  PREDICTED: glutaredoxin-C5-like                  82.4    2e-16   
gb|EYU43910.1|  hypothetical protein MIMGU_mgv1a020927mg              81.6    2e-16   
ref|XP_008386624.1|  PREDICTED: glutaredoxin-C11-like                 81.6    2e-16   
ref|XP_006419644.1|  hypothetical protein CICLE_v10006286mg           81.6    2e-16   
ref|XP_006284819.1|  hypothetical protein CARUB_v10006098mg           81.6    2e-16   
ref|XP_002885441.1|  electron carrier/ protein disulfide oxidored...  81.6    2e-16   
ref|XP_003546093.1|  PREDICTED: monothiol glutaredoxin-S10-like       81.6    2e-16   
ref|XP_010904787.1|  PREDICTED: putative glutaredoxin-C14             81.6    2e-16   
gb|KFK39456.1|  hypothetical protein AALP_AA3G247200                  81.6    2e-16   
ref|XP_006299130.1|  hypothetical protein CARUB_v10015272mg           81.6    2e-16   
gb|ABK28101.1|  unknown                                               81.6    2e-16   
ref|XP_008375845.1|  PREDICTED: glutaredoxin-C11-like                 81.6    2e-16   
ref|NP_001078198.1|  monothiol glutaredoxin-S10                       81.6    2e-16   
ref|XP_004296809.1|  PREDICTED: monothiol glutaredoxin-S2-like        81.6    2e-16   
ref|XP_007147879.1|  hypothetical protein PHAVU_006G162600g           82.8    2e-16   
gb|AHM25912.1|  glutaredoxin 2                                        82.0    3e-16   
ref|NP_193302.1|  monothiol glutaredoxin-S7                           81.3    3e-16   
ref|XP_009384168.1|  PREDICTED: putative glutaredoxin-C14             81.3    3e-16   
ref|XP_008386623.1|  PREDICTED: glutaredoxin-C11-like                 81.3    3e-16   
ref|XP_004236721.1|  PREDICTED: monothiol glutaredoxin-S1-like        81.3    3e-16   
gb|KHN33129.1|  Monothiol glutaredoxin-S4                             81.3    3e-16   
ref|XP_011082490.1|  PREDICTED: monothiol glutaredoxin-S2-like        81.3    3e-16   
ref|XP_004150812.1|  PREDICTED: monothiol glutaredoxin-S10-like       81.3    3e-16   
ref|XP_007201440.1|  hypothetical protein PRUPE_ppa013797mg           81.3    3e-16   
ref|XP_004236714.1|  PREDICTED: monothiol glutaredoxin-S1-like        81.3    3e-16   
gb|KFK24502.1|  hypothetical protein AALP_AAs55560U000200             81.3    3e-16   
ref|XP_008459889.1|  PREDICTED: glutaredoxin-C1-like                  81.6    3e-16   
gb|AGX01499.1|  glutaredoxin                                          81.6    3e-16   
ref|XP_006855454.1|  hypothetical protein AMTR_s00057p00176460        81.3    3e-16   
gb|ABF69995.1|  glutaredoxin family protein                           81.3    4e-16   
ref|XP_006366679.1|  PREDICTED: glutaredoxin-C11-like                 80.9    4e-16   
ref|XP_006594493.1|  PREDICTED: monothiol glutaredoxin-S10-like       80.9    4e-16   
gb|AAS47604.1|  At4g15670                                             81.6    4e-16   
ref|XP_008674046.1|  PREDICTED: glutaredoxin-C1-like                  80.9    4e-16   
ref|XP_008665182.1|  PREDICTED: putative glutaredoxin-C14             80.9    4e-16   
gb|EMS62879.1|  Glutaredoxin-C1                                       80.9    4e-16   
ref|XP_004140545.1|  PREDICTED: glutaredoxin-C3-like                  81.3    4e-16   
ref|XP_010904788.1|  PREDICTED: glutaredoxin-C1-like                  80.9    4e-16   
ref|XP_006406268.1|  hypothetical protein EUTSA_v10021818mg           80.9    4e-16   
ref|XP_004309686.1|  PREDICTED: glutaredoxin-C11-like                 80.9    4e-16   
gb|KFK43355.1|  hypothetical protein AALP_AA1G115300                  80.9    4e-16   
ref|XP_009624459.1|  PREDICTED: monothiol glutaredoxin-S6-like        80.9    4e-16   
ref|XP_010321839.1|  PREDICTED: glutaredoxin-C11-like                 80.9    4e-16   
ref|XP_009346791.1|  PREDICTED: glutaredoxin-C1                       81.6    4e-16   
ref|XP_006584039.1|  PREDICTED: monothiol glutaredoxin-S2-like        80.9    4e-16   
ref|XP_004296804.1|  PREDICTED: monothiol glutaredoxin-S2-like        80.9    5e-16   
ref|XP_011090919.1|  PREDICTED: monothiol glutaredoxin-S4-like        80.9    5e-16   
ref|XP_006346726.1|  PREDICTED: monothiol glutaredoxin-S2-like        80.9    5e-16   
ref|XP_003593973.1|  Monothiol glutaredoxin-S4                        80.9    5e-16   
ref|XP_004134195.1|  PREDICTED: monothiol glutaredoxin-S2-like        80.5    5e-16   
gb|EYU46715.1|  hypothetical protein MIMGU_mgv1a020763mg              80.5    5e-16   
gb|KFK24503.1|  hypothetical protein AALP_AAs55560U000300             80.5    5e-16   
ref|XP_006284821.1|  hypothetical protein CARUB_v10006100mg           80.5    5e-16   
ref|XP_010112749.1|  hypothetical protein L484_020479                 80.5    6e-16   
ref|XP_009761870.1|  PREDICTED: monothiol glutaredoxin-S1-like        80.5    6e-16   
dbj|BAJ86342.1|  predicted protein                                    80.5    6e-16   
ref|XP_010466387.1|  PREDICTED: monothiol glutaredoxin-S10-like       80.5    6e-16   
gb|EYU43911.1|  hypothetical protein MIMGU_mgv1a016894mg              80.5    6e-16   
ref|XP_006414472.1|  hypothetical protein EUTSA_v10027374mg           80.5    6e-16   
ref|XP_011071245.1|  PREDICTED: glutaredoxin-C5-like                  80.9    7e-16   
ref|XP_009378908.1|  PREDICTED: glutaredoxin-C11-like                 80.1    7e-16   
gb|EPS67967.1|  hypothetical protein M569_06806                       80.9    7e-16   
ref|XP_009621532.1|  PREDICTED: glutaredoxin-C11-like                 80.1    8e-16   
emb|CDY02610.1|  BnaC02g08250D                                        80.1    8e-16   
ref|XP_010434934.1|  PREDICTED: monothiol glutaredoxin-S4             80.1    8e-16   
ref|XP_011071466.1|  PREDICTED: monothiol glutaredoxin-S5-like        80.1    8e-16   
emb|CDP12904.1|  unnamed protein product                              80.1    8e-16   
ref|XP_010440264.1|  PREDICTED: monothiol glutaredoxin-S4-like        80.1    8e-16   
ref|NP_193303.1|  monothiol glutaredoxin-S4                           80.1    8e-16   
ref|XP_009801947.1|  PREDICTED: glutaredoxin-C5-like                  80.9    8e-16   
gb|EYU37410.1|  hypothetical protein MIMGU_mgv1a023394mg              80.9    8e-16   
ref|XP_009759599.1|  PREDICTED: monothiol glutaredoxin-S2-like        80.1    8e-16   
ref|XP_006644173.1|  PREDICTED: glutaredoxin-C1-like                  80.1    8e-16   
gb|EMT20789.1|  hypothetical protein F775_52227                       79.7    9e-16   
ref|XP_008347995.1|  PREDICTED: glutaredoxin-C5-like                  80.5    9e-16   
emb|CDY25124.1|  BnaC06g18660D                                        80.1    9e-16   
ref|XP_004236717.1|  PREDICTED: monothiol glutaredoxin-S1-like        79.7    1e-15   
ref|XP_003577277.1|  PREDICTED: glutaredoxin-C10                      80.1    1e-15   
ref|XP_004494334.1|  PREDICTED: glutaredoxin-C11-like                 79.7    1e-15   
ref|XP_008375846.1|  PREDICTED: glutaredoxin-C11-like                 79.7    1e-15   
ref|XP_009125958.1|  PREDICTED: glutaredoxin-C8                       80.9    1e-15   
ref|XP_006483043.1|  PREDICTED: glutaredoxin-C5-like                  79.7    1e-15   
ref|XP_003565027.1|  PREDICTED: putative glutaredoxin-C2              79.7    1e-15   
emb|CDX91084.1|  BnaC02g05130D                                        80.5    1e-15   
ref|XP_008341254.1|  PREDICTED: glutaredoxin-C5-like                  80.5    1e-15   
gb|EYU31846.1|  hypothetical protein MIMGU_mgv1a026975mg              80.5    1e-15   
ref|XP_010524509.1|  PREDICTED: monothiol glutaredoxin-S4             79.7    1e-15   
ref|XP_011098924.1|  PREDICTED: glutaredoxin-C1                       80.5    1e-15   
ref|XP_004236716.1|  PREDICTED: monothiol glutaredoxin-S1-like        79.7    1e-15   
gb|AFK43054.1|  unknown                                               79.7    1e-15   
gb|KFK22959.1|  hypothetical protein AALP_AAs50914U000200             79.3    1e-15   
ref|XP_009757079.1|  PREDICTED: monothiol glutaredoxin-S1-like        79.3    1e-15   
emb|CDP03537.1|  unnamed protein product                              79.3    1e-15   
ref|XP_009146815.1|  PREDICTED: monothiol glutaredoxin-S4             79.3    1e-15   
ref|XP_006346725.1|  PREDICTED: monothiol glutaredoxin-S2-like        79.3    1e-15   
ref|XP_004296808.1|  PREDICTED: monothiol glutaredoxin-S2-like        79.3    1e-15   
ref|XP_006438817.1|  hypothetical protein CICLE_v10033688mg           80.1    2e-15   
ref|XP_004236718.1|  PREDICTED: monothiol glutaredoxin-S1-like        79.3    2e-15   
gb|EMT19730.1|  Putative glutaredoxin-C14                             79.3    2e-15   
ref|XP_010666488.1|  PREDICTED: glutaredoxin-C11-like                 79.3    2e-15   
ref|XP_002870221.1|  glutaredoxin family protein                      79.3    2e-15   
ref|XP_009378907.1|  PREDICTED: glutaredoxin-C11-like                 79.3    2e-15   
emb|CDP12910.1|  unnamed protein product                              79.3    2e-15   
ref|XP_004508301.1|  PREDICTED: monothiol glutaredoxin-S2-like        79.3    2e-15   
ref|XP_010434935.1|  PREDICTED: monothiol glutaredoxin-S7-like        79.3    2e-15   
ref|XP_008670904.1|  PREDICTED: putative glutaredoxin-C14             79.0    2e-15   
ref|XP_009624458.1|  PREDICTED: monothiol glutaredoxin-S6-like        79.0    2e-15   
ref|XP_008353232.1|  PREDICTED: monothiol glutaredoxin-S2-like        79.0    2e-15   
gb|EMT12570.1|  Glutaredoxin-C1                                       79.0    2e-15   
ref|XP_009593070.1|  PREDICTED: monothiol glutaredoxin-S1-like        79.3    2e-15   
ref|XP_009761795.1|  PREDICTED: monothiol glutaredoxin-S6-like        79.0    2e-15   
ref|XP_002516883.1|  glutaredoxin, grx, putative                      79.0    2e-15   
ref|XP_006414476.1|  hypothetical protein EUTSA_v10026878mg           79.0    2e-15   
ref|XP_009126270.1|  PREDICTED: monothiol glutaredoxin-S2-like        79.0    2e-15   
emb|CDP12906.1|  unnamed protein product                              79.3    2e-15   
emb|CDM85466.1|  unnamed protein product                              79.0    2e-15   
ref|XP_004236719.1|  PREDICTED: monothiol glutaredoxin-S1-like        79.0    2e-15   
gb|EMT12569.1|  Glutaredoxin-C1                                       79.0    2e-15   
ref|XP_004236720.1|  PREDICTED: monothiol glutaredoxin-S1-like        79.0    2e-15   
ref|XP_004296806.1|  PREDICTED: monothiol glutaredoxin-S2-like        79.0    2e-15   
ref|XP_009135749.1|  PREDICTED: monothiol glutaredoxin-S10-like       78.6    3e-15   
ref|XP_004304538.1|  PREDICTED: glutaredoxin-C7-like                  79.3    3e-15   
ref|XP_004296805.1|  PREDICTED: monothiol glutaredoxin-S2-like        78.6    3e-15   
gb|EMT22951.1|  Glutaredoxin-C1                                       78.6    3e-15   
ref|XP_002870222.1|  glutaredoxin family protein                      78.6    3e-15   
gb|EMT22949.1|  Glutaredoxin-C1                                       78.6    3e-15   
ref|XP_009131384.1|  PREDICTED: glutaredoxin-C8-like                  79.7    4e-15   
ref|XP_003550174.1|  PREDICTED: monothiol glutaredoxin-S2-like        78.2    4e-15   
ref|XP_010449912.1|  PREDICTED: monothiol glutaredoxin-S7-like        78.2    4e-15   
ref|XP_010523993.1|  PREDICTED: glutaredoxin-C11-like                 78.6    4e-15   
emb|CDX78558.1|  BnaA03g04700D                                        79.0    4e-15   
ref|XP_009369121.1|  PREDICTED: monothiol glutaredoxin-S2-like        78.2    4e-15   
ref|XP_009109577.1|  PREDICTED: monothiol glutaredoxin-S10-like       78.2    4e-15   
ref|XP_011013022.1|  PREDICTED: monothiol glutaredoxin-S6-like        78.2    4e-15   
ref|XP_009421048.1|  PREDICTED: glutaredoxin-C5                       79.0    4e-15   
ref|XP_009757078.1|  PREDICTED: monothiol glutaredoxin-S1-like        78.2    4e-15   
gb|EYU43914.1|  hypothetical protein MIMGU_mgv1a016876mg              78.2    4e-15   



>ref|XP_002268050.1| PREDICTED: glutaredoxin-C13 [Vitis vinifera]
Length=102

 Score =   134 bits (336),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 85/102 (83%), Gaps = 4/102 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIFSK++CCLCYAV+ILFQEL V P VH ID DPDG+E+EKALL LGC
Sbjct  2    DKVTRLASEKGVVIFSKSSCCLCYAVNILFQELGVTPTVHEIDQDPDGREMEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
                NA VPAVFIGG L+GSTNEVMS HLSGSL+ LLKPYQQ
Sbjct  62   ----NAPVPAVFIGGKLVGSTNEVMSRHLSGSLIPLLKPYQQ  99



>ref|XP_011082492.1| PREDICTED: monothiol glutaredoxin-S9-like [Sesamum indicum]
Length=102

 Score =   130 bits (327),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +K+ +L ++NG++IFSK+TCCLCYAV ILFQELRV PRVH ID DP+GKEIEKAL+ +GC
Sbjct  2    EKIVKLASENGILIFSKSTCCLCYAVQILFQELRVHPRVHEIDHDPEGKEIEKALMRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                +  VPAVFIGG L+GSTNEVMSLHLSGSL+ LLKPYQ
Sbjct  62   ----SGPVPAVFIGGKLVGSTNEVMSLHLSGSLIPLLKPYQ  98



>ref|XP_008386625.1| PREDICTED: monothiol glutaredoxin-S11 [Malus domestica]
Length=101

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 4/102 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++NGVVIFSK++CCLCYAV+ILFQE+ V P VH ID DP+G+E+EKAL  LGC
Sbjct  2    DKVMRLASENGVVIFSKSSCCLCYAVNILFQEIGVSPVVHEIDQDPEGREMEKALTRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
                 A VPAVFIGG+LIGSTNEVMSLHL G L+  LKPYQQ
Sbjct  62   ----TAPVPAVFIGGNLIGSTNEVMSLHLKGQLIPQLKPYQQ  99



>emb|CDP03539.1| unnamed protein product [Coffea canephora]
Length=101

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++NG+VIFSK+TCCLCYAV+ILF EL V P +H ID DPDGKEIEKAL+ +GC
Sbjct  2    DKVLRLASENGLVIFSKSTCCLCYAVNILFHELGVTPYIHEIDHDPDGKEIEKALMRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA +PAVFIGG L+GSTNEVMSLHLSGSLL LL+PYQ
Sbjct  62   ----NAPIPAVFIGGKLVGSTNEVMSLHLSGSLLPLLRPYQ  98



>ref|XP_003625870.1| Glutaredoxin [Medicago truncatula]
 gb|AES82088.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=102

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 84/101 (83%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIF+K++CCLCYAV+ILFQEL + P VH ID DP+G+E+EKALL LGC
Sbjct  2    DKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGIRPMVHEIDQDPEGREMEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                 A VPAVFIGG L+GSTNE+MSLHLSGSL QL+KPYQ
Sbjct  62   ----TAPVPAVFIGGQLMGSTNEIMSLHLSGSLTQLIKPYQ  98



>ref|XP_007201438.1| hypothetical protein PRUPE_ppa013777mg [Prunus persica]
 gb|EMJ02637.1| hypothetical protein PRUPE_ppa013777mg [Prunus persica]
Length=103

 Score =   127 bits (318),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 4/102 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIFSK++CCLCYAV+ILFQE+ V P VH ID DPDG+E+EKAL+ LGC
Sbjct  2    DKVMRLASEKGVVIFSKSSCCLCYAVNILFQEIGVSPVVHEIDQDPDGREMEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
                 A VPAVFIGG L+GSTNEVMSLHL G L+  LKP+QQ
Sbjct  62   ----TAPVPAVFIGGTLVGSTNEVMSLHLKGQLIPKLKPHQQ  99



>ref|XP_008234999.1| PREDICTED: glutaredoxin-C13-like [Prunus mume]
Length=103

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 4/102 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIFSK++CCLCYAV+ILFQE+ V P VH ID DPDG+E+EKA+L LGC
Sbjct  2    DKVMRLASEKGVVIFSKSSCCLCYAVNILFQEIGVSPVVHEIDQDPDGREMEKAILRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
                 A VPAVFIGG L+GSTNEVMSLHL G L+  LKP+QQ
Sbjct  62   ----TAPVPAVFIGGTLVGSTNEVMSLHLKGQLIPKLKPHQQ  99



>ref|XP_008375847.1| PREDICTED: monothiol glutaredoxin-S9-like [Malus domestica]
Length=99

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 81/102 (79%), Gaps = 4/102 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIFSK++CCLCYAV ILFQE+ V P VH ID DP+G+E+EKAL  +GC
Sbjct  2    DKVMRLASEKGVVIFSKSSCCLCYAVKILFQEIGVSPVVHEIDQDPEGREMEKALTRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
                 A VPAVFIGG+LIGSTNEVMSLHL G L+  LKPYQQ
Sbjct  62   ----TAPVPAVFIGGNLIGSTNEVMSLHLKGQLIPKLKPYQQ  99



>ref|XP_010523992.1| PREDICTED: glutaredoxin-C14-like [Tarenaya hassleriana]
Length=102

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R+ ++ GVVIFSK++CCLCYAV ILF++LRV+P +H ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMASEKGVVIFSKSSCCLCYAVQILFRDLRVQPTIHDIDNDPDFREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+ G L+GSTNEVMSLHLSGSLL L+KPYQ +H+
Sbjct  62   ST----AVPAVFVSGKLVGSTNEVMSLHLSGSLLPLIKPYQSVHN  102



>ref|XP_006397982.1| hypothetical protein EUTSA_v10001691mg [Eutrema salsugineum]
 gb|ESQ39435.1| hypothetical protein EUTSA_v10001691mg [Eutrema salsugineum]
Length=102

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKALL +GC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALLRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ L +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSLLY  102



>ref|NP_182309.1| glutaredoxin-C13 [Arabidopsis thaliana]
 ref|XP_002863058.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002880329.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010497805.1| PREDICTED: glutaredoxin-C13 [Camelina sativa]
 sp|O82255.1|GRC13_ARATH RecName: Full=Glutaredoxin-C13; Short=AtGrxC13; AltName: Full=Protein 
ROXY 9 [Arabidopsis thaliana]
 gb|AAC63642.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM15127.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM63279.1| putative glutaredoxin [Arabidopsis thaliana]
 dbj|BAD94488.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|ABE02400.1| At2g47880 [Arabidopsis thaliana]
 gb|ACO50414.1| glutaredoxin [Arabidopsis thaliana]
 gb|EFH39317.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56588.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10904.1| glutaredoxin-C13 [Arabidopsis thaliana]
Length=102

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKALL LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ + +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSILY  102



>ref|XP_006295295.1| hypothetical protein CARUB_v10024385mg [Capsella rubella]
 gb|EOA28193.1| hypothetical protein CARUB_v10024385mg [Capsella rubella]
Length=102

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKALL LGC
Sbjct  2    DRVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG LIGSTNEVMSLHLSGSL+ L+KPYQ + +
Sbjct  62   ST----AVPAVFVGGKLIGSTNEVMSLHLSGSLVPLIKPYQSILY  102



>gb|KFK37539.1| hypothetical protein AALP_AA4G270200 [Arabis alpina]
Length=102

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H I+ DPD +EIEKALL LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIENDPDCREIEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ L +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSLLY  102



>ref|XP_006444242.1| hypothetical protein CICLE_v10023018mg [Citrus clementina]
 ref|XP_006479882.1| PREDICTED: monothiol glutaredoxin-S9-like [Citrus sinensis]
 gb|ESR57482.1| hypothetical protein CICLE_v10023018mg [Citrus clementina]
 gb|KDO87381.1| hypothetical protein CISIN_1g034205mg [Citrus sinensis]
Length=101

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 84/101 (83%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIFSK++CCLCYAV+ILFQEL V P V+ ID DP+GKE+EKAL+ +GC
Sbjct  2    DKVTRLASEKGVVIFSKSSCCLCYAVNILFQELGVHPMVYEIDQDPEGKEMEKALMRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA VPAVFI G L+GSTNEVMSLHLSG+L+ LLKPYQ
Sbjct  62   ----NAPVPAVFISGQLVGSTNEVMSLHLSGNLIPLLKPYQ  98



>ref|XP_007163065.1| hypothetical protein PHAVU_001G203200g [Phaseolus vulgaris]
 gb|ESW35059.1| hypothetical protein PHAVU_001G203200g [Phaseolus vulgaris]
Length=97

 Score =   125 bits (314),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 74/85 (87%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV+RL ++NGVVIF+K++CCLCYAV+ILF+EL V+P++H ID DP+G+E+EKALL LGC
Sbjct  2    DKVKRLASENGVVIFTKSSCCLCYAVNILFEELGVKPQLHEIDHDPEGREMEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                NA VPAVFIGG LIGSTNE+M
Sbjct  62   ----NAPVPAVFIGGKLIGSTNEIM  82



>ref|XP_009142495.1| PREDICTED: glutaredoxin-C13 [Brassica rapa]
 emb|CDY53024.1| BnaC04g00060D [Brassica napus]
 emb|CDX80139.1| BnaA05g00170D [Brassica napus]
Length=102

 Score =   125 bits (314),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVI +K++CCLCYAV ILF++LRV+P VH ID DPD +EIEKALL +GC
Sbjct  2    DKVMRMSSERGVVIITKSSCCLCYAVQILFRDLRVQPTVHEIDTDPDCREIEKALLRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ L +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSLLY  102



>ref|NP_001235478.1| uncharacterized protein LOC100499748 [Glycine max]
 ref|XP_006603650.1| PREDICTED: uncharacterized protein LOC100499748 isoform X1 [Glycine 
max]
 gb|ACU13470.1| unknown [Glycine max]
 gb|KHN43545.1| Glutaredoxin-C13 [Glycine soja]
Length=101

 Score =   125 bits (313),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIF+K++CCLCYAV+ILFQEL V P VH ID DP+G+E+EKALL LGC
Sbjct  2    DKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGVNPVVHEIDHDPEGREMEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                 A VPAVFIGG L GSTNE+MSLHLSGSL Q+LKPYQ L
Sbjct  62   ----TAPVPAVFIGGKLRGSTNEIMSLHLSGSLTQMLKPYQAL  100



>gb|AFC01204.1| glutaredoxin family protein [Ammopiptanthus mongolicus]
Length=102

 Score =   125 bits (313),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIF+K++CCLCYAV+ILFQEL V P VH ID DP+G+E+EKAL  LGC
Sbjct  2    DKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGVSPVVHEIDQDPEGREMEKALSRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                 A VPAVFIGG L+GSTNEVMSLHLSGSL QLLKPYQ +
Sbjct  62   ----TAPVPAVFIGGKLMGSTNEVMSLHLSGSLTQLLKPYQPM  100



>ref|XP_009617055.1| PREDICTED: monothiol glutaredoxin-S11-like [Nicotiana tomentosiformis]
Length=101

 Score =   124 bits (312),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 84/101 (83%), Gaps = 5/101 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQ-ELRVEPRVHSIDLDPDGKEIEKALLALG  361
            DKVRRL  ++GVVIFSK+TCCLCYAV ILFQ +L V P VH ID DP+GKE+EKALL +G
Sbjct  2    DKVRRLATEHGVVIFSKSTCCLCYAVTILFQDQLGVSPYVHEIDHDPEGKEMEKALLRMG  61

Query  362  CGTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
            C    NA VPAVFIGG L+GSTNEVMSLHL GSL+QLLKPY
Sbjct  62   C----NASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPY  98



>ref|NP_001275008.1| glutaredoxin [Solanum tuberosum]
 gb|ABU96708.1| glutaredoxin [Solanum tuberosum]
Length=101

 Score =   124 bits (312),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            MADKV+R+++++GV+IFSK+TCCLCYAV ILF++L V+P VH +D D DGK++EKAL+ +
Sbjct  1    MADKVQRMSSEHGVMIFSKSTCCLCYAVTILFRDLGVDPYVHELDHDSDGKDMEKALMRM  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
            GC    NA VPAVFIGG L+GSTNEVMSLHL GSL+QLLKPY
Sbjct  61   GC----NASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPY  98



>ref|NP_001235876.1| uncharacterized protein LOC100305984 [Glycine max]
 ref|XP_006576146.1| PREDICTED: uncharacterized protein LOC100305984 isoform X1 [Glycine 
max]
 gb|ACU13941.1| unknown [Glycine max]
 gb|KHN28230.1| Glutaredoxin-C13 [Glycine soja]
Length=101

 Score =   124 bits (312),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIF+K++CCLCYAV+ILFQEL V P VH ID DP+G+E+EKALL  GC
Sbjct  2    DKVTRLASEKGVVIFTKSSCCLCYAVNILFQELGVNPVVHEIDHDPEGREMEKALLRQGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                 A VPAVFIGG L+GSTNE+MSLHLSGSL Q+LKPYQ L
Sbjct  62   ----TAPVPAVFIGGKLMGSTNEIMSLHLSGSLTQMLKPYQAL  100



>emb|CDY27469.1| BnaC04g51100D [Brassica napus]
Length=105

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCY V ILF++LRV+P +H ID DPD +EIEKALL +GC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYTVQILFRDLRVQPTIHEIDNDPDCREIEKALLRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ L +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSLLY  102



>gb|ADV56687.1| glutaredoxin [Phaseolus vulgaris]
Length=145

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 77/89 (87%), Gaps = 5/89 (6%)
 Frame = +2

Query  173  IKMADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALL  352
            I+M DKV+RL ++NGVVIF+K++CCLCYAV+ILF+EL V+P++H ID DP+G+E+EKALL
Sbjct  47   IRM-DKVKRLASENGVVIFTKSSCCLCYAVNILFEELGVKPQLHEIDHDPEGREMEKALL  105

Query  353  ALGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
             LGC    NA VPAVFIGG LIGSTNE+M
Sbjct  106  RLGC----NAPVPAVFIGGKLIGSTNEIM  130



>ref|XP_010545042.1| PREDICTED: glutaredoxin-C14 [Tarenaya hassleriana]
Length=102

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 87/105 (83%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCLCYAV ILF++LRV+P +H ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFSKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+ G L+GSTNEVMSLHLSGSLL L+KP+Q +H+
Sbjct  62   PT----AVPAVFVSGKLVGSTNEVMSLHLSGSLLPLIKPFQSVHN  102



>emb|CDY55528.1| BnaA04g29520D [Brassica napus]
Length=105

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIE ALL +GC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIETALLRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ L +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSLLY  102



>gb|KHN03747.1| Monothiol glutaredoxin-S9 [Glycine soja]
Length=101

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV+RL  + GVV+F+K++CCLCYAV+ILFQEL V P VH ID DP+GKEIEKA+  LGC
Sbjct  2    DKVKRLATEKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKDPEGKEIEKAITRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
             T     VPAVFIGG+L+GSTNEVMSLHLSGSL QLLKPY+ L
Sbjct  62   PTP----VPAVFIGGNLVGSTNEVMSLHLSGSLTQLLKPYRAL  100



>gb|ABK96409.1| unknown [Populus trichocarpa x Populus deltoides]
Length=101

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 84/101 (83%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RLT++ GVVIF K+TCCLCYAV ILFQE+ V+P VH ID DP+G+E+EKAL  +GC
Sbjct  2    DKVLRLTSEQGVVIFIKSTCCLCYAVKILFQEIGVDPLVHEIDQDPEGREMEKALTRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                +A VPAVF+GG L+GSTNEVMSLHLSGSL Q+LKPYQ
Sbjct  62   ----SAPVPAVFVGGKLLGSTNEVMSLHLSGSLNQMLKPYQ  98



>emb|CDX95739.1| BnaC03g26200D [Brassica napus]
Length=102

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 85/105 (81%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF+ LRV+P +H ID DPD +EIEKALL +GC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRNLRVQPTIHEIDTDPDCREIEKALLRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T      PAVFIGG L+GST+EVMSLHLSGSL+ L+KPYQ L +
Sbjct  62   ST----AFPAVFIGGKLVGSTSEVMSLHLSGSLVPLIKPYQSLLY  102



>ref|XP_010518505.1| PREDICTED: glutaredoxin-C13-like [Camelina sativa]
Length=102

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKALL LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEV SLHLSGSL+ L+KPYQ + +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVTSLHLSGSLVPLIKPYQSILY  102



>ref|XP_009118202.1| PREDICTED: glutaredoxin-C13 [Brassica rapa]
Length=105

 Score =   124 bits (310),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV I+F++LRV+P +H ID DPD +EIE ALL +GC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQIMFRDLRVQPTIHEIDNDPDCREIETALLRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ L +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSLLY  102



>ref|XP_010507838.1| PREDICTED: glutaredoxin-C13-like [Camelina sativa]
Length=102

 Score =   123 bits (309),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ G VIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKALL LGC
Sbjct  2    DKVMRMSSEKGEVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ + +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSILY  102



>ref|XP_007050806.1| Glutaredoxin [Theobroma cacao]
 gb|EOX94963.1| Glutaredoxin [Theobroma cacao]
Length=100

 Score =   123 bits (308),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVV+FSK++CCLCYAV ILFQEL V P VH ID DP+G+++EKAL  LGC
Sbjct  2    DKVMRLASEKGVVLFSKSSCCLCYAVKILFQELGVSPVVHEIDQDPEGRDMEKALTRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA VPAVFIGG L+GSTNEVMSLHLSG L+ LLKPYQ
Sbjct  62   ----NAPVPAVFIGGKLVGSTNEVMSLHLSGGLIPLLKPYQ  98



>ref|XP_010506828.1| PREDICTED: glutaredoxin-C13-like [Camelina sativa]
Length=102

 Score =   123 bits (308),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID D D +EIEKALL LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDTDCREIEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
             T     VPAVF+GG L+GSTNEVMSLHLSGSL+ L+KPYQ + +
Sbjct  62   ST----AVPAVFVGGKLVGSTNEVMSLHLSGSLVPLIKPYQSILY  102



>ref|XP_004494333.1| PREDICTED: monothiol glutaredoxin-S11-like [Cicer arietinum]
Length=102

 Score =   123 bits (308),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL ++ GVVIF+K++CCLCYAV+ILFQEL + P VH ID DP+G+++EKAL+ LGC
Sbjct  2    EKVMRLASEKGVVIFTKSSCCLCYAVNILFQELGIRPMVHEIDQDPEGRDMEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
                 A VPAVFIGG L+GSTNE+MSLHLSGSL QLLKPY Q
Sbjct  62   ----TAPVPAVFIGGKLMGSTNEIMSLHLSGSLTQLLKPYHQ  99



>ref|XP_006402322.1| hypothetical protein EUTSA_v10006331mg [Eutrema salsugineum]
 gb|ESQ43775.1| hypothetical protein EUTSA_v10006331mg [Eutrema salsugineum]
Length=102

 Score =   123 bits (308),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K +CCLCYAV ILF++LRV+P +H ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKNSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
                   VPAVF+ G L+GSTNEVMSLHLSGSL+ L+KPYQ  H+
Sbjct  62   AN----AVPAVFVSGKLVGSTNEVMSLHLSGSLVPLIKPYQSFHN  102



>gb|AFK36241.1| unknown [Lotus japonicus]
Length=99

 Score =   122 bits (307),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 83/101 (82%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIF+K++CCLCYAV+ILFQE+ V P VH ID DP+G+E+EKALL LGC
Sbjct  2    DKVMRLASEKGVVIFTKSSCCLCYAVNILFQEIGVRPVVHEIDQDPEGREMEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                   VPAVFIGG L+GSTNE+MSLHLSGSL QLLKPYQ
Sbjct  62   PVP----VPAVFIGGKLMGSTNEIMSLHLSGSLTQLLKPYQ  98



>ref|XP_009378906.1| PREDICTED: monothiol glutaredoxin-S9-like [Pyrus x bretschneideri]
Length=98

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIFSK++CCLCYAV+ILFQE+ V P V+ ID DP+G+E+EKAL  +GC
Sbjct  2    DKVMRLASEKGVVIFSKSSCCLCYAVNILFQEIGVSPVVYEIDQDPEGREMEKALTRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                 A VPAVFIGG+LIGSTNEVMSLHL G L+  LKPYQ
Sbjct  62   ----TAPVPAVFIGGNLIGSTNEVMSLHLKGQLIPKLKPYQ  98



>ref|XP_009797640.1| PREDICTED: monothiol glutaredoxin-S11-like [Nicotiana sylvestris]
Length=101

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 5/101 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQ-ELRVEPRVHSIDLDPDGKEIEKALLALG  361
            DKVRRL  ++GVVIFSK+TCCLCYAV ILFQ +L V P VH ID DP+GKE+EKALL + 
Sbjct  2    DKVRRLATEHGVVIFSKSTCCLCYAVTILFQDQLGVSPYVHEIDHDPEGKEMEKALLRMS  61

Query  362  CGTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
            C    NA VPAVFIGG L+GSTNEVMSLHL GSL+QLLKPY
Sbjct  62   C----NASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPY  98



>ref|XP_009116964.1| PREDICTED: glutaredoxin-C14 [Brassica rapa]
 emb|CDY11466.1| BnaA09g40320D [Brassica napus]
Length=102

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 85/105 (81%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K +CCLCYAV +LF++LRV+P+VH ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKNSCCLCYAVQVLFRDLRVQPKVHEIDNDPDCREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
                   VPAVF+ G L+GSTN+VMSLHLSGSL+ L+KPYQ  H+
Sbjct  62   AN----AVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQSFHN  102



>ref|NP_001237832.1| uncharacterized protein LOC100527558 [Glycine max]
 gb|ACU16655.1| unknown [Glycine max]
Length=101

 Score =   122 bits (306),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL  + GVV+F+K++CCLCYAV+ILFQEL V P VH ID DP+GKEIEKA+  LGC
Sbjct  2    DKVTRLATEKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKDPEGKEIEKAITRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
             T     VPAVFIGG L+GSTNEVMSLHLSGSL QLLKPY+ L
Sbjct  62   PTP----VPAVFIGGKLVGSTNEVMSLHLSGSLTQLLKPYRAL  100



>ref|XP_010243569.1| PREDICTED: monothiol glutaredoxin-S11-like [Nelumbo nucifera]
Length=101

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 82/103 (80%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL A+ GVVIFSK++CC+CYAV ILF EL V P VH ID DP+GKE+E+AL  LGC
Sbjct  2    EKVMRLAAEKGVVIFSKSSCCMCYAVKILFHELGVNPIVHEIDQDPEGKEMERALCRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                NA VPAVFIGG L+GSTNEVMSLHL GSL+ LL+PYQ L
Sbjct  62   ----NAPVPAVFIGGKLVGSTNEVMSLHLGGSLIPLLRPYQTL  100



>ref|NP_191855.1| glutaredoxin-C14 [Arabidopsis thaliana]
 ref|XP_006292102.1| hypothetical protein CARUB_v10018297mg [Capsella rubella]
 ref|XP_010512694.1| PREDICTED: glutaredoxin-C14 [Camelina sativa]
 ref|XP_010413216.1| PREDICTED: glutaredoxin-C14 [Camelina sativa]
 ref|XP_010468902.1| PREDICTED: glutaredoxin-C14 [Camelina sativa]
 sp|Q9LYC5.1|GRC14_ARATH RecName: Full=Glutaredoxin-C14; Short=AtGrxC14; AltName: Full=Protein 
ROXY 8 [Arabidopsis thaliana]
 emb|CAB87741.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|ABD57487.1| At3g62960 [Arabidopsis thaliana]
 gb|ACO50413.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE80417.1| glutaredoxin-C14 [Arabidopsis thaliana]
 gb|EOA25000.1| hypothetical protein CARUB_v10018297mg [Capsella rubella]
Length=102

 Score =   122 bits (306),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 85/105 (81%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
                   VPAVF+ G L+GSTN+VMSLHLSGSL+ L+KPYQ  H+
Sbjct  62   AN----AVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQSFHN  102



>ref|XP_002320361.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE98676.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score =   122 bits (305),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL ++ GVVIF K+TCCLCYAV ILFQE+ V+P VH ID DP+G+E+EKAL  +GC
Sbjct  2    DKVLRLASEQGVVIFIKSTCCLCYAVKILFQEIGVDPLVHEIDQDPEGREMEKALTRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                +A VPAVF+GG L+GSTNEVMSLHLSGSL Q+LKPYQ
Sbjct  62   ----SAPVPAVFVGGKLLGSTNEVMSLHLSGSLNQMLKPYQ  98



>ref|XP_009138699.1| PREDICTED: glutaredoxin-C14-like [Brassica rapa]
 emb|CDY68061.1| BnaCnng57420D [Brassica napus]
 emb|CDX89162.1| BnaA04g00240D [Brassica napus]
Length=102

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K +CCLCYAV ILF++LRV+P +H ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKDSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
                NA VPAVF+ G L+GSTNEVMSLHLSGSL+ L+KPYQ  H+
Sbjct  62   ---TNA-VPAVFVSGKLVGSTNEVMSLHLSGSLVPLIKPYQSFHN  102



>emb|CDX76678.1| BnaC08g32640D [Brassica napus]
Length=102

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 85/105 (81%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K +CCLCYAV +LF++LRV+P++H ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKNSCCLCYAVQVLFRDLRVQPKIHEIDNDPDCREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
                   VPAVF+ G L+GSTN+VMSLHLSGSL+ L+KPYQ  H+
Sbjct  62   AN----AVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQAFHN  102



>ref|XP_011033601.1| PREDICTED: glutaredoxin-C13 [Populus euphratica]
Length=101

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R+ +++GVVIF+K+TCCLCYAV ILFQE+ V+P VH IDLD +G+E+E+AL  +GC
Sbjct  2    DKVSRMASEHGVVIFTKSTCCLCYAVKILFQEIGVDPLVHEIDLDAEGREMERALKRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                +A VPAVF+GG L+GSTNEVMSLHLSGSL Q+LKPYQ
Sbjct  62   ----SAPVPAVFVGGKLLGSTNEVMSLHLSGSLNQMLKPYQ  98



>ref|XP_006389677.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP48591.1| glutaredoxin family protein [Populus trichocarpa]
Length=99

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV  L ++ GVVIFSK++CCLCYAV ILFQE+ V+P V+ ID DP+G+E+EKAL  LGC
Sbjct  2    DKVMGLASEKGVVIFSKSSCCLCYAVKILFQEIGVDPLVYEIDQDPEGREMEKALTRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA VPAVFIGG L+GSTNEVMSLHLSGSL+ +LKPYQ
Sbjct  62   ----NAPVPAVFIGGKLMGSTNEVMSLHLSGSLIPMLKPYQ  98



>ref|XP_007144558.1| hypothetical protein PHAVU_007G165900g [Phaseolus vulgaris]
 gb|ESW16552.1| hypothetical protein PHAVU_007G165900g [Phaseolus vulgaris]
Length=101

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL  D GVV+F+K++CCLCYAV+ILF+EL V P VH ID DP+GKE+EKAL  LGC
Sbjct  2    EKVIRLATDKGVVVFTKSSCCLCYAVNILFRELGVNPVVHEIDKDPEGKEMEKALTRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                 A VPAVFIGG L+GSTNEVMSLHLSGSL ++LKPY+ L
Sbjct  62   ----PAPVPAVFIGGTLVGSTNEVMSLHLSGSLTKMLKPYRSL  100



>ref|XP_010069984.1| PREDICTED: glutaredoxin-C13-like [Eucalyptus grandis]
 gb|KCW58534.1| hypothetical protein EUGRSUZ_H01202 [Eucalyptus grandis]
Length=104

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 84/101 (83%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV+R  ++ GVVIFSK++CCLCY V ILF++L V+PRV+ ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVKRCASEQGVVIFSKSSCCLCYTVTILFRDLGVQPRVYEIDRDPECREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA VPAVFIGG L+GSTNEVMSLHLSGSL+ +++PYQ
Sbjct  62   ----NAPVPAVFIGGQLVGSTNEVMSLHLSGSLIPMIRPYQ  98



>ref|XP_004240522.1| PREDICTED: glutaredoxin-C13-like [Solanum lycopersicum]
Length=101

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            MADKV+R+++++GV+IFSK+TCCLCYAV ILF++L V+P VH +D D +GK++EKAL+ +
Sbjct  1    MADKVQRMSSEHGVMIFSKSTCCLCYAVTILFRDLGVDPYVHELDHDSEGKDMEKALVRM  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
            GC    N  VPAVFIGG L+GSTNEVMSLHL GSL+QLLKPY
Sbjct  61   GC----NVSVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPY  98



>gb|KEH43252.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=99

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL  + GVVIF+K++CCLCYAV+ILFQE+ V P VH ID DP+GKE+EKA+  LGC
Sbjct  2    EKVMRLATEKGVVIFTKSSCCLCYAVNILFQEIGVFPVVHEIDKDPEGKEMEKAITKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA VPAVFIGG L+GSTNEVMSLHLSGSL+ LL+PY+
Sbjct  62   ----NAPVPAVFIGGRLVGSTNEVMSLHLSGSLVPLLRPYR  98



>ref|XP_007138394.1| hypothetical protein PHAVU_009G205000g [Phaseolus vulgaris]
 gb|ESW10388.1| hypothetical protein PHAVU_009G205000g [Phaseolus vulgaris]
Length=101

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 4/81 (5%)
 Frame = +2

Query  197  RLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGCGTNN  376
            RL  +NGVVIF+K++CCLCYAV+ILFQEL V+P VH ID DP+G+E+EKALL LGC    
Sbjct  3    RLANENGVVIFTKSSCCLCYAVNILFQELGVKPLVHGIDHDPEGREMEKALLRLGC----  58

Query  377  NAVVPAVFIGGHLIGSTNEVM  439
            NA VPAVFIGG LIGSTNE+M
Sbjct  59   NAPVPAVFIGGKLIGSTNEIM  79



>gb|KEH43253.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=99

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL  + GVV+F+K++CCLCYAV+ILFQE+ V P +H ID DP+GKE+EKA+  LGC
Sbjct  2    EKVMRLATEKGVVVFTKSSCCLCYAVNILFQEIGVYPVIHEIDKDPEGKEMEKAITKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA VPAVFIGG L+GSTNEVMSLHLSGSL+ LL+PY+
Sbjct  62   ----NAPVPAVFIGGRLVGSTNEVMSLHLSGSLVPLLRPYR  98



>gb|EPS63131.1| glutaredoxin, partial [Genlisea aurea]
Length=98

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 83/101 (82%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +K+ +L ++NG++I SK+TCCLCYAV +LF+ELRV P VH ID DP+GKE+EKAL+ +GC
Sbjct  2    EKISKLASENGILILSKSTCCLCYAVQMLFKELRVHPIVHEIDHDPEGKEMEKALVRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                +  VPAVFIGG L+GSTNEVMS+HLSG+LL LL PYQ
Sbjct  62   ----SGPVPAVFIGGKLVGSTNEVMSMHLSGALLPLLGPYQ  98



>ref|XP_009758128.1| PREDICTED: glutaredoxin-C13-like [Nicotiana sylvestris]
Length=100

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 84/100 (84%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV+R+ ++ GVVIFSK+TCCLCYAV ILF++L V+P VH +D D +GK++EKAL+ +GC
Sbjct  2    DKVQRMASEYGVVIFSKSTCCLCYAVTILFRDLGVDPYVHELDHDSEGKDMEKALMRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                NA VPAVFIGG L+GSTNEVMSLHL GSL+QLLKPY
Sbjct  62   ----NASVPAVFIGGKLVGSTNEVMSLHLKGSLIQLLKPY  97



>gb|KHN46591.1| Glutaredoxin-C13 [Glycine soja]
Length=101

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL  D GVV+F+K++CCLCYAV+ILFQEL V P VH ID DP+GKE+EKA+  LG 
Sbjct  2    EKVMRLATDKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKDPEGKEMEKAITRLGS  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
             T     VPAVFIGG L+GSTNEVMSLHLSGSL+QLLKPY+ L
Sbjct  62   PTP----VPAVFIGGKLVGSTNEVMSLHLSGSLIQLLKPYRAL  100



>ref|XP_009104404.1| PREDICTED: glutaredoxin-C14-like [Brassica rapa]
Length=102

 Score =   117 bits (294),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 82/105 (78%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R+++  GVVIF+K +CCLCYAV ILF++LRV+P +H ID DPD  EIEKAL+ LGC
Sbjct  2    DKVMRMSSGKGVVIFTKNSCCLCYAVQILFRDLRVQPTIHEIDNDPDCLEIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
                   VPAVF+ G L+GSTNEVMSLHLSGSL+ L+KPYQ  H+
Sbjct  62   PN----AVPAVFVSGKLVGSTNEVMSLHLSGSLVPLIKPYQLFHN  102



>ref|XP_002881118.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57377.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=102

 Score =   117 bits (294),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R+++D GVVIFSK++CCL YAV +LFQ+L V P VH ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVVRMSSDKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG LIGSTNEVMSLHLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQ  98



>gb|KFK35484.1| hypothetical protein AALP_AA5G290300 [Arabis alpina]
Length=102

 Score =   117 bits (294),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++ + GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKAL  LGC
Sbjct  2    DKVMRMSTEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALTRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                   VPAVF+ G L+GSTN+VMSLHLSGSL+ L+KPYQ  
Sbjct  62   AN----AVPAVFVSGKLVGSTNDVMSLHLSGSLVPLIKPYQSF  100



>ref|XP_009621533.1| PREDICTED: glutaredoxin-C13-like [Nicotiana tomentosiformis]
Length=100

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 84/100 (84%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV+R+ +++GVVIFSK+TCCLCYAV ILF++L V+P VH +D D +GK++EKAL+ +GC
Sbjct  2    DKVQRMASEHGVVIFSKSTCCLCYAVTILFRDLGVDPYVHELDHDSEGKDMEKALMRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                NA VPAVFI G L+GSTNEVMSLHL GSL+QLLKPY
Sbjct  62   ----NASVPAVFIAGKLVGSTNEVMSLHLKGSLIQLLKPY  97



>emb|CDY23990.1| BnaC03g17010D [Brassica napus]
Length=102

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P VH ID DPD +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKDPDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG L+GSTNEVMS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQ  98



>ref|NP_001238158.1| uncharacterized protein LOC100500442 [Glycine max]
 gb|ACU15529.1| unknown [Glycine max]
Length=101

 Score =   117 bits (293),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 82/103 (80%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL  + GVV+F+K++CCLCYAV+ILFQEL V P VH ID DP+GKE+EKA+  LG 
Sbjct  2    EKVMRLATEKGVVVFTKSSCCLCYAVNILFQELGVIPVVHEIDKDPEGKEMEKAITRLGS  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
             T     VPAVFIGG L+GSTNEVMSLHLSGSL QLLKPY+ L
Sbjct  62   PTP----VPAVFIGGKLVGSTNEVMSLHLSGSLTQLLKPYRAL  100



>ref|XP_006410157.1| hypothetical protein EUTSA_v10017804mg [Eutrema salsugineum]
 gb|ESQ51610.1| hypothetical protein EUTSA_v10017804mg [Eutrema salsugineum]
Length=102

 Score =   117 bits (293),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P VH ID DPD +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKDPDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG L+GSTNEVMS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQ  98



>ref|XP_004495992.1| PREDICTED: monothiol glutaredoxin-S9-like [Cicer arietinum]
Length=99

 Score =   117 bits (292),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL  + GVVIF+K++CC+CYAV+ILF+EL V P VH ID DP+GKE+EKA+  LGC
Sbjct  2    EKVMRLATEKGVVIFTKSSCCMCYAVNILFRELGVFPVVHEIDKDPEGKEMEKAITKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA VPAVFIGG L+GSTNEVMSLHLSGSL  L++P++
Sbjct  62   ----NAPVPAVFIGGKLVGSTNEVMSLHLSGSLTPLIRPFR  98



>ref|XP_006304582.1| hypothetical protein CARUB_v10011626mg [Capsella rubella]
 gb|EOA37480.1| hypothetical protein CARUB_v10011626mg [Capsella rubella]
Length=99

 Score =   117 bits (292),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_009119027.1| PREDICTED: monothiol glutaredoxin-S11 [Brassica rapa]
Length=99

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVLRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKDPECREIEKALMKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_009118476.1| PREDICTED: monothiol glutaredoxin-S11-like [Brassica rapa]
 emb|CDY09953.1| BnaC08g44980D [Brassica napus]
 emb|CDY06230.1| BnaA09g49730D [Brassica napus]
Length=99

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL+++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +E+EKAL+ LGC
Sbjct  2    DKVMRLSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKDPECREMEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>emb|CDY54881.1| BnaA10g27940D [Brassica napus]
Length=99

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVLRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_002889620.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65879.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=99

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVNPKIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>gb|KDP28094.1| hypothetical protein JCGZ_13865 [Jatropha curcas]
Length=101

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV  L ++ GVVIFSK++CC+CYAV ILFQ + V+P V+ ID DP+G+E+E+ALL +GC
Sbjct  2    EKVMGLASEKGVVIFSKSSCCMCYAVKILFQGIGVDPLVYEIDQDPEGREMERALLRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                +A VPAVFIGG L+GSTNE+MSLHLSG+L+Q+LKPYQ L
Sbjct  62   ----SAPVPAVFIGGKLMGSTNEIMSLHLSGNLVQMLKPYQTL  100



>ref|XP_010486752.1| PREDICTED: monothiol glutaredoxin-S11 [Camelina sativa]
 ref|XP_010475433.1| PREDICTED: monothiol glutaredoxin-S11 [Camelina sativa]
 ref|XP_010475434.1| PREDICTED: monothiol glutaredoxin-S11 [Camelina sativa]
Length=99

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVMRMSSERGVVIFSKSSCCLSYAVQVLFQDLGVNPKIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_010522020.1| PREDICTED: monothiol glutaredoxin-S9 [Tarenaya hassleriana]
Length=102

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P +H ID +PD +EIEKAL+ +GC
Sbjct  2    DKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKEPDCREIEKALMRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPAVFI G LIGSTNEVMSLHLSGSL+ L+KPYQ
Sbjct  62   STP----VPAVFISGKLIGSTNEVMSLHLSGSLVPLVKPYQ  98



>ref|XP_009141071.1| PREDICTED: monothiol glutaredoxin-S9 [Brassica rapa]
 emb|CDY29666.1| BnaA04g17610D [Brassica napus]
Length=102

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CC+ YAV +LFQ+L V P VH ID DPD +EIEKA++ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPDCREIEKAIMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG L+GSTNEVMS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQ  98



>emb|CDY10229.1| BnaC05g04720D [Brassica napus]
Length=99

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +E+EKAL+ LGC
Sbjct  2    DKVLRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVSPKIHEIDKDPECREMEKALMKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_009614874.1| PREDICTED: glutaredoxin-C13-like [Nicotiana tomentosiformis]
Length=100

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV++L ++NGV+IFSK+TCCLCYAV ILF+EL V   VH +D D DGKE++K+L+ +GC
Sbjct  2    EKVQKLASENGVMIFSKSTCCLCYAVSILFRELGVNAYVHELDHDSDGKEMDKSLIKMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                N  VPAVFIGG LIGSTNE+MSLHL GSLLQLLKPY 
Sbjct  62   ----NPSVPAVFIGGKLIGSTNEIMSLHLKGSLLQLLKPYM  98



>ref|XP_010510342.1| PREDICTED: monothiol glutaredoxin-S9 [Camelina sativa]
 ref|XP_010469842.1| PREDICTED: monothiol glutaredoxin-S9 [Camelina sativa]
Length=102

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P +H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG LIGSTNEVMSLHLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQ  98



>ref|NP_180612.1| monothiol glutaredoxin-S9 [Arabidopsis thaliana]
 sp|O04341.1|GRXS9_ARATH RecName: Full=Monothiol glutaredoxin-S9; Short=AtGrxS9; AltName: 
Full=Protein ROXY 7 [Arabidopsis thaliana]
 gb|AAB63083.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM65461.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM83235.1| At2g30540/T6B20.11 [Arabidopsis thaliana]
 gb|AAN46782.1| At2g30540/T6B20.11 [Arabidopsis thaliana]
 gb|ACO50412.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEC08405.1| monothiol glutaredoxin-S9 [Arabidopsis thaliana]
Length=102

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CC+ YAV +LFQ+L V P VH ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG LIGSTNEVMSLHLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQ  98



>ref|XP_009144292.1| PREDICTED: monothiol glutaredoxin-S9-like [Brassica rapa]
 emb|CDY10745.1| BnaA05g11910D [Brassica napus]
Length=102

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R+++D GVVIFSK++CC+ YAV +LFQ+L V P VH ID DPD +EIEKAL+ LGC
Sbjct  2    DKVVRMSSDKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+ G L+GSTNEVMS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVDGKLVGSTNEVMSMHLSGSLVPLVKPFQ  98



>ref|NP_172168.1| monothiol glutaredoxin-S11 [Arabidopsis thaliana]
 sp|Q9M9Y9.1|GRS11_ARATH RecName: Full=Monothiol glutaredoxin-S11; Short=AtGrxS11; AltName: 
Full=Protein ROXY 6 [Arabidopsis thaliana]
 gb|AAF63150.1|AC011001_20 Similar to glutaredoxin [Arabidopsis thaliana]
 gb|AAL62358.1| glutaredoxin, putative [Arabidopsis thaliana]
 gb|AAM47933.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM61604.1| glutaredoxin, putative [Arabidopsis thaliana]
 gb|ACO50411.1| glutaredoxin [Arabidopsis thaliana]
 gb|AEE28043.1| monothiol glutaredoxin-S11 [Arabidopsis thaliana]
Length=99

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLSYAVQVLFQDLGVNPKIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_010486713.1| PREDICTED: monothiol glutaredoxin-S11-like [Camelina sativa]
 ref|XP_010457833.1| PREDICTED: monothiol glutaredoxin-S11-like [Camelina sativa]
 ref|XP_010497824.1| PREDICTED: monothiol glutaredoxin-S11-like [Camelina sativa]
Length=99

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVMRMSSERGVVIFSKSSCCLSYAVQVLFQDLGVIPKIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_004309711.1| PREDICTED: glutaredoxin-C13-like [Fragaria vesca subsp. vesca]
Length=102

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 78/102 (76%), Gaps = 5/102 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL + N VVIFSK++CCLCYAV+ILFQE+ V   V+ ID DPDG+E+EK L+ +GC
Sbjct  2    DKVIRLASANDVVIFSKSSCCLCYAVNILFQEIGVRASVNEIDNDPDGREMEKCLMRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
             +     VPAVFIGG LIGSTNEVMSLHL G L+  LK Y+Q
Sbjct  62   SS-----VPAVFIGGQLIGSTNEVMSLHLKGQLIPKLKAYEQ  98



>ref|XP_004136055.1| PREDICTED: monothiol glutaredoxin-S11-like [Cucumis sativus]
 ref|XP_004160535.1| PREDICTED: monothiol glutaredoxin-S11-like [Cucumis sativus]
 ref|XP_008451631.1| PREDICTED: monothiol glutaredoxin-S11 [Cucumis melo]
 gb|KGN44888.1| hypothetical protein Csa_7G394080 [Cucumis sativus]
Length=103

 Score =   114 bits (286),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV+RL A+  VVIFSK++CCL YAV+ILF EL V P V+ ID DPD +EIEKAL+ LGC
Sbjct  2    DKVKRLVAERSVVIFSKSSCCLSYAVNILFGELGVNPLVYEIDQDPDYREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                NA VPAVFIGG L+GSTNE+M
Sbjct  62   ----NAPVPAVFIGGKLVGSTNEIM  82



>ref|XP_009132744.1| PREDICTED: monothiol glutaredoxin-S9-like [Brassica rapa]
Length=102

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P VH ID D D +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKDLDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG L+GSTNEVMS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLVGSTNEVMSMHLSGSLVSLVKPFQ  98



>gb|KFK42997.1| hypothetical protein AALP_AA1G066100 [Arabis alpina]
Length=99

 Score =   114 bits (285),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 80/100 (80%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCL YAV +LFQ+L V P++H ID DP+ +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLSYAVQVLFQDLGVIPKIHEIDKDPECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>ref|XP_010557174.1| PREDICTED: monothiol glutaredoxin-S9-like [Tarenaya hassleriana]
Length=99

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ++ V P VH ID DPD +EIEKAL+ +GC
Sbjct  2    DKVMRMSSEKGVVIFSKSSCCLSYAVQVLFQDIGVHPTVHEIDTDPDCREIEKALMRIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
             T     VPAVFIGG LIGSTNEVM
Sbjct  62   STP----VPAVFIGGKLIGSTNEVM  82



>ref|XP_010241630.1| PREDICTED: monothiol glutaredoxin-S11-like [Nelumbo nucifera]
Length=101

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV R+ ++ GVVIFS+++CC+CYAV ILF EL V P VH +D DP+ KE+E+AL  +GC
Sbjct  2    EKVMRVASEKGVVIFSRSSCCMCYAVKILFHELGVNPMVHELDQDPEEKEMERALSRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                NA VPAVFIGG L+GSTNEVMSLHLSGSL+ L+K YQ L
Sbjct  62   ----NAPVPAVFIGGKLVGSTNEVMSLHLSGSLVPLIKSYQTL  100



>ref|XP_010414255.1| PREDICTED: monothiol glutaredoxin-S9-like [Camelina sativa]
Length=102

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 82/101 (81%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P +H ID DP+ ++IEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKDPECRDIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG LIGSTNEVMSLHLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQ  98



>ref|XP_010666490.1| PREDICTED: monothiol glutaredoxin-S9-like [Beta vulgaris subsp. 
vulgaris]
Length=103

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R+ ++NGVVIFSK++CCLCY+V+ILFQEL V P ++ ID D +GKEIEKA++ +GC
Sbjct  2    DKVIRVVSENGVVIFSKSSCCLCYSVNILFQELGVTPFIYEIDKDSEGKEIEKAIMKIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              N +  +PAVFIGG L+GSTNE+M
Sbjct  62   --NTHVPLPAVFIGGKLMGSTNEIM  84



>emb|CDY52638.1| BnaCnng23060D [Brassica napus]
Length=102

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CC+ YAV +LFQ+L V P VH ID DPD +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+ G L+GSTNEVMS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVDGKLVGSTNEVMSMHLSGSLVPLVKPFQ  98



>ref|XP_009785800.1| PREDICTED: glutaredoxin-C13-like [Nicotiana sylvestris]
Length=100

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV++L ++NGV+IFSK+TCCLCYAV ILF+EL V   VH +D D DGKE++K+L+ +GC
Sbjct  2    EKVQKLASENGVMIFSKSTCCLCYAVSILFRELGVNAYVHELDHDSDGKEMDKSLIKMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                N  VPAVFIGG LIGSTNE+MSLHL GSL+QLL PY 
Sbjct  62   ----NPSVPAVFIGGKLIGSTNEIMSLHLKGSLIQLLNPYM  98



>ref|XP_002876697.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52956.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=96

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIF+K++CCLCYAV ILF++LRV+P +H ID DPD +EIEKAL+ LGC
Sbjct  2    DKVMRMSSEKGVVIFTKSSCCLCYAVQILFRDLRVQPTIHEIDNDPDCREIEKALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                NA VPAVF+ G L+GSTN+VM
Sbjct  62   A---NA-VPAVFVSGKLVGSTNDVM  82



>ref|XP_011009413.1| PREDICTED: monothiol glutaredoxin-S9-like [Populus euphratica]
Length=99

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV  L ++  VVIFSK++CCLCYAV ILFQE+ V+P V+ ID D +G+E+EKAL  LGC
Sbjct  2    DKVMGLASEKAVVIFSKSSCCLCYAVKILFQEIGVDPLVYEIDQDAEGREMEKALTRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
                NA +PAVFIGG L+GSTNEVMSLHLSGSL+ +LKPY+
Sbjct  62   ----NAPLPAVFIGGKLMGSTNEVMSLHLSGSLIPMLKPYK  98



>emb|CDX84825.1| BnaA03g14050D [Brassica napus]
Length=102

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P VH ID D D +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTVHEIDKDLDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG L+GSTNEVMS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLVGSTNEVMSMHLSGSLVPLVKPFQ  98



>ref|XP_006417875.1| hypothetical protein EUTSA_v10009180mg [Eutrema salsugineum]
 gb|ESQ36228.1| hypothetical protein EUTSA_v10009180mg [Eutrema salsugineum]
Length=99

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V R++++  VVIFSK++CCL YAV +LFQ+L V P++H ID DP+ +EIEKALL LGC
Sbjct  2    DRVMRMSSEKRVVIFSKSSCCLSYAVQVLFQDLGVNPKIHEIDKDPECREIEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                   VPAVFIGG L+GSTNEVMS+HLS SL+ L+KPY
Sbjct  62   SKP----VPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPY  97



>emb|CDX97824.1| BnaC04g41150D [Brassica napus]
Length=102

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CC+ YAV +LFQ+L V P VH ID DPD +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG L+GST E MS+HLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLMGSTTEAMSMHLSGSLVPLVKPFQ  98



>ref|XP_006296283.1| hypothetical protein CARUB_v10025453mg [Capsella rubella]
 gb|EOA29181.1| hypothetical protein CARUB_v10025453mg [Capsella rubella]
Length=102

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CCL YAV +LFQ+L V P +H ID D + +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCLSYAVQVLFQDLGVHPTIHEIDKDVECREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
             T     VPA+F+GG LIGSTNEVMSLHLSGSL+ L+KP+Q
Sbjct  62   STP----VPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQ  98



>emb|CAH59431.1| glutaredoxin 1 [Plantago major]
Length=105

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV ++ ++NGVVIFSK++CCL YAV +LFQELR    ++ ID  PDGKE+EKAL+ LG 
Sbjct  2    DKVMKIKSENGVVIFSKSSCCLSYAVQMLFQELRANAFIYEIDHSPDGKEVEKALMRLG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
               ++  +PAVFIGG L+GSTNEVMSLHLSGSL+ LLKP Q
Sbjct  61   ---SSGPIPAVFIGGKLVGSTNEVMSLHLSGSLIPLLKPTQ  98



>ref|XP_011079732.1| PREDICTED: monothiol glutaredoxin-S9-like [Sesamum indicum]
Length=104

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +K+ +L ++NG++I SK++CCLCYAV +LFQ+L V P ++ ID DP+ KEIEKAL+ +GC
Sbjct  2    EKIVKLASENGILIMSKSSCCLCYAVQMLFQDLGVHPLIYEIDHDPEEKEIEKALVRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQL  493
                +  VPAVFIGG L+GSTNEVMSLHLSGSL+ L+ PYQ L
Sbjct  62   ----SGPVPAVFIGGKLVGSTNEVMSLHLSGSLIPLITPYQAL  100



>ref|XP_004247457.1| PREDICTED: glutaredoxin-C13-like [Solanum lycopersicum]
Length=106

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV+R+  D+GVVIFSK+TCCL YAV +LF++L V P V  ID +PDGKE+EKAL+ +  
Sbjct  2    DKVQRMARDHGVVIFSKSTCCLSYAVSVLFKDLGVVPYVCQIDHEPDGKEMEKALIRM--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
            G N++ + PAVFIGG L+GSTNEVMSLHL GSL QL++PY
Sbjct  60   GVNSSFLFPAVFIGGSLLGSTNEVMSLHLQGSLNQLIQPY  99



>ref|XP_006359429.1| PREDICTED: monothiol glutaredoxin-S9-like [Solanum tuberosum]
Length=106

 Score =   109 bits (273),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV+R+T ++GVVIFSK+TCCL YAV ILFQ+L V P V  ID + DGKE+EKAL+ +  
Sbjct  2    EKVQRMTREHGVVIFSKSTCCLSYAVSILFQDLGVIPYVCEIDHESDGKEMEKALIRM--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
            G N++ + PAVFIGG L+GSTNEVMSLHL GSL++L+KPY
Sbjct  60   GVNSSFMFPAVFIGGLLVGSTNEVMSLHLQGSLIKLIKPY  99



>ref|XP_010038171.1| PREDICTED: glutaredoxin-C13-like [Eucalyptus grandis]
 gb|KCW49985.1| hypothetical protein EUGRSUZ_K03441 [Eucalyptus grandis]
Length=106

 Score =   109 bits (273),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL ++ GVVIFSK+TCCLCY V ILF++L V+P VH ID DP+G E+E+ L  LGC
Sbjct  2    EKVTRLASEKGVVIFSKSTCCLCYTVSILFRDLGVQPEVHEIDQDPEGLEMERYLARLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                   VPAVFIGG+L+GSTNEVM
Sbjct  62   ----TGPVPAVFIGGNLVGSTNEVM  82



>ref|XP_006359428.1| PREDICTED: monothiol glutaredoxin-S9-like [Solanum tuberosum]
Length=106

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV+R+T ++GVVIFSK+TCCL YAV ILFQ+L V P V  ID + DGKE+EKAL+ +  
Sbjct  2    EKVQRMTREHGVVIFSKSTCCLSYAVSILFQDLGVIPYVCEIDHESDGKEMEKALIRM--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQ  490
            G N++ + PA+FIGG L+GSTNEVMSLHL GSL++L+KPY  
Sbjct  60   GVNSSFMFPAIFIGGLLVGSTNEVMSLHLQGSLIKLIKPYMS  101



>gb|EYU40529.1| hypothetical protein MIMGU_mgv1a015649mg [Erythranthe guttata]
Length=150

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 84/107 (79%), Gaps = 5/107 (5%)
 Frame = +2

Query  170  NIKMADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDP-DGKEIEKA  346
            N +  +KV +L ++NG++IFSK+TCCLCYAV +LF+EL   P ++ ID DP +GK+IEKA
Sbjct  44   NKQEMEKVVKLASENGILIFSKSTCCLCYAVQMLFKELGANPSIYEIDHDPAEGKDIEKA  103

Query  347  LLALGCGTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQ  487
            L+ +GC    +  +PAVF+ G L+GSTNEVMSLHLSGSL+ LLKPYQ
Sbjct  104  LMRMGC----SGPLPAVFVSGKLVGSTNEVMSLHLSGSLIPLLKPYQ  146



>gb|AFK47066.1| unknown [Lotus japonicus]
Length=104

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 78/100 (78%), Gaps = 4/100 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV R+ ++ GVVIF+K++CC+CYAV ILF EL V P V+ ID DP+GKE+E+A+  +GC
Sbjct  2    EKVLRMASEKGVVIFTKSSCCMCYAVKILFHELGVIPVVYEIDKDPEGKEMERAITRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPY  484
                 A VPAVFI G L+GSTNEV+SLHLSGSL  LLKPY
Sbjct  62   ----TAPVPAVFIAGKLVGSTNEVLSLHLSGSLNPLLKPY  97



>emb|CAJ38362.1| glutaredoxin [Plantago major]
Length=102

 Score =   107 bits (266),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 66/85 (78%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV ++ ++NG+VIFSK+TCCL Y V +LFQ+L   P +H +D DP+GKE+EKAL+ +GC
Sbjct  2    EKVLQMASENGIVIFSKSTCCLSYTVQMLFQQLGTHPCIHDLDHDPEGKEVEKALMRMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
            G      VPAVFI G+L+GSTNEVM
Sbjct  62   G----GPVPAVFIDGNLVGSTNEVM  82



>ref|XP_004139878.1| PREDICTED: monothiol glutaredoxin-S9-like [Cucumis sativus]
 ref|XP_004159058.1| PREDICTED: monothiol glutaredoxin-S9-like [Cucumis sativus]
 ref|XP_008447177.1| PREDICTED: glutaredoxin-C13-like [Cucumis melo]
 gb|KGN44219.1| hypothetical protein Csa_7G230940 [Cucumis sativus]
Length=105

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 4/106 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL-G  361
            +KV RL A+N V+I SK++CCLCYAV +L ++L V P V+ +D DP+G+++EKAL+ L G
Sbjct  2    EKVNRLAAENEVLIISKSSCCLCYAVSVLLRDLGVSPMVYELDQDPEGRDMEKALVRLQG  61

Query  362  CGTNNNAVVPAVFIGGHLIGSTNEVMslhlsgsllqllKPYQQLHH  499
            C   N   VPAVFI G L+GSTNE+MSLHLSG L ++LKPY+ +  
Sbjct  62   C---NTPPVPAVFIAGDLVGSTNELMSLHLSGDLNRMLKPYKAVQE  104



>emb|CDY71728.1| BnaC04g56450D [Brassica napus]
Length=142

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 4/79 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV R++++ GVVIFSK++CC+ YAV +LFQ+L V P VH ID DPD +EIEKAL+ LGC
Sbjct  2    DKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPDCREIEKALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIG  421
             T     VPAVF+GG L+ 
Sbjct  62   STP----VPAVFVGGKLVA  76



>ref|XP_010036905.1| PREDICTED: monothiol glutaredoxin-S10-like [Eucalyptus grandis]
 gb|KCW84426.1| hypothetical protein EUGRSUZ_B01274 [Eucalyptus grandis]
Length=102

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV RL +   VVIFSK++CC+C+A+  LF +  V P +H +D DP G+E+E+AL+ LGC
Sbjct  2    DKVARLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIHELDEDPRGREMERALIRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N VM
Sbjct  62   ----NPAVPAVFIGGKFVGSANAVM  82



>ref|XP_010024634.1| PREDICTED: monothiol glutaredoxin-S10-like [Eucalyptus grandis]
Length=102

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK+TCC+C+AV  LF EL V P ++ +D D  GKE+E+AL  LGC
Sbjct  2    DRVAKLASQKAVVIFSKSTCCMCHAVKSLFYELGVSPAIYELDEDSRGKEMERALARLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG  +GS N VM
Sbjct  62   ----SPAVPAVFIGGKFVGSANTVM  82



>ref|XP_010241661.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=102

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V  L +   VVIFSK++CC+C+A+  LF +    P V+ IDLDP G+EIE+ALL LGC
Sbjct  2    ERVVALASQMPVVIFSKSSCCMCHAIKTLFSDYGASPVVYEIDLDPRGREIERALLGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVFIGG L+G  NEVM
Sbjct  62   KPS----VPAVFIGGKLVGGANEVM  82



>ref|XP_010241681.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=103

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALL-ALG  361
            +KV +L +   VVIFSK++CC+C+ +  LF +L V P V+ +D DP GKEIEKALL  LG
Sbjct  2    EKVMKLVSQKPVVIFSKSSCCMCHTIKTLFCDLGVNPAVYELDEDPQGKEIEKALLRLLG  61

Query  362  CGTNNNAVVPAVFIGGHLIGSTNEVM  439
            C    N  VPAVF+GG+L+G  NEVM
Sbjct  62   C----NPAVPAVFVGGNLVGGANEVM  83



>ref|XP_010243566.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=102

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V +L +   VVIFSK++CC+C+ +  LF +  V P V+ +D DP G+E+EKALL LGC
Sbjct  2    ERVMKLASQRAVVIFSKSSCCICHTIKTLFSDFGVSPTVYELDEDPRGRELEKALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+G   EVM
Sbjct  62   ----NPSVPAVFIGGKLVGGAKEVM  82



>ref|XP_010273480.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=104

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V  L ++  VVIFS+++CC+C+ V  LF +  V P ++ +DLDP G+EIE+ALL LGC
Sbjct  2    DRVLALASEAPVVIFSQSSCCMCHTVKTLFYDYGVNPAIYELDLDPRGREIERALLKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+G   EVM
Sbjct  62   ----NPSVPAVFIGGRLVGGAREVM  82



>ref|XP_011033600.1| PREDICTED: glutaredoxin-C11 [Populus euphratica]
Length=102

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKVR L + N  VIF+K++CC+C+++  LF EL   P +H +D + +GKE+E+AL  LGC
Sbjct  2    DKVRDLASRNAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDREANGKEMERALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPTVPAVFIGGKWVGSAKDVL  82



>ref|XP_009138702.1| PREDICTED: glutaredoxin-C11 [Brassica rapa]
 emb|CDX89161.1| BnaA04g00250D [Brassica napus]
Length=103

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++R L++    VIF+K++CC+C+++  LF EL   P +H +D DP+G+E+E+AL ALG 
Sbjct  2    ERIRDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              ++N  VPAVF+GG  IGS+ +++
Sbjct  61   --SSNPAVPAVFVGGRYIGSSKDII  83



>ref|XP_006402323.1| hypothetical protein EUTSA_v10006329mg [Eutrema salsugineum]
 gb|ESQ43776.1| hypothetical protein EUTSA_v10006329mg [Eutrema salsugineum]
Length=103

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +K+R L++    VIF+K++CC+C+++  LF EL   P +H +D DP+G+E+E+AL ALG 
Sbjct  2    EKIRDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              ++N  VPA+F+GG  IGS  +++
Sbjct  61   --SSNPAVPAIFVGGRYIGSAKDII  83



>ref|XP_011071468.1| PREDICTED: monothiol glutaredoxin-S10-like [Sesamum indicum]
Length=102

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V ++ +   VVIFSK++CC+C+A+  LF E  V P VH ID D  GK+IE AL  LGC
Sbjct  2    DRVAKIVSQKAVVIFSKSSCCMCHAIKRLFYEQGVSPLVHEIDEDSRGKDIEWALTKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L+GS N VM
Sbjct  62   ----SPAVPAVFIGGKLVGSANTVM  82



>ref|XP_010468903.1| PREDICTED: glutaredoxin-C11-like [Camelina sativa]
Length=103

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++R L++    VIF+K++CC+C+++  LF EL   P +H +D DP+G+E+E+AL ALG 
Sbjct  2    ERIRDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              ++N  VPAVF+GG  IGS  +++
Sbjct  61   --SSNPAVPAVFVGGRYIGSAKDII  83



>gb|KFK35470.1| hypothetical protein AALP_AA5G288300 [Arabis alpina]
Length=103

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++R L++    VIF+K++CC+C+++  LF EL   P +H +D DP+G+E+E+AL ALG 
Sbjct  2    ERIRDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              ++N  VPAVF+GG  IGS  +++
Sbjct  61   --SSNPAVPAVFVGGRYIGSAKDII  83



>ref|NP_191854.1| glutaredoxin-C11 [Arabidopsis thaliana]
 ref|XP_002876696.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010512693.1| PREDICTED: glutaredoxin-C11 [Camelina sativa]
 sp|Q9LYC6.1|GRC11_ARATH RecName: Full=Glutaredoxin-C11; Short=AtGrxC11; AltName: Full=Protein 
ROXY 4 [Arabidopsis thaliana]
 emb|CAB87740.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|AAT71932.1| At3g62950 [Arabidopsis thaliana]
 gb|AAU15146.1| At3g62950 [Arabidopsis thaliana]
 gb|ACO50409.1| glutaredoxin [Arabidopsis thaliana]
 gb|EFH52955.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE80416.1| glutaredoxin-C11 [Arabidopsis thaliana]
Length=103

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++R L++    VIF+K++CC+C+++  LF EL   P +H +D DP+G+E+E+AL ALG 
Sbjct  2    ERIRDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              ++N  VPAVF+GG  IGS  +++
Sbjct  61   --SSNPAVPAVFVGGRYIGSAKDII  83



>ref|XP_002320360.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE98675.1| glutaredoxin family protein [Populus trichocarpa]
Length=102

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKVR L + N  VIF+K++CC+C+++  LF EL   P +H +D + +GKE+E AL  LGC
Sbjct  2    DKVRDLASRNAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDREANGKEMEWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPTVPAVFIGGKWVGSAKDVL  82



>gb|AFK39077.1| unknown [Lotus japonicus]
Length=102

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V  L ++  VVIFSK+TCC+C+ +  LF +  V P VH ID  P G++IE+AL  LGC
Sbjct  2    DRVTTLASERSVVIFSKSTCCMCHTIITLFSDFGVNPTVHEIDEMPRGRDIEQALSRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L+G  NEVM
Sbjct  62   ----SPAVPAVFIGGELVGGANEVM  82



>ref|XP_009419009.1| PREDICTED: putative glutaredoxin-C14 [Musa acuminata subsp. malaccensis]
Length=103

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV +L +   VVIFS+++CC CY+V  LF EL V   VH +D DP G E+EKAL+ L  
Sbjct  2    DKVTKLASQRAVVIFSRSSCCFCYSVKSLFHELGVNAAVHELDEDPRGAEMEKALVKL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                 + VPAVFIGG L+GST+ +M
Sbjct  60   -LGRKSPVPAVFIGGKLVGSTDRIM  83



>ref|XP_002275384.1| PREDICTED: monothiol glutaredoxin-S2 [Vitis vinifera]
 emb|CBI26100.3| unnamed protein product [Vitis vinifera]
Length=103

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            M   V RL ++  VVIFSK++CC+C+ +  LF +  V P VH +D  P G+EIE+AL  L
Sbjct  1    MERAVARLASERPVVIFSKSSCCMCHTIKTLFSDFGVNPAVHELDEMPRGREIEQALARL  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            GC    N  VP VFIGG  +G TNE+M
Sbjct  61   GC----NPTVPTVFIGGERVGGTNEIM  83



>ref|XP_011016037.1| PREDICTED: monothiol glutaredoxin-S10 [Populus euphratica]
Length=102

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+C+A+  LF E  V P ++ +D D  GKE+E AL+ LGC
Sbjct  2    DRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDSRGKEMEWALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +G+ N VM
Sbjct  62   ----NPSVPAVFIGGKFVGTANTVM  82



>gb|KDP40012.1| hypothetical protein JCGZ_02010 [Jatropha curcas]
Length=102

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L     VVIFSK++CC+C+A+  LF E  V P ++ +D D  GKE+E ALL LGC
Sbjct  2    DRVAKLAGQKAVVIFSKSSCCMCHAIKRLFYEQAVSPAIYELDEDSRGKEMECALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N VM
Sbjct  62   ----NPSVPAVFIGGKFVGSANTVM  82



>ref|XP_004492160.1| PREDICTED: glutaredoxin-C3-like [Cicer arietinum]
Length=133

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ RL ++N VVIFS +TCC+C+A+  LF  + V P VH +D DP G E+E+AL+ L  
Sbjct  32   ERIERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVHELDEDPRGNELERALMRL-I  90

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
            GTNN  VVP VFIGG LIG+ + VM
Sbjct  91   GTNN--VVPVVFIGGQLIGTMDRVM  113



>ref|XP_010272731.1| PREDICTED: monothiol glutaredoxin-S2-like [Nelumbo nucifera]
Length=104

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V  L     VVIFSK++CC+C+ V  LF E    P +  +DLDP G+E+E+ALL LGC
Sbjct  2    DRVIGLAKYAPVVIFSKSSCCMCHTVKTLFYEYGANPTIFELDLDPRGREMERALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VP VFIGG LIG TNEVM
Sbjct  62   SPS----VPTVFIGGRLIGGTNEVM  82



>ref|XP_007050807.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOX94964.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=102

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKVR L +    VIF+K++CC+CY++  LF EL   P +H +D DP G+++E AL  LGC
Sbjct  2    DKVRDLASKKAAVIFTKSSCCMCYSIKTLFYELGASPAIHELDHDPSGRDMEWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG  +GS  +V+
Sbjct  62   ----DPSVPAVFIGGRFVGSAKDVI  82



>ref|XP_010098329.1| Monothiol glutaredoxin-S10 [Morus notabilis]
 gb|EXB74833.1| Monothiol glutaredoxin-S10 [Morus notabilis]
Length=102

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+ +A+  LF E  V P V+ ID D  GKE+E AL+ LGC
Sbjct  2    DRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAVYEIDEDSRGKEMEWALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG+ +GS N +M
Sbjct  62   ----NPAVPAVFIGGNFVGSANTIM  82



>ref|XP_006444243.1| hypothetical protein CICLE_v10023999mg [Citrus clementina]
 ref|XP_006479883.1| PREDICTED: glutaredoxin-C11-like [Citrus sinensis]
 gb|ESR57483.1| hypothetical protein CICLE_v10023999mg [Citrus clementina]
 gb|KDO87380.1| hypothetical protein CISIN_1g037937mg [Citrus sinensis]
Length=102

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+VR L +    VIF+K++CC+C+++  LF EL   P +H +D D +G+EIE AL ALGC
Sbjct  2    DRVRDLASKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDQDANGREIEWALRALGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPSVPAVFIGGRYVGSAKDVI  82



>ref|XP_003593970.1| Monothiol glutaredoxin-S2 [Medicago truncatula]
 gb|AES64221.1| monothiol glutaredoxin-S2 protein [Medicago truncatula]
Length=102

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V +L ++  VVIFSK++CC+C+ +  LF +  V P VH +D    G++IE+ALL LGC
Sbjct  2    ERVTQLASERSVVIFSKSSCCMCHTIKTLFSDFGVNPEVHELDEMSGGRDIEQALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+G  NEVM
Sbjct  62   ----NPSVPAVFIGGELVGGANEVM  82



>ref|XP_011009412.1| PREDICTED: glutaredoxin-C11-like [Populus euphratica]
Length=102

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V  L + N  VIF+K++CC+CY++  LF EL   P +H +D + +G+E+E AL  LGC
Sbjct  2    DQVTDLASKNAAVIFTKSSCCMCYSIKTLFYELGASPAIHELDREANGREMEWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N +VPAVFIGG  +GS  +V+
Sbjct  62   ----NPIVPAVFIGGKWVGSAKDVL  82



>ref|XP_006380203.1| hypothetical protein POPTR_0008s22890g [Populus trichocarpa]
 gb|ERP58000.1| hypothetical protein POPTR_0008s22890g [Populus trichocarpa]
Length=102

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+C+A+  LF +  V P ++ +D D  GKE+E AL+ LGC
Sbjct  2    DRVAKLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIYELDEDSRGKEMEWALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N VM
Sbjct  62   ----NPSVPAVFIGGKFVGSANTVM  82



>gb|EYU45573.1| hypothetical protein MIMGU_mgv1a019538mg [Erythranthe guttata]
Length=103

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D++  +++   VVIFSK++CC+C+A+  LF +  V P +H +D D  GKE+E AL+ LGC
Sbjct  2    DRIANISSQKAVVIFSKSSCCMCHAIKRLFYDQGVSPLIHELDEDSRGKEMEWALMKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +   VPAVFIGG L+GS N VM
Sbjct  62   ---SGPTVPAVFIGGKLVGSANTVM  83



>gb|AFK35832.1| unknown [Medicago truncatula]
Length=124

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ RL ++N VVIFS +TCC+C+A+  LF  + V P VH +D DP GKE+E+AL+ L  
Sbjct  23   ERIERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPAVHELDEDPRGKELERALMRL-L  81

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
            GT+N  VVP VFIGG LIG+ + VM
Sbjct  82   GTSN--VVPVVFIGGKLIGTMDRVM  104



>ref|XP_006419643.1| hypothetical protein CICLE_v10006590mg [Citrus clementina]
 ref|XP_006489133.1| PREDICTED: monothiol glutaredoxin-S10-like [Citrus sinensis]
 gb|ESR32883.1| hypothetical protein CICLE_v10006590mg [Citrus clementina]
 gb|KDO75112.1| hypothetical protein CISIN_1g034165mg [Citrus sinensis]
Length=102

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V RL +   VVIFSK++CC+C+A+  LF +  V P ++ +D D  GKE+E AL+ LGC
Sbjct  2    DRVGRLASQKAVVIFSKSSCCMCHAIKRLFYDQGVSPAIYELDEDARGKEMEWALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N VM
Sbjct  62   ----NPSVPAVFIGGKFVGSANTVM  82



>ref|XP_010649773.1| PREDICTED: monothiol glutaredoxin-S10 [Vitis vinifera]
 emb|CBI26101.3| unnamed protein product [Vitis vinifera]
Length=102

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+ +A+  LF E  V P +H +D D  GKE+E AL+ LGC
Sbjct  2    DRVGKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIHELDEDSRGKEMEWALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N VM
Sbjct  62   ----NPSVPAVFIGGKFVGSANTVM  82



>ref|XP_008674047.1| PREDICTED: glutaredoxin-C1 [Zea mays]
 tpg|DAA54578.1| TPA: hypothetical protein ZEAMMB73_315594 [Zea mays]
Length=103

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFS ++CC+C+ V  LF+EL V P V  +D DP GKE+EKAL  L  
Sbjct  2    DRVTKLASQRAVVIFSTSSCCMCHTVTRLFRELGVNPTVVELDEDPRGKEMEKALARL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+GST++VM
Sbjct  60   -LGRNPAVPAVFIGGRLVGSTDKVM  83



>ref|XP_007035504.1| Glutaredoxin family protein [Theobroma cacao]
 gb|EOY06430.1| Glutaredoxin family protein [Theobroma cacao]
Length=102

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+C+A+  LF E  V P ++ +D D  GKE+E AL+ LGC
Sbjct  2    DRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDARGKEMEWALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N +M
Sbjct  62   ----NPPVPAVFIGGKFVGSANTIM  82



>ref|XP_010024635.1| PREDICTED: monothiol glutaredoxin-S2-like [Eucalyptus grandis]
Length=102

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ R+  +  VVIFS+++CC+C+ + +LF+E  V P VH +D  P G+EIE+AL  LG 
Sbjct  2    ERINRMVLERPVVIFSRSSCCMCHTIKMLFREFGVNPVVHELDEIPRGREIEQALSRLG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L+G TNEVM
Sbjct  61   ---RSPAVPAVFIGGELVGGTNEVM  82



>ref|XP_010024181.1| PREDICTED: glutaredoxin-C1 [Eucalyptus grandis]
 gb|KCW60633.1| hypothetical protein EUGRSUZ_H03357 [Eucalyptus grandis]
Length=126

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ R+ A++ VVIFS +TCC+C+AV  LF  + V P VH +D DP GKE+EKAL  L  
Sbjct  23   ERIERMAAESAVVIFSVSTCCMCHAVKSLFCGMGVNPTVHELDHDPRGKELEKALARLS-  81

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
            G   +A VP VFIGG L+G+ + VM
Sbjct  82   GAPPSAAVPVVFIGGKLVGAMDRVM  106



>ref|XP_006389678.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP48592.1| glutaredoxin family protein [Populus trichocarpa]
Length=102

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+VR L + N  VIF+K++CC+C+++  LF EL   P +H +D + +G+E+E AL  LGC
Sbjct  2    DQVRDLASKNAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDREANGREMEWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPTVPAVFIGGKWVGSAKDVL  82



>ref|XP_011071467.1| PREDICTED: monothiol glutaredoxin-S10-like [Sesamum indicum]
Length=102

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            + V +L +   VVIFSK+TCC+C+A+  LF E  V P V+ ID  P+G+E E+AL+ LGC
Sbjct  2    ETVMKLASQKAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYEIDEQPNGRETERALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG  +GS N ++
Sbjct  62   ----SPTVPAVFIGGKFVGSANNIL  82



>ref|XP_004962839.1| PREDICTED: putative glutaredoxin-C14-like [Setaria italica]
Length=105

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 59/87 (68%), Gaps = 2/87 (2%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            MAD+V +L ++  VV+F+ ++CC+C+ V  L Q+L V   VH +D DP GKE+E+ALL +
Sbjct  1    MADRVMKLASERAVVVFTLSSCCMCHTVTKLMQDLSVNALVHELDSDPRGKEMERALLKM  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVM  439
              G      VPAVFIGG L+G TN +M
Sbjct  61   LGG--RGPAVPAVFIGGKLVGGTNRIM  85



>ref|XP_010243565.1| PREDICTED: monothiol glutaredoxin-S2 [Nelumbo nucifera]
Length=102

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V  L + + VVIFSK++CC+C+ +  L  +    P V+ +DLDP G+EIE+AL+ LGC
Sbjct  2    ERVTSLASQSPVVIFSKSSCCMCHTIKTLISDYGASPTVYELDLDPRGREIERALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVFIGG L+G  NEVM
Sbjct  62   KPS----VPAVFIGGRLVGGANEVM  82



>ref|XP_011082491.1| PREDICTED: glutaredoxin-C11-like [Sesamum indicum]
Length=102

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            + VR L +    VIF+K++CC+C+++  LF EL   P VH +D D +G+EIE AL +LGC
Sbjct  2    EMVRELASKKAAVIFTKSSCCMCHSIKALFYELGASPTVHELDQDANGREIEWALRSLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPAVPAVFIGGQFVGSAKDVI  82



>ref|XP_006359427.1| PREDICTED: glutaredoxin-C11-like [Solanum tuberosum]
Length=102

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DK+R L++    VIF+K++CC+C+++  LF EL   P +H +D D  G E+  AL +LGC
Sbjct  2    DKIRDLSSKRAAVIFTKSSCCMCHSIKALFYELGASPAIHELDQDSRGNEMALALRSLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPA+FIGGH +GST +V+
Sbjct  62   ----NPCVPAIFIGGHFVGSTKDVI  82



>ref|XP_003546092.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
Length=102

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V ++ ++  VVIFS+++CC+C+ +  LF +  V P VH +D  P GK+IE+AL  LGC
Sbjct  2    DRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGKDIEQALSRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVFIGG L+G  NEVM
Sbjct  62   SPS----VPAVFIGGELVGGANEVM  82



>ref|XP_002516882.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF45496.1| glutaredoxin, grx, putative [Ricinus communis]
Length=102

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+C+A+  LF E  V P ++ +D D  G E+E AL+ LGC
Sbjct  2    DRVAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPAIYELDEDSRGTEMEWALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N +M
Sbjct  62   ----NPSVPAVFIGGKFVGSANTIM  82



>ref|XP_010545041.1| PREDICTED: glutaredoxin-C11 [Tarenaya hassleriana]
Length=102

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DK+R L       IF+K++CC+C+++  LF EL   P +H +D DP+G+E+E+AL ALG 
Sbjct  2    DKIRDLAGKKAAGIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +N  VPAVF+GG  +GS  +++
Sbjct  61   ---SNPTVPAVFVGGRYVGSAKDII  82



>ref|NP_001043047.1| Os01g0368900 [Oryza sativa Japonica Group]
 sp|Q7G8Y5.1|GRXC1_ORYSJ RecName: Full=Glutaredoxin-C1 [Oryza sativa Japonica Group]
 gb|AAK53837.1|AC011806_14 Putative glutaredoxin [Oryza sativa]
 dbj|BAB64731.1| glutaredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAB64761.1| P0560B06.28 [Oryza sativa Japonica Group]
 dbj|BAD88356.1| glutaredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAD89485.1| putative glutaredoxin 1 [Oryza sativa Japonica Group]
 dbj|BAF04961.1| Os01g0368900 [Oryza sativa Japonica Group]
 gb|EAY74062.1| hypothetical protein OsI_01950 [Oryza sativa Indica Group]
 gb|EAZ11913.1| hypothetical protein OsJ_01785 [Oryza sativa Japonica Group]
Length=103

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V RL A   VVIFS ++CC+C+ V  LF EL V P V  +D DP GKE+EKAL  L  
Sbjct  2    DRVNRLAAQRAVVIFSMSSCCMCHTVTRLFCELGVNPTVVELDEDPRGKEMEKALARL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L+GST++VM
Sbjct  60   -LGRSPAVPAVFIGGRLVGSTDKVM  83



>gb|KCW84427.1| hypothetical protein EUGRSUZ_B01275 [Eucalyptus grandis]
Length=90

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            M D V +++++  VVIFSK++CC+C+ +  L  +    P VH +D  P GKEIE+AL+  
Sbjct  1    MEDLVAKMSSEKPVVIFSKSSCCMCHTIKTLLCDFGANPTVHELDEIPRGKEIEQALVRR  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            GC    N  VPAVFIGG L+G  NEVM
Sbjct  61   GC----NPAVPAVFIGGQLVGGANEVM  83



>ref|XP_008222218.1| PREDICTED: glutaredoxin-C1-like [Prunus mume]
Length=127

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = +2

Query  164  YINIKMA-----DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDG  328
            Y+ ++M+     ++V RL A + VVIFS ++CC+C+AV  LF  + V P V+ +D DP G
Sbjct  14   YVPVRMSMGDPLERVARLAAKSAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDQDPRG  73

Query  329  KEIEKALLALGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            KEIE+AL+ L     N+  VP VFIGG LIG+ + VM
Sbjct  74   KEIERALMRL---LGNSPAVPVVFIGGKLIGTMDRVM  107



>ref|XP_009414476.1| PREDICTED: putative glutaredoxin-C14 [Musa acuminata subsp. malaccensis]
Length=103

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DKV +L +   VV+FS++ CC CY+V  LF EL V   VH +D DP G E+EKAL  L  
Sbjct  2    DKVMKLASQRAVVVFSRSNCCFCYSVKSLFHELGVSAAVHELDEDPSGPEMEKALARL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                   VPAVFIGG L+GST ++M
Sbjct  60   -LGRKPPVPAVFIGGQLVGSTEKIM  83



>ref|XP_002455626.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
 gb|EES00746.1| hypothetical protein SORBIDRAFT_03g014800 [Sorghum bicolor]
Length=103

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFS ++CC+C+ V  LF+EL V P V  +D DP GKE++KAL  L  
Sbjct  2    DRVTKLASQRAVVIFSTSSCCMCHTVTRLFRELGVNPTVVELDQDPRGKEMDKALARL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+GST+ VM
Sbjct  60   -LGRNPAVPAVFIGGRLVGSTDRVM  83



>ref|XP_007227610.1| hypothetical protein PRUPE_ppa021177mg [Prunus persica]
 gb|EMJ28809.1| hypothetical protein PRUPE_ppa021177mg [Prunus persica]
Length=126

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = +2

Query  164  YINIKMA-----DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDG  328
            Y+ ++M+     ++V RL A + VVIFS ++CC+C+AV  LF  + V P V+ +D DP G
Sbjct  13   YVPVRMSMGDPLERVARLAAKSAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDQDPRG  72

Query  329  KEIEKALLALGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            KEIE+AL+ L     N+  VP VFIGG LIG+ + VM
Sbjct  73   KEIERALMRL---LGNSPAVPVVFIGGKLIGTMDRVM  106



>ref|XP_009411702.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
Length=103

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+VRRL +   VV+FS ++CC+C+ +  LF EL V P VH +D DP GK++E+AL  +  
Sbjct  2    DRVRRLASQRAVVVFSLSSCCMCHTIKRLFCELGVNPAVHELDEDPKGKDMERALANM--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG+L+G T+EVM
Sbjct  60   -LGRSPPVPAVFIGGNLVGPTDEVM  83



>emb|CDP03538.1| unnamed protein product [Coffea canephora]
Length=102

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D +R L +    VIF+K++CC+C+++  LF EL   P VH +D D  G+E+E+AL +LGC
Sbjct  2    DTIRDLASKKAAVIFTKSSCCMCHSIKALFYELGASPAVHELDHDASGREMERALRSLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPAVPAVFIGGEFVGSAKDVI  82



>ref|XP_004148005.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
 ref|XP_004161507.1| PREDICTED: glutaredoxin-C1-like [Cucumis sativus]
 gb|KGN58154.1| hypothetical protein Csa_3G563270 [Cucumis sativus]
Length=127

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +2

Query  188  KVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGCG  367
            ++ R+ A+N VV+FS T+CC+C+AV  LF  + V+  V+ +D DP GKEIEKAL+ L   
Sbjct  27   RIERMAAENAVVMFSMTSCCMCHAVKRLFCGMGVKTTVYELDEDPRGKEIEKALMRL---  83

Query  368  TNNNAVVPAVFIGGHLIGSTNEVM  439
              +++ VPAVFIGG LIGS + VM
Sbjct  84   MGSSSAVPAVFIGGKLIGSMDRVM  107



>emb|CAN67225.1| hypothetical protein VITISV_043905 [Vitis vinifera]
 emb|CBI38163.3| unnamed protein product [Vitis vinifera]
Length=107

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL ++N VVIFS ++CC+C+AV  LF  + V P V+ +D DP GKEIE+AL+ L  
Sbjct  6    ERVARLASENAVVIFSLSSCCMCHAVKRLFCGMGVNPTVYELDQDPRGKEIERALMRL--  63

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               N+  VP VFIGG L+GS + VM
Sbjct  64   -LGNSPAVPVVFIGGKLVGSMDSVM  87



>ref|XP_008450140.1| PREDICTED: glutaredoxin-C1-like [Cucumis melo]
Length=127

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +2

Query  188  KVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGCG  367
            ++ R+ A+N VV+FS T+CC+C+AV  LF  + V+  V+ +D DP GKEIEKAL+ L   
Sbjct  27   RIERMAAENAVVMFSMTSCCMCHAVKRLFCGMGVKTTVYELDEDPRGKEIEKALMRL---  83

Query  368  TNNNAVVPAVFIGGHLIGSTNEVM  439
              +++ VPAVFIGG LIGS + VM
Sbjct  84   MGSSSAVPAVFIGGKLIGSMDRVM  107



>ref|XP_003567688.1| PREDICTED: glutaredoxin-C1 [Brachypodium distachyon]
Length=103

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L     VVIFS ++CC+C++V  LF+EL V P V  +D DP GKE++KAL+ L  
Sbjct  2    DRVTKLAGQRAVVIFSMSSCCMCHSVMRLFRELGVNPTVVELDEDPRGKEMDKALVRL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+GST++VM
Sbjct  60   -LGRNPAVPAVFIGGRLVGSTDKVM  83



>gb|ACJ83991.1| unknown [Medicago truncatula]
 gb|AFK46546.1| unknown [Medicago truncatula]
Length=102

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V +L ++  VVIFSK++CC+C+ +  LF +  V P VH +D    G++ E+ALL LGC
Sbjct  2    ERVTQLASERSVVIFSKSSCCMCHTIKTLFSDFGVNPEVHELDEMSGGRDTEQALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+G  NEVM
Sbjct  62   ----NPSVPAVFIGGELVGGANEVM  82



>ref|XP_008799330.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=103

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V RL +   VV+FS +TCC+C+ V  LF EL V P VH +D DP GKE+E AL  L  
Sbjct  2    DRVMRLASQRAVVVFSLSTCCMCHTVKRLFCELGVNPSVHEVDEDPRGKEMEMALAKL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VP VFIGG LIGST++VM
Sbjct  60   -MGRSPPVPVVFIGGKLIGSTDKVM  83



>ref|XP_009116963.1| PREDICTED: glutaredoxin-C11-like [Brassica rapa]
 emb|CDY11464.1| BnaA09g40300D [Brassica napus]
 emb|CDY11465.1| BnaA09g40310D [Brassica napus]
 emb|CDX76677.1| BnaC08g32630D [Brassica napus]
Length=103

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++R L++    VIF+K++CC+C+++  LF EL   P +H +D D +G+E+E+AL ALG 
Sbjct  2    ERIRDLSSKTAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDSEGREMERALRALG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              ++N  VPAVF+GG  IGS  +++
Sbjct  61   --SSNPAVPAVFVGGRYIGSAKDII  83



>gb|KCW61086.1| hypothetical protein EUGRSUZ_H03860 [Eucalyptus grandis]
Length=162

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ R+  +  VVIFS+++CC+C+ + +LF+E  V P VH +D  P G+EIE+AL  LG 
Sbjct  62   ERINRMVLERPVVIFSRSSCCMCHTIKMLFREFGVNPVVHELDEIPRGREIEQALSRLG-  120

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L+G TNEVM
Sbjct  121  ---RSPAVPAVFIGGELVGGTNEVM  142



>ref|XP_010098332.1| Monothiol glutaredoxin-S2 [Morus notabilis]
 gb|EXB74836.1| Monothiol glutaredoxin-S2 [Morus notabilis]
Length=102

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V ++ ++  VVIFS++TCC+C+ +  LF +  V P V+ +D +P G+EIE+AL  LGC
Sbjct  2    ERVTKMVSEKPVVIFSRSTCCMCHTIKTLFCDFGVNPAVYELDEEPRGREIEQALSMLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L+G  NEVM
Sbjct  62   ----SPTVPAVFIGGELVGGANEVM  82



>ref|XP_009382560.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
Length=103

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 5/86 (6%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALL-ALG  361
            D+V RL +   VV+FS ++CC+C+ +  LF EL V P +H +D DP+GK++E+AL   LG
Sbjct  2    DRVMRLASQRAVVVFSLSSCCMCHTIKRLFCELGVNPGIHELDEDPNGKDMERALARMLG  61

Query  362  CGTNNNAVVPAVFIGGHLIGSTNEVM  439
            C    N+ VPAVFIGG+L+G T++VM
Sbjct  62   C----NSPVPAVFIGGNLVGPTDKVM  83



>ref|XP_002264542.2| PREDICTED: glutaredoxin-C1-like [Vitis vinifera]
Length=131

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL ++N VVIFS ++CC+C+AV  LF  + V P V+ +D DP GKEIE+AL+ L  
Sbjct  30   ERVARLASENAVVIFSLSSCCMCHAVKRLFCGMGVNPTVYELDQDPRGKEIERALMRL--  87

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               N+  VP VFIGG L+GS + VM
Sbjct  88   -LGNSPAVPVVFIGGKLVGSMDSVM  111



>ref|XP_009607405.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana tomentosiformis]
 ref|XP_009782550.1| PREDICTED: monothiol glutaredoxin-S10 [Nicotiana sylvestris]
Length=102

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V ++ +   VVIFSK++CC+C+A+  LF E  V P ++ +D D +G+E+E++LL LGC
Sbjct  2    DRVVKVASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYELDEDINGREMERSLLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG  +GS N VM
Sbjct  62   ----SPAVPAVFIGGRFVGSANTVM  82



>ref|XP_010250605.1| PREDICTED: glutaredoxin-C1-like [Nelumbo nucifera]
Length=123

 Score = 88.6 bits (218),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL ++N VVIFS +TCC+C+A+  LF  + V P V+ +D DP GKEIEKAL+ L  
Sbjct  22   ERVERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVYELDEDPRGKEIEKALMRL--  79

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +++ VP VFIGG L+G+ + VM
Sbjct  80   -LGSSSAVPVVFIGGKLVGAMDRVM  103



>ref|XP_002315567.1| glutaredoxin family protein [Populus trichocarpa]
 gb|EEF01738.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 5/85 (6%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V +L ++  VVIFSKTTCC+C+ +  LF +  V P VH +D  P G+EIE+AL   GC
Sbjct  2    ERVTKLASERPVVIFSKTTCCMCHTIKTLFCDFGVNPAVHELDEMPRGREIEQALTRAGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
             T     +PAVFIGG ++G  NEVM
Sbjct  62   PT-----LPAVFIGGEIVGGANEVM  81



>ref|NP_001176691.1| Os11g0656801 [Oryza sativa Japonica Group]
 sp|Q0IRB0.2|GRC13_ORYSJ RecName: Full=Glutaredoxin-C13 [Oryza sativa Japonica Group]
 gb|ABA95165.1| Glutaredoxin-like family protein [Oryza sativa Japonica Group]
 dbj|BAH95419.1| Os11g0656801 [Oryza sativa Japonica Group]
Length=109

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-  355
            MA+ V RL ++  VV+F+K+ CC+C AV  L  EL V   VH +D +P GKE+E+ L   
Sbjct  1    MAEMVARLASERAVVVFTKSGCCMCTAVTTLLGELAVSAAVHELDREPLGKEMERELARR  60

Query  356  -LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
              G G      VPAVFIGG L+GST++VM
Sbjct  61   LYGSGGRGGPAVPAVFIGGSLVGSTSKVM  89



>gb|EAZ19162.1| hypothetical protein OsJ_34699 [Oryza sativa Japonica Group]
Length=111

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-  355
            MA+ V RL ++  VV+F+K+ CC+C AV  L  EL V   VH +D +P GKE+E+ L   
Sbjct  1    MAEMVARLASERAVVVFTKSGCCMCTAVTTLLGELAVSAAVHELDREPLGKEMERELARR  60

Query  356  -LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
              G G      VPAVFIGG L+GST++VM
Sbjct  61   LYGSGGRGGPAVPAVFIGGSLVGSTSKVM  89



>gb|KDP28095.1| hypothetical protein JCGZ_13866 [Jatropha curcas]
Length=102

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+VR L +    VIF+K++CC+C+++  LF EL   P +H +D D +G+E+E AL  LGC
Sbjct  2    DRVRDLASTRAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDRDANGREMEWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPSVPAVFIGGKYVGSAKDVL  82



>ref|XP_006292766.1| hypothetical protein CARUB_v10019015mg [Capsella rubella]
 gb|EOA25664.1| hypothetical protein CARUB_v10019015mg [Capsella rubella]
Length=103

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++  L++    VIF+K++CC+C+++  LF EL   P +H +D DP G+E+E+AL A+G 
Sbjct  2    ERISDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPQGREMERALRAIG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              ++N  VPAVF+GG  IGS  +++
Sbjct  61   --SSNPAVPAVFVGGRYIGSAKDII  83



>ref|XP_006844586.1| hypothetical protein AMTR_s00016p00206670 [Amborella trichopoda]
 gb|ERN06261.1| hypothetical protein AMTR_s00016p00206670 [Amborella trichopoda]
Length=113

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL A+N VVIFS ++CC+C+AV  LF  + V P V+ +D DP GKE+EKAL+ L  
Sbjct  12   ERVERLAAENAVVIFSISSCCMCHAVKRLFCGMGVNPTVYELDEDPRGKEMEKALVRL--  69

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               ++  VPAVFIGG LIG  + VM
Sbjct  70   -LGSSQAVPAVFIGGKLIGPMDRVM  93



>ref|XP_003622060.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES78278.1| glutaredoxin-C3-like protein [Medicago truncatula]
Length=301

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ RL ++N VVIFS +TCC+C+A+  LF  + V P VH +D DP GKE+E+AL+ L  
Sbjct  23   ERIERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPAVHELDEDPRGKELERALMRL-L  81

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
            GT+N  VVP VFIGG LIG+ + VM
Sbjct  82   GTSN--VVPVVFIGGKLIGTMDRVM  104



>ref|XP_006342768.1| PREDICTED: monothiol glutaredoxin-S10-like [Solanum tuberosum]
Length=102

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V ++ +   VVIFSK++CC+C+A+  LF E  V P ++ +D D +G+++E++LL LGC
Sbjct  2    DRVVKIASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYELDEDMNGRDMERSLLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG  +GS N VM
Sbjct  62   ----SPAVPAVFIGGRFVGSANTVM  82



>emb|CDP12908.1| unnamed protein product [Coffea canephora]
Length=102

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            + VRRL ++  VVIFSK+ CC+ YA+ +L       P V+ +D  P G+EIE ALL LGC
Sbjct  2    ETVRRLGSEKPVVIFSKSNCCISYAIKVLISSFGANPTVYELDHHPKGREIENALLTLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIG   +G +NEVM
Sbjct  62   ----NPSVPAVFIGKLFVGGSNEVM  82



>ref|XP_004228854.1| PREDICTED: glutaredoxin-C1-like [Solanum lycopersicum]
Length=120

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL + + VVIFS ++CC+C+A+  LF EL V P V+ +D DP+GK +E+AL  L  
Sbjct  19   ERVARLASGSAVVIFSSSSCCMCHAIKRLFCELGVSPMVYELDQDPNGKGMERALYKL--  76

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               N+  VP VFIGG LIGS + VM
Sbjct  77   -LGNSPTVPVVFIGGELIGSMDRVM  100



>ref|XP_006594494.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max]
Length=154

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +2

Query  164  YINIKMADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEK  343
            +I I + D+V ++ ++  VVIFS+++CC+C+ +  LF +  V P VH +D  P G +IE+
Sbjct  47   HIYIYIMDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGNDIEQ  106

Query  344  ALLALGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            AL  LGC  +    VP VFIGG L+G  NEVM
Sbjct  107  ALSRLGCSPS----VPVVFIGGELVGGANEVM  134



>gb|EPS64181.1| glutaredoxin [Genlisea aurea]
Length=102

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = +2

Query  191  VRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGCGT  370
            V++L ++  VVIFSKT+CC+ + +  LF +  V+P+++ ID  P G+EIE+ALL LGC  
Sbjct  4    VKKLASEKPVVIFSKTSCCMSHTIKSLFYDFGVDPKIYEIDEIPRGREIEQALLTLGC--  61

Query  371  NNNAVVPAVFIGGHLIGSTNEVM  439
              +  VPAVFIGG   G  NE+M
Sbjct  62   --DPSVPAVFIGGEFAGGANEIM  82



>ref|XP_010249120.1| PREDICTED: glutaredoxin-C1-like [Nelumbo nucifera]
Length=123

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL ++N VVIFS +TCC+C+A+  LF  + V P V+ +D DP GKE+EKAL+ L  
Sbjct  22   ERVERLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVYELDEDPRGKEMEKALMRL--  79

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +++ VP VFIGG L+G+ + VM
Sbjct  80   -LGSSSAVPVVFIGGKLVGAMDRVM  103



>ref|XP_004247456.1| PREDICTED: glutaredoxin-C11 [Solanum lycopersicum]
Length=102

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            DK+R L++    VIF+K++CC+C+++  LF EL   P +H +D D  G E+  AL +LGC
Sbjct  2    DKIRDLSSKRAAVIFTKSSCCMCHSIKALFYELGASPAIHELDQDSRGNEMALALRSLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPA+FIGG+ IGST +V+
Sbjct  62   ----NPCVPAIFIGGNFIGSTKDVI  82



>ref|XP_010492199.1| PREDICTED: glutaredoxin-C8 [Camelina sativa]
Length=139

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +2

Query  188  KVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL-GC  364
            K+  + A+N VVIFS +TCC+C+A+  LF+ + V P VH +DL P+G EI +ALL L GC
Sbjct  32   KIESMAAENAVVIFSMSTCCMCHAIKRLFRGMGVSPAVHELDLHPNGAEIHRALLRLVGC  91

Query  365  GTNNNAV---VPAVFIGGHLIGSTNEVM  439
             +   A    +P VFIGG ++GS   VM
Sbjct  92   SSGGAATPGGLPVVFIGGKMVGSMERVM  119



>ref|XP_007147880.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris]
 gb|ESW19874.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris]
Length=102

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V ++ ++  VVIFS+++CC+C+ +  LF +  V P VH +D  P G++IE+AL  LGC
Sbjct  2    DRVVQMASERPVVIFSRSSCCMCHTIKTLFNDFGVNPNVHELDEIPRGRDIEQALSRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+G  +EVM
Sbjct  62   ----NPSVPAVFIGGELVGGASEVM  82



>ref|XP_004968750.1| PREDICTED: glutaredoxin-C1-like [Setaria italica]
Length=103

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFS ++CC+C+ V  LF+EL V P V  +D DP GKE+EKAL  L  
Sbjct  2    DRVTKLASQRAVVIFSMSSCCMCHTVTRLFRELGVNPTVVELDEDPRGKEMEKALARL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L GST++VM
Sbjct  60   -LGRSPAVPAVFIGGRLAGSTDKVM  83



>gb|KFK37654.1| hypothetical protein AALP_AA3G011200 [Arabis alpina]
Length=138

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 6/97 (6%)
 Frame = +2

Query  167  INIKMAD----KVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKE  334
            +++ MAD    ++  L +++ VVIFS +TCC+C+AV  LF+ + V P VH +DL P G E
Sbjct  22   VSMSMADTGLLRIESLASESAVVIFSVSTCCMCHAVKGLFRGMGVSPAVHELDLHPYGGE  81

Query  335  IEKALLA-LGC-GTNNNAVVPAVFIGGHLIGSTNEVM  439
            I++AL+  LGC G ++   +P VFIGG L+G+ + VM
Sbjct  82   IQRALIRLLGCSGASSPGALPVVFIGGKLVGAMDRVM  118



>ref|XP_007139286.1| hypothetical protein PHAVU_008G016400g [Phaseolus vulgaris]
 gb|ESW11280.1| hypothetical protein PHAVU_008G016400g [Phaseolus vulgaris]
Length=133

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-LG  361
            ++V RL + + VVIFS ++CC+C+A+  LF  + V P VH +D DP GK++E+AL+  LG
Sbjct  27   ERVLRLASQSAVVIFSVSSCCMCHAMKRLFCGMGVNPTVHELDQDPKGKDMERALMRLLG  86

Query  362  CGTN-NNAVVPAVFIGGHLIGSTNEVM  439
             G N ++AVVP VFIGG L+GS + V+
Sbjct  87   NGINSSSAVVPVVFIGGKLVGSMDRVL  113



>ref|XP_008791106.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
 ref|XP_010929596.1| PREDICTED: glutaredoxin-C1-like [Elaeis guineensis]
Length=128

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL A++ VVIFS +TCC+C+AV  LF+ + V P V+ +D DP GK++E+AL  L  
Sbjct  24   ERVERLAAESAVVIFSVSTCCMCHAVKRLFRGMGVSPTVYELDEDPRGKDMERALARLLG  83

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                   VP VFIGG L+G+ + VM
Sbjct  84   AAGGPPAVPVVFIGGKLVGAMDRVM  108



>ref|XP_009408234.1| PREDICTED: putative glutaredoxin-C14 [Musa acuminata subsp. malaccensis]
Length=103

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL +   V +FS ++CC+CY+V  LF EL V+  +H +D DP G E+E+AL+ L  
Sbjct  2    EKVMRLASQRAVTVFSFSSCCMCYSVKSLFSELGVDAAIHELDEDPSGAEMERALVGL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                   VPA+FIGG L+GST+ +M
Sbjct  60   -LGRKPPVPAIFIGGRLVGSTDRIM  83



>emb|CDM86171.1| unnamed protein product [Triticum aestivum]
Length=104

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            MA++V RL +   VVIF  + CC+C+AV  LF E+ V   VH +D DP GK++E+AL  +
Sbjct  1    MAERVMRLASQRAVVIFGASNCCMCHAVKTLFTEMGVSWTVHELDKDPRGKDVERALAGM  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVM  439
                  N  VPAVFIGG L+G  ++VM
Sbjct  61   ---VGQNPPVPAVFIGGALVGPIDKVM  84



>ref|XP_010241641.1| PREDICTED: monothiol glutaredoxin-S10-like [Nelumbo nucifera]
Length=102

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D + +L + N  VIFSK++CC+ +A   LF EL V P +H +D D  G+++E ALL LGC
Sbjct  2    DMITKLASQNAAVIFSKSSCCMSHATKRLFYELGVSPAIHELDQDYRGRDMELALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VP VFIGG  +GST +VM
Sbjct  62   ----NPAVPTVFIGGKFVGSTQKVM  82



>gb|KDP41803.1| hypothetical protein JCGZ_26821 [Jatropha curcas]
Length=127

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++  L ++N VVIFS +TCC+C+A+  LF  + V P VH +D DP GKE+EKAL+ L  
Sbjct  26   ERIESLASENAVVIFSISTCCMCHAIKRLFCGMGVNPTVHELDQDPRGKEMEKALMRL--  83

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +++ VP VFIGG L+G+ + VM
Sbjct  84   -LGSSSAVPVVFIGGKLVGAMDRVM  107



>gb|EYU45572.1| hypothetical protein MIMGU_mgv1a023883mg [Erythranthe guttata]
Length=102

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 4/83 (5%)
 Frame = +2

Query  191  VRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGCGT  370
            V +L A   VVIFSK+TCC+C+A+  LF E  V P V+ +D   +GKE+E+AL+ LGC  
Sbjct  4    VVKLAAQKAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYELDEQINGKEMERALIRLGC--  61

Query  371  NNNAVVPAVFIGGHLIGSTNEVM  439
                 VPAVF+GG  IGS N+V+
Sbjct  62   --TPTVPAVFVGGKFIGSANDVL  82



>ref|XP_004310231.1| PREDICTED: glutaredoxin-C1-like [Fragaria vesca subsp. vesca]
Length=130

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL + + VVIFS ++CC+C+AV  LF  + V P V+ +D DP GKEIE+AL+ L  
Sbjct  29   ERVARLASKSAVVIFSLSSCCMCHAVKRLFCGMGVNPTVYELDQDPRGKEIERALMRL--  86

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               N++ VP VFIGG LIG+ + VM
Sbjct  87   -LGNSSAVPVVFIGGKLIGAMDRVM  110



>ref|XP_010243568.1| PREDICTED: monothiol glutaredoxin-S10-like [Nelumbo nucifera]
Length=102

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L + +  V+FSK++CC+ + +   F EL V P +H +D +  G+E+E ALL LGC
Sbjct  2    DRVTKLASQSAAVVFSKSSCCMSHVIKRFFYELGVNPAIHELDEEYRGREMEMALLKLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  IGST +VM
Sbjct  62   ----NPAVPAVFIGGKFIGSTQKVM  82



>ref|XP_010024636.1| PREDICTED: monothiol glutaredoxin-S4-like [Eucalyptus grandis]
Length=108

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D++ R+  +  VVIFS+++CC+C+ V +LF+E  V P VH +D  P G+EIE+AL  LG 
Sbjct  2    DRINRMVLERPVVIFSRSSCCMCHTVKMLFREFGVNPVVHELDEIPRGQEIEQALSRLG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEV  436
                +  VPAVFIGG L+G  NEV
Sbjct  61   ---RSPTVPAVFIGGELVGGINEV  81



>ref|XP_011005540.1| PREDICTED: monothiol glutaredoxin-S2-like [Populus euphratica]
Length=101

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 5/85 (6%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V +L ++  VVIFSKTTCC+C+ +  LF +  V P VH +D  P G+EIE+AL   GC
Sbjct  2    ERVTKLASERPVVIFSKTTCCMCHTIKTLFCDFGVNPAVHELDEMPGGREIEQALRRAGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
             T     +PAVFIGG  +G +NEVM
Sbjct  62   PT-----LPAVFIGGENVGGSNEVM  81



>gb|KCW61087.1| hypothetical protein EUGRSUZ_H03861 [Eucalyptus grandis]
Length=117

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D++ R+  +  VVIFS+++CC+C+ V +LF+E  V P VH +D  P G+EIE+AL  LG 
Sbjct  2    DRINRMVLERPVVIFSRSSCCMCHTVKMLFREFGVNPVVHELDEIPRGQEIEQALSRLG-  60

Query  365  GTNNNAVVPAVFIGGHLIGSTNEV  436
                +  VPAVFIGG L+G  NEV
Sbjct  61   ---RSPTVPAVFIGGELVGGINEV  81



>ref|XP_002520675.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF41637.1| glutaredoxin, grx, putative [Ricinus communis]
Length=102

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+VR L +    VIF+K++CC+C+++  LF EL   P +H +D D +G+E+E AL  LGC
Sbjct  2    DRVRDLASTRAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDRDANGREMEWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVFIGG  +GS  +V+
Sbjct  62   SPS----VPAVFIGGKYVGSAKDVL  82



>ref|XP_010680093.1| PREDICTED: glutaredoxin-C3 [Beta vulgaris subsp. vulgaris]
Length=109

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +2

Query  176  KMADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA  355
            ++ +++ R+ ++N VVIFSK++CC+C+A+  LF  + V P VH +D+DP G+++EKAL+ 
Sbjct  5    RIVERIERVASENAVVIFSKSSCCMCHAIQRLFCGMGVNPTVHDLDMDPWGEDMEKALML  64

Query  356  LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            L    N    VP VF+GG L+G+ + VM
Sbjct  65   LLTTPNP---VPVVFVGGQLLGAMDRVM  89



>ref|XP_009336451.1| PREDICTED: glutaredoxin-C1-like [Pyrus x bretschneideri]
Length=127

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = +2

Query  164  YINIKMA-----DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDG  328
            Y+ ++M+     ++V RL + + VVIFS ++CC+C+AV  LF  + V P V+ +D DP G
Sbjct  14   YVPVRMSMGDPLERVARLASKSAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDQDPRG  73

Query  329  KEIEKALLALGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            KEIE+AL+ L      ++ VP VFIGG LIG+ + VM
Sbjct  74   KEIERALMRL---LGTSSAVPVVFIGGKLIGAMDRVM  107



>ref|XP_011079731.1| PREDICTED: glutaredoxin-C11 [Sesamum indicum]
Length=102

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+VR L +    VIF+K++CC+C+++  LF +L   P VH +D +  GKE+E AL  LGC
Sbjct  2    DRVRELASKKAAVIFTKSSCCMCHSIKALFYDLGASPAVHELDHESRGKEMEWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS  +V+
Sbjct  62   ----NPTVPAVFIGGEFVGSAKDVI  82



>ref|XP_008389917.1| PREDICTED: glutaredoxin-C1-like [Malus domestica]
Length=127

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = +2

Query  164  YINIKMA-----DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDG  328
            Y+ ++M+     ++V RL + + VVIFS ++CC+C+AV  LF  + V P V+ +D DP G
Sbjct  14   YVPVRMSMGDPLERVARLASKSAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDQDPRG  73

Query  329  KEIEKALLALGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            KEIE+AL+ L      ++ VP VFIGG LIG+ + VM
Sbjct  74   KEIERALMRL---LGTSSAVPVVFIGGKLIGAMDRVM  107



>gb|EMS46251.1| Putative glutaredoxin-C14 [Triticum urartu]
 gb|EMT28436.1| Putative glutaredoxin-C14 [Aegilops tauschii]
Length=103

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V ++ ++ GVVIF+  +CC+C+ V  LF +L V   VH +D DP GKE+E+ALL L  
Sbjct  2    DRVMKMASERGVVIFTLNSCCMCHTVTRLFTDLGVNALVHELDHDPKGKEMERALLKL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                   VPAVFIGG L+G TN+VM
Sbjct  60   -LGKGPPVPAVFIGGKLVGGTNKVM  83



>emb|CDO98900.1| unnamed protein product [Coffea canephora]
Length=102

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D++ +L +   VVIFSK++CC+C+A+  LF E  V P +  +D +  G+E+E AL+ LGC
Sbjct  2    DRIAKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMILELDEESRGQEMEWALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS N VM
Sbjct  62   ----NPSVPAVFIGGKFVGSANTVM  82



>gb|EAY81718.1| hypothetical protein OsI_36892 [Oryza sativa Indica Group]
Length=109

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-  355
            MA++V  L ++  VV+F+K+ CC+C AV  L  EL V   VH +D DP GKE+E+ L   
Sbjct  1    MAERVAMLASERAVVVFTKSGCCMCTAVTTLLGELAVSAAVHELDRDPLGKEMERELARR  60

Query  356  -LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
              G G      VPAVFIGG L+G T++VM
Sbjct  61   LYGSGGRGGPAVPAVFIGGSLVGGTSKVM  89



>ref|XP_004136054.1| PREDICTED: glutaredoxin-C11-like [Cucumis sativus]
 ref|XP_004167455.1| PREDICTED: glutaredoxin-C11-like [Cucumis sativus]
 ref|XP_008451630.1| PREDICTED: glutaredoxin-C11 [Cucumis melo]
 gb|KGN44889.1| hypothetical protein Csa_7G394580 [Cucumis sativus]
Length=102

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D++R L +   VVIFSK++C +C+++  LF EL   P VH +D D +G+EI+ AL  LGC
Sbjct  2    DRLRNLASQKAVVIFSKSSCYICHSIQTLFYELGASPAVHELDHDANGREIDWALRGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  IGS  +V+
Sbjct  62   ----NPSVPAVFIGGKFIGSAKDVI  82



>sp|Q2R073.1|GRC12_ORYSJ RecName: Full=Putative glutaredoxin-C12 [Oryza sativa Japonica 
Group]
 gb|ABA95162.1| Glutaredoxin-like family protein [Oryza sativa Japonica Group]
 gb|EAZ19161.1| hypothetical protein OsJ_34698 [Oryza sativa Japonica Group]
Length=109

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-  355
            MA+ V RL ++  VV+F+K+ CC+C AV  L  EL V   VH +D +P GKE+E+ L   
Sbjct  1    MAEMVARLASERAVVVFTKSGCCMCTAVTTLLGELAVSAAVHELDREPLGKEMERELARR  60

Query  356  -LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
              G G      VPAVFIGG L+G T++VM
Sbjct  61   LYGSGGRGGPAVPAVFIGGSLVGGTSKVM  89



>ref|XP_002514866.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF47420.1| glutaredoxin, grx, putative [Ricinus communis]
Length=128

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL +++ VVIFS ++CC+C+AV  LF  + V P V+ +D DP GKEIE+AL+ L  
Sbjct  26   ERVVRLASESAVVIFSISSCCMCHAVKRLFCGMGVNPTVYELDQDPRGKEIERALMRL--  83

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              N ++VVP VFIGG LIG+ + VM
Sbjct  84   LGNYSSVVPVVFIGGKLIGAMDRVM  108



>ref|XP_008796225.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=103

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D++ RL +   VVIFS ++CC+C+ V  LF +L V P +H +D DP GK++E+AL  +  
Sbjct  2    DRINRLASQKAVVIFSLSSCCMCHTVKTLFSDLGVSPAIHELDEDPKGKDMERALAKM--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG+L+G T+++M
Sbjct  60   -LGRSPPVPAVFIGGNLVGPTDKIM  83



>emb|CDO98899.1| unnamed protein product [Coffea canephora]
Length=102

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D + +L +   VVIFSK++CC+C+A+  LF E  V P ++ ID   +G EIE AL+ LGC
Sbjct  2    DSIVKLASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPMIYEIDQISNGTEIEWALIRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG+ +GS + VM
Sbjct  62   ----NPSVPAVFIGGNFVGSASTVM  82



>ref|NP_001176689.1| Os11g0656000 [Oryza sativa Japonica Group]
 sp|Q2R075.1|GRC11_ORYSJ RecName: Full=Putative glutaredoxin-C11 [Oryza sativa Japonica 
Group]
 gb|ABA95123.1| Glutaredoxin-like family protein [Oryza sativa Japonica Group]
 dbj|BAH95417.1| Os11g0656000 [Oryza sativa Japonica Group]
Length=109

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-  355
            MA+ V RL ++  VV+F+K+ CC+C AV  L  EL V   VH +D DP GKE+EK L   
Sbjct  1    MAEMVARLASERAVVVFTKSGCCMCTAVTTLLGELAVSAAVHELDRDPLGKEMEKELARR  60

Query  356  -LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
              G        VPAVFIGG L+G T++VM
Sbjct  61   LYGSSGRGGPAVPAVFIGGSLVGGTSKVM  89



>ref|XP_009399249.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
 gb|ABF69994.1| glutaredoxin family protein [Musa acuminata]
Length=103

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFS ++CC+C+ +  LF EL V P V+ +D DP G+E+EKAL+ L  
Sbjct  2    DRVMKLASQKAVVIFSLSSCCMCHTIKRLFCELGVNPAVYELDEDPRGREMEKALVKL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VP VFIGG L+GST+ +M
Sbjct  60   -LGRNPSVPVVFIGGKLVGSTDRIM  83



>ref|XP_003575739.1| PREDICTED: putative glutaredoxin-C14 [Brachypodium distachyon]
Length=103

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L ++  VV+F+ ++CC+C+ V  LF +L V   VH +D DP GKE+EKALL L  
Sbjct  2    DRVMKLASERAVVVFTLSSCCMCHTVSRLFCDLGVNALVHELDQDPKGKEMEKALLKL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                   VPAVFIGG L+G TN+VM
Sbjct  60   -LGRGPSVPAVFIGGKLVGGTNKVM  83



>gb|KDP26855.1| hypothetical protein JCGZ_18013 [Jatropha curcas]
Length=125

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +2

Query  164  YINIKMADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEK  343
            Y   +  ++V RL +++ VVIFS ++CC+C+AV  LF  + V P V+ ID DP GKEIE+
Sbjct  13   YYEAEPLERVVRLASESAVVIFSISSCCMCHAVKRLFCGMGVNPTVYEIDEDPRGKEIER  72

Query  344  ALLA-LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
            AL+  LG  + +++ VP VFIGG L+G+ + VM
Sbjct  73   ALMRLLGNFSYSSSAVPVVFIGGKLVGAIDRVM  105



>ref|XP_006380199.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ERP57996.1| glutaredoxin family protein [Populus trichocarpa]
Length=101

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V  L ++  VVIFSK+TCC+C+ +  LF E  V   VH +D  P G+EIE+AL   GC
Sbjct  2    ERVTNLASERPVVIFSKSTCCMCHTIKTLFNEFGVNVAVHELDEMPRGREIEQALSRFGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
             T     +PAVFIGG L+G  NEVM
Sbjct  62   PT-----LPAVFIGGELVGGANEVM  81



>ref|XP_007161691.1| hypothetical protein PHAVU_001G090300g [Phaseolus vulgaris]
 gb|ESW33685.1| hypothetical protein PHAVU_001G090300g [Phaseolus vulgaris]
Length=126

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ RL ++N VVIFS +TCC+C+A+  LF  + V P VH +D DP GK++E+AL+ L  
Sbjct  25   ERIERLASENAVVIFSVSTCCMCHAIKRLFCGMGVNPTVHELDEDPRGKDLERALMRL--  82

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               + +VVP VFIGG L+G+ + VM
Sbjct  83   -LGSPSVVPVVFIGGKLVGTMDRVM  106



>ref|XP_008390723.1| PREDICTED: monothiol glutaredoxin-S10 [Malus domestica]
 ref|XP_009352226.1| PREDICTED: monothiol glutaredoxin-S10-like [Pyrus x bretschneideri]
Length=102

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+ +A+  LF E  V P ++ +D +  GKE+E AL+ LGC
Sbjct  2    DRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESRGKEMEWALIRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVFIGG L+GS N VM
Sbjct  62   QPS----VPAVFIGGKLVGSANTVM  82



>gb|EPS63130.1| hypothetical protein M569_11657 [Genlisea aurea]
Length=102

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            + VR L +    VIF+K++CC+C+++  LF EL   P VH +D D  G E+E+AL  LGC
Sbjct  2    ESVRELASKKAAVIFTKSSCCMCHSIKALFYELGASPAVHELDQDVRGTEMERALKGLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  IGS  +V+
Sbjct  62   ----NPSVPAVFIGGEFIGSAKDVI  82



>gb|EAY81716.1| hypothetical protein OsI_36890 [Oryza sativa Indica Group]
Length=109

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-  355
            MA++V RL ++  VV+F+K+ CC+  AV  L  EL V   VH +D +P GKE+EK L   
Sbjct  1    MAERVARLASERAVVVFTKSGCCMSTAVTTLLGELAVSAAVHELDREPLGKEMEKELARR  60

Query  356  -LGCGTNNNAVVPAVFIGGHLIGSTNEVM  439
              G G      VPAVFIGG L+G T++VM
Sbjct  61   LYGSGGRGGPAVPAVFIGGSLVGGTSKVM  89



>ref|XP_004962842.1| PREDICTED: putative glutaredoxin-C14-like [Setaria italica]
Length=104

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L ++  VV+F+ ++CC+C+ V  L Q+L V   VH +D DP GKE+E+ALL +  
Sbjct  2    DRVMKLASERAVVVFTLSSCCMCHTVTKLMQDLSVNALVHELDSDPRGKEMERALLKMLG  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
            G      VPAVFIGG L+G TN +M
Sbjct  62   G--RGPAVPAVFIGGKLVGGTNRIM  84



>ref|XP_004962841.1| PREDICTED: putative glutaredoxin-C14-like [Setaria italica]
Length=104

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L ++  VV+F+ ++CC+C+ V  L Q+L V   VH +D DP GKE+E+ALL +  
Sbjct  2    DRVMKLASERAVVVFTLSSCCMCHTVTKLMQDLSVNALVHELDSDPRGKEMERALLKMLG  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
            G      VPAVFIGG L+G TN +M
Sbjct  62   G--RGPAVPAVFIGGKLVGGTNRIM  84



>gb|EYU34223.1| hypothetical protein MIMGU_mgv1a023043mg [Erythranthe guttata]
Length=103

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D V +L + N VVIFSK+TCC+C+A+  LF E  V P V+ +D   +G+EIE+AL+ LGC
Sbjct  2    DCVLKLASQNAVVIFSKSTCCMCHAIKRLFYEQGVSPMVYELDELLNGREIERALVRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +   +PAVFIGG L+GST  ++
Sbjct  62   ---SGPTLPAVFIGGKLVGSTKNLL  83



>ref|XP_007035505.1| Thioredoxin superfamily protein [Theobroma cacao]
 gb|EOY06431.1| Thioredoxin superfamily protein [Theobroma cacao]
Length=102

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V +L ++  VVIFSK++CC+C+ +  LF +  V P VH +D    G+EIE+AL  LGC
Sbjct  2    ERVTKLASEKPVVIFSKSSCCMCHTIKTLFYDFGVNPAVHELDEIARGREIEQALSRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVF+GG L+G  NEVM
Sbjct  62   SPS----VPAVFVGGELVGGANEVM  82



>ref|XP_003521537.1| PREDICTED: glutaredoxin-C11-like [Glycine max]
 ref|XP_006604701.1| PREDICTED: glutaredoxin-C11-like [Glycine max]
 gb|KHN28229.1| Glutaredoxin-C11 [Glycine soja]
 gb|KHN43544.1| Glutaredoxin-C11 [Glycine soja]
Length=102

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V+ L +    VIF+K++CC+C+++  LF EL   P VH +D D  GKE+E AL  +GC
Sbjct  2    DRVKDLASKKAAVIFTKSSCCMCHSIKQLFYELGASPAVHELDNDSYGKEMEWALRGMGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +GS+ +V+
Sbjct  62   ----NPSVPAVFIGGKFVGSSKDVI  82



>ref|XP_008802104.1| PREDICTED: glutaredoxin-C1-like [Phoenix dactylifera]
Length=103

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFS ++CC+C+ +   F EL V P +H +D DP GK++E+AL  +  
Sbjct  2    DRVNKLASQKAVVIFSLSSCCMCHTIKRFFSELGVNPTIHELDEDPKGKDMERALAKM--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+G T+++M
Sbjct  60   -VGRNPPVPAVFIGGSLVGPTDKIM  83



>ref|XP_002455625.1| hypothetical protein SORBIDRAFT_03g014790 [Sorghum bicolor]
 gb|EES00745.1| hypothetical protein SORBIDRAFT_03g014790 [Sorghum bicolor]
Length=103

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V RL +   VVIFS +TCC+C+ V  LF+EL V   V  +D +P GKE+EK L  L  
Sbjct  2    DQVTRLASQRAVVIFSTSTCCMCHTVTQLFRELGVNTMVVELDKEPRGKEMEKGLARL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +A VPAVFIGG L+GST++VM
Sbjct  60   -LGRSAGVPAVFIGGRLVGSTDKVM  83



>gb|KHN47302.1| Monothiol glutaredoxin-S4 [Glycine soja]
Length=102

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V ++ ++  VVIFS+++CC+C+ +  LF +  V P VH +D  P G +IE+AL  LGC
Sbjct  2    DRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGNDIEQALSRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VP VFIGG L+G  NEVM
Sbjct  62   SPS----VPVVFIGGELVGGANEVM  82



>gb|EMS50255.1| Putative glutaredoxin-C2 [Triticum urartu]
Length=104

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            MAD+V  L +   VVIF  + CC+C+AV  LF EL V   VH +D DP GK++E+ L+ +
Sbjct  1    MADRVTNLASQRAVVIFGASNCCMCHAVKTLFTELGVSWTVHELDKDPRGKDVERVLVGM  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVM  439
                      PAVFIGG L+G+T++VM
Sbjct  61   ---VGRTPPAPAVFIGGRLVGTTDQVM  84



>gb|EMT00625.1| hypothetical protein F775_42757 [Aegilops tauschii]
Length=104

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +2

Query  179  MADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL  358
            MA++V +L +   VVIF  + CC+C+AV  LF EL V   VH +D DP GK++E+AL  +
Sbjct  1    MAERVTKLASQRAVVIFGVSNCCMCHAVKTLFTELGVSWVVHELDKDPRGKDVERALAGM  60

Query  359  GCGTNNNAVVPAVFIGGHLIGSTNEVM  439
                  +  VPAVFIGG L+G T++VM
Sbjct  61   ---VGRSPPVPAVFIGGRLVGPTDKVM  84



>ref|XP_002442257.1| hypothetical protein SORBIDRAFT_08g017120 [Sorghum bicolor]
 gb|EES16095.1| hypothetical protein SORBIDRAFT_08g017120 [Sorghum bicolor]
Length=107

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAV-DILFQELRVEPRVHSIDLDPDGKEIEKALLALG  361
            ++V +L ++  VV+F+ ++CC+C++V  +L  +L V   VH +D DP GK++E+ALL + 
Sbjct  2    ERVMQLASERAVVVFTLSSCCMCHSVTQLLVADLSVNALVHELDRDPRGKDMERALLKML  61

Query  362  CGTNNNAVVPAVFIGGHLIGSTNEVM  439
             G   +A VPAVFIGG L+G TN VM
Sbjct  62   GGGRGSAAVPAVFIGGKLVGGTNSVM  87



>ref|XP_009386287.1| PREDICTED: glutaredoxin-C1-like [Musa acuminata subsp. malaccensis]
Length=103

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV +L +   VVIFS ++CC+CY+V  LF EL V   +H +D +P G E+EKAL+ L  
Sbjct  2    EKVMKLASQRAVVIFSVSSCCMCYSVKSLFHELGVNAAIHELDEEPRGVEMEKALVKL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +  VVPA+FIGG L+GS + +M
Sbjct  60   -LGHRPVVPAIFIGGRLVGSIDRIM  83



>ref|XP_006342767.1| PREDICTED: monothiol glutaredoxin-S3-like [Solanum tuberosum]
Length=102

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V R+ A+  VVIFSK +CC+ + +  LF +L V P VH +D    G+EIE AL  LGC
Sbjct  2    ERVSRMVAEKPVVIFSKNSCCMSHTIKSLFCDLGVHPSVHELDEMQRGREIEAALSRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG L+G  NEVM
Sbjct  62   ----NPTVPAVFIGGELVGGENEVM  82



>ref|XP_006288869.1| hypothetical protein CARUB_v10002222mg [Capsella rubella]
 gb|EOA21767.1| hypothetical protein CARUB_v10002222mg [Capsella rubella]
Length=140

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +2

Query  188  KVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLA-LGC  364
            K+  + A+N VVIFS +TCC+C+A+  LF+ + V P VH +DL P G EI +ALL  LGC
Sbjct  33   KIESMAAENAVVIFSVSTCCMCHAIKRLFRGMGVSPAVHELDLHPYGAEIHRALLRLLGC  92

Query  365  ---GTNNNAVVPAVFIGGHLIGSTNEVM  439
               G  +   +P VFIGG ++G+   VM
Sbjct  93   SSGGATSQGALPVVFIGGKMVGAMERVM  120



>ref|XP_002272852.1| PREDICTED: glutaredoxin-C1 [Vitis vinifera]
Length=123

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 60/85 (71%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +++ RL ++N VVIFS ++CC+C+A+  LF  + V P V+ +D DP GKE+EKAL+ L  
Sbjct  22   ERIERLASENAVVIFSISSCCMCHAIKRLFCGMGVNPTVYELDEDPRGKEMEKALMRL--  79

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               +++ VP VFIGG L+G+ + VM
Sbjct  80   -LGSSSAVPVVFIGGKLVGAMDRVM  103



>ref|XP_006363784.1| PREDICTED: glutaredoxin-C5-like [Solanum tuberosum]
Length=120

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL + + VVIFS ++CC+C+A+ +LF EL V P V+ +D DP+G+ +E+AL  L  
Sbjct  19   ERVARLASRSAVVIFSSSSCCMCHAIKMLFCELGVSPMVYELDQDPNGRGMERALYKL--  76

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               N+  +P VFIGG LIG  + VM
Sbjct  77   -LGNSPAIPVVFIGGELIGPMDRVM  100



>ref|XP_008353233.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
 ref|XP_008361968.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
Length=102

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L + N VVIFSK++CC+ +AV  LF E  V P ++ +D +  GKE+E AL  LGC
Sbjct  2    DRVTKLASQNAVVIFSKSSCCMSHAVKRLFYEQGVSPEIYELDEESRGKEMECALTRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVFIGG  +GS N VM
Sbjct  62   QPS----VPAVFIGGKFVGSANTVM  82



>ref|XP_004486045.1| PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum]
Length=102

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V  L ++  VVIFSK++CC+C+ +  L  +  V P VH +D    G++IE+ALL LGC
Sbjct  2    ERVTELASERSVVIFSKSSCCMCHTIKTLLSDFGVNPEVHELDEINGGRDIEQALLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                N  VPAVFIGG  +G  NEVM
Sbjct  62   ----NPSVPAVFIGGEFVGGANEVM  82



>gb|EPS67026.1| hypothetical protein M569_07752 [Genlisea aurea]
Length=102

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++++R+ ++  VVIFSKT+CC+ + +  LF +L V+P++  +D  P G++IE+ALL +GC
Sbjct  2    ERMKRMGSEKAVVIFSKTSCCMSHTIKSLFYDLGVDPKIFELDEIPRGRDIEQALLKIGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG   G  NE+M
Sbjct  62   ----DPTVPAVFIGGEFAGGANEIM  82



>ref|XP_006363780.1| PREDICTED: glutaredoxin-C5-like [Solanum tuberosum]
Length=120

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V RL + + VV+FS ++CC+C+A+  LF EL V P V+ +D DP+GK +E+AL  L  
Sbjct  19   ERVARLASGSAVVLFSSSSCCMCHAMKRLFCELGVSPMVYELDQDPNGKGMERALSKL--  76

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               N+  +P VFIGG LIGS + VM
Sbjct  77   -IGNSPAIPVVFIGGELIGSMDRVM  100



>ref|XP_004296803.1| PREDICTED: monothiol glutaredoxin-S10-like [Fragaria vesca subsp. 
vesca]
Length=102

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V +L +   VVIFSK++CC+ +A+  LF E  V P ++ +D +  GKE+E AL+ LGC
Sbjct  2    DRVAKLASQKAVVIFSKSSCCMSHAIKRLFYEQGVSPAIYELDEESRGKEMEWALMRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
              +    VPAVFIGG  +GS N VM
Sbjct  62   QPS----VPAVFIGGKFVGSANTVM  82



>ref|XP_006380202.1| hypothetical protein POPTR_0008s22870g [Populus trichocarpa]
 gb|ERP57999.1| hypothetical protein POPTR_0008s22870g [Populus trichocarpa]
Length=101

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V  L ++  VVIFSK++CC+C+ +  LF E  V   VH +D  P G+EIE+AL   GC
Sbjct  2    ERVTNLASERPVVIFSKSSCCMCHTIKTLFNEFGVNVAVHELDEMPRGREIEQALSRFGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
             T     +PAVFIGG L+G  NEVM
Sbjct  62   PT-----LPAVFIGGELVGGANEVM  81



>ref|XP_004229212.1| PREDICTED: monothiol glutaredoxin-S10 [Solanum lycopersicum]
Length=102

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            ++V ++ +   VVIFSK++CC+C+A+  LF E  V P ++ +D D +G+++E++LL LGC
Sbjct  2    ERVVKVASQKAVVIFSKSSCCMCHAIKRLFYEQGVSPLIYELDEDMNGRDMERSLLRLGC  61

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG  +GS N VM
Sbjct  62   ----SPAVPAVFIGGRFVGSANTVM  82



>ref|XP_004968749.1| PREDICTED: glutaredoxin-C1-like [Setaria italica]
Length=103

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            D+V RL A   VVIFS ++CC+C+ V  LF+EL V   V  +D DP G E+EKAL  L  
Sbjct  2    DRVTRLAAQRAVVIFSTSSCCMCHTVTQLFRELGVNATVVELDEDPRGNEMEKALARL--  59

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
                +  VPAVFIGG L+GST++VM
Sbjct  60   -LGRSTGVPAVFIGGRLVGSTDKVM  83



>ref|XP_002446324.1| hypothetical protein SORBIDRAFT_06g014300 [Sorghum bicolor]
 gb|EES10652.1| hypothetical protein SORBIDRAFT_06g014300 [Sorghum bicolor]
Length=137

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = +2

Query  182  ADKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLAL-  358
            A++V RL +++ VV+FS +TCC+C+AV  LF  + V P VH +DLDP G+E+E+AL  L 
Sbjct  27   AERVERLASESAVVVFSVSTCCMCHAVKRLFCGMGVHPTVHELDLDPRGRELERALACLL  86

Query  359  ----GCGTNNNAVVPAVFIGGHLIGSTNEVM  439
                        VVP VFIGG L+G+ + VM
Sbjct  87   GASGASAAGAPPVVPVVFIGGRLVGAMDRVM  117



>ref|XP_011020819.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=126

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +2

Query  185  DKVRRLTADNGVVIFSKTTCCLCYAVDILFQELRVEPRVHSIDLDPDGKEIEKALLALGC  364
            +KV RL +++ VV+FS ++CC+C+AV  LF  + V P V+ +D DP G+EIEKAL+ L  
Sbjct  25   EKVARLASESAVVVFSISSCCMCHAVKRLFCGMGVNPTVYELDHDPRGEEIEKALMRL--  82

Query  365  GTNNNAVVPAVFIGGHLIGSTNEVM  439
               N+  VP VFIGG LIG+   VM
Sbjct  83   -LGNSTSVPVVFIGGKLIGAMERVM  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 769335055200