BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77528_g1_i1 len=1389 path=[1367:0-1388]

Length=1389
                                                                      Score     E

ref|XP_006364030.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    280   4e-86   
ref|XP_004234629.1|  PREDICTED: putative E3 ubiquitin-protein lig...    278   2e-85   
ref|XP_006364018.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    278   5e-85   
ref|XP_004234581.2|  PREDICTED: putative E3 ubiquitin-protein lig...    278   7e-85   
ref|XP_004234707.1|  PREDICTED: putative E3 ubiquitin-protein lig...    273   4e-83   
ref|XP_009587577.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    261   2e-78   
ref|XP_011097140.1|  PREDICTED: putative E3 ubiquitin-protein lig...    254   9e-76   
emb|CDP02721.1|  unnamed protein product                                251   1e-74   
ref|XP_009804895.1|  PREDICTED: uncharacterized protein LOC104250058    255   2e-72   
ref|XP_011099492.1|  PREDICTED: putative E3 ubiquitin-protein lig...    239   5e-70   
ref|XP_010108933.1|  E3 ubiquitin-protein ligase SINA-like 10           230   6e-67   
ref|XP_007033104.1|  RING/U-box and TRAF-like domains, putative i...    224   7e-65   
ref|XP_006430664.1|  hypothetical protein CICLE_v10012174mg             223   7e-65   
ref|XP_007033105.1|  Ubiquitin-protein ligase, putative isoform 2       224   7e-65   
ref|XP_006482161.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    223   9e-65   
ref|XP_011046039.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    221   3e-63   
gb|KDP22664.1|  hypothetical protein JCGZ_02506                         221   3e-63   
gb|ACU24390.1|  unknown                                                 218   7e-63   Glycine max [soybeans]
ref|XP_003531068.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    217   2e-62   
gb|KHN39162.1|  E3 ubiquitin-protein ligase SINA-like 10                216   3e-62   
ref|XP_008229332.1|  PREDICTED: putative E3 ubiquitin-protein lig...    218   8e-62   
ref|XP_008460511.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    216   8e-62   
ref|XP_002532642.1|  ubiquitin-protein ligase, putative                 216   2e-61   Ricinus communis
ref|XP_006372377.1|  seven in absentia family protein                   216   2e-61   
gb|EYU44590.1|  hypothetical protein MIMGU_mgv1a008310mg                214   1e-60   
gb|KHN22942.1|  E3 ubiquitin-protein ligase SINA-like 10                211   3e-60   
ref|XP_003524774.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    211   4e-60   
ref|XP_004303331.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    212   4e-60   
ref|XP_007217731.1|  hypothetical protein PRUPE_ppa006254mg             213   6e-60   
ref|XP_002271757.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    211   8e-60   Vitis vinifera
ref|XP_007201550.1|  hypothetical protein PRUPE_ppa017592mg             209   1e-59   
emb|CAN77431.1|  hypothetical protein VITISV_037121                     210   2e-59   Vitis vinifera
ref|XP_010243800.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    208   2e-59   
gb|KHG01588.1|  hypothetical protein F383_23529                         208   5e-59   
ref|XP_007159014.1|  hypothetical protein PHAVU_002G201000g             203   3e-57   
ref|XP_008236352.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    207   4e-57   
ref|XP_011021345.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    203   3e-56   
gb|EPS66631.1|  hypothetical protein M569_08146                         196   1e-55   
ref|XP_008381498.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    200   1e-55   
ref|XP_010032666.1|  PREDICTED: putative E3 ubiquitin-protein lig...    199   2e-55   
ref|XP_011035360.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    199   4e-55   
ref|XP_010113237.1|  E3 ubiquitin-protein ligase SINA-like 10           195   5e-55   
ref|XP_011035359.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    199   5e-55   
ref|XP_009371812.1|  PREDICTED: putative E3 ubiquitin-protein lig...    200   1e-54   
ref|XP_010666725.1|  PREDICTED: uncharacterized protein LOC104883855    204   1e-54   
gb|AFK36482.1|  unknown                                                 194   3e-54   
ref|XP_004504728.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    193   2e-53   
ref|XP_008236350.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    192   4e-53   
ref|XP_008368801.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    194   3e-52   
gb|AEC11038.1|  hypothetical protein                                    187   7e-52   
ref|XP_008457096.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    184   2e-51   
ref|XP_004170241.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    185   4e-51   
ref|XP_004289811.1|  PREDICTED: putative E3 ubiquitin-protein lig...    185   1e-50   
ref|XP_003638120.1|  E3 ubiquitin-protein ligase SINA-like protein      186   1e-50   
ref|XP_006430661.1|  hypothetical protein CICLE_v10012175mg             186   2e-50   
ref|XP_011002805.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    184   2e-50   
gb|KGN57437.1|  hypothetical protein Csa_3G185660                       182   4e-50   
ref|XP_010916338.1|  PREDICTED: putative E3 ubiquitin-protein lig...    184   6e-50   
ref|XP_007199542.1|  hypothetical protein PRUPE_ppb019386mg             186   9e-50   
gb|AES99109.2|  seven in absentia family protein                        184   1e-49   
ref|XP_010317754.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    177   4e-49   
ref|XP_008811968.1|  PREDICTED: putative E3 ubiquitin-protein lig...    182   5e-49   
ref|XP_003616151.1|  Ubiquitin                                          183   7e-49   
ref|XP_009409203.1|  PREDICTED: putative E3 ubiquitin-protein lig...    181   7e-49   
ref|XP_009375681.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    186   7e-49   
ref|XP_008811985.1|  PREDICTED: putative E3 ubiquitin-protein lig...    179   1e-48   
ref|XP_003615393.1|  Ubiquitin                                          180   1e-48   
ref|XP_002868822.1|  hypothetical protein ARALYDRAFT_494184             178   1e-48   
ref|XP_003614921.1|  Ubiquitin                                          180   2e-48   
gb|AES65367.2|  seven in absentia family protein                        179   5e-48   
ref|XP_010435701.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    176   7e-48   
emb|CDY01699.1|  BnaC04g30530D                                          177   9e-48   
gb|KEH41209.1|  seven in absentia family protein                        178   1e-47   
ref|XP_002870580.1|  hypothetical protein ARALYDRAFT_915957             176   1e-47   
ref|XP_003595116.1|  Ubiquitin                                          179   1e-47   
ref|XP_010445579.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    178   2e-47   
ref|XP_003595117.1|  Ubiquitin                                          178   2e-47   
ref|XP_002870579.1|  hypothetical protein ARALYDRAFT_915956             175   2e-47   
ref|XP_010314967.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    171   5e-47   
ref|XP_006285318.1|  hypothetical protein CARUB_v10006701mg             174   5e-47   
ref|NP_198605.2|  E3 ubiquitin-protein ligase SINA-like 7               174   8e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KEH23716.1|  seven in absentia family protein                        178   3e-46   
ref|XP_003616156.1|  Ubiquitin                                          175   6e-46   
gb|KEH41206.1|  seven in absentia family protein                        172   9e-46   
ref|XP_002868825.1|  hypothetical protein ARALYDRAFT_356210             175   9e-46   
ref|XP_003621859.1|  Ubiquitin                                          172   1e-45   
ref|XP_003616164.1|  Ubiquitin                                          171   3e-45   
ref|XP_006291420.1|  hypothetical protein CARUB_v10017558mg             172   3e-45   
gb|EYU41321.1|  hypothetical protein MIMGU_mgv11b0171931mg              168   3e-45   
ref|XP_006405827.1|  hypothetical protein EUTSA_v10027864mg             170   6e-45   
gb|EPS57190.1|  hypothetical protein M569_17631                         167   9e-45   
ref|XP_006405812.1|  hypothetical protein EUTSA_v10028143mg             168   1e-44   
gb|KEH41205.1|  seven in absentia family protein                        169   1e-44   
ref|XP_010415205.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    168   2e-44   
ref|XP_006302648.1|  hypothetical protein CARUB_v10020752mg             168   2e-44   
dbj|BAB09039.1|  unnamed protein product                                167   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405828.1|  hypothetical protein EUTSA_v10027866mg             167   4e-44   
ref|NP_198609.1|  E3 ubiquitin-protein ligase SINA-like 10              169   4e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25763.1|  BnaA07g10190D                                          166   5e-44   
gb|KDO63138.1|  hypothetical protein CISIN_1g038068mg                   166   9e-44   
ref|XP_002870581.1|  hypothetical protein ARALYDRAFT_915958             165   1e-43   
gb|AES99097.2|  seven in absentia family protein                        167   1e-43   
ref|XP_009103206.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    165   1e-43   
ref|XP_002868819.1|  seven in absentia family protein                   167   2e-43   
ref|XP_006405825.1|  hypothetical protein EUTSA_v10027865mg             165   2e-43   
ref|XP_010450966.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    166   3e-43   
ref|XP_006405877.1|  hypothetical protein EUTSA_v10028216mg             165   3e-43   
ref|XP_010445581.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    164   3e-43   
ref|XP_006405826.1|  hypothetical protein EUTSA_v10027852mg             165   3e-43   
emb|CDY12498.1|  BnaC07g13380D                                          164   5e-43   
ref|XP_003616139.1|  Ubiquitin                                          167   5e-43   
ref|XP_006430662.1|  hypothetical protein CICLE_v10013856mg             164   7e-43   
ref|XP_010451915.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    169   7e-43   
ref|XP_010511492.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    164   7e-43   
ref|XP_010470538.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    163   1e-42   
ref|XP_006284306.1|  hypothetical protein CARUB_v10005477mg             162   1e-42   
gb|KFK35022.1|  hypothetical protein AALP_AA5G224000                    162   2e-42   
ref|XP_006284253.1|  hypothetical protein CARUB_v10005419mg             162   2e-42   
gb|KDO63136.1|  hypothetical protein CISIN_1g048313mg                   161   3e-42   
ref|XP_006430663.1|  hypothetical protein CICLE_v10013490mg             161   4e-42   
ref|XP_006301171.1|  hypothetical protein CARUB_v10021568mg             162   4e-42   
ref|XP_006390991.1|  hypothetical protein EUTSA_v10018806mg             163   6e-42   
ref|XP_006302616.1|  hypothetical protein CARUB_v10020721mg             161   7e-42   
ref|XP_010916809.1|  PREDICTED: putative E3 ubiquitin-protein lig...    162   7e-42   
gb|KFK35021.1|  hypothetical protein AALP_AA5G223900                    160   9e-42   
ref|XP_006405814.1|  hypothetical protein EUTSA_v10027819mg             162   1e-41   
ref|XP_010556279.1|  PREDICTED: uncharacterized protein LOC104825614    167   1e-41   
gb|KFK40945.1|  hypothetical protein AALP_AA2G064200                    160   1e-41   
ref|XP_010470542.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    160   2e-41   
ref|XP_010451727.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    159   2e-41   
ref|XP_006288380.1|  hypothetical protein CARUB_v10001631mg             160   2e-41   
ref|XP_002888527.1|  predicted protein                                  160   2e-41   
ref|XP_002305191.1|  seven in absentia family protein                   157   2e-41   Populus trichocarpa [western balsam poplar]
ref|NP_198603.1|  E3 ubiquitin-protein ligase SINA-like 6               159   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470536.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    161   2e-41   
ref|XP_008811970.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    159   5e-41   
ref|XP_010493885.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    159   1e-40   
ref|XP_009125055.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    159   1e-40   
ref|XP_010470534.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    160   2e-40   
ref|XP_002305940.2|  seven in absentia family protein                   160   2e-40   Populus trichocarpa [western balsam poplar]
emb|CDY47873.1|  BnaA07g14180D                                          158   2e-40   
ref|XP_009148656.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    158   2e-40   
ref|XP_006291706.1|  hypothetical protein CARUB_v10017872mg             156   3e-40   
ref|XP_010445578.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    156   3e-40   
ref|NP_176835.1|  E3 ubiquitin-protein ligase SINA-like 2               157   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301755.1|  hypothetical protein CARUB_v10022216mg             157   3e-40   
ref|XP_006285515.1|  hypothetical protein CARUB_v10006956mg             159   3e-40   
ref|XP_010445575.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    156   5e-40   
ref|XP_002868828.1|  hypothetical protein ARALYDRAFT_916596             157   5e-40   
ref|XP_010436743.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    153   6e-40   
ref|XP_010511495.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    155   8e-40   
ref|XP_010551979.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    155   1e-39   
ref|XP_009144236.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    154   1e-39   
ref|XP_010424345.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    156   1e-39   
ref|XP_006301872.1|  hypothetical protein CARUB_v10022345mg             155   1e-39   
emb|CDY10787.1|  BnaA05g11490D                                          155   1e-39   
gb|AES99123.2|  seven in absentia family protein                        155   1e-39   
ref|XP_006301558.1|  hypothetical protein CARUB_v10021992mg             154   2e-39   
ref|XP_006482159.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    155   2e-39   
ref|NP_198607.1|  putative E3 ubiquitin-protein ligase SINA-like 9      153   4e-39   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FM14.2|SIL11_ARATH  RecName: Full=E3 ubiquitin-protein ligas...    154   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139756.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    152   5e-39   
ref|XP_003616165.1|  Ubiquitin                                          154   5e-39   
ref|XP_010470535.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    155   5e-39   
gb|KFK35023.1|  hypothetical protein AALP_AA5G224100                    153   6e-39   
emb|CDY01756.1|  BnaC06g27960D                                          153   6e-39   
emb|CDY27008.1|  BnaC06g12240D                                          154   6e-39   
gb|ADE77080.1|  unknown                                                 153   6e-39   
gb|KDP22663.1|  hypothetical protein JCGZ_02505                         154   8e-39   
ref|XP_006656079.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    153   9e-39   
emb|CDY70665.1|  BnaA02g35510D                                          153   9e-39   
ref|NP_201086.1|  E3 ubiquitin-protein ligase SINA-like 11              154   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33270.1|  hypothetical protein AALP_AA6G352900                    154   1e-38   
ref|XP_003616125.1|  Ubiquitin                                          153   2e-38   
emb|CDY01695.1|  BnaC04g30570D                                          152   2e-38   
ref|XP_003616141.1|  E3 ubiquitin-protein ligase SINA-like protein      150   2e-38   
ref|XP_010454972.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    152   2e-38   
ref|XP_006391405.1|  hypothetical protein EUTSA_v10018712mg             154   2e-38   
ref|XP_006302575.1|  hypothetical protein CARUB_v10020683mg             152   3e-38   
ref|XP_010513557.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    155   3e-38   
ref|XP_010450967.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    154   3e-38   
ref|XP_010444133.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    150   3e-38   
ref|XP_002868826.1|  hypothetical protein ARALYDRAFT_916594             150   3e-38   
ref|XP_002864819.1|  hypothetical protein ARALYDRAFT_358487             151   3e-38   
ref|XP_009105517.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    152   3e-38   
ref|XP_006301023.1|  hypothetical protein CARUB_v10021414mg             154   4e-38   
ref|NP_001141682.1|  Ubiquitin-protein ligase/ zinc ion binding p...    151   5e-38   Zea mays [maize]
ref|XP_006482392.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    150   7e-38   
ref|XP_009135925.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    150   9e-38   
emb|CDX95911.1|  BnaA07g28200D                                          150   1e-37   
ref|XP_010451724.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    149   1e-37   
ref|NP_176836.1|  E3 ubiquitin-protein ligase SINA-like 3               150   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132807.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    149   2e-37   
ref|XP_006405821.1|  hypothetical protein EUTSA_v10028229mg             149   2e-37   
ref|XP_010440901.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    152   2e-37   
ref|XP_010440900.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    152   2e-37   
sp|Q9FKD6.2|SINL8_ARATH  RecName: Full=E3 ubiquitin-protein ligas...    148   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496724.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    149   3e-37   
ref|XP_010435704.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    147   3e-37   
gb|KEH41208.1|  seven in absentia family protein                        149   3e-37   
ref|XP_006405811.1|  hypothetical protein EUTSA_v10028190mg             148   4e-37   
ref|XP_010511494.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    149   5e-37   
ref|XP_010456725.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    147   5e-37   
ref|XP_004962639.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    149   6e-37   
emb|CDM80861.1|  unnamed protein product                                147   8e-37   
ref|XP_010916810.1|  PREDICTED: putative E3 ubiquitin-protein lig...    149   9e-37   
gb|KFK34836.1|  hypothetical protein AALP_AA5G199400                    146   1e-36   
emb|CBI33566.3|  unnamed protein product                                144   2e-36   
ref|XP_009105214.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    148   2e-36   
emb|CDY52473.1|  BnaA04g27970D                                          146   2e-36   
gb|ADE77895.1|  unknown                                                 145   3e-36   
emb|CAC80703.1|  SIAH1 protein                                          147   4e-36   Brassica napus [oilseed rape]
emb|CAB89182.1|  SIAH1 protein                                          147   4e-36   Brassica napus var. napus [annual rape]
ref|XP_010485288.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    144   5e-36   
ref|NP_849853.1|  E3 ubiquitin-protein ligase SINA-like 4               146   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001057483.2|  Os06g0311300                                       145   6e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CDM86649.1|  unnamed protein product                                144   7e-36   
gb|EEC80479.1|  hypothetical protein OsI_22706                          145   8e-36   Oryza sativa Indica Group [Indian rice]
emb|CDX96140.1|  BnaA07g25910D                                          145   9e-36   
ref|XP_010511491.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    145   1e-35   
emb|CDX99687.1|  BnaC04g34440D                                          144   1e-35   
emb|CDM80812.1|  unnamed protein product                                144   1e-35   
ref|XP_009140166.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    142   4e-35   
ref|XP_002442006.1|  hypothetical protein SORBIDRAFT_08g006830          143   5e-35   Sorghum bicolor [broomcorn]
ref|XP_006285250.1|  hypothetical protein CARUB_v10006614mg             141   7e-35   
dbj|BAD61768.1|  SIAH1 protein-like                                     146   7e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KEH28223.1|  seven in absentia family protein                        142   1e-34   
ref|XP_003559018.1|  PREDICTED: putative E3 ubiquitin-protein lig...    142   2e-34   
gb|KFK41067.1|  hypothetical protein AALP_AA2G081300                    140   4e-34   
ref|XP_006286814.1|  hypothetical protein CARUB_v10003728mg             139   4e-34   
ref|XP_006289541.1|  hypothetical protein CARUB_v10003085mg             137   6e-34   
ref|XP_006302255.1|  hypothetical protein CARUB_v10020292mg             142   9e-34   
ref|XP_006301282.1|  hypothetical protein CARUB_v10021683mg             138   3e-33   
ref|XP_010436734.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    135   5e-33   
ref|XP_003616137.1|  Ubiquitin                                          142   1e-32   
ref|XP_006403041.1|  hypothetical protein EUTSA_v10006392mg             135   1e-32   
ref|XP_006405815.1|  hypothetical protein EUTSA_v10028270mg             134   2e-32   
gb|KFK29798.1|  hypothetical protein AALP_AA7G181000                    135   3e-32   
ref|XP_006284296.1|  hypothetical protein CARUB_v10005465mg             134   4e-32   
ref|XP_006300896.1|  hypothetical protein CARUB_v10021270mg             134   4e-32   
ref|XP_010435714.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    131   4e-32   
ref|XP_010660351.1|  PREDICTED: uncharacterized protein LOC100263...    137   8e-32   
ref|XP_010660347.1|  PREDICTED: uncharacterized protein LOC100263...    137   9e-32   
ref|XP_010660346.1|  PREDICTED: uncharacterized protein LOC100263...    137   9e-32   
emb|CDY36211.1|  BnaC06g27550D                                          134   1e-31   
ref|XP_006285302.1|  hypothetical protein CARUB_v10006683mg             132   1e-31   
ref|XP_006482158.1|  PREDICTED: uncharacterized protein LOC102612380    137   2e-31   
ref|XP_006391410.1|  hypothetical protein EUTSA_v10018780mg             134   2e-31   
emb|CDM80859.1|  unnamed protein product                                132   2e-31   
gb|KDO63134.1|  hypothetical protein CISIN_1g043878mg                   137   2e-31   
ref|XP_010459144.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    131   2e-31   
gb|AAG51169.1|AC079285_2  hypothetical protein                          133   2e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CAN72428.1|  hypothetical protein VITISV_032233                     137   3e-31   Vitis vinifera
emb|CBI33564.3|  unnamed protein product                                137   3e-31   
gb|EMT30213.1|  E3 ubiquitin-protein ligase SINA-like 10                131   3e-31   
ref|XP_006430659.1|  hypothetical protein CICLE_v10011294mg             136   3e-31   
emb|CDY11709.1|  BnaC06g13170D                                          128   3e-31   
ref|XP_007011252.1|  RING/U-box and TRAF-like domains                   136   4e-31   
ref|XP_009371811.1|  PREDICTED: uncharacterized protein LOC103961030    134   4e-31   
gb|EMS62235.1|  E3 ubiquitin-protein ligase SINA-like 11                132   5e-31   
ref|XP_007215313.1|  hypothetical protein PRUPE_ppa003531mg             134   6e-31   
ref|XP_006284929.1|  hypothetical protein CARUB_v10006228mg             127   7e-31   
gb|EMT04364.1|  E3 ubiquitin-protein ligase SINA-like 11                130   8e-31   
ref|XP_008229334.1|  PREDICTED: uncharacterized protein LOC103328702    134   1e-30   
gb|EMT03346.1|  Putative E3 ubiquitin-protein ligase SINA-like pr...    131   1e-30   
ref|XP_003565279.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    129   1e-30   
ref|XP_009105216.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    130   1e-30   
ref|XP_010436883.1|  PREDICTED: putative E3 ubiquitin-protein lig...    129   2e-30   
emb|CDX96138.1|  BnaA07g25930D                                          130   2e-30   
gb|EMT04574.1|  E3 ubiquitin-protein ligase SINA-like 11                134   2e-30   
gb|EMT12284.1|  Putative E3 ubiquitin-protein ligase SINA-like pr...    129   2e-30   
ref|XP_010447989.1|  PREDICTED: putative E3 ubiquitin-protein lig...    129   2e-30   
ref|XP_010474150.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    129   3e-30   
ref|NP_001077779.1|  E3 ubiquitin-protein ligase SINA-like 5            130   3e-30   Arabidopsis thaliana [mouse-ear cress]
sp|Q7XA77.2|SINL5_ARATH  RecName: Full=E3 ubiquitin-protein ligas...    129   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496730.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    127   4e-30   
gb|KHN44664.1|  E3 ubiquitin-protein ligase SINA-like 10                128   5e-30   
ref|XP_006587986.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    127   7e-30   
gb|AAG51171.1|AC079285_4  hypothetical protein                          130   7e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53462.1|  BnaA04g28030D                                          127   9e-30   
ref|XP_010436165.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    127   1e-29   
gb|EMT02099.1|  Putative E3 ubiquitin-protein ligase SINA-like pr...    127   1e-29   
gb|KHG25342.1|  hypothetical protein F383_32011                         131   2e-29   
gb|EMS55743.1|  E3 ubiquitin-protein ligase SINA-like 11                126   2e-29   
ref|XP_004971618.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    127   2e-29   
ref|XP_006589372.1|  PREDICTED: uncharacterized protein LOC100782920    130   3e-29   
ref|XP_009116290.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    125   3e-29   
emb|CDM80824.1|  unnamed protein product                                128   3e-29   
gb|KHN37849.1|  E3 ubiquitin-protein ligase SINA-like 10                130   3e-29   
ref|XP_010445737.1|  PREDICTED: putative E3 ubiquitin-protein lig...    125   4e-29   
ref|XP_003581134.2|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    125   4e-29   
ref|XP_002868809.1|  hypothetical protein ARALYDRAFT_916568             121   1e-28   
ref|XP_002532645.1|  ubiquitin-protein ligase, putative                 122   1e-28   
ref|XP_006482160.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    121   2e-28   
ref|XP_004234630.2|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    121   2e-28   
ref|XP_001758984.1|  predicted protein                                  119   2e-28   
emb|CDM80563.1|  unnamed protein product                                123   2e-28   
ref|XP_010108937.1|  E3 ubiquitin-protein ligase SINA-like 2            128   2e-28   
ref|XP_002457452.1|  hypothetical protein SORBIDRAFT_03g007552          123   2e-28   
ref|XP_010451730.1|  PREDICTED: putative E3 ubiquitin-protein lig...    120   3e-28   
ref|XP_002455271.1|  hypothetical protein SORBIDRAFT_03g007633          122   3e-28   
gb|EMT03344.1|  E3 ubiquitin-protein ligase SINA-like 10                125   5e-28   
ref|XP_006301126.1|  hypothetical protein CARUB_v10021520mg             122   5e-28   
ref|XP_009105518.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    122   6e-28   
ref|XP_002888526.1|  hypothetical protein ARALYDRAFT_894342             123   7e-28   
ref|XP_011097137.1|  PREDICTED: uncharacterized protein LOC105176...    126   7e-28   
ref|XP_011097136.1|  PREDICTED: uncharacterized protein LOC105176...    126   7e-28   
gb|KFK34837.1|  hypothetical protein AALP_AA5G199500                    121   8e-28   
emb|CDY27251.1|  BnaA09g35510D                                          126   8e-28   
gb|KDP22662.1|  hypothetical protein JCGZ_02504                         125   8e-28   
ref|NP_001054675.2|  Os05g0152900                                       123   9e-28   
ref|XP_010496720.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    119   1e-27   
gb|EMT19039.1|  E3 ubiquitin-protein ligase SINA-like protein 10        122   1e-27   
gb|EYU41323.1|  hypothetical protein MIMGU_mgv1a003049mg                125   1e-27   
ref|XP_010233329.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    124   1e-27   
ref|XP_004234633.1|  PREDICTED: uncharacterized protein LOC101262187    125   2e-27   
ref|XP_008365752.1|  PREDICTED: uncharacterized protein LOC103429377    124   2e-27   
gb|EMS62236.1|  E3 ubiquitin-protein ligase SINA-like 7                 122   2e-27   
ref|XP_002439304.1|  hypothetical protein SORBIDRAFT_09g004100          121   3e-27   
ref|XP_006302479.1|  hypothetical protein CARUB_v10020574mg             120   7e-27   
gb|AES99122.2|  seven in absentia family protein                        118   9e-27   
ref|XP_006651033.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    118   1e-26   
ref|NP_001172575.1|  Os01g0761900                                       118   1e-26   
ref|XP_009103207.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    117   1e-26   
ref|XP_004982313.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    117   2e-26   
ref|XP_006364024.1|  PREDICTED: uncharacterized protein LOC102585...    122   2e-26   
ref|XP_006364023.1|  PREDICTED: uncharacterized protein LOC102585...    122   2e-26   
ref|XP_003565277.1|  PREDICTED: putative E3 ubiquitin-protein lig...    118   2e-26   
emb|CDM86196.1|  unnamed protein product                                117   2e-26   
dbj|BAD52688.1|  seven in absentia protein -like                        117   3e-26   
gb|EAY75911.1|  hypothetical protein OsI_03831                          119   4e-26   
gb|EEE53788.1|  hypothetical protein OsJ_00192                          116   4e-26   
ref|XP_006292842.1|  hypothetical protein CARUB_v10019102mg             114   4e-26   
emb|CDX72185.1|  BnaC08g26890D                                          119   8e-26   
gb|KDO63135.1|  hypothetical protein CISIN_1g038900mg                   114   9e-26   
ref|XP_010474151.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    115   1e-25   
ref|XP_010496735.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    115   1e-25   
ref|XP_010485290.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    113   2e-25   
gb|EMT20544.1|  E3 ubiquitin-protein ligase SINA-like 10                115   2e-25   
emb|CDM80353.1|  unnamed protein product                                115   2e-25   
gb|EMT21830.1|  E3 ubiquitin-protein ligase SINA-like 10                115   3e-25   
ref|XP_006301370.1|  hypothetical protein CARUB_v10021782mg             114   3e-25   
ref|XP_009140608.1|  PREDICTED: putative E3 ubiquitin-protein lig...    112   3e-25   
ref|XP_006301864.1|  hypothetical protein CARUB_v10022334mg             114   4e-25   
emb|CDY36209.1|  BnaC06g27530D                                          112   5e-25   
ref|XP_006301763.1|  hypothetical protein CARUB_v10022224mg             113   6e-25   
gb|EMS46006.1|  E3 ubiquitin-protein ligase SINA-like 10                115   7e-25   
ref|XP_008381308.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    110   2e-24   
emb|CDY53465.1|  BnaA04g28060D                                          111   3e-24   
gb|AAU44152.1|  hypothetical protein                                    113   3e-24   
ref|XP_002440605.1|  hypothetical protein SORBIDRAFT_09g003910          112   3e-24   
gb|EAY96587.1|  hypothetical protein OsI_18493                          112   3e-24   
emb|CDY01758.1|  BnaC06g27980D                                          113   4e-24   
ref|XP_010232944.1|  PREDICTED: LOW QUALITY PROTEIN: putative E3 ...    111   4e-24   
ref|XP_004292136.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    108   5e-24   
ref|XP_002439301.1|  hypothetical protein SORBIDRAFT_09g004070          111   7e-24   
ref|XP_001758512.1|  predicted protein                                  105   1e-23   
dbj|BAJ85298.1|  predicted protein                                      107   2e-23   
gb|AAU44153.1|  hypothetical protein                                    109   3e-23   
ref|XP_009804893.1|  PREDICTED: uncharacterized protein LOC104250...    112   3e-23   
ref|XP_002455269.1|  hypothetical protein SORBIDRAFT_03g007556          107   4e-23   
dbj|BAM18147.1|  sina homologue                                         106   4e-23   
gb|EAY96588.1|  hypothetical protein OsI_18494                          108   4e-23   
ref|XP_009587673.1|  PREDICTED: uncharacterized protein LOC104085366    111   5e-23   
ref|XP_002868824.1|  hypothetical protein ARALYDRAFT_916592             105   7e-23   
ref|XP_004963410.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    108   8e-23   
ref|XP_010470543.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    105   1e-22   
emb|CDX74557.1|  BnaA04g08320D                                          103   1e-22   
emb|CDM80352.1|  unnamed protein product                                107   1e-22   
emb|CDM80815.1|  unnamed protein product                                106   2e-22   
emb|CDM80350.1|  unnamed protein product                                106   2e-22   
emb|CDM80842.1|  unnamed protein product                                106   3e-22   
emb|CDM80405.1|  unnamed protein product                                107   3e-22   
gb|EMS49581.1|  Putative E3 ubiquitin-protein ligase SINA-like 6        106   3e-22   
emb|CDY68078.1|  BnaUnng02700D                                          101   4e-22   
ref|XP_002962210.1|  hypothetical protein SELMODRAFT_68563              100   6e-22   
ref|XP_009139752.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    100   6e-22   
ref|XP_006430660.1|  hypothetical protein CICLE_v10013760mg             102   1e-21   
gb|EAZ10348.1|  hypothetical protein OsJ_00185                          107   1e-21   
gb|ABK24533.1|  unknown                                                 103   2e-21   
gb|EMS64113.1|  E3 ubiquitin-protein ligase SINA-like 2                 103   2e-21   
ref|XP_009405137.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    103   2e-21   
emb|CDM80564.1|  unnamed protein product                                102   2e-21   
ref|XP_002439298.1|  hypothetical protein SORBIDRAFT_09g004040          103   2e-21   
ref|XP_002868577.1|  hypothetical protein ARALYDRAFT_916020             100   2e-21   
gb|EAY72325.1|  hypothetical protein OsI_00180                          106   3e-21   
emb|CDM80804.1|  unnamed protein product                                101   3e-21   
ref|XP_002439305.1|  hypothetical protein SORBIDRAFT_09g004110          105   3e-21   
ref|XP_002439302.1|  hypothetical protein SORBIDRAFT_09g004093        99.8    3e-21   
ref|NP_001172150.1|  Os01g0121900                                       106   4e-21   
ref|XP_797311.2|  PREDICTED: E3 ubiquitin-protein ligase SIAH1-like     102   4e-21   
ref|XP_002455277.1|  hypothetical protein SORBIDRAFT_03g007690          103   4e-21   
emb|CDM80516.1|  unnamed protein product                                103   4e-21   
ref|XP_010240773.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    102   4e-21   
ref|XP_008811984.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    100   4e-21   
dbj|BAK02973.1|  predicted protein                                      103   4e-21   
ref|XP_004971614.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...    102   4e-21   
emb|CDM80522.1|  unnamed protein product                                102   7e-21   
ref|XP_002305192.1|  hypothetical protein POPTR_0004s09080g             105   7e-21   
gb|KFM63131.1|  E3 ubiquitin-protein ligase SIAH1                       102   8e-21   
ref|XP_011002802.1|  PREDICTED: uncharacterized protein LOC105109...    104   1e-20   
gb|KEH41207.1|  seven in absentia family protein                        100   1e-20   
ref|XP_011002799.1|  PREDICTED: uncharacterized protein LOC105109...    104   2e-20   
gb|EMS53589.1|  E3 ubiquitin-protein ligase SINA-like 11                103   2e-20   
ref|NP_001149583.1|  ubiquitin-protein ligase/ zinc ion binding p...    100   2e-20   
ref|XP_011002800.1|  PREDICTED: uncharacterized protein LOC105109...    104   2e-20   
ref|XP_011002798.1|  PREDICTED: uncharacterized protein LOC105109...    104   2e-20   
ref|XP_006301450.1|  hypothetical protein CARUB_v10021872mg           99.4    2e-20   
ref|XP_011002801.1|  PREDICTED: uncharacterized protein LOC105109...    104   2e-20   
ref|XP_006301570.1|  hypothetical protein CARUB_v10022008mg           98.2    2e-20   
gb|EEC69847.1|  hypothetical protein OsI_00183                        99.8    4e-20   
ref|XP_002457456.1|  hypothetical protein SORBIDRAFT_03g007580        99.8    4e-20   
ref|XP_003579487.1|  PREDICTED: putative E3 ubiquitin-protein lig...    100   4e-20   
ref|XP_008390147.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT2      100   4e-20   
gb|KDO63139.1|  hypothetical protein CISIN_1g042263mg                 97.1    5e-20   
gb|EMS62697.1|  Putative E3 ubiquitin-protein ligase SINA-like 6        102   5e-20   
ref|XP_010511496.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...  98.2    5e-20   
emb|CDY36208.1|  BnaC06g27520D                                          102   5e-20   
gb|EMT30857.1|  E3 ubiquitin-protein ligase SINA-like protein 2       98.6    5e-20   
ref|XP_010233332.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...  98.2    6e-20   
gb|EMT09498.1|  E3 ubiquitin-protein ligase SINA-like 10              99.8    7e-20   
ref|XP_003633943.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  98.6    9e-20   
ref|XP_005089405.1|  PREDICTED: E3 ubiquitin-protein ligase SIAH1...  99.0    9e-20   
emb|CDM85461.1|  unnamed protein product                              99.0    1e-19   
ref|XP_006854147.1|  hypothetical protein AMTR_s00048p00177540        98.6    1e-19   
ref|XP_006301201.1|  hypothetical protein CARUB_v10021600mg           98.2    1e-19   
gb|EEC69851.1|  hypothetical protein OsI_00192                        97.8    1e-19   
ref|XP_009416451.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  98.2    2e-19   
ref|XP_010661948.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  97.4    2e-19   
ref|XP_010943647.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  97.8    2e-19   
ref|XP_002457470.1|  hypothetical protein SORBIDRAFT_03g007710        97.4    3e-19   
gb|EMS45356.1|  E3 ubiquitin-protein ligase SINA-like 10              97.4    3e-19   
ref|XP_003747929.1|  PREDICTED: E3 ubiquitin-protein ligase Siah1...  97.4    4e-19   
gb|EMT13584.1|  E3 ubiquitin-protein ligase SINA-like 10                100   4e-19   
dbj|BAK07993.1|  predicted protein                                    98.2    4e-19   
ref|XP_009375224.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  97.4    4e-19   
ref|XP_004494818.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  97.1    5e-19   
ref|XP_002263725.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  96.3    5e-19   
gb|ABC95994.1|  seven in absentia                                     95.5    5e-19   
ref|XP_008672970.1|  PREDICTED: ubiquitin-protein ligase/ zinc io...  96.7    5e-19   
ref|XP_006664938.1|  PREDICTED: uncharacterized protein LOC102705037    100   5e-19   
ref|XP_002406021.1|  E3 ubiquitin protein ligase SiaH1, putative      96.7    5e-19   
ref|XP_009364092.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  96.7    6e-19   
ref|XP_010240617.1|  PREDICTED: putative E3 ubiquitin-protein lig...  97.8    6e-19   
gb|EMT08150.1|  E3 ubiquitin-protein ligase SINA-like 10              99.4    7e-19   
gb|EMT12695.1|  Putative E3 ubiquitin-protein ligase SINA-like pr...  95.1    7e-19   
emb|CDM80362.1|  unnamed protein product                              96.3    7e-19   
ref|NP_001150969.1|  ubiquitin-protein ligase/ zinc ion binding p...  96.3    7e-19   
ref|XP_001984668.1|  GH16597                                          96.3    9e-19   
gb|ACL54358.1|  unknown                                               95.9    1e-18   
dbj|BAJ98755.1|  predicted protein                                    94.7    1e-18   
ref|XP_006301822.1|  hypothetical protein CARUB_v10022291mg           95.1    1e-18   
ref|XP_009389384.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  95.9    1e-18   
ref|XP_002030832.1|  GM25664                                          95.9    1e-18   
ref|NP_476725.1|  seven in absentia, isoform A                        95.9    1e-18   
ref|XP_007205606.1|  hypothetical protein PRUPE_ppa009039mg           95.5    1e-18   
ref|XP_002046688.1|  seven in absentia                                95.5    2e-18   
ref|XP_002025708.1|  GL20852                                          95.5    2e-18   
ref|XP_001957619.1|  GF23936                                          95.9    2e-18   
gb|KHG26771.1|  E3 ubiquitin-protein ligase SINAT4 -like protein      95.9    2e-18   
gb|AAW47608.1|  seven in absentia                                     95.1    2e-18   
gb|EMT07557.1|  Putative E3 ubiquitin-protein ligase SINA-like pr...  94.7    2e-18   
ref|XP_010055011.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT3    95.5    2e-18   
gb|AAD53877.1|AF175124_1  SINAH1 protein                              95.9    2e-18   
ref|XP_002455280.1|  hypothetical protein SORBIDRAFT_03g007720        95.5    2e-18   
dbj|GAA52231.1|  E3 ubiquitin-protein ligase SIAH1                    95.9    2e-18   
ref|XP_002299139.1|  hypothetical protein POPTR_0001s04770g           95.1    2e-18   
emb|CDX97399.1|  BnaC08g12640D                                        95.5    2e-18   
ref|XP_004690122.1|  PREDICTED: E3 ubiquitin-protein ligase Siah1...  96.7    2e-18   
ref|XP_002007325.1|  GI12443                                          95.1    2e-18   
emb|CAB89184.1|  SIAH2 protein                                        95.1    2e-18   
ref|XP_009402766.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  95.1    2e-18   
ref|XP_394284.2|  PREDICTED: E3 ubiquitin-protein ligase Siah1 is...  94.7    2e-18   
ref|XP_009392529.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  95.1    2e-18   
ref|XP_001653865.1|  seven in absentia, putative                      94.4    3e-18   
gb|ETN59040.1|  E3 ubiquitin-protein ligase sina                      94.4    3e-18   
ref|XP_010257505.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  94.7    3e-18   
ref|XP_008459990.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  94.7    3e-18   
gb|EFN64159.1|  E3 ubiquitin-protein ligase SIAH1                     94.4    3e-18   
ref|XP_004140587.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  94.7    3e-18   
ref|XP_007092327.1|  PREDICTED: E3 ubiquitin-protein ligase SIAH1...  94.4    3e-18   
ref|XP_002972272.1|  hypothetical protein SELMODRAFT_97849            94.7    3e-18   
ref|XP_001851156.1|  E3 ubiquitin-protein ligase sina                 94.4    3e-18   
ref|XP_001688791.1|  AGAP006127-PA                                    94.7    3e-18   
ref|XP_008786842.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  94.4    4e-18   
dbj|BAJ95432.1|  predicted protein                                    94.4    4e-18   
ref|XP_009164196.1|  hypothetical protein T265_01822                  95.1    4e-18   
ref|XP_009607471.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT5    94.7    4e-18   
ref|XP_004240070.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  94.7    4e-18   
gb|EYU38272.1|  hypothetical protein MIMGU_mgv1a010573mg              94.4    4e-18   
sp|P29304.1|SINA_DROVI  RecName: Full=E3 ubiquitin-protein ligase...  94.4    4e-18   
emb|CDX92848.1|  BnaC07g41060D                                        94.4    4e-18   
gb|EPS72485.1|  hypothetical protein M569_02273                       94.4    5e-18   
emb|CDM80361.1|  unnamed protein product                              94.0    5e-18   
ref|XP_008226952.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT...  94.0    5e-18   
ref|XP_005190071.1|  PREDICTED: E3 ubiquitin-protein ligase sina-...  94.0    5e-18   
ref|XP_009768953.1|  PREDICTED: E3 ubiquitin-protein ligase SINAT5    94.4    5e-18   
ref|XP_003565370.1|  PREDICTED: E3 ubiquitin-protein ligase SINA-...  93.6    5e-18   
ref|XP_003917603.1|  PREDICTED: E3 ubiquitin-protein ligase SIAH1...  93.6    6e-18   
ref|XP_007218737.1|  hypothetical protein PRUPE_ppa009142mg           94.0    6e-18   



>ref|XP_006364030.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like, partial 
[Solanum tuberosum]
Length=369

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 180/257 (70%), Gaps = 15/257 (6%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            GSIS TL+DPDVLDCPICF  L +P+FQCENGHIACASCCIK+ NKCPSC  PIG+NRCR
Sbjct  125  GSISVTLLDPDVLDCPICFEHLCVPVFQCENGHIACASCCIKIANKCPSCCLPIGYNRCR  184

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+E V+ESLKV C NN YGC+E + Y+K  +HE  CI+ PC CP+  C F+G+S +VY H
Sbjct  185  AMENVLESLKVSCVNNRYGCKEILSYSKNTEHENACIYVPCLCPSHGCDFIGTSAKVYAH  244

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F+++H   A+ I FN+   I ++K+QR+  LQ +T G++F++NH  D  GSA+N+IC+ P
Sbjct  245  FSDKHASSAEHIFFNAVHPIYIEKDQRYKILQMRTEGILFIINHASDRGGSAINIICVGP  304

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
               KRRF YKLV    E             +S KLE+VAE IP W  ++ LK FL+VP +
Sbjct  305  ARQKRRFSYKLVVTDGE-------------SSFKLESVAECIPNWSENSPLKKFLVVPRD  351

Query  272  VISDSWDHLKLEVCIKD  222
            V++ S   LKL V I++
Sbjct  352  VVNSSAP-LKLNVFIEE  367



>ref|XP_004234629.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Solanum 
lycopersicum]
 ref|XP_010317729.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Solanum 
lycopersicum]
 ref|XP_010317730.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Solanum 
lycopersicum]
 ref|XP_010317731.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Solanum 
lycopersicum]
 ref|XP_010317732.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Solanum 
lycopersicum]
Length=360

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 177/256 (69%), Gaps = 15/256 (6%)
 Frame = -2

Query  986  SISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            SIS TL+DPDVLDCPICF  L +P+FQC NGHIACA CCIK+ NKCPSC  PIG+NRCRA
Sbjct  117  SISVTLLDPDVLDCPICFEHLCVPVFQCGNGHIACAPCCIKIANKCPSCCLPIGYNRCRA  176

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +E V+ESLKV C NN YGC+E + Y+K  DHE  CI+ PC CP+  C F+G++ +VY HF
Sbjct  177  MENVLESLKVSCVNNRYGCKEILSYSKKTDHENACIYVPCFCPSHGCDFIGTAAKVYAHF  236

Query  626  TNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
            + +H   A  I+FN    I ++K+QR+I LQ +T G++F+VNH  D +GSA+N+IC+   
Sbjct  237  SEKHASSADHISFNVVHPIYIEKDQRYIILQMRTEGILFIVNHASDRVGSAINIICVGQA  296

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
              KRRF YKLV    E             +S KLE+VAE++P W   + +K FL+VP +V
Sbjct  297  RQKRRFSYKLVVTDGE-------------SSFKLESVAESVPNWTEDSPMKKFLVVPKDV  343

Query  269  ISDSWDHLKLEVCIKD  222
            ++ S   LKL+V I++
Sbjct  344  VNSSA-RLKLDVLIEE  358



>ref|XP_006364018.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Solanum 
tuberosum]
Length=396

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 180/271 (66%), Gaps = 15/271 (6%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             V+     +   +G GSIS  L DPDVLDCPIC   L +P+FQCENGHIACASCC K+ NK
Sbjct  130   VEDPDQNLEGSRGNGSISVMLSDPDVLDCPICLEHLRVPIFQCENGHIACASCCTKIANK  189

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             CPSC  PIG+NRCRA+EKVVES+KV C N  YGC+E + Y+K  DHE  CI+ PCSCP+ 
Sbjct  190   CPSCCWPIGYNRCRAMEKVVESVKVSCVNKMYGCKEILSYSKKTDHENACIYVPCSCPSH  249

Query  671   ACKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
              C F+G+S  VY HF+++H   A+ I FN+   I ++K+Q +  LQ +T G++F++NH  
Sbjct  250   GCDFIGTSTNVYAHFSDKHASSAEHIFFNAVHPIHIEKDQSYKILQMRTEGILFIINHAS  309

Query  494   DPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
             D +GSA N+IC+ P   KRRF YKLV    E             +S KLE+VAE IP W 
Sbjct  310   DRVGSAFNIICVGPSRQKRRFSYKLVVTDGE-------------SSFKLESVAECIPNWS  356

Query  314   PSAALKIFLLVPGNVISDSWDHLKLEVCIKD  222
              ++ LK FL+VP +V++ S   LKL V I++
Sbjct  357   ENSPLKKFLVVPRDVVNSSAP-LKLNVFIEE  386



>ref|XP_004234581.2| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Solanum 
lycopersicum]
Length=392

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 177/260 (68%), Gaps = 15/260 (6%)
 Frame = -2

Query  998  KGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFN  819
            +G GSIS  L DPDVLDCPIC   L++P+FQCENGHIACASCC K+ NKCPSC  PIG+N
Sbjct  137  RGNGSISVMLSDPDVLDCPICLEHLSVPVFQCENGHIACASCCTKIANKCPSCCWPIGYN  196

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEV  639
            RCRALEKV+ES+KV C N  YGC+E + Y+K  DHE  CI+ PC CP+  C FLG+S  V
Sbjct  197  RCRALEKVLESVKVSCVNKMYGCKEILSYSKKTDHENACIYVPCFCPSHGCDFLGTSTNV  256

Query  638  YTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
            Y HF ++H   A+ I FN+   I ++K+Q +  LQ +T G++F++NH  D +GSA N+IC
Sbjct  257  YAHFRDKHASSAEHIFFNAVHPIHIEKDQSYKILQMRTEGILFIINHASDRVGSAFNIIC  316

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            + P   KRRF YKLV    E             +S KLE+VAE++P W  S+ LK FL+V
Sbjct  317  VGPARQKRRFSYKLVVTDGE-------------SSFKLESVAESMPNWSESSPLKKFLVV  363

Query  281  PGNVISDSWDHLKLEVCIKD  222
            P +V++ S   LKL V I++
Sbjct  364  PRDVVNSSAP-LKLNVFIEE  382



>ref|XP_004234707.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Solanum 
lycopersicum]
Length=375

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/256 (51%), Positives = 177/256 (69%), Gaps = 15/256 (6%)
 Frame = -2

Query  986  SISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            SI  TL+D DVLDCPICF  L +P+FQC NGHIACA CCIK+ NKCPSC  PIG+NRCRA
Sbjct  132  SIFMTLLDLDVLDCPICFEHLCVPVFQCGNGHIACAPCCIKIANKCPSCCLPIGYNRCRA  191

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +E V+ESLKV C NN YGC+E + ++K  DHE  CI+ PC CP+  C F+G+S +VY HF
Sbjct  192  MENVLESLKVSCVNNRYGCKEILNFSKKTDHENACIYVPCFCPSHGCDFIGTSAKVYAHF  251

Query  626  TNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
            + +H   A+ I+FN+   I ++K+QR+I LQ +T G++F+VNH  D +GS++N+IC+   
Sbjct  252  SEKHASSAEHISFNAVHPIYIEKDQRYIILQMRTEGILFIVNHASDRVGSSINIICVGQA  311

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
              KRRF YKLV    E             +S KLE+VAE++P W   + +K FL+VP +V
Sbjct  312  RQKRRFSYKLVVTDGE-------------SSFKLESVAESVPNWSEDSPMKKFLVVPKDV  358

Query  269  ISDSWDHLKLEVCIKD  222
            ++ S   LKL+V I++
Sbjct  359  VNSSA-RLKLDVLIEE  373



>ref|XP_009587577.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Nicotiana 
tomentosiformis]
Length=394

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 173/259 (67%), Gaps = 17/259 (7%)
 Frame = -2

Query  998  KGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFN  819
            +G GSI  TL DPDVLDCPIC   L+ P+FQCENGHIACASCCIK+ NKCPSC  PIG+N
Sbjct  144  RGNGSIPVTLSDPDVLDCPICLEPLSTPVFQCENGHIACASCCIKIANKCPSCCWPIGYN  203

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEV  639
            RCRA+EKV+ES+KV C N +YGC+E + Y K  DHE  C + PCSCP   C F  +S +V
Sbjct  204  RCRAIEKVLESVKVSCMNKSYGCKEILSYGKKTDHENACTYVPCSCP--CCDFTATSTKV  261

Query  638  YTHF-TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
            Y HF  N     ++I FN+   I ++ +    YLQE+T GV+F++NH    LGSAVN+IC
Sbjct  262  YAHFRVNHGSLVEQIVFNAHHPIYVEYHHTCKYLQERTEGVIFIINHISYRLGSAVNIIC  321

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            I P S +RRF Y+LV    E             +S KLE+VAE++PK+  +  LK FLLV
Sbjct  322  IEPTSEERRFPYELVVSNGE-------------SSFKLESVAESVPKFSQNLPLKKFLLV  368

Query  281  PGNVISDSWDHLKLEVCIK  225
            P +V+ DS   LKL+V IK
Sbjct  369  PTDVV-DSSAKLKLDVFIK  386



>ref|XP_011097140.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Sesamum 
indicum]
Length=411

 Score =   254 bits (650),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 176/270 (65%), Gaps = 17/270 (6%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGS--ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLIN  855
             +G   G +  +G     +S TL+DPDVLDCPIC   L+ P+ QCENGHIACASCCIK+ N
Sbjct  138   NGTGRGSVPARGDAPAPVSVTLVDPDVLDCPICLEPLSPPVNQCENGHIACASCCIKMRN  197

Query  854   KCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPN  675
             KC SC  PIG+NRCRALEKV+ES++V C N  +GC ES+ Y+K  DHE TC + PCSCP+
Sbjct  198   KCASCCWPIGYNRCRALEKVLESIRVSCGNMLHGCTESLSYSKKLDHERTCKYAPCSCPH  257

Query  674   RACKFLGSSKEVYTHFTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHH  498
               C ++G  K +YTHF + H ++  +  FN    ISL  +Q   +LQEKT  ++F++N  
Sbjct  258   PDCNYVGLPKGLYTHFASEHSRSSTQFRFNYGFPISLDNSQTHAFLQEKTESILFILNRS  317

Query  497   MDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW  318
              +PLGS VNV+CIAP SSKR F Y+L A+             +  +SIKL+ +AE+IP+W
Sbjct  318   FEPLGSFVNVMCIAPTSSKREFSYELTAK-------------DGFSSIKLKTIAESIPQW  364

Query  317   DPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
                  +K  +LVP + I+ S   LKLEV I
Sbjct  365   ITQPPVKKCVLVPNDFIT-SAGQLKLEVTI  393



>emb|CDP02721.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 167/261 (64%), Gaps = 14/261 (5%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
              G   G IS TL DPDVLDCPIC   L+IP+FQCENGHIAC+SCC+K+ NKCPSC+ PIG
Sbjct  115   DGNRDGPISVTLTDPDVLDCPICIEPLSIPVFQCENGHIACSSCCLKIRNKCPSCSWPIG  174

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
             +NRCRA+EKV+ES+KV C N  YGC + ++Y    +HE TCI  PCSCP   C F+GS+ 
Sbjct  175   YNRCRAIEKVLESVKVSCRNIKYGCTQMVRYCNKHEHENTCILAPCSCPLLDCNFVGSAW  234

Query  644   EVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
             ++Y+HF  RH           P  ISL+K+QR I L+E  G ++F++NH  +  GSA+N+
Sbjct  235   QLYSHFKLRHPASGNTFLLGKPFSISLEKSQRSIILREGDGNIIFILNHFNERHGSAINI  294

Query  467   ICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFL  288
             + IAP  S  RF Y L  R             +  TSI+L++  E+I KW  SA  K FL
Sbjct  295   VRIAPLGSGTRFSYDLTVR-------------DGDTSIRLQSSVESIRKWVDSAPAKKFL  341

Query  287   LVPGNVISDSWDHLKLEVCIK  225
             LVP    + +   L+L+VCI+
Sbjct  342   LVPCYYYTSNCGQLELDVCIR  362



>ref|XP_009804895.1| PREDICTED: uncharacterized protein LOC104250058 [Nicotiana sylvestris]
Length=795

 Score =   255 bits (652),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 171/256 (67%), Gaps = 17/256 (7%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            GSIS TL DPDVLDCPIC   L+ P+FQCENGHIACASCCIK+ NKCPSC  PIG+NRCR
Sbjct  548  GSISVTLSDPDVLDCPICLEPLSTPVFQCENGHIACASCCIKIANKCPSCCWPIGYNRCR  607

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES+KV C N  YGC+E + Y    DHE  C + PC+CP   C F  +S +VY H
Sbjct  608  AIEKVLESVKVSCMNKIYGCKEILSYGNKTDHENACTYDPCTCP--CCDFTAASTKVYAH  665

Query  629  FTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F  +H    ++I +++   I ++ +    YLQE+T G++F++NH    LGSAVN+ICI P
Sbjct  666  FRVKHGSLVEQIVYDAHHPIYVEYHHTCKYLQERTQGIIFIINHISYRLGSAVNIICIEP  725

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
             S KRRF Y+LV    E             +S KLE+VAE++PK+  +  LK FLLVP +
Sbjct  726  TSEKRRFRYELVVTNGE-------------SSFKLESVAESMPKFSQNLPLKKFLLVPID  772

Query  272  VISDSWDHLKLEVCIK  225
            V+ DS   LKL+V IK
Sbjct  773  VV-DSSTKLKLDVFIK  787


 Score =   245 bits (625),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 169/270 (63%), Gaps = 22/270 (8%)
 Frame = -2

Query  1007  MSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPI  828
                +G  S++ TL DPDVLDCPIC   L++P+FQCENGHIACASCC K+ NKCPSC  PI
Sbjct  69    QDSRGNKSLAMTLSDPDVLDCPICVEILSVPVFQCENGHIACASCCFKIANKCPSCCCPI  128

Query  827   GFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSS  648
             G+ RCR +EKV++S+KV C N  +GC+E   Y     HE  CI+ PCSCP   C F+  S
Sbjct  129   GYIRCRVIEKVLDSVKVSCVNKRFGCKEIRSYGNKTAHENACIYAPCSCPYDGCDFVDPS  188

Query  647   KEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHH-MDPLGSAV  474
              ++Y HF ++H   A+ I FN+   I ++KNQ +  +QEKT G++F++NH   D  GSAV
Sbjct  189   TKLYAHFRDKHGSLAEHIFFNTVHPIYIEKNQTYQIIQEKTEGIIFIINHSTQDHPGSAV  248

Query  473   NVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKI  294
             N+IC+ P    RRF Y+LVA             GE T   KL ++AEN+PKW  +  LK 
Sbjct  249   NIICVGPALQTRRFRYELVA-----------TDGEST--FKLGSIAENVPKWPENFPLKK  295

Query  293   FLLVPGNVISDSWD-------HLKLEVCIK  225
             +LL+P +++  +          LKLEV I+
Sbjct  296   YLLLPRDLVDSTLSFEEREVAQLKLEVFIE  325



>ref|XP_011099492.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Sesamum 
indicum]
Length=402

 Score =   239 bits (610),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 158/248 (64%), Gaps = 14/248 (6%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             SG   G IS TL DPDVLDCPICF  L  P++QCENGHIAC SCC ++ NKC SC  PIG
Sbjct  151   SGGPSGPISVTLTDPDVLDCPICFEPLCSPVYQCENGHIACGSCCTRMRNKCASCCWPIG  210

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
             +NRCRA+EKV+ES+K+ C N  +GC+E++ Y+K   HE TC + PCSCP+  C ++G  K
Sbjct  211   YNRCRAIEKVLESVKITCRNMPHGCKETLSYSKKLAHEKTCNYAPCSCPHPGCNYVGVCK  270

Query  644   EVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
              +Y HF  +H   +K+  FNS   I L  NQ  + LQE++  ++F++N  ++  GS VNV
Sbjct  271   SLYAHFALQHSHSSKQFRFNSATSILLDTNQNHVILQERSHSMLFILNRSIESRGSFVNV  330

Query  467   ICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFL  288
             +C+AP S++R FLY L A   E             +SIKL   A+ +PKW      K++L
Sbjct  331   VCVAPASAERAFLYDLTATVGE-------------SSIKLRTWADCVPKWMADPPAKMYL  377

Query  287   LVPGNVIS  264
              VP + +S
Sbjct  378   FVPRDFMS  385



>ref|XP_010108933.1| E3 ubiquitin-protein ligase SINA-like 10 [Morus notabilis]
 gb|EXC20573.1| E3 ubiquitin-protein ligase SINA-like 10 [Morus notabilis]
Length=366

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 167/262 (64%), Gaps = 16/262 (6%)
 Frame = -2

Query  1007  MSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPI  828
             +S     SIS  L DPDVLDC ICF +LT+P+FQCENGHIAC+SCC KL NKCPSC+ PI
Sbjct  104   LSTNSDRSISVFLTDPDVLDCCICFEALTVPVFQCENGHIACSSCCTKLGNKCPSCSWPI  163

Query  827   GFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSS  648
             G+NRCRA+EKV+ES+K+ C N  YGC+E + Y++++DHE TC H PCSCP  +C F+ S+
Sbjct  164   GYNRCRAIEKVLESVKIACQNKQYGCKEMVSYSEIKDHETTCTHAPCSCPLTSCNFISSA  223

Query  647   KEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVN  471
             K++Y HF ++H   A    +N    ++L +  +F+ LQE+ GG +F++N+  + LG+ V+
Sbjct  224   KQLYQHFRSQHADSAVLFQYNCDFTVTLNEGDKFLVLQERDGGGLFILNNETETLGNLVS  283

Query  470   VICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIF  291
             V CI P S  + + Y L+A+       C G       +++LE+ A         +   ++
Sbjct  284   VSCIGPYSFGKSY-YNLLAK-------CDG------NTLRLESFATCTQGQADYSLSSVY  329

Query  290   LLVPGNVISDSWDHLKLEVCIK  225
             LL+P      S   LKL++ I+
Sbjct  330   LLIPPGFFGSSG-QLKLDLFIE  350



>ref|XP_007033104.1| RING/U-box and TRAF-like domains, putative isoform 1 [Theobroma 
cacao]
 gb|EOY04030.1| RING/U-box and TRAF-like domains, putative isoform 1 [Theobroma 
cacao]
Length=363

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/285 (42%), Positives = 177/285 (62%), Gaps = 16/285 (6%)
 Frame = -2

Query  1025  GVSNGVMSGKG--KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             G   G MS +    GSIS TL DP+VLDC IC+ +LTIP+FQCENGHIAC+ CCIK+ NK
Sbjct  77    GAEQGAMSLETNRDGSISITLTDPEVLDCSICYEALTIPVFQCENGHIACSICCIKIRNK  136

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             CPSCA+PIG++RCRA+EKV+ES+KV C N  YGC E+ +Y+  + HE  C + PCSCP  
Sbjct  137   CPSCATPIGYSRCRAIEKVLESVKVSCQNTKYGCREAFRYSIKQKHEKICPYAPCSCPLA  196

Query  671   ACKFLGSSKEVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
              C F GSSKE+Y HF ++H   A R  ++    I++  ++RF  LQE+  G +F++N+ +
Sbjct  197   DCNFEGSSKELYEHFRDKHKYSATRFQYDRTISITVGIDERFCILQEEQDGSLFILNNKV  256

Query  494   DPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
             + LG+ V +  I P S +R F Y L+A+   E            ++++L++  ++ PK  
Sbjct  257   ETLGNVVTLSRIGP-SEERGFFYDLMAKALTE-----------ASTVRLQSFTKSTPKQV  304

Query  314   PSAALKIFLLVPGNVISDSWDHLKLEVCIKDLA*DSMDTYMSGFL  180
              +     FLLVP     +S   LK+++ +   A  S   ++ G++
Sbjct  305   DNPPSLGFLLVPSQFSCNS-RKLKMDLRLWHHAWRSPTRWLCGYV  348



>ref|XP_006430664.1| hypothetical protein CICLE_v10012174mg [Citrus clementina]
 gb|ESR43904.1| hypothetical protein CICLE_v10012174mg [Citrus clementina]
 gb|KDO63140.1| hypothetical protein CISIN_1g020280mg [Citrus sinensis]
Length=328

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 159/258 (62%), Gaps = 16/258 (6%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G  S T+ DP+V DCPIC+ SLT P+FQCENGHIAC++CC K++NKCPSC +PIG+NRCR
Sbjct  74   GPFSVTVTDPEVFDCPICYESLTAPVFQCENGHIACSTCCSKIMNKCPSCCTPIGYNRCR  133

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES+KV C N+ YGC+ ++ Y K  DHE  C H PCSCP   C F+GS+  +Y H
Sbjct  134  AIEKVLESVKVTCRNSNYGCKVTMSYGKKHDHEKICPHVPCSCPIPDCNFVGSANHLYKH  193

Query  629  FTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F+ +H   A    +N   +++L    RFI LQE+  GV+F+++   + LG  ++V CIAP
Sbjct  194  FSAKHKNSALHFLYNEVVEVTLNVKNRFIVLQEEGDGVLFILSSRSETLGHVISVSCIAP  253

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
             S K    Y + A             G   ++++ ++  +NI     +     FLLVP  
Sbjct  254  -SCKGCLFYSIFA-------------GPAGSTVRFQSFTKNIQNRVDNPPSTGFLLVPIE  299

Query  272  VISDSWDHLKLEVCIKDL  219
                S D LKLE+CI+ L
Sbjct  300  SFGSSGD-LKLELCIRRL  316



>ref|XP_007033105.1| Ubiquitin-protein ligase, putative isoform 2 [Theobroma cacao]
 gb|EOY04031.1| Ubiquitin-protein ligase, putative isoform 2 [Theobroma cacao]
Length=348

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 169/267 (63%), Gaps = 16/267 (6%)
 Frame = -2

Query  1025  GVSNGVMSGKG--KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             G   G MS +    GSIS TL DP+VLDC IC+ +LTIP+FQCENGHIAC+ CCIK+ NK
Sbjct  77    GAEQGAMSLETNRDGSISITLTDPEVLDCSICYEALTIPVFQCENGHIACSICCIKIRNK  136

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             CPSCA+PIG++RCRA+EKV+ES+KV C N  YGC E+ +Y+  + HE  C + PCSCP  
Sbjct  137   CPSCATPIGYSRCRAIEKVLESVKVSCQNTKYGCREAFRYSIKQKHEKICPYAPCSCPLA  196

Query  671   ACKFLGSSKEVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
              C F GSSKE+Y HF ++H   A R  ++    I++  ++RF  LQE+  G +F++N+ +
Sbjct  197   DCNFEGSSKELYEHFRDKHKYSATRFQYDRTISITVGIDERFCILQEEQDGSLFILNNKV  256

Query  494   DPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
             + LG+ V +  I P S +R F Y L+A+   E            ++++L++  ++ PK  
Sbjct  257   ETLGNVVTLSRIGP-SEERGFFYDLMAKALTE-----------ASTVRLQSFTKSTPKQV  304

Query  314   PSAALKIFLLVPGNVISDSWDHLKLEV  234
              +     FLLVP     +S   LK+++
Sbjct  305   DNPPSLGFLLVPSQFSCNS-RKLKMDL  330



>ref|XP_006482161.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Citrus 
sinensis]
Length=330

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 159/258 (62%), Gaps = 16/258 (6%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G  S T+ DP+V DCPIC+ SLT P+FQCENGHIAC++CC K++NKCPSC +PIG+NRCR
Sbjct  76   GPFSVTVTDPEVFDCPICYESLTAPVFQCENGHIACSTCCSKIMNKCPSCCTPIGYNRCR  135

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES+KV C N+ YGC+ ++ Y K  DHE  C H PCSCP   C F+GS+  +Y H
Sbjct  136  AIEKVLESVKVTCRNSNYGCKVTMSYGKKHDHEKICPHVPCSCPIPDCNFVGSANHLYKH  195

Query  629  FTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F+ +H   A    +N   +++L  N RFI LQE+  GV+F+++   + LG  ++V CIAP
Sbjct  196  FSAKHKNSALHFLYNEVVEVTLNVNNRFIVLQEEGDGVLFILSSRSETLGHVISVSCIAP  255

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
               K    Y + A             G   ++++ ++  +NI     +     FLLVP  
Sbjct  256  -LCKGCLFYSIFA-------------GPAGSTVRFQSFTKNIQNRVDNPPSTGFLLVPIE  301

Query  272  VISDSWDHLKLEVCIKDL  219
                S D LKLE+CI+ L
Sbjct  302  SFGSSGD-LKLELCIRRL  318



>ref|XP_011046039.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Populus euphratica]
Length=404

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 164/259 (63%), Gaps = 17/259 (7%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G+I ATL DP+VLDCPIC  SLTIP+FQCENGH AC+SCC KL +KCPSCA PIG+NRCR
Sbjct  144  GAIYATLSDPEVLDCPICCESLTIPVFQCENGHTACSSCCRKLQHKCPSCAMPIGYNRCR  203

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ESLKV C N +YGC ESI Y+K  +H+ +C H PC+CP  AC + GSSK +Y H
Sbjct  204  AIEKVLESLKVSCSNRSYGCRESICYSKKYEHDKSCAHAPCTCPLPACNYQGSSKHLYLH  263

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
              ++H+       FN+   +    + +F+ LQE+  GV+F++ +  + LG+ + V C+ P
Sbjct  264  CRSKHLCDLTSFQFNTSFPLFFMVDHKFLVLQEEKEGVLFILTNRSECLGNVITVSCMGP  323

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP-KWDPSAALKIFLLVPG  276
             SSK+ + Y+L A+    N             ++ ++   NI  + D   +L  FLLVP 
Sbjct  324  SSSKQGYFYELTAKAVGSN-------------VRFQSSTRNIQTRVDHPPSLG-FLLVPN  369

Query  275  NVISDSWDHLKLEVCIKDL  219
            + +  +   + L+VCI  L
Sbjct  370  DFLG-THGGITLDVCIWRL  387



>gb|KDP22664.1| hypothetical protein JCGZ_02506 [Jatropha curcas]
Length=384

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 161/256 (63%), Gaps = 16/256 (6%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G I  TL DP+VLDCP+C+ SLTIP+FQCENGH AC+SCC KL+ KCP+C+ PIG+NRCR
Sbjct  103  GGICVTLTDPEVLDCPVCYESLTIPVFQCENGHTACSSCCKKLLQKCPTCSLPIGYNRCR  162

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES+++ C N  YGC+E + Y+K  DHE  C H PC CP+  C F+GSS+++Y H
Sbjct  163  AIEKVLESVRLSCQNLKYGCKEIVNYSKKVDHEKICSHAPCFCPSSGCSFVGSSRQIYQH  222

Query  629  FTNRHVQAKRI-TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F+N+H  A  +  + +   +    N +   L+E+  GV+F++N+  + +G+ + V CI P
Sbjct  223  FSNKHKGAAVLFRYGNTFPVFFTLNDKSRILREEKEGVLFILNNTAEVVGNIITVSCIGP  282

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW-DPSAALKIFLLVPG  276
             S K  + Y+L A+ E  N             +K ++  +NI K  D     + FL+VP 
Sbjct  283  SSPKGGYFYELAAKMEGSN-------------LKFQSFTKNIRKVNDDDPHSQDFLVVPA  329

Query  275  NVISDSWDHLKLEVCI  228
            +    S+  + L++CI
Sbjct  330  SFFG-SYGQISLDLCI  344



>gb|ACU24390.1| unknown [Glycine max]
Length=320

 Score =   218 bits (555),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 165/265 (62%), Gaps = 17/265 (6%)
 Frame = -2

Query  1016  NGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCA  837
             NG  +     S+   + DPDVLDC IC+  LT P+FQCENGHIAC+ CC++L NKCP C+
Sbjct  69    NGAGTSTRDRSVPIFVSDPDVLDCCICYEPLTSPVFQCENGHIACSICCVRLSNKCPMCS  128

Query  836   SPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFL  657
              PIG+NRCRA+EKV+E +K+ CPN  YGC+E++ Y+K  +HE  CI+ PCSCP   C F+
Sbjct  129   MPIGYNRCRAIEKVLECIKMSCPNANYGCKETLSYSKKNEHEKECIYLPCSCPFTGCDFI  188

Query  656   GSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGS  480
              SSKE++ HF++RHV    + T++    + L  NQR + L+EK+ G +FVV+++++ LG+
Sbjct  189   ASSKELFLHFSHRHVGSGTQFTYDKFFTVFLSINQRTVVLKEKSDGNLFVVHNNLEHLGN  248

Query  479   AVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL  300
              V + CI P S+   F Y+++AR              +  ++ L++  + +      A  
Sbjct  249   IVRISCIGPKSTT-EFQYEVLAR-------------HQGNALILQSFTKIVQGQYTDAPF  294

Query  299   KIFLLVPGNVISDSWDHLKLEVCIK  225
               FLL+P  +      HLKL++ IK
Sbjct  295   STFLLIPSCLFGSP--HLKLDIRIK  317



>ref|XP_003531068.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine 
max]
Length=320

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 165/265 (62%), Gaps = 17/265 (6%)
 Frame = -2

Query  1016  NGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCA  837
             NG  +     S+   + DPDVLDC IC+  LT P+FQCENGHIAC+ CC++L NKCP C+
Sbjct  69    NGAGTSTRDRSVPIFVSDPDVLDCCICYEPLTSPVFQCENGHIACSICCVRLSNKCPMCS  128

Query  836   SPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFL  657
              PIG+NRCRA+EKV+E +K+ CPN  YGC+E++ Y+K  +HE  CI+ PCSCP   C F+
Sbjct  129   MPIGYNRCRAIEKVLECIKMSCPNANYGCKETLSYSKKNEHEKECIYLPCSCPFTGCDFI  188

Query  656   GSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGS  480
              SSKE++ HF++RHV    + T++    + L  NQR + L+EK+ G +FVV+++++ LG+
Sbjct  189   ASSKELFLHFSHRHVGSGTQFTYDKFFTVFLSINQRTVVLKEKSDGNLFVVHNNLEHLGN  248

Query  479   AVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL  300
              V + CI P S+   F Y+++AR              +  ++ L++  + +      A  
Sbjct  249   IVRISCIGPKSTT-EFQYEVLAR-------------HQGNALILQSFTKIVQGQYTDAPS  294

Query  299   KIFLLVPGNVISDSWDHLKLEVCIK  225
               FLL+P  +      HLKL++ IK
Sbjct  295   STFLLIPSCLFGSP--HLKLDIRIK  317



>gb|KHN39162.1| E3 ubiquitin-protein ligase SINA-like 10 [Glycine soja]
Length=320

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 165/265 (62%), Gaps = 17/265 (6%)
 Frame = -2

Query  1016  NGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCA  837
             NG  +     S+   + DPDVLDC IC+  LT P+FQCENGHIAC+ CC++L NKCP C+
Sbjct  69    NGAGTSTRDRSVPIFVSDPDVLDCCICYEPLTSPVFQCENGHIACSICCVRLSNKCPMCS  128

Query  836   SPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFL  657
              PIG+NRCRA+EKV+E +K+ CPN  YGC+E++ Y+K  +HE  CI+ PCSCP   C F+
Sbjct  129   MPIGYNRCRAIEKVLECIKMSCPNANYGCKETLSYSKKNEHEKECIYLPCSCPFTGCDFV  188

Query  656   GSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGS  480
              SSKE++ HF++RHV    + T++    + L  NQR + L+EK+ G +FVV+++++ LG+
Sbjct  189   ASSKELFLHFSHRHVGSGTQFTYDKFFTVFLSINQRTVVLKEKSDGNLFVVHNNLEHLGN  248

Query  479   AVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL  300
              V + CI P S+   F Y+++AR              +  ++ L++  + +      A  
Sbjct  249   IVRISCIGPKSTT-EFQYEVLAR-------------HQGNALILQSFTKIVQGQYTDAPS  294

Query  299   KIFLLVPGNVISDSWDHLKLEVCIK  225
               FLL+P  +      HLKL++ IK
Sbjct  295   STFLLIPSCLFGSP--HLKLDIRIK  317



>ref|XP_008229332.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 isoform 
X1 [Prunus mume]
Length=422

 Score =   218 bits (556),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 166/268 (62%), Gaps = 16/268 (6%)
 Frame = -2

Query  1040  AGIVDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKL  861
             AG+ +G S   +S    GS+  TL DP+VLDC IC+  LTIP+FQCENGHIAC+SCC K+
Sbjct  152   AGVQEG-SPPPISPVTDGSLVFTLADPEVLDCLICYEPLTIPVFQCENGHIACSSCCTKI  210

Query  860   INKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSC  681
              NKCPSC+ PIG+NRCRA+EK++ES+++ C N  +GC+E + YNK  +HE  C+++PCSC
Sbjct  211   KNKCPSCSWPIGYNRCRAIEKILESIRISCQNIKHGCKEMVTYNKKNEHEKACVYSPCSC  270

Query  680   PNRACKFLGSSKEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVN  504
             P   C F+ SSK++Y HFT  HV  A R  +     I+L    +F+ LQEK  G++F+++
Sbjct  271   PLSGCNFISSSKQLYLHFTVSHVDYATRFLYGINFSITLNIKDKFLVLQEKREGILFILD  330

Query  503   HHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP  324
             +H + LG+ V++ CI P   K  F Y L+A+  E             +S++ ++  +N  
Sbjct  331   NHAEKLGNLVSLCCIQP-IFKGGFYYDLLAKTNE-------------SSLRFQSFTKNSA  376

Query  323   KWDPSAALKIFLLVPGNVISDSWDHLKL  240
                 S +   + ++P +  S    H+ L
Sbjct  377   GQVISPSSTGYFIIPSDFFSSGKLHMDL  404



>ref|XP_008460511.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Cucumis melo]
Length=350

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/275 (43%), Positives = 164/275 (60%), Gaps = 23/275 (8%)
 Frame = -2

Query  1028  DGVSNGVMSGKG-------KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCC  870
             DG    + SGK         GS+S  LIDP+VLDC IC   L+IP+FQCENGHIAC+SCC
Sbjct  80    DGGKRALWSGKSCTKNAKPNGSVSMFLIDPEVLDCSICCEPLSIPIFQCENGHIACSSCC  139

Query  869   IKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTP  690
              KL NKC +C+ PIG+NRCRA+EKV+ES+K+PC  + +GC+E I Y    DHE TC++ P
Sbjct  140   NKLKNKCATCSWPIGYNRCRAVEKVLESIKLPCKQSKFGCKEIIGYGNESDHEKTCLYAP  199

Query  689   CSCPNRACKFLGSSKEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVF  513
             C CP   CKF+ S+K++  HF+N+H   A    F+S   I LK N  +  LQE+  GV+F
Sbjct  200   CLCPYSDCKFIASAKQLSLHFSNKHTNSATNFHFSSSFTICLKTNDTYHVLQEQD-GVLF  258

Query  512   VVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAE  333
             ++++  + LGS V + C+ P S K  F Y L A  ++              S+ L++  +
Sbjct  259   ILSNSSENLGSVVKICCLQPPSLKETFSYDLRAETQD-------------LSLVLQSSMK  305

Query  332   NIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
             NI           FL++P ++ S S   +KL +CI
Sbjct  306   NIQSSSDCCHSTRFLMIPRDLFSSS-GMIKLNICI  339



>ref|XP_002532642.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF29745.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=374

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 160/258 (62%), Gaps = 20/258 (8%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
             +I  TL DP+VLDCPIC+  L+IP+FQCENGH AC+SCC KL +KCPSC+ PIG+NRCR
Sbjct  108  AAICVTLTDPEVLDCPICYECLSIPVFQCENGHTACSSCCRKLAHKCPSCSLPIGYNRCR  167

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES+K+PC N  YGC+E + Y+K  DH+  C + PCSCP   C F+GSS+++Y H
Sbjct  168  AIEKVLESVKLPCHNLKYGCKEMVSYSKKLDHDKICNNAPCSCPLSGCSFVGSSRQLYQH  227

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F+ +H   A    +N    +    N + + LQE+  GVVF + +  + LG+ + V C+  
Sbjct  228  FSIKHKGSAAPFRYNITFPVFFTLNDKSLILQEEKEGVVFFLKNTAEILGNVITVNCLGG  287

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW---DPSAALKIFLLV  282
             SSK  + Y+L AR E  N             +K ++  +NI K    DP +    FL++
Sbjct  288  PSSKGGYFYELAARMEGSN-------------LKFQSFTKNIQKVNHDDPHS--DTFLII  332

Query  281  PGNVISDSWDHLKLEVCI  228
            PG+    S+  + L++CI
Sbjct  333  PGSFFG-SYGQISLDLCI  349



>ref|XP_006372377.1| seven in absentia family protein [Populus trichocarpa]
 gb|ERP50174.1| seven in absentia family protein [Populus trichocarpa]
Length=403

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 162/260 (62%), Gaps = 17/260 (7%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G I ATL DP+VLDCPIC   LTIP+FQC+NGH AC+SCCIKL +KCPSC  PIG+NRCR
Sbjct  143  GVIYATLSDPEVLDCPICCEPLTIPVFQCDNGHTACSSCCIKLQHKCPSCTMPIGYNRCR  202

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ESLKV C N++YGC+ESI Y+K  +H+ +C H PC+CP  AC + GSSK +Y H
Sbjct  203  AIEKVLESLKVSCSNSSYGCKESICYSKKYEHDKSCTHAPCTCPLPACNYQGSSKRLYQH  262

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               +H+       FN+   +    + +F  LQE+   V+F++ +  + LG+ + V C+ P
Sbjct  263  CRIKHLCDLTSFQFNTSFPLFFMVDHKFRVLQEEKEDVLFILTNRSECLGNVITVSCMGP  322

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENI-PKWDPSAALKIFLLVPG  276
             SSK+ + Y+L A+ E  N             ++ ++   NI  + D   +L  FLLVP 
Sbjct  323  SSSKQGYFYELTAKAEGSN-------------VRFQSSTRNIQTRVDHPPSLG-FLLVPN  368

Query  275  NVISDSWDHLKLEVCIKDLA  216
            + +  +   + L+VCI  L 
Sbjct  369  DFLG-THGGITLDVCIWRLG  387



>gb|EYU44590.1| hypothetical protein MIMGU_mgv1a008310mg [Erythranthe guttata]
Length=378

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 161/273 (59%), Gaps = 13/273 (5%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             V      V S    GSI+ T+ D D LDCPICF  L  P++QCENGHIAC SCC  +  K
Sbjct  112   VQATEARVDSEGDTGSITVTITDKDALDCPICFDPLCAPIYQCENGHIACESCCNSMHKK  171

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             C SC  PIG+NRCRA+E+VVES+ + C N  +GC  ++ Y+K  DHE TC++ PCSCP+ 
Sbjct  172   CASCQWPIGYNRCRAIERVVESVLIRCRNMLHGCPATLNYSKKLDHERTCVYAPCSCPHI  231

Query  671   ACKFLGSSKEVYTHFTNRH-VQAKRITFNSPRQISL-KKNQRFIYLQEKTGGVVFVVNHH  498
              C ++G SK +Y HF  RH + A    F++   +     N + ++L+E++  ++F+VN  
Sbjct  232   RCDYVGMSKSLYAHFATRHPLAATNFCFDTVFTVEFYDSNTKHVFLRERSRDILFIVNRC  291

Query  497   MDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW  318
             +   GS+VNV+ +AP S+KR F Y L A            + E  +SIKL+   E++P +
Sbjct  292   VLAGGSSVNVVRVAPSSAKREFSYSLTA----------TSAYEADSSIKLKTRVESMPIF  341

Query  317   DPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
              P      +LLVP + +  +   L LEV I+ +
Sbjct  342   RPEEPATAYLLVPSDFMRTNG-KLVLEVMIRKV  373



>gb|KHN22942.1| E3 ubiquitin-protein ligase SINA-like 10 [Glycine soja]
Length=320

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/266 (41%), Positives = 159/266 (60%), Gaps = 17/266 (6%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             +NG  +     S+   + DPDVLDC IC+  L  P+FQCENGHIAC++CC++L NKCP C
Sbjct  68    ANGAGTSSRDRSVPIFVSDPDVLDCCICYEPLAAPVFQCENGHIACSTCCVRLSNKCPMC  127

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
               PIG+NRCRA+EKV+E +K+ CPN  YGC+E+  Y++  +HE  CI+ PCSCP   C F
Sbjct  128   LMPIGYNRCRAIEKVLECIKMSCPNANYGCKETFSYSRKNNHEKECIYLPCSCPLTGCDF  187

Query  659   LGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLG  483
             + SSKE++ HF++RHV    R  ++    + L  NQR I LQEK  G +F+V+++ + LG
Sbjct  188   VASSKELFLHFSHRHVGMGTRFAYDKFFTVFLSINQRTIVLQEKNDGNLFIVHNNHEHLG  247

Query  482   SAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAA  303
             + V + CI P  S   F Y+++AR              +  ++ L++  + +      A 
Sbjct  248   NIVRISCIGP-KSMAEFQYEVLAR-------------HQGNALILQSFTKIVQGQYADAP  293

Query  302   LKIFLLVPGNVISDSWDHLKLEVCIK  225
                FLL+P  +       LKL++ IK
Sbjct  294   SSTFLLIPSCLFGSP--QLKLDIRIK  317



>ref|XP_003524774.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Glycine 
max]
Length=320

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/266 (41%), Positives = 159/266 (60%), Gaps = 17/266 (6%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             +NG  +     S+   + DPDVLDC IC+  L  P+FQCENGHIAC++CC++L NKCP C
Sbjct  68    ANGAGTSSRDRSVPIFVSDPDVLDCCICYEPLAAPVFQCENGHIACSTCCVRLSNKCPMC  127

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
               PIG+NRCRA+EKV+E +K+ CPN  YGC+E+  Y++  +HE  CI+ PCSCP   C F
Sbjct  128   LMPIGYNRCRAIEKVLECIKMSCPNANYGCKETFSYSRKNNHEKECIYLPCSCPLTGCDF  187

Query  659   LGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLG  483
             + SSKE++ HF++RHV    R  ++    + L  NQR I LQEK  G +F+V+++ + LG
Sbjct  188   VASSKELFLHFSHRHVGMGTRFAYDKFFTVFLSINQRTIVLQEKNDGNLFIVHNNHEHLG  247

Query  482   SAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAA  303
             + V + CI P  S   F Y+++AR              +  ++ L++  + +      A 
Sbjct  248   NIVRISCIGP-KSMAEFQYEVLAR-------------HQGNALILQSFTKIVQGQYADAP  293

Query  302   LKIFLLVPGNVISDSWDHLKLEVCIK  225
                FLL+P  +       LKL++ IK
Sbjct  294   SSTFLLIPSCLFGSP--QLKLDIRIK  317



>ref|XP_004303331.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Fragaria 
vesca subsp. vesca]
Length=355

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/254 (42%), Positives = 158/254 (62%), Gaps = 16/254 (6%)
 Frame = -2

Query  986  SISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            SIS TL DPDVLDCPIC  SLT+P+FQCENGHIAC+SC  K+ NKCPSC+ PIG+NRCRA
Sbjct  108  SISITLADPDVLDCPICCESLTVPVFQCENGHIACSSCSTKVKNKCPSCSWPIGYNRCRA  167

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +EKV+ES+++ C N  YGC+E +  +   +HE  C+H+PCSCP+  C F+ S+K++Y HF
Sbjct  168  IEKVLESIRISCQNIKYGCKEWMTCDNKNEHEKGCMHSPCSCPHSGCNFVSSTKQLYQHF  227

Query  626  TNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
            ++ H+  A R  +N    I++  N +F+ LQE+  G++F++++  + +G+ V +  I P 
Sbjct  228  SSNHLNSATRFLYNCSFSITINFNDKFVVLQEENDGMLFILDNESEIIGNMVRLSSIQP-  286

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
                 F Y L A+              K   ++L++   +      S      L++PG+ 
Sbjct  287  RFMGGFFYDLTAK-------------RKGCLLRLQSFTTSTQSHVRSPTSSGSLIIPGDF  333

Query  269  ISDSWDHLKLEVCI  228
             S S   LKL++CI
Sbjct  334  FS-SCGQLKLDICI  346



>ref|XP_007217731.1| hypothetical protein PRUPE_ppa006254mg [Prunus persica]
 gb|EMJ18930.1| hypothetical protein PRUPE_ppa006254mg [Prunus persica]
Length=420

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 167/272 (61%), Gaps = 18/272 (7%)
 Frame = -2

Query  1040  AGIVDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKL  861
             AG+ +G S   +S    GS+  TL DP+VLDC IC+  LTIP+FQCENGHIAC+SCC K 
Sbjct  150   AGVQEG-SPPPISPVTDGSLVFTLADPEVLDCLICYEPLTIPVFQCENGHIACSSCCTKS  208

Query  860   INKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSC  681
              NKCPSC+ PIG+NRCRA+EK++ES+++ C N  +GC+E + YNK  +HE  C+++PCSC
Sbjct  209   KNKCPSCSWPIGYNRCRAIEKILESIRISCRNIKHGCKEMVTYNKKNEHEKACMYSPCSC  268

Query  680   PNRACKFLGSSKEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVN  504
             P   C F+ SSK++Y HFT  HV  A R  +     I+L    +F+ LQEK  G++F+++
Sbjct  269   PLSGCNFISSSKQLYLHFTVSHVDYATRFLYGIDFSITLNIKDKFLVLQEKREGILFILD  328

Query  503   HHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP  324
             +H + LG+ V++ CI P   K  F Y L+A+                +S++ ++  +N  
Sbjct  329   NHAEKLGNLVSLRCIQP-IFKGGFYYDLLAK-------------TNGSSLRFQSFTKNSA  374

Query  323   KWDPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
                 S +   + ++P +  S     L +++CI
Sbjct  375   GQVISPSSTGYFIIPSDFFSSG--KLNMDLCI  404



>ref|XP_002271757.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Vitis vinifera]
Length=355

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 162/271 (60%), Gaps = 21/271 (8%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             G S+G  + +   S+S  L DP+VLDC IC   L++P+FQCENGHIAC+SCC KL N+CP
Sbjct  89    GTSSGSEANR-DASVSVILTDPEVLDCSICLEPLSVPVFQCENGHIACSSCCTKLSNRCP  147

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRAC  666
             SC+ PIG+NRCRA+EKV+ES+KV C N  YGC+E++ Y K  DHE TC + PCSCP+  C
Sbjct  148   SCSWPIGYNRCRAIEKVLESVKVSCQNTAYGCKETVSYGKKHDHEVTCNYVPCSCPHSNC  207

Query  665   KFLGSSKEVYTHFTNRHVQAK-RITFNS--PRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
              F GSSK++  HF ++H+ +  R  +NS  P  +      +F  L+ K G  +F+V+  +
Sbjct  208   NFRGSSKQLAQHFRSKHLNSVIRFQYNSFFPVHLEFNAVDKFCILEAKEGA-LFIVSSSI  266

Query  494   DPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
               LG AV V  I P SS+         +G+               SI L++  ENI +  
Sbjct  267   QQLGHAVTVCRIGPRSSRGHAFNLAAWKGDR--------------SIMLQSFTENIREVV  312

Query  314   PSAALKI-FLLVPGNVISDSWDHLKLEVCIK  225
                +L + FLL+P N    S   LKLE+CI+
Sbjct  313   ELPSLSMGFLLIP-NAFLGSSGQLKLELCIR  342



>ref|XP_007201550.1| hypothetical protein PRUPE_ppa017592mg [Prunus persica]
 gb|EMJ02749.1| hypothetical protein PRUPE_ppa017592mg [Prunus persica]
Length=306

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 161/258 (62%), Gaps = 21/258 (8%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQC-ENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            +  TL DP+V DCPICF  LTIP++QC +NGHIAC+SCC K+ NKCPSC+  +GFNRCRA
Sbjct  56   VVITLTDPEVFDCPICFEPLTIPVYQCDQNGHIACSSCCTKINNKCPSCSGSVGFNRCRA  115

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +EK +ES+ + C N  YGC+ S+ ++K  +H+  C+++PCSCP+ +C F+ S++++Y HF
Sbjct  116  IEKALESITISCQNIHYGCKASVAFHKKGEHQKACVYSPCSCPHLSCNFVSSAEQLYQHF  175

Query  626  TNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVV-NHHMDPLGSAVNVICIAP  453
            ++ HV  A +  +     +SL  + +F+ LQEK  G +F++ NH ++ LGSA+ + C+ P
Sbjct  176  SSSHVNSATQFRYYDSIAVSLNASDKFLVLQEKNNGTLFILKNHRVENLGSAMTITCVQP  235

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW---DPSAALKIFLLV  282
            G     F ++L A+ E+               + L++   N P     D S     FLL+
Sbjct  236  G-FMEGFFFELYAKTEK-------------NYLILQSFTMNTPSLHLIDDSPPRTGFLLI  281

Query  281  PGNVISDSWDHLKLEVCI  228
            P   IS    HLK+E+CI
Sbjct  282  PCGFISPG-GHLKMELCI  298



>emb|CAN77431.1| hypothetical protein VITISV_037121 [Vitis vinifera]
Length=355

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 162/271 (60%), Gaps = 21/271 (8%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             G S+G  + +   S+S  L DP+VLDC IC   L++P+FQCENGHIAC+SCC KL N+CP
Sbjct  89    GTSSGSEANR-DASVSVILTDPEVLDCSICLEPLSVPVFQCENGHIACSSCCTKLSNRCP  147

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRAC  666
             SC+ PIG+NRCRA+EKV+ES+KV C N  YGC+E++ Y K  DHE TC + PCSCP+  C
Sbjct  148   SCSWPIGYNRCRAIEKVLESVKVSCQNTAYGCKETVSYXKKXDHEVTCNYVPCSCPHSNC  207

Query  665   KFLGSSKEVYTHFTNRHVQAK-RITFNS--PRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
              F GSSK++  HF ++H+ +  R  +NS  P  +      +F  L+ K G  +F+V+  +
Sbjct  208   NFRGSSKQLAQHFRSKHLNSVIRFQYNSFFPVHLEFNAVDKFCILEAKEGA-LFIVSSSI  266

Query  494   DPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
               LG AV V  I P SS+         +G+               SI L++  ENI +  
Sbjct  267   QQLGHAVTVCRIGPRSSRGHAFNLAAWKGDR--------------SIMLQSFTENIREVV  312

Query  314   PSAALKI-FLLVPGNVISDSWDHLKLEVCIK  225
                +L + FLL+P N    S   LKLE+CI+
Sbjct  313   XLPSLSMGFLLIP-NAFLGSSGQLKLELCIR  342



>ref|XP_010243800.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Nelumbo 
nucifera]
Length=298

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 160/261 (61%), Gaps = 17/261 (7%)
 Frame = -2

Query  1007  MSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPI  828
             +S  G G IS TLIDP+VLDCPIC   LT P+FQC NGHIAC+SC  KL +KCPSC  PI
Sbjct  47    ISKDGPG-ISVTLIDPEVLDCPICLEPLTPPVFQCNNGHIACSSCSSKLEDKCPSCCRPI  105

Query  827   GFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSS  648
               NRC A+EKVVES+KV C N  YGC+E I Y +   HE TCI+ PC+CP   C F GS 
Sbjct  106   QQNRCLAIEKVVESIKVSCQNAPYGCKEMISYVEKHTHEETCIYAPCACPLSDCNFHGSF  165

Query  647   KEVYTHFTNRHVQAKR-ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVN  471
             +++  H ++ H  + R   +N P  +SL KN++ +  Q +  GV+F++N+  + +G+A++
Sbjct  166   EQLSLHVSHVHWDSVRCFRYNCPFPVSLDKNRQLLVFQGEEDGVLFILNNKTELIGNALS  225

Query  470   VICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIF  291
             V CI P S K  FLY L++R   E C  +  S  K T+ +LE             ++  F
Sbjct  226   VTCIGPRSPKEGFLYDLISR--REGCSLRLQSFTKCTTGQLE------------GSIVDF  271

Query  290   LLVPGNVISDSWDHLKLEVCI  228
             LL+P N    +   +KLEVCI
Sbjct  272   LLIPCNFCGCN-GQIKLEVCI  291



>gb|KHG01588.1| hypothetical protein F383_23529 [Gossypium arboreum]
Length=344

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 163/255 (64%), Gaps = 14/255 (5%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            GSIS TL DP+VLDC IC+ +LTIP++QCENGHIAC++CCIK+ N+CPSC +PIG++RCR
Sbjct  88   GSISITLTDPEVLDCSICYEALTIPVYQCENGHIACSTCCIKMRNRCPSCMTPIGYSRCR  147

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES+KV C N  YGC+E+  Y+  + H   C+ TPCSCP   C F GSS+E+  H
Sbjct  148  AIEKVLESVKVTCQNTKYGCKEAFSYSMKQKHGKACLFTPCSCPLPDCDFEGSSEELSAH  207

Query  629  FTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F N H   A    ++ P  I+L  +++F+ L+E+  G +F++++ ++ LG+ V +  I P
Sbjct  208  FGNVHKYSATCFRYDRPASITLGVSEKFLILREERDGSLFILHNKVENLGNVVTLSRIGP  267

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
             S++R   Y+L  +   +            ++++L++  ++ PK   S     FLLVP  
Sbjct  268  -STERGSFYELTVKAPSDG-----------SNLRLQSFTKSTPKRVDSPQSLGFLLVPSQ  315

Query  272  VISDSWDHLKLEVCI  228
                S   +K+++C+
Sbjct  316  FSCISR-QIKMDLCL  329



>ref|XP_007159014.1| hypothetical protein PHAVU_002G201000g [Phaseolus vulgaris]
 gb|ESW31008.1| hypothetical protein PHAVU_002G201000g [Phaseolus vulgaris]
 emb|CDN96906.1| hypothetical protein [Phaseolus vulgaris]
Length=316

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/269 (41%), Positives = 159/269 (59%), Gaps = 18/269 (7%)
 Frame = -2

Query  1025  GVSNGVMSGKGK-GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             G  NG  S   +  SI   + DPDVLDC IC+  L+ P+FQCENGHIAC++CC++L NKC
Sbjct  62    GTPNGSASNATRVRSIPIFVSDPDVLDCCICYEPLSAPVFQCENGHIACSNCCVRLNNKC  121

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRA  669
             P C  PIG+NRCRA+EKV+ES+K+ CPN  YGC E+  Y+K  DHE  CI+ PC CP+  
Sbjct  122   PMCLMPIGYNRCRAIEKVLESIKMSCPNANYGCTETFCYSKKNDHEKECIYLPCLCPHTG  181

Query  668   CKFLGSSKEVYTHFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMD  492
             C F+ SSKE++ H ++RHV +  + T++    +    +Q+ I LQEK    +F+V+++ +
Sbjct  182   CDFVASSKELFLHVSHRHVDSGTQFTYDKFFTVIFSADQKTIVLQEKNDSNLFIVHNNHE  241

Query  491   PLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDP  312
              LG  V + CI P  S   F Y+++AR              + +++ L++  + I     
Sbjct  242   TLGHKVRISCIGP-KSMGEFQYEVLARF-------------RGSTLILQSFTKIIQGQYA  287

Query  311   SAALKIFLLVPGNVISDSWDHLKLEVCIK  225
              A    FLL+P          LKL++ IK
Sbjct  288   DAPSNAFLLIPSGFFGPL--QLKLDIRIK  314



>ref|XP_008236352.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Prunus mume]
Length=492

 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 160/255 (63%), Gaps = 21/255 (8%)
 Frame = -2

Query  974  TLIDPDVLDCPICFMSLTIPLFQC-ENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
            TL DP++ DCPIC+  LTIP++QC +NGHIAC+SC  K+ +KCP C+  IGFNRCRA+EK
Sbjct  241  TLTDPELFDCPICYEPLTIPVYQCDQNGHIACSSCRTKINDKCPFCSESIGFNRCRAIEK  300

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
             +ES+   C N  YGC+ES+ +NK  +H+  C+++PC CP+  CKF+ S+K++Y HF++ 
Sbjct  301  ALESITTSCQNIQYGCKESVTFNKKGEHKKACVYSPCYCPHLNCKFVSSAKQLYQHFSSS  360

Query  617  HVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVN-HHMDPLGSAVNVICIAPGSS  444
            HV  A +  +     +SL  +  F+ LQEK GG +F++  HH+  LG+AV + CI P S 
Sbjct  361  HVNSATQFEYYVIFHVSLNADDNFLVLQEKKGGTLFILKRHHVADLGNAVTISCIQP-SF  419

Query  443  KRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPK---WDPSAALKIFLLVPGN  273
            + RF ++L  + EE               ++LE+  ++ P     D       FLL+P +
Sbjct  420  RGRFFHELDVKSEE-------------NFLRLESFTKSTPSRQVIDDRPPKTGFLLIPFD  466

Query  272  VISDSWDHLKLEVCI  228
            VIS S   LK+E+CI
Sbjct  467  VIS-SGGQLKMEICI  480


 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQC-ENGHIACASCCIKLINKCPSCASPIGFN  819
             +  +S TL DP++ DCPIC   LTIP++QC +NGHIAC+SC  K+ +KCPSC+  IGF+
Sbjct  125  SQSHVSITLTDPELFDCPICCEPLTIPVYQCDQNGHIACSSCRTKINDKCPSCSGFIGFS  184

Query  818  RCRALEKVVESLKVPCPN  765
            RCRA+EK +ES+K  C N
Sbjct  185  RCRAIEKALESIKTSCQN  202



>ref|XP_011021345.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Populus 
euphratica]
 ref|XP_011021346.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Populus 
euphratica]
 ref|XP_011021347.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Populus 
euphratica]
Length=412

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 133/204 (65%), Gaps = 1/204 (0%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             D V + + S  G G++S TL+D D+LDC IC   LTIP+FQCENGH AC+SCC KL +KC
Sbjct  134   DDVLDKLSSFLGDGAMSMTLMDLDILDCTICLYPLTIPVFQCENGHTACSSCCSKLAHKC  193

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRA  669
             P+C+ PIG NRCRA+EKV+ES+++PC N  YGC E+  Y+K  +H+ +CI+ PCSCP + 
Sbjct  194   PACSFPIGDNRCRAIEKVLESVRIPCENMRYGCGETFIYSKKYNHDKSCIYAPCSCPIQG  253

Query  668   CKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMD  492
             C F+ SSK++  H   RHV    R  +     + L   Q  + LQE   G +F+++HH +
Sbjct  254   CNFISSSKKLDPHLRCRHVGDVIRFYYGGAFPLPLSVGQSSVVLQETDNGAIFILHHHEE  313

Query  491   PLGSAVNVICIAPGSSKRRFLYKL  420
               G+ V + C+ P +S   + Y+L
Sbjct  314   TFGNIVTISCLGPPTSAGEYFYEL  337



>gb|EPS66631.1| hypothetical protein M569_08146, partial [Genlisea aurea]
Length=242

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 138/224 (62%), Gaps = 16/224 (7%)
 Frame = -2

Query  986  SISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            S+S  L+D DVLDCPICFM+L  P++QC+NGH+AC SCC  + NKC SC+ PIG+NRCRA
Sbjct  15   SLSCVLLDSDVLDCPICFMALNPPVYQCKNGHVACKSCCTNMKNKCGSCSLPIGYNRCRA  74

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
             EKV+ESL+  CPN+ YGC + +K ++   HE  C + PC+CP   C ++GS  ++YTHF
Sbjct  75   FEKVIESLEFKCPNSIYGCWDFVKNSERLRHEKACAYIPCACP--CCCYMGSRDDLYTHF  132

Query  626  TNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
               H  +  +I F    ++S+   +  I L E+ G  +FV++  +    ++  V+CIAP 
Sbjct  133  REEHASSVNKIRFGVASKVSVDGIKGHIVLVEEEGSFIFVLSRSVKADWNSGYVVCIAPT  192

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW  318
            +S R F+Y+L A              +  +S +L   AEN PKW
Sbjct  193  NSDRDFVYELAAE-------------DADSSTQLRTTAENTPKW  223



>ref|XP_008381498.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Malus domestica]
Length=363

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 154/243 (63%), Gaps = 12/243 (5%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             S +   S+  TL + DVLDC IC   LT+P++QCENGHIAC+SCC K  NKCP+C+ PIG
Sbjct  103   SDEIDASVVFTLTESDVLDCFICCEPLTVPVYQCENGHIACSSCCTKSKNKCPTCSWPIG  162

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
             +NRCRA+E V+E+++V C N  +GC+ES+ YNK  +HE  CI +PCSCP   C F+  SK
Sbjct  163   YNRCRAIENVLEAIRVSCQNIKHGCKESMTYNKKNEHEKACIFSPCSCPQSGCNFVSPSK  222

Query  644   EVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
             ++Y HF++ HV  A R  +N    I+L   ++   LQE+  G +F++++  + LG+ V++
Sbjct  223   QLYQHFSSNHVNSAXRFRYNCVFSITLFHREKSHTLQEQNDGTLFILDNVEESLGNIVSI  282

Query  467   ICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFL  288
              CI P S    F Y L+AR        K G G   +S++L++ A++IP    + +    L
Sbjct  283   SCIQP-SFMGGFYYDLLART-------KNGKG---SSLRLQSFAKSIPGQVSNPSSTDHL  331

Query  287   LVP  279
             ++P
Sbjct  332   IIP  334



>ref|XP_010032666.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Eucalyptus 
grandis]
 gb|KCW52108.1| hypothetical protein EUGRSUZ_J01542 [Eucalyptus grandis]
Length=356

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/261 (40%), Positives = 154/261 (59%), Gaps = 20/261 (8%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             G+  GS   T+ DPDV DC +C   LTIP+FQCENGHIAC+SCC K+ NKCPSC+ PIG+
Sbjct  106   GRTDGSFKVTVTDPDVFDCAVCLEPLTIPVFQCENGHIACSSCCRKISNKCPSCSMPIGY  165

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
             NRCRA+EKV+ES+++ C N  +GC +   Y+   DHE TC+  PCSCP  +C ++GS + 
Sbjct  166   NRCRAMEKVLESVQMACRNAKFGCHQKFGYHMKNDHEKTCLFAPCSCPFSSCSYVGSFRI  225

Query  641   VYTHFTNRHVQAKR---ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVN  471
             +  HF+ +H  +       FN+   ++++   R   L+E    V+FV+ +    LG+ + 
Sbjct  226   LVKHFSTKHGASPTSFCFNFNTFFLMNVETEVRL--LKEAREDVLFVLKNETVDLGNKIK  283

Query  470   VICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIF  291
             + CI P   K  +LY +VA+  E             +S+KL    ++   ++ +  L+ +
Sbjct  284   ISCIGP-LPKAAYLYDIVAKSRE-------------SSLKLHTCTKSFSDFEYTPNLEPY  329

Query  290   LLVPGNVISDSWDHLKLEVCI  228
             LLVP     D +  LKLEVCI
Sbjct  330   LLVPRGFF-DDFLGLKLEVCI  349



>ref|XP_011035360.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 isoform X2 
[Populus euphratica]
Length=367

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 154/260 (59%), Gaps = 17/260 (7%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G+I   L DP+VLDCP C  +LTIP+FQC+NGH+AC+SC  KL +KCPSCA PIG NRC 
Sbjct  115  GAIFVALSDPEVLDCPTCCETLTIPVFQCQNGHVACSSCSKKLQHKCPSCAMPIGDNRCC  174

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ESLKV C N  YGC E+I ++K  +H+  C H  C+CP   C F GSSK++Y H
Sbjct  175  AIEKVLESLKVQCSNWRYGCRENICFSKKYEHDKWCSHALCTCPLLGCNFQGSSKQLYLH  234

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               +H+ +     FN+   + +  N +F  LQE   GV+F++N+  D LG  + V C+  
Sbjct  235  CRRKHLGKLTSFQFNTSFPLFITVNDKFCILQEDKEGVLFILNNRWDTLGHVITVSCMGL  294

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP-KWDPSAALKIFLLVPG  276
             SSK  + YKL+ R E  N             I+ ++   N+  + D   +L   LLVP 
Sbjct  295  SSSKPGYFYKLMTRAEGSN-------------IRFQSSTRNVQTRVDDPPSLGC-LLVPN  340

Query  275  NVISDSWDHLKLEVCIKDLA  216
            + +  ++  + L+VCI  L 
Sbjct  341  DFLG-AYGQITLDVCIWHLG  359



>ref|XP_010113237.1| E3 ubiquitin-protein ligase SINA-like 10 [Morus notabilis]
 gb|EXC76281.1| E3 ubiquitin-protein ligase SINA-like 10 [Morus notabilis]
Length=245

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 153/246 (62%), Gaps = 21/246 (9%)
 Frame = -2

Query  959  DVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLK  780
            ++L   +CF+++     QCENGHIAC+SCC KL NKCPSC+ PIG+NRCRA+EKV+ES+K
Sbjct  4    EILITILCFLTI-----QCENGHIACSSCCTKLGNKCPSCSWPIGYNRCRAIEKVLESVK  58

Query  779  VPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ-AK  603
            + C N  YGC+E + Y++++DHE TC H PCSCP  +C F+ S+K++Y HF ++H   A 
Sbjct  59   IACQNKQYGCKEMVSYSEIKDHETTCTHAPCSCPLTSCNFISSAKQLYQHFRSQHADSAV  118

Query  602  RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYK  423
               +N    ++L +  +F+ LQE+ GG +F++N+  + LG+ V+V CI P S  + + Y 
Sbjct  119  LFQYNCDFTVTLNEGDKFLVLQERDGGGLFILNNETETLGNLVSVSCIGPYSFGKSY-YN  177

Query  422  LVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLK  243
            L+A+       C G       +++LE+ A         +   ++LL+P      S   LK
Sbjct  178  LLAK-------CDG------NTLRLESFATCTQGQADYSLSSVYLLIPPGFFGSS-GQLK  223

Query  242  LEVCIK  225
            L++ I+
Sbjct  224  LDLFIE  229



>ref|XP_011035359.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 isoform X1 
[Populus euphratica]
Length=369

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 154/260 (59%), Gaps = 17/260 (7%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G+I   L DP+VLDCP C  +LTIP+FQC+NGH+AC+SC  KL +KCPSCA PIG NRC 
Sbjct  115  GAIFVALSDPEVLDCPTCCETLTIPVFQCQNGHVACSSCSKKLQHKCPSCAMPIGDNRCC  174

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ESLKV C N  YGC E+I ++K  +H+  C H  C+CP   C F GSSK++Y H
Sbjct  175  AIEKVLESLKVQCSNWRYGCRENICFSKKYEHDKWCSHALCTCPLLGCNFQGSSKQLYLH  234

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               +H+ +     FN+   + +  N +F  LQE   GV+F++N+  D LG  + V C+  
Sbjct  235  CRRKHLGKLTSFQFNTSFPLFITVNDKFCILQEDKEGVLFILNNRWDTLGHVITVSCMGL  294

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP-KWDPSAALKIFLLVPG  276
             SSK  + YKL+ R E  N             I+ ++   N+  + D   +L   LLVP 
Sbjct  295  SSSKPGYFYKLMTRAEGSN-------------IRFQSSTRNVQTRVDDPPSLGC-LLVPN  340

Query  275  NVISDSWDHLKLEVCIKDLA  216
            + +  ++  + L+VCI  L 
Sbjct  341  DFLG-AYGQITLDVCIWHLG  359



>ref|XP_009371812.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009371813.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 isoform 
X2 [Pyrus x bretschneideri]
Length=451

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 156/250 (62%), Gaps = 13/250 (5%)
 Frame = -2

Query  974  TLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKV  795
            TL D DVLDC IC   LT+P++QCE+GHIAC+SCC K  NKCP+C+ PIG+NRCRA+E V
Sbjct  190  TLTDSDVLDCFICCEPLTVPVYQCEHGHIACSSCCTKSKNKCPTCSWPIGYNRCRAIENV  249

Query  794  VESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRH  615
            +E+++V C N  +GC+ES+ YNK  +HE TCI +PCSCP   C F+  SK++Y HF++ H
Sbjct  250  LEAIRVSCQNIKHGCKESMTYNKKNEHEKTCIFSPCSCPQSGCNFVSPSKQLYQHFSSNH  309

Query  614  VQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKR  438
            V  A R  +N    I L    +   LQE+  G +F++++  + LG+ V++ CI P S   
Sbjct  310  VNSATRFRYNCVFSIMLFHKDKSHTLQEQNDGTLFILDNKEESLGNIVSISCIQP-SFMG  368

Query  437  RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDS  258
             F Y L+AR        K G G   +S++L++ A++IP    + +    L++P     + 
Sbjct  369  GFYYDLLART-------KNGKG---SSLRLQSFAKSIPGQVSNPSSTDHLIIPCGFFENG  418

Query  257  WDHLKLEVCI  228
               LK+E+ I
Sbjct  419  GS-LKMELRI  427



>ref|XP_010666725.1| PREDICTED: uncharacterized protein LOC104883855 [Beta vulgaris 
subsp. vulgaris]
Length=709

 Score =   204 bits (520),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/256 (43%), Positives = 151/256 (59%), Gaps = 19/256 (7%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            GSIS TL DPDVLDC IC + LTIP+FQCENGHIAC+SC   L N CPSC   IG+NRCR
Sbjct  123  GSISVTLSDPDVLDCSICCLPLTIPVFQCENGHIACSSCRSNLGNTCPSCCGKIGYNRCR  182

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES++V C N  YGC  +I Y K ++HE TCI+TPCSCP   C F G S+ + TH
Sbjct  183  AIEKVIESVQVSCCNLRYGCRGTINYCKKQEHEETCIYTPCSCPYPDCLFRGPSRSLSTH  242

Query  629  FTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
             +  H  +  R  F+S   + L+ +++F+ LQEK  G++F+++H     G+ + V C+  
Sbjct  243  MSEDHAYSVIRFRFDSKFSVFLEMDEKFLVLQEKRDGILFILSH-----GNRIAVRCVDR  297

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
              SKRRF Y LV                  TS K ++      +         +L++PG 
Sbjct  298  SLSKRRFSYDLVL-------------SRDATSFKFQSFTHCATERFNDPPSVDYLVIPGY  344

Query  272  VISDSWDHLKLEVCIK  225
                   ++KL++CI+
Sbjct  345  PYHRYGGYVKLDICIR  360


 Score =   203 bits (516),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 148/256 (58%), Gaps = 21/256 (8%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G IS TL DPDVLDC ICF+ LTIP+FQCENGHIAC+SCC  L N CPSC   IG+NRCR
Sbjct  463  GIISVTLSDPDVLDCSICFLPLTIPVFQCENGHIACSSCCSNLGNTCPSCCGTIGYNRCR  522

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES +V C N  YGC+E+I Y K  +HE TCI+TPC CP   C F G S+ + TH
Sbjct  523  AIEKVIESAQVSCCNLRYGCKETINYCKKHEHEETCIYTPCLCPYPGCLFRGPSRSLSTH  582

Query  629  FTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
             +  H  +     ++S   + L+++ +F+ LQE+T G +F+++H     G+ + V C+ P
Sbjct  583  MSKDHADSVIHFRYDSNFHVFLERDDKFLVLQEETDGNLFILSH-----GNRIAVRCVDP  637

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
              S  RF Y L                   TS K ++                + ++PG 
Sbjct  638  SLSNGRFSYDLAL-------------SRDATSFKFQSFTHCATGQFNEPPSADYFVIPGY  684

Query  272  VISDSWDHLKLEVCIK  225
            + +  +  +KLE+C++
Sbjct  685  LYNGGY--VKLEICVR  698



>gb|AFK36482.1| unknown [Lotus japonicus]
Length=281

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/269 (38%), Positives = 161/269 (60%), Gaps = 18/269 (7%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             +GVS    + + + S+   + DPDVLDC IC+  L++P+FQCENGH+AC+SCC +L NKC
Sbjct  27    NGVSGYSAARERERSVPVIITDPDVLDCCICYEPLSVPVFQCENGHVACSSCCARLRNKC  86

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRA  669
             P C  PIG+NRCRA+EK++ES+K+ C N  YGC+E   Y+   DH   C++ P  CP+  
Sbjct  87    PMCLMPIGYNRCRAMEKLLESIKISCLNAKYGCKEVFSYSMKSDHAKECVYIPILCPHTD  146

Query  668   CKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMD  492
             C F+ SSKE+  H ++RHV    + T++    + L  +Q+ I LQE+    +F+V++ ++
Sbjct  147   CDFVASSKELSLHVSHRHVGSGVQFTYDKFITVFLNTDQKEIVLQEQNDAHLFIVHNKLE  206

Query  491   PLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDP  312
              LG+ V++ CI P  S   F Y ++AR              + +++ L++V + I +   
Sbjct  207   LLGNTVHISCIGP-KSMAGFHYDILARS-------------RGSTLILQSVTK-IIQAIG  251

Query  311   SAALKIFLLVPGNVISDSWDHLKLEVCIK  225
              A+  +FLL+P          LKL++ IK
Sbjct  252   HASSSVFLLIPSKFF--GCGQLKLDIRIK  278



>ref|XP_004504728.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Cicer 
arietinum]
Length=321

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 157/266 (59%), Gaps = 20/266 (8%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             SNG   GK   ++SA + DPDVLDC IC   LTIP+FQCENGHIAC++CC +L NKCP C
Sbjct  73    SNGYDVGK---NVSAIISDPDVLDCFICSEPLTIPIFQCENGHIACSNCCSQLRNKCPMC  129

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
               PIG+NRCRA+EK++ES+K+ CP   YGC+E    +    HE  C + PC CP+  C F
Sbjct  130   LMPIGYNRCRAMEKLLESIKISCPCAKYGCKEMFSCSMKSSHEKECTYIPCKCPHTGCGF  189

Query  659   LGSSKEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLG  483
             L SSKE+  HF++RHV    + T++    + L   Q+ I L ++    +F+V++++  LG
Sbjct  190   LASSKELALHFSHRHVGFGVQFTYDKFISVVLNTGQKEIVLLDQNDARLFIVHNNLVDLG  249

Query  482   SAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAA  303
             + V++ C+ P  +   F Y ++AR              + +++ L++  + I   +  A 
Sbjct  250   NMVHISCLGP-KAMAGFHYDVLAR-------------SQGSTLILQSSTKTIQDNNGGAP  295

Query  302   LKIFLLVPGNVISDSWDHLKLEVCIK  225
                FLL+P +     +  LKL++ IK
Sbjct  296   RTGFLLIPSDYF--GFGQLKLDIRIK  319



>ref|XP_008236350.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Prunus mume]
Length=310

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/261 (40%), Positives = 155/261 (59%), Gaps = 27/261 (10%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQC-ENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            +  TL DP++ DCPIC+  LTIP++QC +NGHIAC SC  K+ NKCPSC++ IGFNRCRA
Sbjct  58   VVVTLNDPELFDCPICYEPLTIPVYQCDQNGHIACFSCRTKINNKCPSCSNFIGFNRCRA  117

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +EK +ES+   C N  YGC++S+ ++K   H+  C+++PCSCP   C F+ S+K+VY HF
Sbjct  118  IEKALESITTSCQNLQYGCKKSLTFDKKGPHQKACVYSPCSCPRLYCNFVSSAKQVYRHF  177

Query  626  TNRH--VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVV-NHHMDPLGSAVNVICIA  456
            T+ H    A R  FN+   + L     F  LQEK  G +F++ NH+++ LG+ V + CI 
Sbjct  178  TSSHEISAASRFKFNNSFPVLLNAGNNFRVLQEKNDGTLFILKNHYVEGLGNLVTISCIQ  237

Query  455  PGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD-----PSAALKIF  291
            P    R   Y+LV + +E+             S++L +   + P        P   +   
Sbjct  238  P-VFMRGIFYELVTKAKED-------------SLRLHSFTRSTPSRQVLDGPPKTGV---  280

Query  290  LLVPGNVISDSWDHLKLEVCI  228
            LL+P + I+ S   LK+++CI
Sbjct  281  LLIPRDFIT-SDGQLKMDICI  300



>ref|XP_008368801.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Malus domestica]
Length=452

 Score =   194 bits (492),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/255 (42%), Positives = 158/255 (62%), Gaps = 21/255 (8%)
 Frame = -2

Query  974  TLIDPDVLDCPICFMSLTIPLFQCE-NGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
            TL DP + +CPIC+  LTIP+FQC+ NGHIAC+SC  K+ NKCPSC+  I  NRCRA+EK
Sbjct  202  TLTDPYLFECPICYEPLTIPVFQCDQNGHIACSSCISKMNNKCPSCSGSICSNRCRAIEK  261

Query  797  VVESLK-VPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            ++ES+  + C N  +GC+ES+ Y+K  +H+ TC+++PCSCP+  C F+ SSK++  HF +
Sbjct  262  ILESVSTISCRNAKHGCKESVTYDKRSEHQKTCVYSPCSCPHIGCDFVASSKQICQHFRH  321

Query  620  RHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVV-NHHMDPLGSAVNVICIAPGS  447
            +H   AKR  ++    ++L    +F+  QEK  G +FV+ NH +  LG+AV + CI P S
Sbjct  322  KHFGSAKRFEYHCSFPVTLSVTDKFVVFQEKNEGTLFVLKNHCVKELGNAVTLSCIQP-S  380

Query  446  SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPK--WDPSAALKIFLLVPGN  273
            S   F Y LVA+              K   ++L+A  ++ P+   D S     F L+P +
Sbjct  381  STGGFFYDLVAKT-------------KGNRLRLQAFTKSTPRIIIDDSPPKTGFHLIPTD  427

Query  272  VISDSWDHLKLEVCI  228
             IS S   LK+++CI
Sbjct  428  FIS-SCGQLKMDLCI  441



>gb|AEC11038.1| hypothetical protein, partial [Camellia sinensis]
Length=273

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
            G GSIS TL DPDVLDCPIC   LTIP+FQCENGH+AC+SCC KL N+CPSCA PIG+NR
Sbjct  96   GDGSISVTLTDPDVLDCPICLEHLTIPVFQCENGHVACSSCCFKLGNQCPSCAWPIGYNR  155

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            CRA+EKV+ES+K+ C N  YGC+E++ Y+K  DHE  C++ PC CP   C F+GSS+ + 
Sbjct  156  CRAIEKVIESVKISCQNMKYGCKEAVSYSKKHDHEEACVYAPCLCPLPECNFVGSSEHLS  215

Query  635  THFTNRHVQA-KRITFNSPRQISLKKNQ  555
             HFT++H  +  R  +N    IS++ N+
Sbjct  216  LHFTSKHSNSTTRFCYNCLFSISIESNR  243



>ref|XP_008457096.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase SINA-like 
10 [Cucumis melo]
Length=220

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 130/199 (65%), Gaps = 2/199 (1%)
 Frame = -2

Query  1010  VMSGKG-KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCAS  834
             V+S +G  G+++    DP +LDC IC+  L+IP+FQCEN HIAC+SCC K+ NKCPSC  
Sbjct  17    VISRRGTNGTMNVIFTDPQILDCYICWNXLSIPIFQCENXHIACSSCCTKVQNKCPSCIL  76

Query  833   PIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLG  654
              IG+ RCRA+EKV+ES+K+PC N  Y C+ ++  N + D E  C + PCSCP   C F+G
Sbjct  77    AIGYIRCRAIEKVLESIKLPCKNAIYRCKTAMDLNLINDQETLCRYEPCSCPLDNCTFVG  136

Query  653   SSKEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSA  477
              ++++Y HF+ RH   AK  ++N+   I L     +  L+ +  GV+F +++  +  G+A
Sbjct  137   LAEQLYLHFSRRHKNSAKHFSYNTRFTICLNNGDTYRILKAEDDGVLFFLSYTFEIFGNA  196

Query  476   VNVICIAPGSSKRRFLYKL  420
             + V  I P SS+++F YK+
Sbjct  197   ITVNWIGPLSSEKKFSYKI  215



>ref|XP_004170241.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Cucumis 
sativus]
Length=269

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 153/263 (58%), Gaps = 16/263 (6%)
 Frame = -2

Query  1010  VMSGKG-KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCAS  834
             V+S +G  G+++    DP +LDC IC   L+IP+FQCENGHIAC+SCC K  NKCPSC  
Sbjct  17    VISRRGTNGTLNVIFTDPQILDCYICCEPLSIPVFQCENGHIACSSCCTKAQNKCPSCTL  76

Query  833   PIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLG  654
              IG+ RCRA+EKV+ES+K+PC N  YGC+  +  N + DHE  C + PCSCP   C F+G
Sbjct  77    AIGYIRCRAIEKVLESIKLPCQNAIYGCKTVMGLNLINDHESLCRYEPCSCPLDNCTFVG  136

Query  653   SSKEVYTHFTNRHVQAKRI-TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSA  477
             S++++  HFT +H  + +I ++N+   I L        L+ +  GV+F +++  +  G+A
Sbjct  137   STEQLGLHFTKKHKNSAKIFSYNTRFTICLNNGDTHRILKAENDGVLFFLSYTFEIFGNA  196

Query  476   VNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALK  297
             V +  I P SS+++F Y++ A+                + + L+++A+ I         K
Sbjct  197   VTMNRIGPLSSEKKFCYEIKAK-------------TLGSVLSLQSIAKEIQGLIKVPPSK  243

Query  296   IFLLVPGNVISDSWDHLKLEVCI  228
               LL+P      S   + LE+CI
Sbjct  244   GSLLIPNEYFGSSTQTM-LEICI  265



>ref|XP_004289811.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6-like 
[Fragaria vesca subsp. vesca]
Length=301

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 152/277 (55%), Gaps = 24/277 (9%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGS-ISATLIDPDVLDCPICFMSLTIPLFQCE-NGHIACASCCIKLIN  855
             D   +   S   +GS I   L DP +LDCPIC   LT+P+FQC+ NGHIAC+ CC K+ N
Sbjct  37    DYEDHASTSASREGSNIVINLTDPGLLDCPICCEPLTVPVFQCDQNGHIACSLCCGKIKN  96

Query  854   KCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPN  675
             KCP CA PIG NRCRA+EKVVES   PC N+ YGC   + YNK  +HE TC   PCSCP 
Sbjct  97    KCPFCACPIGSNRCRAIEKVVESSTTPCQNSKYGCNIPVAYNKKNEHEKTCECAPCSCPY  156

Query  674   RACKFLGSSKEVYTHFTNRHVQ-AKRITFNSPRQ-----ISLKKNQRFIYLQEKTGGVVF  513
               C F  S+K +Y HF+N H+  A    +++        I LKKN  F+ ++EK  G +F
Sbjct  157   IGCNFASSAKLLYRHFSNVHLDSATSFHYDNYNDGLSFPIILKKNDNFLVVREKDSGTLF  216

Query  512   VVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAE  333
             ++ +  + LG+ V V CI P S    F+Y L+   EE             +S+K  +V  
Sbjct  217   ILYNRTEVLGNVVTVCCIQP-SFMNDFIYVLLVTNEE-------------SSLKFRSVTR  262

Query  332   NIPKWDPSA-ALKIFLLVPGNVISDSWDHLKLEVCIK  225
             + P       +   FLL+P    + S    K++V I+
Sbjct  263   STPSLQVDGPSPTSFLLIPSEFFNSS-GQAKIDVSIR  298



>ref|XP_003638120.1| E3 ubiquitin-protein ligase SINA-like protein [Medicago truncatula]
 gb|KEH31317.1| E3 ubiquitin-protein ligase SINA-like protein [Medicago truncatula]
Length=327

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/268 (37%), Positives = 155/268 (58%), Gaps = 21/268 (8%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             G  N  +S K    +SA + DPDVLDC IC   L +P++QCENGHIAC+ CC +L NKCP
Sbjct  78    GQQNNDLSKK----VSAIISDPDVLDCFICSEPLAVPIYQCENGHIACSKCCGELRNKCP  133

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRAC  666
              C+ PIG+NRCRA+EK++ES+K+ CPN  YGC++    +    HE  CI+ PC CP+  C
Sbjct  134   MCSMPIGYNRCRAVEKLLESIKISCPNAKYGCKDMFSCSMKSSHEKECIYIPCKCPHTGC  193

Query  665   KFLGSSKEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDP  489
              FL SSKE+  HF++RH     + T++    +SL   Q+ I L ++    +F+V++H+  
Sbjct  194   GFLASSKELALHFSHRHAGFGIQFTYDKFISVSLNTRQKQIVLLDQNDARLFIVHNHIVQ  253

Query  488   LGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPS  309
              G+ V++ C+ P +      Y ++AR +              +++ L++  + I   +  
Sbjct  254   HGNMVHISCMGPKAITDTH-YDVLARSQ-------------GSTLILQSSTKTIQDNNGD  299

Query  308   AALKIFLLVPGNVISDSWDHLKLEVCIK  225
             A    FL++P +     +  LKL++ IK
Sbjct  300   APTAGFLVIPSDHF--GFGQLKLDIRIK  325



>ref|XP_006430661.1| hypothetical protein CICLE_v10012175mg [Citrus clementina]
 gb|ESR43901.1| hypothetical protein CICLE_v10012175mg [Citrus clementina]
 gb|KDO63137.1| hypothetical protein CISIN_1g020290mg [Citrus sinensis]
Length=328

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 150/260 (58%), Gaps = 23/260 (9%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            G ++ TL DP+VLDCP+C+  L IP++QC NGH+ C  CC  L+NKCPSC  P G +R  
Sbjct  83   GPVTVTLNDPEVLDCPVCYEPLNIPVYQCGNGHVVCHRCCCDLMNKCPSCRLPNGHSRST  142

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+ES++V C N  YGC+E + Y++  DH   C +TPCSCP  AC F+GS  ++Y H
Sbjct  143  AMEKVIESIQVACENADYGCKEKMSYSEKYDHGRACHYTPCSCPLAACNFVGSFHQIYQH  202

Query  629  FTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F   H   A+   ++   +I+L  +   I LQE+  G +F++N+  +P G  ++V CIAP
Sbjct  203  FRGVHKHAAEEFVYDKVLRITLSVHHDLIILQEEKNGDLFILNNSTEPDGYRISVNCIAP  262

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD----PSAALKIFLL  285
             S K   +Y +VA+         GG+       +  +  ++I  WD    PS A    LL
Sbjct  263  -SCKGGVVYSIVAK--------SGGA-----VYEFNSCTKSIQNWDENNPPSVAS---LL  305

Query  284  VPGNVISDSWDHLKLEVCIK  225
            VP +    S+  L L V I+
Sbjct  306  VPSDFFG-SYGQLHLGVRIQ  324



>ref|XP_011002805.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Populus 
euphratica]
Length=277

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 154/262 (59%), Gaps = 19/262 (7%)
 Frame = -2

Query  1007  MSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPI  828
             ++ + KG IS  L D +VLDC ICF    IP+FQC NGH AC+SCC KL + CPSC+ PI
Sbjct  20    LARRDKGFISVIL-DSEVLDCLICFKPFIIPIFQCTNGHAACSSCCSKLAHLCPSCSLPI  78

Query  827   GFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSS  648
             G+  C A+EKV+ES K  C N  YGC+E++ Y+K  DHE +CI+  CSCP   C F+ SS
Sbjct  79    GYIHCLAIEKVLESAKTSCQNMKYGCKETVNYSKKCDHEKSCIYATCSCPVPGCSFVSSS  138

Query  647   KEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVN  471
             K++++H ++ HV   K + ++    +S   +++F+ LQEK  GVVF++N+ +  +G+ + 
Sbjct  139   KQLFSHLSSIHVGDVKHLEYDCKIPVSFTASKKFVVLQEKKEGVVFILNNALQIMGNVIM  198

Query  470   VICIAPGSSKRRFLYKLVARGEEENCGCKGGSG-EKTTSIKLEAVAENIPKWDPSAALKI  294
             V CI P  SK  + Y+L A         KG S   ++ +    +  +N P          
Sbjct  199   VSCIGP-LSKGGYFYELSANS-------KGNSLIFRSFTPCFRSRVDNPPSVR-------  243

Query  293   FLLVPGNVISDSWDHLKLEVCI  228
             FLLVPG     S   + L++CI
Sbjct  244   FLLVPGGFFG-SGGEVTLDLCI  264



>gb|KGN57437.1| hypothetical protein Csa_3G185660 [Cucumis sativus]
Length=269

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 132/202 (65%), Gaps = 2/202 (1%)
 Frame = -2

Query  1010  VMSGKG-KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCAS  834
             V+S +G  G+++    DP +LDC IC   L+IP+FQCENGHIAC+SCC K  NKCPSC  
Sbjct  17    VISRRGTNGTLNVIFTDPQILDCYICCEPLSIPVFQCENGHIACSSCCTKAQNKCPSCTL  76

Query  833   PIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLG  654
              IG+ RCRA+EKV+ES+K+PC N  YGC+  +  N + DHE  C + PCSCP   C F+G
Sbjct  77    AIGYIRCRAIEKVLESIKLPCQNAIYGCKTVMGLNLINDHESLCRYEPCSCPLDNCTFVG  136

Query  653   SSKEVYTHFTNRHVQAKRI-TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSA  477
             S++++  HFT +H  + +I ++N+   I L        L+ +  GV+F +++  +  G+A
Sbjct  137   STEQLGLHFTKKHKDSAKIFSYNTRFTICLNNGDTHRILKAENDGVLFFLSYTFEIFGNA  196

Query  476   VNVICIAPGSSKRRFLYKLVAR  411
             V +  I P SS+++F Y++ A+
Sbjct  197   VTMNRIGPLSSEKKFCYEIKAK  218



>ref|XP_010916338.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 9 [Elaeis 
guineensis]
Length=345

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 148/264 (56%), Gaps = 15/264 (6%)
 Frame = -2

Query  1013  GVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCAS  834
             G+  GK  G   +  IDPDVLDC IC+  L  PLFQC NGH+AC SC  KL +KC  C+ 
Sbjct  90    GMSFGKENGDGVSVRIDPDVLDCSICYEPLRPPLFQCSNGHVACCSCWSKLDHKCYLCSH  149

Query  833   PIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLG  654
              I F+R  ALEK+VES+K+ C +  YGC  +I Y +   HE TCI+ PC CP   C + G
Sbjct  150   EISFSRNLALEKIVESIKISCRHAKYGCRRTINYTQRDHHEETCIYAPCHCPVSDCTYSG  209

Query  653   SSKEVYTHF-TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSA  477
             S+  +  HF +     +KR  +  P +++LK  + F  LQ + G +  ++N+    +G A
Sbjct  210   STVMLSAHFSSKHSKSSKRFCYGQPFKVNLKPMEPFFVLQGEDGHLFLLLNNRDVAVGYA  269

Query  476   VNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALK  297
             ++V CI P + +  F YKL A G+E             +S++L+A   NI +W      K
Sbjct  270   LSVACIRPDTPEFNFSYKLTASGKE-------------SSVRLKASTTNIKEWKGVYPTK  316

Query  296   IFLLVPGNVISDSWDHLKLEVCIK  225
              FLLVP ++   S   L L+VCI+
Sbjct  317   AFLLVPHDLFYSSGIML-LDVCIR  339



>ref|XP_007199542.1| hypothetical protein PRUPE_ppb019386mg [Prunus persica]
 gb|EMJ00741.1| hypothetical protein PRUPE_ppb019386mg [Prunus persica]
Length=410

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/263 (40%), Positives = 155/263 (59%), Gaps = 21/263 (8%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQC-ENGHIACASCCIKLINKCPSCASPIGFN  819
             +  +S TL DP++ DCPIC   LTIP++QC +NGHIAC+SC  K+ NKCPSC+  IGF+
Sbjct  162  SQSHVSITLTDPELFDCPICCEPLTIPVYQCDQNGHIACSSCRTKINNKCPSCSGFIGFS  221

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEV  639
            RCRA+EK +ES+K  C N  YGC++S  ++K  +H   C+++PC CP+  C F+    E+
Sbjct  222  RCRAMEKALESIKTSCQNIKYGCKQSFPFHKKGEHINACVYSPCFCPH--CNFVSPDIEL  279

Query  638  YTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVV-NHHMDPLGSAVNVI  465
            Y HF + H   A +  +N    +SL     F+ LQEK    +F++  ++++ +G++V V 
Sbjct  280  YNHFRSSHATFATQFKYNCFFSVSLNAEASFLVLQEKNDDTLFILKKNYVEDVGNSVKVT  339

Query  464  CIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKI-FL  288
            CI PG  +  FLY+L AR              K  S+KLEA+ E+ P        K  FL
Sbjct  340  CIQPG-FREGFLYQLRARA-------------KKMSLKLEALTESTPSRQAIDNPKTGFL  385

Query  287  LVPGNVISDSWDHLKLEVCIKDL  219
            L+P + IS     LK+E+ I+  
Sbjct  386  LIPCDFISPG-GQLKMEIRIESF  407



>gb|AES99109.2| seven in absentia family protein [Medicago truncatula]
Length=344

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/256 (36%), Positives = 151/256 (59%), Gaps = 15/256 (6%)
 Frame = -2

Query  992  KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRC  813
            K S+S  + DP+  DC ICF  L+IP+FQC NGHI C++CC K  NKCP C+  I   RC
Sbjct  21   KNSVSVMISDPNSFDCCICFQPLSIPVFQCVNGHIVCSTCCDKHRNKCPKCSKRIRLKRC  80

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYT  633
            +A+E +++S ++ CPN  +GC+E++ YN+ + HE  C++ PC CP   C F+ SS+ +  
Sbjct  81   KAIENLLQSFEMSCPNEKHGCKETMGYNEKKKHEEECMYVPCYCPLSGCDFVASSEVLSN  140

Query  632  HFTNRHVQAKR-ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
            HF+++H   +   ++     +SLK N   I LQE+  G +F++N+ +  LG+AV++ CI 
Sbjct  141  HFSHKHKDFQSTFSYGHSFIVSLKFNDEAIVLQEECVGKLFILNNSIVSLGNAVSISCIG  200

Query  455  PGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
            P  S+  + Y ++AR +               S+KL++  +N+ +   +     FL++P 
Sbjct  201  PNYSEPWYQYDILARSQ-------------ICSLKLQSFPKNVQRVSLADLSSTFLVIPF  247

Query  275  NVISDSWDHLKLEVCI  228
                 S + L+LE+CI
Sbjct  248  GHFGSS-ELLELEICI  262



>ref|XP_010317754.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 8 [Solanum lycopersicum]
Length=184

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 127/196 (65%), Gaps = 15/196 (8%)
 Frame = -2

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +E V+ESLKV C NN YGC+E +  +K  DHE  CI+ PC CP+  C F+G+S +VY HF
Sbjct  1    MENVLESLKVSCVNNRYGCKEILNLSKKTDHENACIYVPCFCPSHGCDFIGTSAKVYAHF  60

Query  626  TNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
            + +H   A+ I+FN+   I ++K+QR+I LQ +T G++F+VNH  D +GSA+N+IC+   
Sbjct  61   SKKHASSAEHISFNAVHPIYIEKDQRYIILQMRTEGILFIVNHASDRVGSAINIICVGQA  120

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
              KRRF YKLV    E             +S KLE+VAE++P W   + +K FL+VP +V
Sbjct  121  RQKRRFSYKLVVTDGE-------------SSFKLESVAESVPNWSEDSPMKKFLVVPKDV  167

Query  269  ISDSWDHLKLEVCIKD  222
            ++ S   LKL+V I++
Sbjct  168  VNSS-ARLKLDVLIEE  182



>ref|XP_008811968.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 9 isoform 
X1 [Phoenix dactylifera]
Length=341

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 145/266 (55%), Gaps = 15/266 (6%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
               G+ SGK  G   +  IDPDVLDC IC+  L  PL QC NGH+AC SC  KL +KC  C
Sbjct  84    DGGISSGKENGDGISVRIDPDVLDCCICYEPLRPPLLQCSNGHVACCSCWSKLDHKCYLC  143

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
             +  I F+R  ALEK++ES+K+ C +  YGC  +I Y +   HE TCI+ PC CP   C F
Sbjct  144   SCEISFSRNLALEKIIESIKISCRHAKYGCRRTINYTQRDHHEETCIYAPCYCPVSDCTF  203

Query  659   LGSSKEVYTHF-TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLG  483
              GS+  +  HF +     +KR  +  P +++LK  + F  LQ   G +  ++N+    +G
Sbjct  204   SGSTVMLSAHFSSKHSKSSKRFCYGQPFKVNLKPTEPFFVLQGDDGHLFLLLNNRDVAMG  263

Query  482   SAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAA  303
              A+++ CI P + +  F Y+L A GEE             +S+ L+A   NI +W     
Sbjct  264   YALSIACIRPDTPEGNFSYELTATGEE-------------SSVLLKACTTNIKEWKGVHP  310

Query  302   LKIFLLVPGNVISDSWDHLKLEVCIK  225
              K FLLVP +    S   L L+VCI+
Sbjct  311   TKAFLLVPHDFFYSSGIML-LDVCIQ  335



>ref|XP_003616151.1| Ubiquitin [Medicago truncatula]
Length=405

 Score =   183 bits (465),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/256 (36%), Positives = 151/256 (59%), Gaps = 15/256 (6%)
 Frame = -2

Query  992  KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRC  813
            K S+S  + DP+  DC ICF  L+IP+FQC NGHI C++CC K  NKCP C+  I   RC
Sbjct  21   KNSVSVMISDPNSFDCCICFQPLSIPVFQCVNGHIVCSTCCDKHRNKCPKCSKRIRLKRC  80

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYT  633
            +A+E +++S ++ CPN  +GC+E++ YN+ + HE  C++ PC CP   C F+ SS+ +  
Sbjct  81   KAIENLLQSFEMSCPNEKHGCKETMGYNEKKKHEEECMYVPCYCPLSGCDFVASSEVLSN  140

Query  632  HFTNRHVQAKR-ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
            HF+++H   +   ++     +SLK N   I LQE+  G +F++N+ +  LG+AV++ CI 
Sbjct  141  HFSHKHKDFQSTFSYGHSFIVSLKFNDEAIVLQEECVGKLFILNNSIVSLGNAVSISCIG  200

Query  455  PGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
            P  S+  + Y ++AR +               S+KL++  +N+ +   +     FL++P 
Sbjct  201  PNYSEPWYQYDILARSQ-------------ICSLKLQSFPKNVQRVSLADLSSTFLVIPF  247

Query  275  NVISDSWDHLKLEVCI  228
                 S + L+LE+CI
Sbjct  248  GHFGSS-ELLELEICI  262



>ref|XP_009409203.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Musa 
acuminata subsp. malaccensis]
Length=340

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 154/272 (57%), Gaps = 20/272 (7%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             V G   G  SG G   +    +DPD+LDC IC+  L  P+FQC++GH+AC+SCC KL+NK
Sbjct  82    VIGEERGQSSGDGNVCVR---MDPDILDCSICYEPLRPPIFQCQSGHVACSSCCSKLLNK  138

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             C  C+  IG+NRC  LEKV+ES+K+ C    YGC +++ Y     HE TCI+ PCSCP  
Sbjct  139   CHLCSQSIGYNRCLILEKVIESIKITCSYAKYGCRKAMSYADKDAHEETCIYAPCSCPVP  198

Query  671   ACKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
              C F GS + +  HF N H    +R ++N   ++   K   F  L  K G +  ++N+ +
Sbjct  199   TCSFCGSREMLSAHFINTHTFFCERFSYNQIFKVEFHKTDPFRALYGKDGHLFLLLNNSV  258

Query  494   DPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
               +G+A+++ C  P S K  F Y+L    +E N          ++S++L++   +I +W 
Sbjct  259   ANVGNALSMACFRPRSLKHEFSYELTT--DEHN----------SSSLQLKS---SITEWK  303

Query  314   PSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
                 +K+FLLVP ++ +     + L VCI+ +
Sbjct  304   AVYPMKVFLLVPPHLCT-PVGKIVLNVCIRKI  334



>ref|XP_009375681.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Pyrus x 
bretschneideri]
Length=538

 Score =   186 bits (472),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 151/250 (60%), Gaps = 24/250 (10%)
 Frame = -2

Query  974  TLIDPDVLDCPICFMSLTIPLFQC-ENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
            TL DPD+ +CPIC+  LTIP+FQC +NGHIAC+SC  K+ NKCPSC+  I  NRCRA+EK
Sbjct  238  TLTDPDLFECPICYEPLTIPVFQCNQNGHIACSSCIGKINNKCPSCSGSICSNRCRAIEK  297

Query  797  VVESLK-VPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +++S+  + C N  +GC+ES+ Y+K  +H+ TC+++PCSCP+  C F+ SSK++  HF  
Sbjct  298  ILKSVSTISCRNAKHGCKESVTYDKRSEHQKTCVYSPCSCPHLGCDFVASSKQICQHFRR  357

Query  620  RHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVV-NHHMDPLGSAVNVICIAPGS  447
            +H   AKR  ++    ++L    +F+  QEK  G +FV+ NH +  LG+AV + CI P S
Sbjct  358  KHFGSAKRFEYHCSFPVTLSATDKFVVFQEKNEGALFVLKNHCVKDLGNAVTLSCIQP-S  416

Query  446  SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPK--WDPSAALKIFLLVPGN  273
            S   F Y LV +              K   ++L+A  ++ P+   D S     FL+V  N
Sbjct  417  STGGFFYDLVVKT-------------KGNRLRLQAFTKSTPRIIIDDSPPKTEFLVVFYN  463

Query  272  V----ISDSW  255
            V    + D W
Sbjct  464  VRHSQLLDLW  473



>ref|XP_008811985.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Phoenix 
dactylifera]
Length=274

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 155/282 (55%), Gaps = 25/282 (9%)
 Frame = -2

Query  1037  GIVDGVSNGVMS-----GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASC  873
             G +DG+   V       G    SIS + IDP VLDC ICF  L  P+FQC NGH+AC  C
Sbjct  9     GKMDGIEPQVRQELHEGGNNNESISVS-IDPAVLDCSICFTPLLPPVFQCHNGHVACYLC  67

Query  872   CIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNK--LRDHEPTCI  699
             C KL  KC  C+ P G +RCRALE V+E++K+PCP++T+GC  +I Y +    DHE +C+
Sbjct  68    CAKL-QKCHVCSLPTGQSRCRALEAVIEAMKIPCPHSTFGCRATIPYTQKDTHDHESSCL  126

Query  698   HTPCSCPNRACKFLGSSKEVYTHFTNRHVQAKRITF--NSPRQISLKKNQRFIYLQEKTG  525
               PCSCP  +C F G +  +  H  ++H   +RI F  ++   + L++ + F  L+   G
Sbjct  127   FAPCSCPISSCTFRGPAALLSDHIFDKHPVTRRIFFCYDTTFSVFLQQEEPFHVLRGMDG  186

Query  524   GVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLE  345
              +  ++N    P GS++++ CI PGS +    Y +  +GE              + ++L 
Sbjct  187   RIFLLLNAANVPHGSSLSIACIRPGSRELNLGYDITVKGER-------------SELRLR  233

Query  344   AVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
             A   NI     ++  + FL VP + ISDS   + ++VCI+ +
Sbjct  234   ASPRNIRDLKVASPAESFLFVP-HAISDSAGKISIDVCIRKV  274



>ref|XP_003615393.1| Ubiquitin [Medicago truncatula]
 gb|AES98351.1| seven in absentia family protein [Medicago truncatula]
Length=316

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 150/263 (57%), Gaps = 22/263 (8%)
 Frame = -2

Query  965  DPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVES  786
            +P++ DC  CF  LTIP+FQC+NGHI C++CC KL NKC  C+  I   RC+A+E ++ S
Sbjct  8    NPNLFDCCKCFQPLTIPVFQCDNGHIVCSTCCTKLRNKCHECSLRISSKRCKAIENILLS  67

Query  785  LKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQA  606
            +++PCPN  +GC+E I Y   R HE  CI+ PC CP   C F  SS+ +  HF+++H  +
Sbjct  68   IEMPCPNANHGCKEKISYTGNRKHEDECIYFPCYCPLSGCDFAASSEVLSNHFSHKHGDS  127

Query  605  K-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFL  429
            + + ++     +SLK N   I LQE+T G +F++N+    LG+ VN+ CI P SS+  + 
Sbjct  128  RIKFSYGHSFNVSLKSNDETIVLQEETEGKLFILNNRTTLLGNGVNICCIGPNSSESEYS  187

Query  428  YKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDH  249
            Y ++AR +     CK         + L++  +N+ +   +      L++P      S + 
Sbjct  188  YDILARSQ----ICK---------LTLQSFVKNVQEVALATPSSELLVIPFG----SSEP  230

Query  248  LKLEVCIKDLA*DSMDTYMSGFL  180
            LKL++CI  +    M  Y+   +
Sbjct  231  LKLDICITPM----MQIYVEDLI  249



>ref|XP_002868822.1| hypothetical protein ARALYDRAFT_494184 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45081.1| hypothetical protein ARALYDRAFT_494184 [Arabidopsis lyrata subsp. 
lyrata]
Length=270

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/276 (37%), Positives = 150/276 (54%), Gaps = 21/276 (8%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSI------SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIK  864
             G S  ++   G+G        SATL+D D+LDCP+C  +L  P+FQC+NGH+AC+SCC K
Sbjct  3     GASEALLFHGGEGERVAKRHRSATLLDLDILDCPVCCEALATPIFQCDNGHLACSSCCPK  62

Query  863   LINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCS  684
             L NKCPSCA P+G NRCRA+E ++ES  VPCPN  +GC ++  Y K   HE  CI + CS
Sbjct  63    LRNKCPSCAFPVGHNRCRAMESILESTLVPCPNEMFGCTKTCFYGKESAHEKECIFSQCS  122

Query  683   CPNRACKFLGSSKEVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVV  507
             CP+R C + GS K++Y H+   H + +  I    P    +  + + +  +     ++F V
Sbjct  123   CPSRECDYTGSYKDLYAHYKLTHSKFSWSIKCGIPYTAVMFISNKILIKRVHESKLLFAV  182

Query  506   NHHMDPLGSAVNVICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAEN  330
                 +P G  V V CIAP + +  +F Y+L    + +    +    +K   +  E   EN
Sbjct  183   QCFREPCGVYVTVSCIAPSAPEVGQFSYRLSYTKDGQTVIYESPEVKKVRKVSFETPQEN  242

Query  329   IPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKD  222
                         F+L+P N++  S   L +E+CI D
Sbjct  243   ------------FMLIPHNLLLRS-GLLMIELCIVD  265



>ref|XP_003614921.1| Ubiquitin [Medicago truncatula]
 gb|AES97879.1| seven in absentia family protein [Medicago truncatula]
Length=327

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 153/270 (57%), Gaps = 21/270 (8%)
 Frame = -2

Query  1007  MSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPI  828
             MS K   S+S  + +P VL+C  CF  LTIPL++C+NGHI C++CC KL  KCP C   I
Sbjct  1     MSSKKNNSVSVIVSNPKVLNCSNCFELLTIPLYKCDNGHIVCSTCCDKLEKKCPKCY--I  58

Query  827   GFNRCRALEKVVESL-KVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGS  651
                RC+A+E +++S+ ++ CPN  +GC E+I Y + R HE  CI+ PC CP   C F+ S
Sbjct  59    SSKRCKAIENILQSMEEISCPNEKHGCRETISYCRNRKHEKECIYEPCYCPFSGCDFVAS  118

Query  650   SKEVYTHFTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
             S+ + +HF+ +H  ++ + +++    +SL  N   + LQEK  G +F++ +    LG+AV
Sbjct  119   SEVLSSHFSQKHGDSQNKFSYDHSFIVSLNSNDETVVLQEKNDGQLFILKNITMFLGNAV  178

Query  473   NVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKI  294
             NV CI P SS+ ++ Y ++A               K + +K    A+N+ +         
Sbjct  179   NVCCIGPKSSESKYSYNILA-------------CSKMSELKFHTFAKNVQRVTLKTLSSK  225

Query  293   FLLVPGNVISDSWDHLKLEVCIKDLA*DSM  204
             FL++P        + L++E+CI+    DSM
Sbjct  226   FLVIPFGF----SEPLEIEICIRSFPCDSM  251



>gb|AES65367.2| seven in absentia family protein [Medicago truncatula]
Length=335

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 144/257 (56%), Gaps = 20/257 (8%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
             S+S  + +P V DC ICF+ L+IP+FQC+ GHI C +CC KL NKC  C+  I   RCR
Sbjct  14   SSVSLMISNPKVFDCCICFLLLSIPIFQCKTGHIVCFTCCSKLGNKCDKCSKCISLKRCR  73

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A E +++ +K+ CPN  YGC E+I Y++   HE  CI+ PC CP   C F+ SS+ +  H
Sbjct  74   AFENLLQYIKMSCPNEKYGCRETIDYSQKTKHEEKCIYVPCYCPISGCDFVASSEVLSNH  133

Query  629  FTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFV-VNHHMDP-LGSAVNVICI  459
            F+N+H  ++ + ++     +SLK +   I LQEK  G +F+ +N  +   LG+AVN+ C 
Sbjct  134  FSNKHEDSQIKFSYGQSFIVSLKSDDDAIILQEKYDGKLFILINSTITTLLGNAVNICCF  193

Query  458  APGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
             P +S+  + Y + AR +     CK         +KL +   N+ +         FL++P
Sbjct  194  GPNASESEYSYGIKARSQR----CK---------LKLHSFVTNVQQVTLGTLSPEFLMIP  240

Query  278  GNVISDSWDHLKLEVCI  228
                  S   LKLE+CI
Sbjct  241  NG----SSKPLKLEICI  253



>ref|XP_010435701.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=245

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 147/259 (57%), Gaps = 25/259 (10%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            L+D D+LDCPIC+ +LT+P+FQC+NGHIAC+SCC KL NKCP+CA PIG +RCRA+EKVV
Sbjct  3    LMDLDILDCPICYEALTVPIFQCDNGHIACSSCCPKLKNKCPACALPIGHSRCRAMEKVV  62

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV  612
            +S+  PCPN+ +GC ES  Y K  +HE  C  +PCSCP + C + G  K++Y H+   H 
Sbjct  63   KSVSFPCPNSIFGCTESSSYGKESNHEKECNFSPCSCPEQDCNYTGPYKDLYNHYALTHS  122

Query  611  QAKR-------ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            +  R       ++F S   IS          +E    ++F V    +P G  + V CIAP
Sbjct  123  KGFRLDSFSCGVSFTSLINISGTMKIE----KEDVKRLLFAVQCFREPCGVYLTVSCIAP  178

Query  452  GSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
             + +   + Y +    ++ +    G    K    ++  V+ ++P+ +       F+ +P 
Sbjct  179  STPEVGEYSYHVSYNVDDGHTLTYGSPNMK----RILEVSFHVPQQN-------FMFIPN  227

Query  275  NVISDSWDHLKLEVCIKDL  219
            + +   W  L +E+CI+ L
Sbjct  228  HFLRGDW--LDIELCIRKL  244



>emb|CDY01699.1| BnaC04g30530D [Brassica napus]
Length=282

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 147/284 (52%), Gaps = 23/284 (8%)
 Frame = -2

Query  1040  AGIVDGVSNGVMSGKGKGS-------ISATLIDPDVLDCPICFMSLTIPLFQCENGHIAC  882
             +G  DG S+ +   + + S       +S  L+D +VLDCPICF + TIP+FQCENGH+AC
Sbjct  9     SGEKDGASSILTQKRKRSSKSSPDKRLSPALLDLNVLDCPICFEAFTIPIFQCENGHLAC  68

Query  881   ASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTC  702
             +SCC K+ NKCP+CA P G  RCR +E VVES+ VPCPN   GC E++ Y K   HE  C
Sbjct  69    SSCCPKMSNKCPTCALPTGHIRCRPMESVVESVCVPCPNAKSGCTENLSYGKQLTHEKEC  128

Query  701   IHTPCSCPNRACKFLGSSKEVYTHF--TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKT  528
               +PCSCP + C + G  K++Y H+  T  H +        P    +  + + +  +   
Sbjct  129   DFSPCSCPEQDCDYTGPYKDLYRHYDSTAHHERFNWFLCGQPFTAQMDISDKILIKRGCN  188

Query  527   GGVVFVVNHHMDPLGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIK  351
               ++  V    +P G  V V CIAP S K R F Y +    E           +  T I 
Sbjct  189   LIILIAVQCFREPCGVYVTVSCIAPPSPKVREFSYDITYTTE-----------DGYTMIY  237

Query  350   LEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
                  + I K         F+L+P N++    D LKLE+CI +L
Sbjct  238   KSPTVKRILKVSFETPRDNFMLIPHNLLRG--DLLKLEICINEL  279



>gb|KEH41209.1| seven in absentia family protein [Medicago truncatula]
Length=346

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 153/272 (56%), Gaps = 26/272 (10%)
 Frame = -2

Query  1040  AGIVDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKL  861
             AG+ +  S GVM        S  + +P++LDC  CF  LTIP+FQC+NGHI C++CC KL
Sbjct  21    AGVFNFYSKGVME-------SLMISEPNLLDCCKCFEPLTIPIFQCDNGHIVCSTCCTKL  73

Query  860   INKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSC  681
              NKC  C+  I   RC+A+E ++ S+K+ C N  +GC+E I Y   R HE  C++  C C
Sbjct  74    KNKCHECSLHISSKRCKAIENLLLSIKMSCSNAKHGCKEKISYTD-RKHEEECVYVLCYC  132

Query  680   PNRACKFLGSSKEVYTHFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVN  504
             P   C F  SS+ +  HF ++H  +  + ++     +SLK N   I LQE+  G +F++N
Sbjct  133   PLSGCDFAASSEVLSNHFRHKHGDSIIKFSYGYSFTVSLKSNDEIIVLQEENDGKLFILN  192

Query  503   HHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP  324
             +    LG+AVN+ CI P SS+  + Y ++AR   +NC            +KL++ A+N+ 
Sbjct  193   NRTTLLGNAVNLCCIGPNSSESNYNYDILARS--QNC-----------ILKLQSFAKNVQ  239

Query  323   KWDPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
             +   +      L++P      S + LKL++CI
Sbjct  240   QVTLATLSSELLVIPFG----SSEPLKLDICI  267



>ref|XP_002870580.1| hypothetical protein ARALYDRAFT_915957 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46839.1| hypothetical protein ARALYDRAFT_915957 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 146/271 (54%), Gaps = 20/271 (7%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             S+G      K SI   L++ ++LDCPIC+ + TIP+FQC+NGH+AC+SCC KL NKCP+C
Sbjct  29    SDGAKRDAKKRSI--MLMELEILDCPICYEAFTIPIFQCDNGHLACSSCCPKLNNKCPAC  86

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
             ASP+G NRCRA+E V+ES+ VPCPN   GC +   Y K   HE  CI + CSCP   C +
Sbjct  87    ASPVGHNRCRAMESVLESILVPCPNAKLGCTKKFSYGKESTHEKECIFSQCSCPALDCNY  146

Query  659   LGSSKEVYTHFTNRHVQA---KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDP  489
               S K++Y H+   H++     +    S   I +  +++ +   E T  ++F V    +P
Sbjct  147   TCSYKDLYRHYHTTHLEVYHLNKFCCGSFFSIRINISEKMLIRLEYTKALLFAVQCFQEP  206

Query  488   LGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDP  312
              G  V V CIAP + +   F Y L    + +    K    +    +  +   EN      
Sbjct  207   YGVYVTVSCIAPSAPEVGNFSYDLSYTVDGQTMTYKSPKMKMILEVSFQTPQEN------  260

Query  311   SAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
                   F+L+P N++    D L +++ IK+L
Sbjct  261   ------FMLIPNNLL--RGDMLDMKLLIKEL  283



>ref|XP_003595116.1| Ubiquitin [Medicago truncatula]
Length=369

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 144/257 (56%), Gaps = 20/257 (8%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
             S+S  + +P V DC ICF+ L+IP+FQC+ GHI C +CC KL NKC  C+  I   RCR
Sbjct  14   SSVSLMISNPKVFDCCICFLLLSIPIFQCKTGHIVCFTCCSKLGNKCDKCSKCISLKRCR  73

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A E +++ +K+ CPN  YGC E+I Y++   HE  CI+ PC CP   C F+ SS+ +  H
Sbjct  74   AFENLLQYIKMSCPNEKYGCRETIDYSQKTKHEEKCIYVPCYCPISGCDFVASSEVLSNH  133

Query  629  FTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFV-VNHHMDP-LGSAVNVICI  459
            F+N+H  ++ + ++     +SLK +   I LQEK  G +F+ +N  +   LG+AVN+ C 
Sbjct  134  FSNKHEDSQIKFSYGQSFIVSLKSDDDAIILQEKYDGKLFILINSTITTLLGNAVNICCF  193

Query  458  APGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
             P +S+  + Y + AR +     CK         +KL +   N+ +         FL++P
Sbjct  194  GPNASESEYSYGIKARSQR----CK---------LKLHSFVTNVQQVTLGTLSPEFLMIP  240

Query  278  GNVISDSWDHLKLEVCI  228
                  S   LKLE+CI
Sbjct  241  NG----SSKPLKLEICI  253



>ref|XP_010445579.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7, partial [Camelina 
sativa]
Length=363

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 122/198 (62%), Gaps = 4/198 (2%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             +G+ N     K + S SA L+  DVLDCPICF +LTIP+FQCENGH+AC SCC KL NKC
Sbjct  98    EGLRNNTHLKKRQRSSSAMLLGLDVLDCPICFEALTIPIFQCENGHLACTSCCPKLSNKC  157

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRA  669
             PSCASP+G NRCRA+E V+ES+ VPC N  +GC + + Y K   HE  C  T CSCP   
Sbjct  158   PSCASPVGHNRCRAMESVLESVFVPCRNAKFGCTKIVSYAKESIHEKECTFTQCSCPALE  217

Query  668   CKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKN---QRFIYLQEKTGGVVFVVNH  501
             C + GS   +YTHF + H  ++K ++F     + ++ N   ++ + L E    ++F +  
Sbjct  218   CSYTGSYDNIYTHFVDNHCHESKSVSFVCGSAVDVQMNIASEKSLVLWESKKRLLFALQC  277

Query  500   HMDPLGSAVNVICIAPGS  447
               +P G  V V  IAP +
Sbjct  278   FNEPDGLYVTVRWIAPSA  295



>ref|XP_003595117.1| Ubiquitin [Medicago truncatula]
 gb|AES65368.1| seven in absentia family protein [Medicago truncatula]
Length=343

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 145/265 (55%), Gaps = 28/265 (11%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
             SIS  + +P V DC ICF  L+ P+FQC+NGHI C++CC K  NKC  C+  I   RCR
Sbjct  14   SSISVMISNPKVFDCSICFQLLSFPIFQCDNGHIVCSTCCSKFGNKCDKCSKCISLKRCR  73

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A E +++ +K+PC N  YGC+E+I Y + R HE  CI+ PC CP   C F+ SS+ +  H
Sbjct  74   AFENLLQYIKMPCLNEKYGCKETIDYIQKRKHEEECIYVPCYCPLSGCDFVASSEVLSDH  133

Query  629  FTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVV----------NHHMDPLG  483
            F+++H  ++    +     +SLK +   I LQEK  G VF++          N+    LG
Sbjct  134  FSHKHEDSQINFYYGFSFLVSLKSDDEVIVLQEKRSGKVFILNNSTMLYSKKNYSTMLLG  193

Query  482  SAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAA  303
            +AVN+ C  P +S   + Y + AR ++    CK         +KL + A+N+ +   +  
Sbjct  194  NAVNICCFGPTASVSEYSYDISARSQK----CK---------LKLHSFAKNLHQVTLATL  240

Query  302  LKIFLLVPGNVISDSWDHLKLEVCI  228
               FL++P      S + L+L +CI
Sbjct  241  SSEFLVIPIG----SSEPLELVICI  261



>ref|XP_002870579.1| hypothetical protein ARALYDRAFT_915956 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46838.1| hypothetical protein ARALYDRAFT_915956 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 143/257 (56%), Gaps = 20/257 (8%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            L+D ++LDCPIC+ + TIP+FQC+NGH+AC+SCC  L NKCP+CA PIG NRCR +E V+
Sbjct  2    LMDLEILDCPICYEAFTIPIFQCDNGHLACSSCCPTLSNKCPTCALPIGHNRCRGMESVL  61

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV  612
            ES+ +PCPN   GC + + Y K   HE  CI + CSCP   C +  S K++YTH+   H+
Sbjct  62   ESILIPCPNAKLGCTKKVSYGKESTHEKECIFSQCSCPVEDCNYTSSYKDLYTHYRITHM  121

Query  611  QAKRI-----TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
            +  ++        S  ++++  +++ +   E    ++F V    DP G  V V CIAP +
Sbjct  122  KVYQLHKFICDIPSIVKMNISSDKKILIRMEYMKRILFAVQCFRDPCGVYVTVSCIAPSA  181

Query  446  SKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
             +  +F Y+L    +      K    ++   +  +   EN            F+L+P ++
Sbjct  182  PEVGQFSYRLSYTVDGHTMIYKSPDVKRVLKLNFQTPQEN------------FMLIPNSL  229

Query  269  ISDSWDHLKLEVCIKDL  219
            +    + LK+ +C+K L
Sbjct  230  LRG--EMLKMRICVKKL  244



>ref|XP_010314967.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10, partial 
[Solanum lycopersicum]
Length=164

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = -2

Query  905  CENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNK  726
            C NGHIACA CCIK+ NKCPSC  PIG+NRCRA+E V+ESLKV C NN YGC+E +  +K
Sbjct  23   CGNGHIACAPCCIKIANKCPSCCLPIGYNRCRAMENVLESLKVSCVNNRYGCKEILNLSK  82

Query  725  LRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRF  549
              DHE  CI+ PC CP+  C F+G+S +VY HF  +H   A+ I+FN+   I ++K+QR+
Sbjct  83   KTDHENACIYVPCFCPSHGCDFIGTSAKVYAHFCEKHASSAEHISFNAVHPIYIEKDQRY  142

Query  548  IYLQEKTGGVVFVVNHHMDPLG  483
            I LQ +T G++F+VNH  D +G
Sbjct  143  IILQMRTEGILFIVNHASDRVG  164



>ref|XP_006285318.1| hypothetical protein CARUB_v10006701mg, partial [Capsella rubella]
 gb|EOA18216.1| hypothetical protein CARUB_v10006701mg, partial [Capsella rubella]
Length=279

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/278 (35%), Positives = 154/278 (55%), Gaps = 21/278 (8%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGK--GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLI  858
             V+G SN  +  K +        ++D DVLDCP+C   LTIP+FQC+NGH+AC+SCC KL 
Sbjct  13    VNGPSNTHLHKKQRTEDKTRQAMLDFDVLDCPVCCEPLTIPIFQCDNGHLACSSCCPKLS  72

Query  857   NKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCP  678
             NKCP+CA PIG  RCRA+E+V+ES+ +PCPN T+GC +++ Y K   HE  CI +PCSCP
Sbjct  73    NKCPACALPIGRIRCRAMERVLESILIPCPNATFGCTKNVSYGKESTHEKECIFSPCSCP  132

Query  677   NRACKFLGSSKEVYTHFTN-RHVQAKRITFNSP---RQISLKKNQRFIYLQEKTGGVVFV  510
              + C + G  K++Y H+ +  H          P     + +K + + + L E    ++F 
Sbjct  133   VQECNYNGIYKDLYAHYNSASHPIGYIFHIIKPDFCYSVRMKISNKILILMESMKRLLFA  192

Query  509   VNHHMDPLGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAE  333
             V    +P G  V + CIAP + +  +F Y++    +E     +    ++   +  +   E
Sbjct  193   VQCLREPYGVYVTLSCIAPTAPEVAKFSYRIYYTVDEHTLIYRSPEVKRILEVSFQTPQE  252

Query  332   NIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
             N            F+L+P +++   +  L++++ IK+L
Sbjct  253   N------------FMLIPNSLLRGEF--LEMKLFIKEL  276



>ref|NP_198605.2| E3 ubiquitin-protein ligase SINA-like 7 [Arabidopsis thaliana]
 sp|Q9FKD7.1|SINL7_ARATH RecName: Full=E3 ubiquitin-protein ligase SINA-like 7; AltName: 
Full=Seven in absentia-like protein 7 [Arabidopsis thaliana]
 dbj|BAB09035.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL62428.1| putative protein [Arabidopsis thaliana]
 gb|AAM48041.1| putative protein [Arabidopsis thaliana]
 gb|AED94244.1| protein with RING/U-box domain [Arabidopsis thaliana]
Length=286

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/258 (35%), Positives = 146/258 (57%), Gaps = 18/258 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S  L+D ++LDCPIC+ + TIP+FQC+NGH+AC+SCC KL NKCP+C SP+G NRCRA+E
Sbjct  40   STMLMDLEILDCPICYEAFTIPIFQCDNGHLACSSCCPKLNNKCPACTSPVGHNRCRAME  99

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
             V+ES+ +PCPN   GC++++ Y K   HE  C+ + C+CP   C +  S K++YTH+  
Sbjct  100  SVLESILIPCPNAKLGCKKNVSYGKELTHEKECMFSHCACPALDCNYTSSYKDLYTHYRI  159

Query  620  RHVQAKRI-TF--NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             H++  +I TF  + P  + +  +++ +   E     +F V    +P G  V V CIAP 
Sbjct  160  THMEINQINTFICDIPLSVRMNISKKILIRTEHLTNHLFAVQCFREPYGVYVTVSCIAPS  219

Query  449  SSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
            S +  ++ Y L    +      +    ++   +  +   EN            F+L+P +
Sbjct  220  SPELSQYSYALSYTVDGHTVIYQSPEVKRVLKLSFQTPQEN------------FMLIPNS  267

Query  272  VISDSWDHLKLEVCIKDL  219
            ++    D L++ + +K L
Sbjct  268  LL--RGDVLEMRISVKKL  283



>gb|KEH23716.1| seven in absentia family protein [Medicago truncatula]
Length=477

 Score =   178 bits (451),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 149/258 (58%), Gaps = 19/258 (7%)
 Frame = -2

Query  995  GKGS-ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFN  819
            GK S I   + +P VLDC ICF  LTIP+FQC+NGHIAC++C  KL N CP C+  I   
Sbjct  158  GKNSPIPVVISNPKVLDCYICFQPLTIPVFQCDNGHIACSTCYPKLRNTCPKCSLRISSK  217

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEV  639
            RC+A+E ++ S+++ C N  YGC E I Y    +HE  CIH PC CP   C F+ SS+ +
Sbjct  218  RCKAIENLLLSIELSCSNAKYGCREKISYIGKMNHEEQCIHEPCYCPLPDCDFVASSEVL  277

Query  638  YTHFTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
              HF+++H  ++ + ++     +SLK N   I LQE   G +F++N+     G+A+N+ C
Sbjct  278  SKHFSHKHGDSQTKFSYGLSVIVSLKSNDETIVLQENNVGKLFILNNSTMLFGNAINICC  337

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            I+P SS+    Y ++AR +     CK          K ++ A+N+ ++  S     FL++
Sbjct  338  ISPKSSQYECGYDILARSQ----ACKP---------KFQSFAKNVQRFTLSTLSLEFLVI  384

Query  281  PGNVISDSWDHLKLEVCI  228
            P      S + L+LE+CI
Sbjct  385  PFG----SSEPLELEICI  398



>ref|XP_003616156.1| Ubiquitin [Medicago truncatula]
 gb|AES99114.1| seven in absentia family protein [Medicago truncatula]
Length=390

 Score =   175 bits (443),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 153/269 (57%), Gaps = 20/269 (7%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             + + N V       S+   + +P +L+C  C+  L IP+FQC+NGHI C++CC KL NKC
Sbjct  58    EEIVNSVTDVSKNSSVPLIISNPKLLECCNCYQPLKIPVFQCDNGHIVCSTCCPKLRNKC  117

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRA  669
               C+  I   RC A+E ++ S++VPCPN  YGC  + +Y + RDHE  CIH PC CP   
Sbjct  118   HKCSLSISSKRCEAIENLLRSIEVPCPNAKYGCRVTNRYIRQRDHENECIHKPCYCPFSG  177

Query  668   CKFLGSSKEVYTHFTNRHVQAKRITFNSPRQ--ISLKKNQRFIYLQEKTGGVVFVVNHHM  495
             C F+ SS+ +  HF ++H  ++ I F++ +   ISLK N   I L+E+    +F++N+  
Sbjct  178   CDFVESSEVLSMHFCHKHGDSQ-IKFSNGQSFVISLKSNDETIVLREENDDKLFILNNST  236

Query  494   DPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
               LG+AVN+ C  P +S+  + Y ++A  +     CK         +KL + A+N+ +  
Sbjct  237   TLLGNAVNICCFGPDASESEYSYDILATSQ----ICK---------LKLHSFAKNVQQIT  283

Query  314   PSAALKIFLLVPGNVISDSWDHLKLEVCI  228
              +     FL++P +    S + LKLE+CI
Sbjct  284   LANLSSKFLVIPFS----SSEPLKLEICI  308



>gb|KEH41206.1| seven in absentia family protein [Medicago truncatula]
Length=315

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 145/252 (58%), Gaps = 19/252 (8%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S  + +P++LDC  CF  LTIP+FQC+NGHI C++CC KL NKC  C+  I   RC+A+E
Sbjct  3    SLMISEPNLLDCCKCFEPLTIPIFQCDNGHIVCSTCCTKLKNKCHECSLHISSKRCKAIE  62

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
             ++ S+K+ C N  +GC+E I Y   R HE  C++  C CP   C F  SS+ +  HF +
Sbjct  63   NLLLSIKMSCSNAKHGCKEKISYTD-RKHEEECVYVLCYCPLSGCDFAASSEVLSNHFRH  121

Query  620  RHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSS  444
            +H  +  + ++     +SLK N   I LQE+  G +F++N+    LG+AVN+ CI P SS
Sbjct  122  KHGDSIIKFSYGYSFTVSLKSNDEIIVLQEENDGKLFILNNRTTLLGNAVNLCCIGPNSS  181

Query  443  KRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVIS  264
            +  + Y ++AR   +NC            +KL++ A+N+ +   +      L++P     
Sbjct  182  ESNYNYDILARS--QNC-----------ILKLQSFAKNVQQVTLATLSSELLVIPFG---  225

Query  263  DSWDHLKLEVCI  228
             S + LKL++CI
Sbjct  226  -SSEPLKLDICI  236



>ref|XP_002868825.1| hypothetical protein ARALYDRAFT_356210 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45084.1| hypothetical protein ARALYDRAFT_356210 [Arabidopsis lyrata subsp. 
lyrata]
Length=408

 Score =   175 bits (443),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 100/280 (36%), Positives = 152/280 (54%), Gaps = 24/280 (9%)
 Frame = -2

Query  1028  DGVSNG-VMSGKGKGSI------SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCC  870
             +GVSN  ++  + + SI      S  L+  DVLDCPICF +LTIP+FQC+NGH+AC+SCC
Sbjct  136   EGVSNNTLLKKRQRSSILEGKTRSGMLLGLDVLDCPICFEALTIPIFQCDNGHLACSSCC  195

Query  869   IKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTP  690
              KL NKCP+CASP+G NRCRA+E V+ES+ V C N  +GC +++ Y K+  HE  C  + 
Sbjct  196   HKLSNKCPTCASPVGHNRCRAMESVLESVFVTCRNAKFGCAKNVSYGKVSIHEKECTFSQ  255

Query  689   CSCPNRACKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKN---QRFIYLQEKTGG  522
             CSCP   C + GS   +Y+HF + H  ++  I+F     + ++ N      + LQE   G
Sbjct  256   CSCPALDCNYTGSYNNIYSHFVDNHRNKSTSISFVCGGSVDVQMNISTGNILVLQESKKG  315

Query  521   VVFVVNHHMDPLGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLE  345
             ++F +     P G  V V CIAP + +  +  Y L    +      K    +K   +  E
Sbjct  316   LLFALQCFYKPHGLYVTVRCIAPSTPEVGKLAYCLYYSMDGHTLTYKSPEVKKVLEVSSE  375

Query  344   AVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIK  225
                +N            F+ VP +++   +  +K+ + +K
Sbjct  376   TPQDN------------FMFVPHSLLRGEFLEMKIAIGLK  403



>ref|XP_003621859.1| Ubiquitin [Medicago truncatula]
 gb|AES78077.1| seven in absentia family protein [Medicago truncatula]
Length=317

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 145/250 (58%), Gaps = 18/250 (7%)
 Frame = -2

Query  974  TLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKV  795
            T+ +  +LDC  CF  L+IP+FQC+NGHI C++CC KL NKC  C+  I   RC A+E +
Sbjct  5    TISNSKLLDCCNCFQPLSIPVFQCDNGHIVCSTCCPKLRNKCHKCSLHISSKRCIAIENL  64

Query  794  VESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRH  615
            ++S+++ C N  +GC+E I Y   R HE  CI+ PC CP   C F+ SS+ +  HF+++H
Sbjct  65   LQSIEMSCLNAKHGCKEKISYTGNRKHEEECIYVPCYCPLSGCDFVASSEVLSNHFSHKH  124

Query  614  VQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKR  438
              ++   ++     +SL  N   I LQE+  G +F++N++   LG AVN+ CI P SS  
Sbjct  125  GDSQIEFSYGHSFIVSLMSNGETIVLQEENDGKLFILNNNTMSLGKAVNICCIGPNSSGS  184

Query  437  RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDS  258
             + Y + A+ E     CK         +KL++ A+N+ ++  +     FL++P      S
Sbjct  185  EYSYDISAKSE----ICK---------LKLQSFAKNVQQFTLATLSSEFLVIPFR----S  227

Query  257  WDHLKLEVCI  228
             + LKL++CI
Sbjct  228  SEPLKLDICI  237



>ref|XP_003616164.1| Ubiquitin [Medicago truncatula]
Length=317

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 143/249 (57%), Gaps = 18/249 (7%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            +++P +LDC  C   LTIP+FQC+NGHI C++CC KL NKC  C+  I   RC+ +E V+
Sbjct  6    ILNPKLLDCSKCLQRLTIPVFQCDNGHIICSTCCPKLRNKCFMCSLNISSKRCKYIENVL  65

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV  612
            +S+++ CPN  YGC E I Y + R HE  CI+  C CP   C F  SS+ +  H +++H 
Sbjct  66   QSIEMSCPNAKYGCREKISYIENRKHEEECIYELCYCPLSGCDFAASSEVLSNHVSHKHR  125

Query  611  QAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRR  435
             +  + ++     +SLK N   I LQE+  G +F++N+    LG+AVN+ C+ P SS+  
Sbjct  126  DSHIKFSYGGSFIVSLKSNDETIVLQEENDGKLFILNNRTTLLGNAVNICCLGPNSSESE  185

Query  434  FLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSW  255
            + Y ++A  +     CK         +KL++  +N+ +   +     FL++P      S 
Sbjct  186  YSYDILASSQ----ICK---------LKLQSFVKNVQRVALATLSSEFLVIPF----ASS  228

Query  254  DHLKLEVCI  228
            + LKL++CI
Sbjct  229  EPLKLDICI  237



>ref|XP_006291420.1| hypothetical protein CARUB_v10017558mg [Capsella rubella]
 gb|EOA24318.1| hypothetical protein CARUB_v10017558mg [Capsella rubella]
Length=347

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 112/183 (61%), Gaps = 11/183 (6%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +S TL+DPDVLDCPIC   L IP+FQC+NGH+AC+ CC K+ N+CPSC  PIG+ RCRA+
Sbjct  97   LSVTLLDPDVLDCPICCEPLKIPIFQCDNGHLACSLCCTKVRNRCPSCTLPIGYVRCRAM  156

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            EKV+E+ +V CPN  YGC+E+  Y     HE  C++ PCSCP R C + G     Y  + 
Sbjct  157  EKVIEASRVSCPNAKYGCKENTSYGNRYSHEKLCVYAPCSCPIRNCNYTG-----YYKYL  211

Query  623  NRHVQAKR------ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
            N H +A+         +N+   ISL  N++   LQE+  G + VV          V+V C
Sbjct  212  NNHARAEHKDDMIPFKWNTRLTISLDLNEKTTILQEENNGHMIVVQVFKALYAVYVSVSC  271

Query  461  IAP  453
            IAP
Sbjct  272  IAP  274



>gb|EYU41321.1| hypothetical protein MIMGU_mgv11b0171931mg, partial [Erythranthe 
guttata]
Length=221

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = -2

Query  905  CENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNK  726
            C NGHIAC SCC K+  KC SC  PIG NRCRALEKV+ESL++ C +  YGC + I Y  
Sbjct  1    CWNGHIACESCCAKMSKKCASCCLPIGSNRCRALEKVLESLRILCAHAPYGCSDLISYTD  60

Query  725  LRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAKRITFNSPRQISLKKNQRFI  546
               HE TC H P  CP   C +  S + VY+HF   H  + +  F+   ++S  ++Q  +
Sbjct  61   KHAHEKTCKHAPFYCPLLGCTYADSPQSVYSHFAVTHWTSVKFDFDRSFRVSFVQDQNHV  120

Query  545  YLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEK  366
            +LQE     +FV++   +  G+ V+V  IAP SS+R + Y L AR     CG +      
Sbjct  121  FLQELDTLRIFVLSRFSENAGNYVSVTFIAPASSRREYFYNLTAR-----CGAR------  169

Query  365  TTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
              SI + +VAE   +W   A  + F++VP + ++ +   L+LE+ I  L
Sbjct  170  --SIMVTSVAECTARWSAEAKAERFVVVPTDFLTSA-GELELELTIWKL  215



>ref|XP_006405827.1| hypothetical protein EUTSA_v10027864mg [Eutrema salsugineum]
 gb|ESQ47280.1| hypothetical protein EUTSA_v10027864mg [Eutrema salsugineum]
Length=299

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 148/269 (55%), Gaps = 23/269 (9%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             G     +S TL+D  +LDCPICF + TIP+FQC+NGH+AC+SCC KL +KCPSCASPIG 
Sbjct  40    GTEDKRLSTTLLDLSILDCPICFEAFTIPIFQCDNGHLACSSCCAKLSDKCPSCASPIGH  99

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
              RCRA+E V+ES+ +PC N   GC +++ Y K+  HE  C  + CSCP   C + G  K+
Sbjct  100   IRCRAMESVLESILIPCANAKLGCAKNVSYGKVSTHEKECAFSLCSCPVLDCNYTGPYKD  159

Query  641   VYTH--FTNRHVQAKRITF--NSPRQIS----LKKNQRFIYLQEKTGGVVFVVNHHMDPL  486
             +Y H  FT+R   +  + +  ++ RQ S    +  + +   +   T  ++FVV    +P 
Sbjct  160   LYDHYKFTHRKKWSTGLAYMISNYRQSSFGAKMNISDKIFIIVNDTRSLLFVVQCFREPY  219

Query  485   GSAVNVICIAPGSSK-RRFLYKLVARG-EEENCGCKGGSGEKTTSIKLEAVAENIPKWDP  312
             G  V V CIAP + +   F Y++  +  +E     K    ++   +  +   EN      
Sbjct  220   GVYVTVRCIAPSAPEVGEFSYQISYKSVDEHTMFYKSPVVKRIREVSFQTPQEN------  273

Query  311   SAALKIFLLVPGNVISDSWDHLKLEVCIK  225
                    LL+P + +S   D L++ +CIK
Sbjct  274   -----SMLLIPLSWLSG--DSLEINICIK  295



>gb|EPS57190.1| hypothetical protein M569_17631, partial [Genlisea aurea]
Length=230

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 132/241 (55%), Gaps = 15/241 (6%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            L+DPDVLDCPICF++L  P++QC NGH+AC SCC K+ NKC SC+  IG+NRCRALEKV+
Sbjct  1    LLDPDVLDCPICFLALNPPVYQCVNGHVACDSCCKKMKNKCGSCSFSIGYNRCRALEKVM  60

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV  612
            ESL+  C N++YGC   +K N  R H                 +  S K++YTH    H 
Sbjct  61   ESLEFKCSNHSYGCLARLK-NSERVHHEKACPCIPCLCPCCSNYKASRKDLYTHLQKEHA  119

Query  611  QA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRR  435
             + ++I F     + L   +  I L E+  G +FV++  ++   S+  V+CIAP +S+R 
Sbjct  120  SSVEKIRFGVASMLCLDAIEGHIVLVEEGEGFLFVLSCSVNADWSSGYVVCIAPNNSERD  179

Query  434  FLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSW  255
            F+Y+L A              +  +S KL   AEN PKW      +   +V    ++  W
Sbjct  180  FVYELSAE-------------DGDSSTKLTTTAENTPKWGVDHKPRKQFVVLKEFMTSEW  226

Query  254  D  252
            +
Sbjct  227  E  227



>ref|XP_006405812.1| hypothetical protein EUTSA_v10028143mg, partial [Eutrema salsugineum]
 gb|ESQ47265.1| hypothetical protein EUTSA_v10028143mg, partial [Eutrema salsugineum]
Length=275

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 143/253 (57%), Gaps = 15/253 (6%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +S TL+D DVL+CPIC   L IP+FQC+NGH+AC+ CC K+ N CPSC  PIG++RCRA+
Sbjct  28   VSVTLLDQDVLECPICCEPLKIPIFQCDNGHLACSLCCNKVKNICPSCTLPIGYSRCRAM  87

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            EKV+E+ +V CP+  YGC+E+I Y     HE  C+ TPCSCP   C + GS  ++  H  
Sbjct  88   EKVIEATRVSCPHAKYGCKENISYGNQSSHEKLCVFTPCSCPMSDCNYTGSYNDLMNHVD  147

Query  623  NRHVQAKRI-TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
              H +   + ++++P +I     ++   L+EK  G + VV       G  V V C AP  
Sbjct  148  VEHKEDLLLFSWDTPLKIKFNLGEKLTILKEKNHGKLIVVQGSNGSQGMIVRVSCFAPSV  207

Query  446  SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVI  267
             +   L  L    + ++   +   G K T+I  + +++  P++        F+LVP  ++
Sbjct  208  PESERL-SLFCSLKLKSLNYRLKHGLKVTNI--QKMSDEQPEYG-------FMLVPSYML  257

Query  266  SDSWDHLKLEVCI  228
              ++    +++CI
Sbjct  258  GRTY----MDICI  266



>gb|KEH41205.1| seven in absentia family protein [Medicago truncatula]
Length=315

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 142/247 (57%), Gaps = 19/247 (8%)
 Frame = -2

Query  965  DPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVES  786
            DP +LDC  CF  LTIP+FQC+N HI C++CC KL NKC  C+  I   RC+ +E ++ S
Sbjct  8    DPYLLDCCKCFEPLTIPIFQCDNDHIVCSTCCTKLRNKCHECSLRISSKRCKVIENLLLS  67

Query  785  LKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQA  606
            +K+  PN  +GC+  I Y   R HE  CI+ PC CP   C F  SS+ +  HF+++H  +
Sbjct  68   IKISYPNAKHGCKAKISYTD-RKHEEKCIYVPCDCPLSGCDFAASSELLSNHFSHKHGDS  126

Query  605  K-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFL  429
            + + ++     +S+K N   I LQE+  G +F++N+    LG+AVN+ CI P SS+  + 
Sbjct  127  QIKFSYGQSFTVSMKSNDETIVLQEENDGKLFILNNRSMLLGNAVNLCCIGPNSSESDYS  186

Query  428  YKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDH  249
            Y ++AR +              + +KL++  +N+ +  P A L   LLV   +   S + 
Sbjct  187  YDILARSQ-------------ISKLKLQSFVKNVQQV-PLATLSSELLV---IPFGSSEP  229

Query  248  LKLEVCI  228
            LKL++CI
Sbjct  230  LKLDICI  236



>ref|XP_010415205.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Camelina 
sativa]
Length=295

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 133/258 (52%), Gaps = 17/258 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S T+ + D+LDCPIC  +LTIP+FQC+NGHIAC+SCC K+ NKCPSC  PIG  R R +E
Sbjct  37   SGTMFELDLLDCPICCHALTIPIFQCDNGHIACSSCCTKVRNKCPSCTLPIGNFRSRIME  96

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +VVE++ VPCPN   GC E   Y K   HE  C    C CP   C F G  K++Y+H+  
Sbjct  97   RVVEAVIVPCPNAKLGCTEKFSYGKELAHEKKCRFALCYCPEPGCDFSGVYKDLYSHYYA  156

Query  620  RHVQAK---RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             H       +          L  + + + LQE   G + VV    +P G  V V CIAP 
Sbjct  157  NHDDEDSWNKFVCGRSSGAWLHISDKILVLQESADGPLVVVQCFKEPQGFYVTVNCIAPS  216

Query  449  S-SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
            +     F Y L  +           SG KT + +LE + E I K       K F+LVP  
Sbjct  217  APGVGEFSYHLSYK-----------SGGKTMTFELEEM-ERIQKVSYRTPEKDFMLVP-Y  263

Query  272  VISDSWDHLKLEVCIKDL  219
               +    LK+ +CI+ L
Sbjct  264  YFQEQGIRLKMNICIRRL  281



>ref|XP_006302648.1| hypothetical protein CARUB_v10020752mg [Capsella rubella]
 gb|EOA35546.1| hypothetical protein CARUB_v10020752mg [Capsella rubella]
Length=283

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 140/260 (54%), Gaps = 21/260 (8%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL++ D+LDCPIC  +LTIP+FQC+NGHIAC+SCC KL NKCPSCA PIG  R R +E
Sbjct  9    SGTLMELDLLDCPICCHALTIPIFQCDNGHIACSSCCAKLRNKCPSCALPIGNYRSRIME  68

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +V+E++ VPCPN  +GC E   Y K   HE  C  + C CP   C + G  K++Y+HF  
Sbjct  69   RVLEAVFVPCPNAKHGCTEKFSYGKELVHEKDCNFSLCYCPAPNCNYTGMYKDLYSHFYA  128

Query  620  RHVQAKRIT-FNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP---  453
             H  +  +    +     L+ +++ + LQE  GG +  V    +P G  V V CIAP   
Sbjct  129  NHDNSWNLFGCGNSTGAWLRMSEKLLVLQEYRGGPLVAVQCFKEPQGVYVTVNCIAPSVP  188

Query  452  --GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
              G    +  YK+   G          + +     +++ V+   P+ D       F+LVP
Sbjct  189  GVGEYSYKLSYKMPMGGNTM-------TFKSPEMNRIQKVSFETPEKD-------FMLVP  234

Query  278  GNVISDSWDHLKLEVCIKDL  219
               + +    LK+E+CI  L
Sbjct  235  YYFLGEQ-SALKMEICIHKL  253



>dbj|BAB09039.1| unnamed protein product [Arabidopsis thaliana]
Length=291

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 136/252 (54%), Gaps = 16/252 (6%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
             TL+DPDVLDCPIC   L IP+FQC+NGH+AC  CC K+ N+CPSC  PIG+ RCRA+EK
Sbjct  45   VTLLDPDVLDCPICCEPLKIPIFQCDNGHLACTLCCTKVRNRCPSCTLPIGYVRCRAMEK  104

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            V+E+ +V C N  YGC+ES  Y     HE  C+ TPCSCP   C + G  K++  H    
Sbjct  105  VIEASRVSCLNAKYGCKESTSYGNRFSHEQVCVFTPCSCPILDCHYTGYYKDLNNHVRAE  164

Query  617  HVQAKRITF--NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSS  444
            H +   I+F  N+   ISL  N++   LQE+  G V VV          V+V CIAP   
Sbjct  165  H-KDDLISFVWNTRLTISLDLNKKTTILQEENDGHVIVVQVFRALHAVYVSVSCIAP---  220

Query  443  KRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVIS  264
                L   V R       C+       + +K   + +NI K         F+L+P  + S
Sbjct  221  ----LTPGVGR-----LSCRLAKITVDSLLKQGFMVKNIQKVTNEHPEDGFMLIPSYLFS  271

Query  263  DSWDHLKLEVCI  228
             + D+L L++ I
Sbjct  272  GN-DNLNLQIWI  282



>ref|XP_006405828.1| hypothetical protein EUTSA_v10027866mg [Eutrema salsugineum]
 gb|ESQ47281.1| hypothetical protein EUTSA_v10027866mg [Eutrema salsugineum]
Length=296

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 144/266 (54%), Gaps = 19/266 (7%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             G     +S TL+D  +LDCPICF + TIP+FQC+NGH+ C+SCC KL +KCPSC+SPIG 
Sbjct  37    GTEDKRLSTTLLDLSILDCPICFEAFTIPIFQCDNGHLTCSSCCPKLSDKCPSCSSPIGR  96

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
              RC+A+E V+ES+ +PCPN  +GC + + Y K   HE  C  + CSCP   C + GS K+
Sbjct  97    IRCKAMESVLESIFIPCPNAKFGCTKKVSYGKESTHEKECTFSLCSCPVLDCNYTGSYKD  156

Query  641   VYTHFTNRHVQA------KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGS  480
             +Y H+   H+           +F +  +  +  + + +   + T  ++FVV    +P G 
Sbjct  157   LYDHYKFIHLDCYVDIVLNTFSFGNSFRAYMNISDKILLRLDHTRSLLFVVQCFREPYGV  216

Query  479   AVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAA  303
              V V CIAP + +   F Y +     +E+         K    ++  V+   P+ +    
Sbjct  217   YVTVRCIAPSAPEVGEFSYHISYTSVDEHTMIYKSPVVK----RIREVSFQTPQENS---  269

Query  302   LKIFLLVPGNVISDSWDHLKLEVCIK  225
                 LL+P   +  + D L++++CIK
Sbjct  270   ---MLLIPLGCL--NGDSLEMDICIK  290



>ref|NP_198609.1| E3 ubiquitin-protein ligase SINA-like 10 [Arabidopsis thaliana]
 sp|Q84K34.1|SIL10_ARATH RecName: Full=E3 ubiquitin-protein ligase SINA-like 10; AltName: 
Full=Seven in absentia-like protein 10 [Arabidopsis thaliana]
 gb|AAO42143.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50500.1| unknown protein [Arabidopsis thaliana]
 gb|AED94248.1| E3 ubiquitin-protein ligase SINA-like 10 [Arabidopsis thaliana]
Length=349

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 136/252 (54%), Gaps = 16/252 (6%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
             TL+DPDVLDCPIC   L IP+FQC+NGH+AC  CC K+ N+CPSC  PIG+ RCRA+EK
Sbjct  103  VTLLDPDVLDCPICCEPLKIPIFQCDNGHLACTLCCTKVRNRCPSCTLPIGYVRCRAMEK  162

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            V+E+ +V C N  YGC+ES  Y     HE  C+ TPCSCP   C + G  K++  H    
Sbjct  163  VIEASRVSCLNAKYGCKESTSYGNRFSHEQVCVFTPCSCPILDCHYTGYYKDLNNHVRAE  222

Query  617  HVQAKRITF--NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSS  444
            H +   I+F  N+   ISL  N++   LQE+  G V VV          V+V CIAP   
Sbjct  223  H-KDDLISFVWNTRLTISLDLNKKTTILQEENDGHVIVVQVFRALHAVYVSVSCIAP---  278

Query  443  KRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVIS  264
                L   V R       C+       + +K   + +NI K         F+L+P  + S
Sbjct  279  ----LTPGVGR-----LSCRLAKITVDSLLKQGFMVKNIQKVTNEHPEDGFMLIPSYLFS  329

Query  263  DSWDHLKLEVCI  228
             + D+L L++ I
Sbjct  330  GN-DNLNLQIWI  340



>emb|CDY25763.1| BnaA07g10190D [Brassica napus]
Length=272

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 114/182 (63%), Gaps = 3/182 (2%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +S TL+DPDVL+CPIC   L IP+FQCENGH+AC+ CC K+   CPSC SP G++RCRA+
Sbjct  19   VSLTLLDPDVLECPICCEPLKIPIFQCENGHLACSQCCEKVKKICPSCKSPNGYSRCRAM  78

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPN--RACKFLGSSKEVYTH  630
            E+V+E+ +V CPN+ YGC+E+  +     HE  C+  PC CP     C ++GS K +  H
Sbjct  79   ERVIEACRVSCPNSKYGCKENTSFGNRSSHEKQCLFAPCFCPVPLNDCNYVGSDKNLRNH  138

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               +H      I F++P  + +  +++ +  QEK  G +FVV       G AV+V CIAP
Sbjct  139  IRAKHKDHVIPIVFDTPLTLVMGSSEKIVCFQEKKDGELFVVQAFRKSYGLAVSVNCIAP  198

Query  452  GS  447
             +
Sbjct  199  SA  200



>gb|KDO63138.1| hypothetical protein CISIN_1g038068mg, partial [Citrus sinensis]
Length=269

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 122/200 (61%), Gaps = 9/200 (5%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            GS + T+ D D+ DCPICF  LT+P+FQC NGH+AC+ CC K+   CP+C+SP    R  
Sbjct  43   GSEALTITDQDIFDCPICFEPLTVPVFQCVNGHLACSDCCAKIKRNCPTCSSPTVIVRNW  102

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+E ++V C N  YGC++ + ++K R HE TC H+P  CP   C FLG S +   H
Sbjct  103  AIEKVIELVQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPLPCPLSDCSFLGCSSQFVRH  162

Query  629  FTNRH-VQAKRITFNSPRQISLKKNQ-----RFIYLQ-EKTGGVVFVVNHHMDPLGSAVN  471
            F  +H + A    +NS   ++L  N      +F  LQ EK   V+F++N++   LG+ V+
Sbjct  163  FMAKHNISAVPFKYNSLLNVNLNVNDINIDGKFSVLQEEKNDDVLFILNNNTGSLGNLVS  222

Query  470  VICIAPGSSKRRFLYKLVAR  411
            V CIA  S ++   Y +VAR
Sbjct  223  VCCIA--SVRKDLYYDIVAR  240



>ref|XP_002870581.1| hypothetical protein ARALYDRAFT_915958 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46840.1| hypothetical protein ARALYDRAFT_915958 [Arabidopsis lyrata subsp. 
lyrata]
Length=269

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 10/192 (5%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            ++D DVLDCP+CF  LTIP+FQC+NGH+AC+SCC KL NKCP+C   +G  RCRA+E V+
Sbjct  30   MLDFDVLDCPVCFEPLTIPIFQCDNGHLACSSCCPKLSNKCPTCTLHVGNKRCRAMESVL  89

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV  612
            ES+ +PCPN  +GC +SI Y K   HE  CI + C CP   C +  S K++YTH+   H+
Sbjct  90   ESIFIPCPNANFGCTKSISYGKESTHEKECIFSQCYCPALNCNYTSSYKDLYTHYRTTHM  149

Query  611  QAKR-------ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            +  +       I F+    I   KN   I  +E T  ++F V    +P G  V V CIAP
Sbjct  150  EVDQLNKYICDIPFSVRMNIGSDKN--IIIRKEYTKRLLFAVQCFREPCGVYVTVSCIAP  207

Query  452  GSSKR-RFLYKL  420
             + +  +F Y L
Sbjct  208  SAPEVGQFSYHL  219



>gb|AES99097.2| seven in absentia family protein [Medicago truncatula]
Length=322

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 140/246 (57%), Gaps = 18/246 (7%)
 Frame = -2

Query  962  PDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESL  783
            PD+L C  C   LTIP+ QC+NGHI C++CC KL NKC  C+ P     C+A+E ++ SL
Sbjct  9    PDLLVCCNCCEPLTIPVSQCDNGHIVCSTCCPKLGNKCYKCSLPTSSKHCKAIENLLVSL  68

Query  782  KVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAK  603
            ++ CPN  YGC + I Y + R+HE  CIH PC CP  +C F+ SS+ +  HF+++H  ++
Sbjct  69   EMSCPNAKYGCNKKISYIRKRNHEKECIHVPCYCPISSCGFVASSEVLSKHFSDKHKDSQ  128

Query  602  -RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLY  426
             + ++     +SLK     I  QE++ G +F++N+    LG+A+N+ CI P S +    Y
Sbjct  129  IKFSYGDSFNVSLKSKDETIVFQEESYGKLFILNNRATLLGNAINICCIGPNSFESECSY  188

Query  425  KLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHL  246
             ++ R +  N             +KL++ A+N+     +      L++P      S++ L
Sbjct  189  DILVRSQMCN-------------LKLQSFAKNVQSVVLATLSSELLVIPFG----SFEAL  231

Query  245  KLEVCI  228
            KLE+CI
Sbjct  232  KLEICI  237



>ref|XP_009103206.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 isoform X1 
[Brassica rapa]
Length=272

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 139/267 (52%), Gaps = 18/267 (7%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +S TL+DPDVL+CPIC   L IP+FQCENGH+AC+ CC K+   CPSC SP G++RCRA+
Sbjct  19   VSLTLLDPDVLECPICCEPLKIPIFQCENGHLACSQCCEKVKKICPSCKSPNGYSRCRAM  78

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPN--RACKFLGSSKEVYTH  630
            E+V+E+ +V CPN+ YGC+E+  +     HE  C+  PC CP     C ++GS K +  H
Sbjct  79   ERVIEACRVSCPNSKYGCKENTSFGNRSSHEKQCLFAPCFCPVPLNDCNYVGSDKNLRNH  138

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               +H      I F++P  + +  +++ +  QEK  G +FVV       G +V+V CIAP
Sbjct  139  IRAKHKDHVIPIVFDTPLTLVMGSSEKIVCFQEKKDGELFVVQAFRKSYGLSVSVNCIAP  198

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
                        A G      C     +    +K       I K         F+L+P +
Sbjct  199  S-----------AHGHGRFSCCMDVIIDPCIKLKQAFTVREIQKKIHEEPKDSFMLIPSH  247

Query  272  VISDSWDHLKLEVCIKDLA*DSMDTYM  192
            ++  +     +++C        MD+++
Sbjct  248  MLMLTDWSFGIDICFS----RGMDSFI  270



>ref|XP_002868819.1| seven in absentia family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45078.1| seven in absentia family protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 110/179 (61%), Gaps = 3/179 (2%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +S TL+DPDVLDCPIC   L IP+FQC+NGH+AC  CC K+ N+CPSC  PIG+ RCRA+
Sbjct  102  LSVTLLDPDVLDCPICCEPLKIPIFQCDNGHLACTLCCTKVRNRCPSCTLPIGYVRCRAM  161

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            EKV+E+ +V CPN  YGC+E+  Y     HE  C+ TPC CP   C + G  K++  H  
Sbjct  162  EKVIETSRVSCPNAKYGCKENTAYGNRFSHEKVCVFTPCFCPIVDCNYSGYYKDLNNHVR  221

Query  623  NRHVQAKRITF--NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
              H +   I+F  N+   +SL  N++   LQE+  G V VV          ++V CIAP
Sbjct  222  AEH-KDDLISFVWNTRLTLSLDLNEKTTILQEENDGDVIVVQVFKALHAVYLSVSCIAP  279



>ref|XP_006405825.1| hypothetical protein EUTSA_v10027865mg [Eutrema salsugineum]
 gb|ESQ47278.1| hypothetical protein EUTSA_v10027865mg [Eutrema salsugineum]
Length=298

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 148/273 (54%), Gaps = 28/273 (10%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             G     +S  L+D ++L+CPICF +LTIP+FQC+NGH+AC+SCC KL +KCPSCASPIG 
Sbjct  39    GTDDKRLSTMLLDLNILECPICFETLTIPIFQCDNGHLACSSCCAKLSDKCPSCASPIGH  98

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
              RCRA+E V++S+ VPCPN  +GC + + Y K   HE  C  + CSCP   C + G  ++
Sbjct  99    IRCRAMESVLDSIFVPCPNAKFGCTKKVSYGKESAHEKECAFSRCSCPELDCNYTGLYED  158

Query  641   VYTHFTNRH---------VQAKRI--TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
             +Y H+   H         V   R+  +F +   IS K + +     + T   +F V    
Sbjct  159   LYDHYLYDHNYITSYPAIVNFCRLGNSFCAQMNISDKISIKV----DTTTSRLFAVQCFR  214

Query  494   DPLGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW  318
             +P G  V V CIAP + +   F Y++     + +      + E     ++  V+   P+ 
Sbjct  215   EPYGVYVTVSCIAPSAPEVGEFSYQISYTSADGH----TMTYESPEVKRIREVSFETPQE  270

Query  317   DPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
             +        LL+P + +  S D LK+++CIK L
Sbjct  271   NS------MLLIPRSCL--SGDSLKMKICIKKL  295



>ref|XP_010450966.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Camelina 
sativa]
Length=344

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 138/252 (55%), Gaps = 16/252 (6%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
             TL+DPDVLDCPIC   L  P+FQC+NGH+AC+ CC K+ N CPSC  PIG+ RCRA+EK
Sbjct  96   VTLLDPDVLDCPICCEPLKNPIFQCDNGHLACSLCCTKVRNICPSCTLPIGYVRCRAMEK  155

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            V+ES +V CPN  YGC+E+  Y     HE  C+ TPCSCP R C + G  K++  H    
Sbjct  156  VIESSRVSCPNARYGCKENTFYGNRFSHEKFCVFTPCSCPIRDCNYTGYYKDLNNHVRAE  215

Query  617  HVQAKRITF--NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSS  444
            H +   I+F  N+   ISL  N++   LQE+  G V VV          V+V CIAP + 
Sbjct  216  H-KDDLISFMWNTRLTISLDLNEKTTILQEENDGHVIVVQVFRALHAVYVSVSCIAPSAP  274

Query  443  KRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVIS  264
                    +A+   +N             +K   + +NI K         F+L+P  ++S
Sbjct  275  GVGKFSCSIAKITVDNL------------LKQGFMLKNIQKVKNEQPEDGFMLIPSYLLS  322

Query  263  DSWDHLKLEVCI  228
             + ++L L++ I
Sbjct  323  GN-ENLNLQILI  333



>ref|XP_006405877.1| hypothetical protein EUTSA_v10028216mg, partial [Eutrema salsugineum]
 gb|ESQ47330.1| hypothetical protein EUTSA_v10028216mg, partial [Eutrema salsugineum]
Length=280

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 149/277 (54%), Gaps = 22/277 (8%)
 Frame = -2

Query  1028  DGVSNGVMSGKGK-GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             DG  N  +  + +  +I + ++D DVLDCPICF  L IP+FQC+NGH+AC+SCC +L +K
Sbjct  12    DGSGNIRLHKRQRTDNIRSAMVDFDVLDCPICFEPLNIPIFQCDNGHLACSSCCAELSDK  71

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             CPSC  PIG  RCRA+E V+ES+ +PC N T GC + + Y K+  HE  C  + CSCP  
Sbjct  72    CPSCTLPIGHIRCRAMESVLESILIPCQNATLGCAKKVSYGKVSTHEKECAFSLCSCPVL  131

Query  671   ACKFLGSSKEVYTHFTNRHV-----QAKRITFNSPRQISLKKN--QRFIYLQEKTGGVVF  513
              C + G  K++Y H+   H+     Q     F      S++ N   + +  +E    ++F
Sbjct  132   DCNYTGPYKDLYDHYRFTHLKGDSRQRADSMFKCGVSFSVQMNISDKILIKREGVKKLLF  191

Query  512   VVNHHMDPLGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVA  336
             VV    +P G  V V CIAP +S+   F Y +  + E+ +         K    ++  ++
Sbjct  192   VVQCIKEPYGVYVTVSCIAPSASEGGEFSYDIFYKSEDGHIMTYQSPEVK----RIRELS  247

Query  335   ENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIK  225
               IP+ +       F+L+P + +    D LK+ V I+
Sbjct  248   FQIPQNN-------FMLIPHSFL--RGDLLKMNVVIQ  275



>ref|XP_010445581.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=274

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/259 (38%), Positives = 142/259 (55%), Gaps = 17/259 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            SATL+D   LDCPIC  +LT P+ QC+NGHI+C++CC KL NKCPSCA P G  RCRA+E
Sbjct  25   SATLLDLKALDCPICTDALTTPILQCDNGHISCSTCCNKLRNKCPSCALPNGHIRCRAME  84

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF--  627
            +V++++ VPCPN  +GC++   Y +   HE  C  + CSCP R CK+ GS K++Y+HF  
Sbjct  85   RVIKAVIVPCPNVKFGCKQKFSYGEELTHEKECTLSLCSCPARNCKYTGSYKDLYSHFKI  144

Query  626  -TNRHVQAKRITFNSP-RQISLKKNQRF-IYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
                   + R TF     Q+  +  +   + ++E+  G++FVV+   +P G  V V CIA
Sbjct  145  HKGERGYSYRFTFGDKFAQVYFELTEYTSVVMKERKDGLLFVVHCFTEPHGVYVTVSCIA  204

Query  455  PGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
            P +              E +C       +   +  L  V + I K +     + F+LVP 
Sbjct  205  PSA----------LEVGEFSCHISTFLEKYNMTFDLPKV-KKIQKLNFQTPEEDFMLVPT  253

Query  275  NVISDSWDHLKLEVCIKDL  219
              +  S   LKL +CI  L
Sbjct  254  YFLHGS-QALKLRICISKL  271



>ref|XP_006405826.1| hypothetical protein EUTSA_v10027852mg [Eutrema salsugineum]
 gb|ESQ47279.1| hypothetical protein EUTSA_v10027852mg [Eutrema salsugineum]
Length=312

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/268 (37%), Positives = 145/268 (54%), Gaps = 37/268 (14%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +SATL D ++LDCP+CF +LTIP+FQC+NGH+AC+SCC KL +KCPSCASPIG  RCRA+
Sbjct  46   LSATLFDLNILDCPVCFEALTIPIFQCDNGHLACSSCCAKLSDKCPSCASPIGHIRCRAM  105

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            E V+ES  + CPN   GC + + Y K+  HE  C  + CSCP   C + GS K++Y H+ 
Sbjct  106  ESVLESTLILCPNAKLGCTKKVSYGKVSTHEKECAFSLCSCPLLDCNYTGSYKDLYDHYK  165

Query  623  NRHVQAKR---------ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVN  471
              H+ + +         I+F++   IS K   +  Y + +    +F V    +  G  V 
Sbjct  166  FIHMNSLQTLLNTFSCGISFSAEMNISDKVLIKADYTRRR----LFAVQCFRESYGVYVT  221

Query  470  VICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEA-----VAENIPKWDPS  309
            V CIAP + +   F Y +             G G   T    E      V+  IP+ +  
Sbjct  222  VRCIAPSAPQVGEFSYHISY---------TSGDGHIMTYESPEVKRICEVSHQIPQEN--  270

Query  308  AALKIFLLVPGNVISDSWDHLKLEVCIK  225
                 F+L+P + +    + L++++CIK
Sbjct  271  -----FMLIPHSFL--RGESLEMDICIK  291



>emb|CDY12498.1| BnaC07g13380D [Brassica napus]
Length=272

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 138/267 (52%), Gaps = 18/267 (7%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +S TL+DPDVL+CPIC   L IP+FQCENGH+AC+ CC K+   CPSC SP G++RCRA+
Sbjct  19   VSLTLLDPDVLECPICREPLKIPIFQCENGHLACSQCCEKVKKICPSCKSPNGYSRCRAM  78

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPN--RACKFLGSSKEVYTH  630
            E+V+E+ +V CPN  YGC+E+  +     HE  C+  PC CP     C ++GS K +  H
Sbjct  79   ERVIEACRVSCPNAKYGCKENTSFGNRASHEKQCLFAPCFCPVPLNDCNYVGSDKNLRNH  138

Query  629  FTNRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               +H      I F++P  + +  +++    QEK  G +FVV       G  V+V CIAP
Sbjct  139  IRAKHKDHVIPIVFDTPLTLVMGSSEKIACFQEKKDGELFVVQAFRKSYGLVVSVNCIAP  198

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
                        A G      C     + +  +K  +    I K         F+L+P +
Sbjct  199  S-----------AHGLGRFSCCMDVIIDPSIKLKQASTVREIQKKIHEEPKDSFMLIPSH  247

Query  272  VISDSWDHLKLEVCIKDLA*DSMDTYM  192
            ++  +     +++C        MD+++
Sbjct  248  MLMLTDWSFGIDICFS----RGMDSFI  270



>ref|XP_003616139.1| Ubiquitin [Medicago truncatula]
Length=417

 Score =   167 bits (424),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 145/257 (56%), Gaps = 19/257 (7%)
 Frame = -2

Query  992  KGSISATLID-PDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
            KG +   ++  PD+L C  C   LTIP+ QC+NGHI C++CC KL NKC  C+ P     
Sbjct  93   KGVMEPVIVSVPDLLVCCNCCEPLTIPVSQCDNGHIVCSTCCPKLGNKCYKCSLPTSSKH  152

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C+A+E ++ SL++ CPN  YGC + I Y + R+HE  CIH PC CP  +C F+ SS+ + 
Sbjct  153  CKAIENLLVSLEMSCPNAKYGCNKKISYIRKRNHEKECIHVPCYCPISSCGFVASSEVLS  212

Query  635  THFTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI  459
             HF+++H  ++ + ++     +SLK     I  QE++ G +F++N+    LG+A+N+ CI
Sbjct  213  KHFSDKHKDSQIKFSYGDSFNVSLKSKDETIVFQEESYGKLFILNNRATLLGNAINICCI  272

Query  458  APGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
             P S +    Y ++ R +  N             +KL++ A+N+     +      L++P
Sbjct  273  GPNSFESECSYDILVRSQMCN-------------LKLQSFAKNVQSVVLATLSSELLVIP  319

Query  278  GNVISDSWDHLKLEVCI  228
                  S++ LKLE+CI
Sbjct  320  FG----SFEALKLEICI  332



>ref|XP_006430662.1| hypothetical protein CICLE_v10013856mg, partial [Citrus clementina]
 gb|ESR43902.1| hypothetical protein CICLE_v10013856mg, partial [Citrus clementina]
Length=279

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 157/272 (58%), Gaps = 21/272 (8%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK-  852
             D   N   +    G ++  L +  VL C +C   LT+P+FQCENGH+AC+ CCI L  K 
Sbjct  7     DEDDNAQSADVENGPLALILDNRKVLHCSMCDGHLTVPIFQCENGHLACSFCCITLKRKE  66

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHE-PTCIHTPCSCPN  675
             C SC S IG +RC A+E+++E ++V C N+ YGC+E++ Y+K+ DH+   C + PCSCP 
Sbjct  67    CYSCQSTIGSSRCLAIERILEVVRVKCQNSIYGCKETVTYSKMHDHQIYDCYYAPCSCPI  126

Query  674   RACKFLGSSKEVYTHFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQ-EKTGGVVFVVNH  501
               CKF+G+S+ +Y H +  H  +  +  +N+  +I++  + +F  LQ EK   V+F++N+
Sbjct  127   SDCKFVGTSRHLYQHLSGEHNNSVVKFQYNNFFKITVNIDGKFSVLQEEKNDDVLFILNN  186

Query  500   HMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEA-VAENIP  324
             +   LG+ V+V CIA  S ++   Y +VAR       C  G+  K  S    + V  +IP
Sbjct  187   NTGSLGNLVSVCCIA--SVRKDLYYDIVAR-------CVTGTTLKIQSSTWSSKVRSDIP  237

Query  323   KWDPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
                P      FLLVP  + + +   L+LE+CI
Sbjct  238   S--PFG----FLLVPPYMFNCN-GQLELEICI  262



>ref|XP_010451915.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=497

 Score =   169 bits (427),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 120/190 (63%), Gaps = 4/190 (2%)
 Frame = -2

Query  998  KGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFN  819
            K + S SA L+  DVLDCPICF +LTIP+FQC+NGH+AC+SCC KL NKCP+CASP+G N
Sbjct  242  KRQRSSSAMLLGLDVLDCPICFEALTIPIFQCDNGHLACSSCCPKLSNKCPTCASPVGHN  301

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEV  639
            RCRA+E V+ES+ VPC N   GC +++ Y K   HE  C  T CSCP   C + GS   +
Sbjct  302  RCRAMESVLESVFVPCRNAKLGCTKNVSYAKESIHEKECTFTQCSCPVLECSYTGSYDNI  361

Query  638  YTHFTNRHV-QAKRITFNSPRQISLKKN---QRFIYLQEKTGGVVFVVNHHMDPLGSAVN  471
            YTHF + H  ++K ++F     + ++ N   ++ + L +    ++F +    +P    V 
Sbjct  362  YTHFFDNHCHESKSVSFFCGGAVDVQMNIASEKSLVLWKSKKRLLFALQCFNEPHCLYVT  421

Query  470  VICIAPGSSK  441
            V  IAP +S+
Sbjct  422  VRWIAPSASE  431



>ref|XP_010511492.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Camelina 
sativa]
Length=309

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 133/258 (52%), Gaps = 17/258 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S T+ + D+LDCPIC  +LTIP+FQC+NGHIAC+SCC K+ NKCPSC  PIG  R R +E
Sbjct  35   SGTMFELDLLDCPICCYALTIPIFQCDNGHIACSSCCTKVRNKCPSCTLPIGNFRSRIME  94

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +VVE++ VPCPN   GC E   Y K   HE  C    C CP   C + G  K++Y+H+  
Sbjct  95   RVVEAVIVPCPNARLGCTEKFSYGKELAHEKICRFALCYCPIPDCDYSGVYKDLYSHYYA  154

Query  620  RHVQA---KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             H       +          L  + + + LQE   G + V+    +P G  V V CIAP 
Sbjct  155  NHDDEHSWNKFVCGRSSGAWLLISDKILVLQESADGPLVVLQCFKEPQGFYVTVSCIAPS  214

Query  449  S-SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
            +     F Y L  +           SG KT + +LE + E I K       K F+LVP  
Sbjct  215  APGVGEFSYHLSYK-----------SGGKTMTFELEEM-ERIQKVSYRTPEKDFMLVP-Y  261

Query  272  VISDSWDHLKLEVCIKDL  219
               +    LK+ +CI+ L
Sbjct  262  YFQEQGIRLKMNICIRRL  279



>ref|XP_010470538.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Camelina 
sativa]
Length=284

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/258 (38%), Positives = 133/258 (52%), Gaps = 17/258 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            + T+ + D+LDCPIC  +LTIP+FQC+NGHIAC+SCC KL NKCP+C  PIG  R R +E
Sbjct  26   TGTMFELDLLDCPICCHALTIPIFQCDNGHIACSSCCTKLRNKCPACTLPIGNFRSRIME  85

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +VVE++ VPCPN   GC +   Y K   HE  C    C CP   C + G  K++Y+H+  
Sbjct  86   RVVEAVIVPCPNARLGCTQKFSYGKELVHEKKCRFALCYCPEPGCDYSGVYKDLYSHYYA  145

Query  620  RHVQAK---RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             H       +          L  + + + LQE   G + VV    +P G  V V CIAP 
Sbjct  146  NHDDEDSWNKFVCGRSSGAWLLISDKILVLQESADGPLVVVQCFKEPQGFYVTVNCIAPS  205

Query  449  S-SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
            +     F Y L  +           SG KT + +LE + E I K       K F+LVP  
Sbjct  206  APGVGEFSYHLSYK-----------SGGKTMTFELEEM-ERIQKVSYRTPEKDFMLVP-Y  252

Query  272  VISDSWDHLKLEVCIKDL  219
               +    LK+ +CI+ L
Sbjct  253  YFQEQGIRLKMNICIRRL  270



>ref|XP_006284306.1| hypothetical protein CARUB_v10005477mg [Capsella rubella]
 gb|EOA17204.1| hypothetical protein CARUB_v10005477mg [Capsella rubella]
Length=274

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 145/282 (51%), Gaps = 37/282 (13%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGK--GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLI  858
             V+G SN  +  K +        ++D DV DCPIC   LTIP+FQC+NGH+AC+SCC KL 
Sbjct  8     VNGPSNTYLQKKQRTEDKTRPAMLDFDVFDCPICSEPLTIPIFQCDNGHLACSSCCPKLS  67

Query  857   NKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCP  678
             NKCP+C  PIG  RCRA+E ++ES+ +PCPN T+GC +++ Y K   H   C  + CSCP
Sbjct  68    NKCPACTLPIGRIRCRAMESILESILIPCPNATFGCTKNVSYGKESTHVKECAFSQCSCP  127

Query  677   NRACKFLGSSKEVYTHFTNRHVQAKRITFNSPRQ---ISLKKNQRFIYLQEKTGGV----  519
                C + GS K++Y H+         I F+ P +   + LK +  FI+  E +  +    
Sbjct  128   VPGCNYNGSYKDLYAHY---------ILFSHPIEYINLPLKFDNSFIFRMEISKKILILR  178

Query  518   ------VFVVNHHMDPLGSAVNVICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTT  360
                   VFVV    +P G  V + CIAP + +  +F Y L    +  +   K    ++  
Sbjct  179   GLVKKLVFVVQCFKEPYGVYVTISCIAPSAPEVGKFSYHLSYIVDGYSMTFKSPEVKRVL  238

Query  359   SIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEV  234
              + LE      P+ D       F+L+P + +      +K  +
Sbjct  239   EVSLET-----PRED-------FMLIPNSFLRGEMLDMKFRI  268



>gb|KFK35022.1| hypothetical protein AALP_AA5G224000 [Arabis alpina]
Length=266

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 146/279 (52%), Gaps = 37/279 (13%)
 Frame = -2

Query  1007  MSGKGKGS-----ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPS  843
              SG+G GS     +S TL+DPD L CPICF  LTIP+FQC+NGH+AC+SCC KL NKCP+
Sbjct  6     FSGEGNGSSRKRQLSTTLLDPDSLHCPICFELLTIPIFQCDNGHLACSSCCPKLRNKCPA  65

Query  842   CASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACK  663
             CA PIG  RCRA+E V+ES+ VPC N   GC ++  Y     HE  C  + CSCP + C 
Sbjct  66    CALPIGHIRCRAMETVLESVFVPCRNAKLGCTKNFSYGNELAHEKECAFSLCSCPVQDCN  125

Query  662   FLGSSKEVYTHFTNRHVQ-------AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVN  504
             +  S + +Y H+   H Q       +  I+F +   IS K + +  Y       ++F V 
Sbjct  126   YAASYEHLYVHYKCNHGQICPLNLFSAGISFTAKMNISDKISMQTEYRMR----LLFAVQ  181

Query  503   HHMDPLGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAE--  333
                +P G  V V CIAP + +   F Y L    +        G      + K++ V E  
Sbjct  182   CFREPYGVYVTVNCIAPSAPEVGEFSYHLSYTVD--------GHTMTYEAPKMKMVLEVS  233

Query  332   -NIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
                PK         F+L+P +  S   D L++++CI+ L
Sbjct  234   FQTPKEK-------FMLIPDS--SLRGDVLEMKLCIRKL  263



>ref|XP_006284253.1| hypothetical protein CARUB_v10005419mg [Capsella rubella]
 gb|EOA17151.1| hypothetical protein CARUB_v10005419mg [Capsella rubella]
Length=286

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 143/272 (53%), Gaps = 19/272 (7%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             ++ V S       S TL+D ++LDCPIC+ +L  P+FQC+NGHIAC+ CC KL NKC  C
Sbjct  20    ASSVPSSDAAKKRSITLLDLEILDCPICYEALATPIFQCDNGHIACSVCCPKLRNKCSIC  79

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
             A PIG +RCRA+E V+ES+ + C N  +GC +++ Y    +HE  C+ + CSCP   C  
Sbjct  80    ALPIGHSRCRAMESVLESILILCTNANFGCTKTVSYGDKSNHEKECVFSQCSCPALGCDH  139

Query  659   LGSSKEVYTHFTNRHVQAK----RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMD  492
               S  +++ H+   H+  +    + + +    + L+ + +    +E   G++FVV    +
Sbjct  140   ASSYDDLFLHYIMTHMDMEIEPVKFSCDISFAVLLRISDKVRVFREFEEGLLFVVQCFKE  199

Query  491   PLGSAVNVICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
             P G  V V CIAP + K   F Y L    +  +   K    ++   +  E   EN     
Sbjct  200   PCGVFVTVRCIAPSAPKVGEFSYHLSYAVDGYSMAFKSPEVKRVLEVSFEIPREN-----  254

Query  314   PSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
                    FLL+P +++    + L ++VCIK L
Sbjct  255   -------FLLIPNSLL--RGETLDMKVCIKKL  277



>gb|KDO63136.1| hypothetical protein CISIN_1g048313mg, partial [Citrus sinensis]
Length=252

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 139/252 (55%), Gaps = 26/252 (10%)
 Frame = -2

Query  956  VLDCPICFMSLTIPLF---QCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVES  786
            VL C I F S    L    +C NGHI C  CCI+L+NKCPSC  PIG +R  A+EKV+ES
Sbjct  15   VLHCFISFSSFIFTLLSVAECGNGHIVCNRCCIELMNKCPSCRLPIGHSRSIAMEKVLES  74

Query  785  LKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ-  609
            ++V C N  +GC+E + Y+K  DH   C H  CSCP  AC F+GS  ++Y HF   H   
Sbjct  75   IQVTCENEDHGCKEKMSYSKKYDHGKACHHARCSCPLAACNFVGSFNQIYQHFRGVHKHA  134

Query  608  AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFL  429
            A+   ++   +I+L  +   I+LQE+  G +F++N+  +P G  ++V CIAP   K   +
Sbjct  135  AEEFVYDKVLRITLSVHHDLIFLQEEKNGDLFILNNSTEPHGYRISVNCIAP-PCKGGIV  193

Query  428  YKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD----PSAALKIFLLVPGNVISD  261
            Y +VA+         GG+     + K  +  ++I  WD    PS A    LLVP +    
Sbjct  194  YSIVAKS--------GGA-----AYKFNSCTKSIQNWDENNPPSVAS---LLVPSDFFG-  236

Query  260  SWDHLKLEVCIK  225
            S+  L LEV I+
Sbjct  237  SYGQLNLEVRIQ  248



>ref|XP_006430663.1| hypothetical protein CICLE_v10013490mg [Citrus clementina]
 gb|ESR43903.1| hypothetical protein CICLE_v10013490mg [Citrus clementina]
Length=267

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 118/199 (59%), Gaps = 5/199 (3%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCR  810
            GS + T+ D D+ DCPICF  LT+P+FQC NGH+AC+ CC K+   CP+C+SP    R  
Sbjct  41   GSEALTITDQDIFDCPICFEPLTVPVFQCVNGHLACSDCCAKIKRNCPTCSSPTVIVRNW  100

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            A+EKV+E ++V C N  YGC++ + ++K R HE TC H+P  CP   C FLG S +   H
Sbjct  101  AIEKVIELVQVNCKNAEYGCQQKMSFSKKRGHEKTCQHSPLPCPLSDCSFLGCSSQFVRH  160

Query  629  FTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            F  +H + A    +NS   ++L  N   +  QE+  G +FV+ + +   G   N+I I P
Sbjct  161  FMAKHNISAVPFKYNSLLNVNLNVNDSVLLFQEEKNGYLFVLRNRI--TGELGNIISIRP  218

Query  452  --GSSKRRFLYKLVARGEE  402
               S  ++F Y++  R ++
Sbjct  219  VCASHDKQFQYQIGVRSQK  237



>ref|XP_006301171.1| hypothetical protein CARUB_v10021568mg [Capsella rubella]
 gb|EOA34069.1| hypothetical protein CARUB_v10021568mg [Capsella rubella]
Length=296

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 133/262 (51%), Gaps = 19/262 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL D ++LDCP+C  +LT  +FQC+NGHIAC+SCC KL + CPSC  PIG  RCR +E
Sbjct  42   SGTLFDLNLLDCPVCSNALTSSIFQCDNGHIACSSCCTKLRHICPSCTLPIGIYRCRIME  101

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +VV+++ VPCPN  +GC E+  Y K   HE  C+ + C CP   C + G  K++Y HF  
Sbjct  102  EVVKAIIVPCPNTKHGCTETFSYGKELVHEKKCVFSMCYCPAPNCNYRGLYKDLYIHFYR  161

Query  620  RHVQAKRITFN--SPRQISLKKNQRFIYLQE---KTGGVVFVVNHHMDPLGSAVNVICI-  459
             H       FN   P +  L+ N++ + LQE      G + VV    +P G  V V CI 
Sbjct  162  THYSHMEDKFNCGRPNEAWLRINEKMVVLQELKISDDGPLVVVQCFNEPGGWYVTVNCIA  221

Query  458  --APGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLL  285
              APG  +  F  K  A             GEK       +    I K       K F+L
Sbjct  222  PSAPGVGEYSFDLKYQA----------PAGGEKQIMRFYSSEMNRIQKVSFQTPEKDFML  271

Query  284  VPGNVISDSWDHLKLEVCIKDL  219
            +P +   D  + +K+ + I  L
Sbjct  272  IP-HYFQDRRNSIKMTIWIHRL  292



>ref|XP_006390991.1| hypothetical protein EUTSA_v10018806mg [Eutrema salsugineum]
 gb|ESQ28277.1| hypothetical protein EUTSA_v10018806mg [Eutrema salsugineum]
Length=346

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 143/282 (51%), Gaps = 26/282 (9%)
 Frame = -2

Query  1040  AGIVDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKL  861
             +G  D   +GV++   KG     L+D D+LDCP+CF +LTIP+FQC+NGHIAC+SCC KL
Sbjct  39    SGDRDIAGDGVITEARKG-----LLDLDILDCPVCFHALTIPIFQCDNGHIACSSCCTKL  93

Query  860   INKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSC  681
              N+CPSC  PIG  R R +E+V+E++ +PCPN  +GC +   Y K   HE  C    C C
Sbjct  94    RNQCPSCTLPIGNIRNRGMERVLEAVTLPCPNGKHGCTKKFSYGKELAHEKECSFALCYC  153

Query  680   PNRACKFLGSSKEVYTHFTNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVV--  507
             P   C + G  K++Y H+   H + +           +  N+    LQE   G + VV  
Sbjct  154   PAPQCSYTGKYKDLYRHYDANHGK-EHFRCGHTSDAWVHSNEMITVLQEYRDGPLVVVQC  212

Query  506   ----NHHMDPLGSAVNVICIAPGSSK--RRFLYKLVARGEEENCGCKGGSGEKTTSIKLE  345
                     +  G  V V CIAP S+     F YKL +    +     G S E     +++
Sbjct  213   FEKIQGFEESQGVYVTVNCIAPPSAPGVGEFSYKLTSSNHGD-----GKSDEMRKMKRIQ  267

Query  344   AVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
              V+   P+ D       F+L+P   +      LK+ +CI+ L
Sbjct  268   KVSFQPPEKD-------FMLIPRYFLLQHPYALKMNICIRRL  302



>ref|XP_006302616.1| hypothetical protein CARUB_v10020721mg [Capsella rubella]
 gb|EOA35514.1| hypothetical protein CARUB_v10020721mg [Capsella rubella]
Length=298

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 135/256 (53%), Gaps = 15/256 (6%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + D+LDCP+C  +LT P+FQC+NGHIAC+SCC K+ N+CP C  P+G  R R +E
Sbjct  38   SVTLFELDLLDCPVCCHALTAPIFQCDNGHIACSSCCTKMRNQCPVCTLPVGNVRSRIME  97

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            K+VE+  V CPN  +GC E   Y K  DHE  C    C CP   C + G  K++Y H+  
Sbjct  98   KIVEAAIVQCPNAKHGCTEKFSYVKESDHEKKCSFVLCHCPAPNCNYSGVYKDLYAHYYA  157

Query  620  RHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS-  447
            +H  +  +    S     L  + + + LQE   G + VV    +P G  V V CIAP + 
Sbjct  158  KHDDSWNQFKCGSYTSAWLLLSDKVLVLQESGDGPLVVVQCLKEPQGVYVTVNCIAPNAP  217

Query  446  SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVI  267
               +F Y L      E    + G  ++   +  +     IP+       K FLLVP N  
Sbjct  218  GVGKFSYILSYSYGHETILIEKGEMDRIQKLSFQ-----IPE-------KSFLLVP-NYF  264

Query  266  SDSWDHLKLEVCIKDL  219
              + D+LK+++CI+ L
Sbjct  265  QGTRDYLKMKICIRRL  280



>ref|XP_010916809.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Elaeis 
guineensis]
Length=322

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/252 (35%), Positives = 143/252 (57%), Gaps = 18/252 (7%)
 Frame = -2

Query  968  IDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVE  789
            IDPD L C +CF  L+ PLFQC NGH+AC+SCC+KL NKC  C+ P G ++CR LE V+E
Sbjct  83   IDPDGLGCSVCFTPLSPPLFQCHNGHVACSSCCVKLSNKCHVCSLPTGHSQCRPLEIVIE  142

Query  788  SLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ  609
            ++K+PCP+ T+GC E+I YN+   HE +C   P SCP  +C F GS+  +  H  N H  
Sbjct  143  AIKIPCPHCTFGCRETISYNQKDTHEESCPFAPGSCPVLSCTFRGSTALLSGHIRNEHRS  202

Query  608  AK-RITFNSPR--QISLKKNQRFIYLQEKTGGVVFVVNH-HMDPLGSAVNVICIAPGSSK  441
               +I+F+  R   ++L++ +    L  +   +  ++N  +   L + +++ CI PGS +
Sbjct  203  TTPQISFSYDRSFMVALQRKEPCYVLHGEDDRIFLLLNECNFFALWNLLSIACIRPGSLE  262

Query  440  RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISD  261
                + ++  G             K + + L++  ENI ++  ++  + FL VP   I+D
Sbjct  263  SDLGFNIMVEG-------------KGSELHLKSSPENIREFKVASDAESFLFVP-RAIND  308

Query  260  SWDHLKLEVCIK  225
            S   + ++V I+
Sbjct  309  SAGMISIDVLIR  320



>gb|KFK35021.1| hypothetical protein AALP_AA5G223900 [Arabis alpina]
Length=281

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 99/269 (37%), Positives = 140/269 (52%), Gaps = 24/269 (9%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             SG G   +S  L DPD L CPIC   LTIP+FQC+NGH+AC+SCC KL NKC SCA PIG
Sbjct  27    SGNGTKKLSTMLFDPDSLHCPICVEVLTIPIFQCDNGHLACSSCCPKLRNKCASCALPIG  86

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
              +RCRA+E V+ES+ VPC N++ GC ++I Y     H+  C    C CP + C +    K
Sbjct  87    HSRCRAMETVLESVFVPCLNSSLGCTKNISYGNEVAHDEECEFAICLCPVKGCNYPDMYK  146

Query  644   EVYTHFTNRHVQAKR---ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
             E+Y H+   H Q  R   I    P    +  + + +  +E    ++F V    +  G  V
Sbjct  147   EIYNHYNRNHSQRSRRETICCGIPFSAKMSISDKILIKREHNKSLLFAVQCFREQYGVYV  206

Query  473   NVICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAE---NIPKWDPSA  306
              V CIAP + +   F Y L    +        G      S K++ V E    IP+ +   
Sbjct  207   TVSCIAPPAPEVGEFPYHLSYTVD--------GHTMIYKSPKMKMVFEVSSEIPQEN---  255

Query  305   ALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
                 F+L+P +++    D L++E+CI  L
Sbjct  256   ----FMLIPHSLL--RGDVLEMEICICKL  278



>ref|XP_006405814.1| hypothetical protein EUTSA_v10027819mg [Eutrema salsugineum]
 gb|ESQ47267.1| hypothetical protein EUTSA_v10027819mg [Eutrema salsugineum]
Length=352

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 109/181 (60%), Gaps = 11/181 (6%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
              L+DPDVLDCPIC   L IP+FQC+NGH+AC+ CC K+ N CPSC  PIG++RCRA+EK
Sbjct  102  VMLLDPDVLDCPICCEPLKIPIFQCDNGHLACSMCCNKVKNICPSCTLPIGYSRCRAMEK  161

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            V+E+ +V C N  YGC+E+I Y     HE  C+ TPCSCP   C + G  K++     N 
Sbjct  162  VIEATRVSCLNAKYGCKENISYGNQSSHEKLCVFTPCSCPILDCNYTGYYKDL-----NN  216

Query  617  HVQAKR------ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
            HV+AK         ++  + ISL  +++   LQE+  G V VV          V V C+A
Sbjct  217  HVRAKHKNDLIPFVWDVSKGISLDLDKKTTVLQEENDGEVIVVQVFKGLHAVYVTVSCLA  276

Query  455  P  453
            P
Sbjct  277  P  277



>ref|XP_010556279.1| PREDICTED: uncharacterized protein LOC104825614 [Tarenaya hassleriana]
Length=692

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 132/242 (55%), Gaps = 13/242 (5%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
            G+  ++  L DPDVLDC +C+  L  P+FQC+NGHIACASCC K  +KCPSC  PIG+ R
Sbjct  95   GESPLTVMLTDPDVLDCAVCYEPLKSPIFQCDNGHIACASCCTKSRHKCPSCTMPIGYFR  154

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            CRA+E+V+ES+++PCPN   GC +   Y +   H   C+  PCSCP   C F+GS K++ 
Sbjct  155  CRAMERVIESIRLPCPNAKQGCTKKFVYGEGSSHVKECLFIPCSCPALDCNFMGSYKQLN  214

Query  635  THFTNRHVQ-AKRITFNSPRQISLKKNQR-FIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
            THF + H    ++I+      + L  N       +E+  GV+ V+   +      V+V C
Sbjct  215  THFRDEHRNILRKISRGKEEYVCLSINDNETEVFEEEKEGVLIVIQSFLVANDLRVSVSC  274

Query  461  IAPG-SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLL  285
            IAP       F Y L  R E          GE  T++  ++   NI +      ++ F+L
Sbjct  275  IAPPVRGVGEFSYTLETRLE----------GEGETTLTFDSKMRNIQEVSMEPPVECFML  324

Query  284  VP  279
            +P
Sbjct  325  IP  326


 Score =   162 bits (411),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/247 (37%), Positives = 142/247 (57%), Gaps = 22/247 (9%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
            G+ S++ TL +PDVLDC +C+  L IP+FQC++GHIACASCC KL +KCPSCA PIG  R
Sbjct  440  GESSLAVTLTEPDVLDCGVCYEPLGIPIFQCDSGHIACASCCTKLRHKCPSCAMPIGNYR  499

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            CRA+E+++E++++PCPN  YGC++ + Y +   H   C+   C+CP   C F G  K++ 
Sbjct  500  CRAMERLLETIRLPCPNTRYGCKKILAYGERSSHGKECLFISCTCPVLGCNFSGPYKQLT  559

Query  635  THFTNRHVQA-KRITFNSPRQ--ISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSA--VN  471
            +HF + H ++ K I+   P    +S+  N+  ++ +EK G +V + +    P+ +   V+
Sbjct  560  SHFRDEHSRSLKGISCGKPEYTCLSINHNEMKVFEEEKEGELVVLQSF---PVANDLRVS  616

Query  470  VICIAPGSSKRRFLYKLVARGEEE---NCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL  300
            V CI+P           + RG  E   N       GE+ T +  ++  + I K       
Sbjct  617  VSCISP-----------LVRGVGEFSYNLETSILDGERETILTFDSKMKKIQKVSIDPPD  665

Query  299  KIFLLVP  279
              F+LVP
Sbjct  666  AGFMLVP  672



>gb|KFK40945.1| hypothetical protein AALP_AA2G064200 [Arabis alpina]
Length=269

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 138/265 (52%), Gaps = 31/265 (12%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             S  G   +SA L D D L CPICF  LTIP+FQC+NGH+AC+SCC KL NKCPSCASPIG
Sbjct  27    SVNGTKKLSAMLFDLDSLSCPICFEVLTIPIFQCDNGHLACSSCCPKLGNKCPSCASPIG  86

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
              NRCRA+E V+ES+ VPC N   GC +   Y     HE  C  + CSCP   C +    +
Sbjct  87    HNRCRAMETVLESVCVPCRNAKLGCTKKASYGNELTHEKECKFSLCSCPVEDCNYTALHE  146

Query  644   EVYTHFTNRHVQAKRI-TFNSPRQISLKKNQRFIYLQ-EKTGGVVFVVNHHMDPLGSAVN  471
             ++Y H+T  H     +  F+       K     I +Q E    ++F V    +P G  V 
Sbjct  147   DLYVHYTKIHWSICWLDVFSCGNSFGAKNITDKILIQREYKRSLLFAVQCFKEPYGLYVT  206

Query  470   VICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKI  294
             V CIAP + +   F Y L                  + ++ LEA +   P+ D       
Sbjct  207   VSCIAPSAPEVGEFSYHL------------------SYTMVLEA-SSLTPQED-------  240

Query  293   FLLVPGNVISDSWDHLKLEVCIKDL  219
             F+L+P + +    + L++E+CI++L
Sbjct  241   FMLIPLSFLRG--NGLEMEICIREL  263



>ref|XP_010470542.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 5 isoform X1 
[Camelina sativa]
Length=274

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/278 (36%), Positives = 143/278 (51%), Gaps = 22/278 (8%)
 Frame = -2

Query  1040  AGIVDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKL  861
             A IVD   + V   + K   S  L   DVLDCPICF  L  P++QC NGH++C+SCC K+
Sbjct  2     ATIVDDSEDVVTEAQSKTQ-SVKLQSSDVLDCPICFEPLKKPIYQCTNGHLSCSSCCKKI  60

Query  860   INKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKY-NKLRDHEPTCIHTPCS  684
              N+C  C SPIG  RCRA+EKV+E+  VPCPN  YGC+ES  Y NK   HE  C+   C 
Sbjct  61    NNRCSFCTSPIGDIRCRAMEKVIEATIVPCPNAKYGCKESTTYGNKSSIHEKVCVFARCF  120

Query  683   CPNRACKFLGSSKEVYTHFTNRHVQAKR----ITFNSPRQISLKKNQ-RFIYLQEKTGGV  519
             CP + C ++GS  ++  H    H   +       F+ P    +  N+ + +  +E+  G 
Sbjct  121   CPLQNCNYVGSYTDLKGHANAAHSWEEYGLISFVFDRPLIFGMNINEKKMVVFREEEDGD  180

Query  518   VFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAV  339
             + VV       G +V V CIAP S   R L   VA+  E             T+++L   
Sbjct  181   LVVVQAFKGTEGVSVTVSCIAPLSPGIRNLSCSVAKLNE------------CTTLRLRLR  228

Query  338   AENIPKWDPSAALKI-FLLVPGNVISDSWDHLKLEVCI  228
              +NI K       +  F+ +P  ++S    H+K+++CI
Sbjct  229   VKNIQKVSEQMQFEDGFMFIPSYMLSGG--HMKMQICI  264



>ref|XP_010451727.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=274

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 110/182 (60%), Gaps = 11/182 (6%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            L+D D+LDCPIC+ +LTI +FQC NGHIAC+SCC KL NKCP+CA PIG +RCRA+EKVV
Sbjct  43   LMDLDILDCPICYEALTILIFQCANGHIACSSCCPKLRNKCPACALPIGHSRCRAMEKVV  102

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV  612
            +S+  PCPN+ +GC ES    K   HE  C  +PCSCP + C + G  K++Y H+   H 
Sbjct  103  KSVSFPCPNSIFGCTESSSNGKESTHEKECNFSPCSCPEQDCNYTGPYKDLYNHYALTHS  162

Query  611  QAK-------RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            +          ++FNS   I         Y++     ++F V    +P G  + V CIAP
Sbjct  163  KGFGLNSFSCGVSFNSLINIGCTMKIEKEYVKR----LLFAVQCFKEPCGVYLTVSCIAP  218

Query  452  GS  447
             +
Sbjct  219  ST  220



>ref|XP_006288380.1| hypothetical protein CARUB_v10001631mg [Capsella rubella]
 gb|EOA21278.1| hypothetical protein CARUB_v10001631mg [Capsella rubella]
Length=287

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 128/258 (50%), Gaps = 22/258 (9%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S   +D D+L CPIC   LTIP+FQCENGH+AC+SCC KL+NKCPSCA PIG  RCRA+E
Sbjct  40   STMQMDLDILGCPICLGKLTIPIFQCENGHLACSSCCPKLMNKCPSCALPIGHIRCRAME  99

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF--  627
             V+ S+ +PCPN  +GC E + Y     HE  C+ +PC CP   C + GS ++V  H+  
Sbjct  100  SVLSSISIPCPNTKFGCTEYVFYGLESTHEKECLFSPCPCPALGCDYTGSYRDVGYHYYT  159

Query  626  ------TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVI  465
                  T  H   +  T++    + +  + +   L +K    +F V    +P G  V V 
Sbjct  160  YVDTCLTPLH-PYELFTYDKSSSVRMNISDKVKILVDKINNTLFAVQCFREPYGVCVTVS  218

Query  464  CIAPGSSKRRFL-YKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFL  288
            CIAP S + +   Y L    +      K    +    +  +   EN            FL
Sbjct  219  CIAPSSPEMQTCSYHLSYTVDGHTMTYKSPGMKNVVEVSFQTPLEN------------FL  266

Query  287  LVPGNVISDSWDHLKLEV  234
             +P + +      +KL +
Sbjct  267  FIPHSSLLGDLLEMKLYI  284



>ref|XP_002888527.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64786.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 138/273 (51%), Gaps = 20/273 (7%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             + V     SG  K + S  L   DVLDCPIC+  L  P++QC NGH+AC+SCC K+  +C
Sbjct  47    EDVITEAQSGTPKSTQSLKLQSSDVLDCPICYEPLKRPIYQCNNGHLACSSCCKKMNKRC  106

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYN-KLRDHEPTCIHTPCSCPNR  672
               C SPIG  RCRA+EKV+ES KV C    YGC+E+  Y  +   HE  C   PCSCP  
Sbjct  107   SFCQSPIGDIRCRAMEKVIESTKVSCLYAKYGCKETTVYGIESTSHEKLCFFAPCSCPIL  166

Query  671   ACKFLGSSKEVYTHFTNRHVQAK----RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVN  504
              C ++GS  ++ +H    H   +       F+ P   S+   ++ +  QE+  G + VV 
Sbjct  167   YCNYVGSYTDLKSHAHAAHSWDEDDLIMFVFDRPLIFSMDLGKKKVVFQEENEGDLLVVQ  226

Query  503   HHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP  324
                   G +V V CIAP +S            E  N  C      + T+++L  + + I 
Sbjct  227   AFKGSEGVSVTVSCIAPMAS------------EALNLSCSLAKINQYTTLRLGLMVKKIQ  274

Query  323   KWDPSAALKI-FLLVPGNVISDSWDHLKLEVCI  228
             K       +  F+ +P  ++  S DHLK+++CI
Sbjct  275   KVSEQMEFEDGFMFIPSYMV--SGDHLKMQICI  305



>ref|XP_002305191.1| seven in absentia family protein [Populus trichocarpa]
 gb|EEE85702.1| seven in absentia family protein [Populus trichocarpa]
Length=213

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 133/226 (59%), Gaps = 18/226 (8%)
 Frame = -2

Query  899  NGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLR  720
            NGH AC+SCC KL + CPSC+ PIG+  C A+EKV+ES K+ C N  YGC+E++ Y+K  
Sbjct  2    NGHAACSSCCSKLAHICPSCSLPIGYIHCLAIEKVLESAKISCQNMKYGCKETVSYSKKC  61

Query  719  DHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFIY  543
            DHE +CI+  CSCP   C F+ SSK++Y+H ++ HV   K   ++    +S   +++F+ 
Sbjct  62   DHEKSCIYATCSCPVSGCSFVSSSKQLYSHLSSTHVGDVKHFEYDCKIPVSFTASKKFVV  121

Query  542  LQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSG-EK  366
            LQEK  GVVF++N+ +  +G+ + V CI P SSK  + Y+L A         KG S   +
Sbjct  122  LQEKKEGVVFILNNALQIMGNVIMVSCIGP-SSKGGYFYELSANS-------KGNSLIFR  173

Query  365  TTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
            + +    +  +N P          FLLVPG     S + + L++CI
Sbjct  174  SFTPCFRSRVDNPPSVR-------FLLVPGGFF-GSGEKVTLDLCI  211



>ref|NP_198603.1| E3 ubiquitin-protein ligase SINA-like 6 [Arabidopsis thaliana]
 sp|Q9FKD9.1|SINL6_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase SINA-like 
6; AltName: Full=Seven in absentia-like protein 6 [Arabidopsis 
thaliana]
 dbj|BAB09033.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94243.1| protein with RING/U-box and TRAF-like domains [Arabidopsis thaliana]
Length=281

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 119/197 (60%), Gaps = 4/197 (2%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            SA L D D+LDCPIC+ +L IP+FQC NGH+AC+SCC KL NKCP+CA P+G  RCRA+E
Sbjct  34   SAMLTDLDILDCPICYQALKIPVFQCGNGHLACSSCCPKLRNKCPACALPVGHIRCRAME  93

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +V+ES+ VPC     GC ++I Y +   HE  C  +PCSCP + C + GS K++Y H+  
Sbjct  94   RVLESVLVPCRYADLGCTKTIYYGRESTHEKICNFSPCSCPVQGCNYTGSYKDLYEHYDL  153

Query  620  RH-VQAKRITFNSPRQIS--LKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             H   +   +FN    I+  +  + + +  +     ++FVV    +P G  V+V CIAP 
Sbjct  154  THSTGSTAYSFNGVSYIAAMMFISDKILIERVYEKKLLFVVQCFEEPCGVYVSVSCIAPS  213

Query  449  SSKR-RFLYKLVARGEE  402
            + +   F Y L+    E
Sbjct  214  APEVGEFSYGLLYTTWE  230



>ref|XP_010470536.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 isoform X3 
[Camelina sativa]
Length=349

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 131/257 (51%), Gaps = 18/257 (7%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
             TL + D+LDCP+C  +LT  +FQC+NGHIAC+SCC KL + CPSC  PIG NRCR +EK
Sbjct  82   GTLFELDLLDCPVCCDALTDHIFQCDNGHIACSSCCTKLRHTCPSCTFPIGINRCRIMEK  141

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            +V+++ VPCPN  +GC E+  Y K   HE  C    C CP   C + G  K +Y+H+   
Sbjct  142  IVKAIIVPCPNAKHGCTETFSYGKELAHEKKCSFVLCYCPALNCNYSGLYKNLYSHYAAN  201

Query  617  HVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS-S  444
            H    KR  +     + L    +   LQE   G + VV    +P G    V CIAP S  
Sbjct  202  HKDTDKRFRYGYSHHVYLDIETKISVLQEYADGPLVVVQCFKEPQGMYFTVNCIAPPSPG  261

Query  443  KRRFLYKLVARGEEENCGCKGGSGEKTTSI--KLEAVAENIPKWDPSAALKIFLLVPGNV  270
              +F Y +       +    G S   T+S   KL  V+   PK D       F+LVP  +
Sbjct  262  VGKFSYDI-------SYSTAGNSMTFTSSKMNKLPEVSFQTPKKD-------FMLVPDYL  307

Query  269  ISDSWDHLKLEVCIKDL  219
                +    + +CI+ L
Sbjct  308  FDPRFLLKHMRICIRSL  324



>ref|XP_008811970.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 isoform X2 
[Phoenix dactylifera]
Length=290

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 117/203 (58%), Gaps = 1/203 (0%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
               G+ SGK  G   +  IDPDVLDC IC+  L  PL QC NGH+AC SC  KL +KC  C
Sbjct  84    DGGISSGKENGDGISVRIDPDVLDCCICYEPLRPPLLQCSNGHVACCSCWSKLDHKCYLC  143

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
             +  I F+R  ALEK++ES+K+ C +  YGC  +I Y +   HE TCI+ PC CP   C F
Sbjct  144   SCEISFSRNLALEKIIESIKISCRHAKYGCRRTINYTQRDHHEETCIYAPCYCPVSDCTF  203

Query  659   LGSSKEVYTHF-TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLG  483
              GS+  +  HF +     +KR  +  P +++LK  + F  LQ   G +  ++N+    +G
Sbjct  204   SGSTVMLSAHFSSKHSKSSKRFCYGQPFKVNLKPTEPFFVLQGDDGHLFLLLNNRDVAMG  263

Query  482   SAVNVICIAPGSSKRRFLYKLVA  414
              A+++ CI P + +  F Y+L A
Sbjct  264   YALSIACIRPDTPEGNFSYELTA  286



>ref|XP_010493885.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=324

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 111/187 (59%), Gaps = 4/187 (2%)
 Frame = -2

Query  968  IDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVE  789
            +D +VL+CPICF +LTIP+FQC+NGH+AC+ CC KL NKCPSCA PIG  RCRA+E V+ 
Sbjct  106  MDLEVLECPICFETLTIPIFQCDNGHLACSFCCPKLSNKCPSCALPIGRIRCRAMESVLR  165

Query  788  SLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ  609
            S+ +PCPN  +GC +++ Y     H   CI + CSCP   C + GS + ++ H+      
Sbjct  166  SISIPCPNAKFGCTDNVSYGLESTHVKECIFSQCSCPALDCDYTGSYEALWEHYCYDFCP  225

Query  608  A---KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSK-  441
            A   +  T++    + +  + +     + T G+ F V    +P G  V V CIAP S K 
Sbjct  226  APSYESFTYHVSSTVRMNISDKIKIKADYTKGLFFAVQCFREPNGVRVTVSCIAPSSPKV  285

Query  440  RRFLYKL  420
             +F Y L
Sbjct  286  GKFSYHL  292



>ref|XP_009125055.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Brassica 
rapa]
Length=324

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 116/193 (60%), Gaps = 3/193 (2%)
 Frame = -2

Query  992  KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRC  813
            + S+S TL+DPDVLDCPIC   L  P+FQC+NGH+AC+ CC K+ N CPSC  P+G+ RC
Sbjct  78   ESSLSVTLLDPDVLDCPICCEPLKAPIFQCDNGHLACSVCCTKVRNICPSCTLPVGYIRC  137

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYT  633
            RA+EKV+E+ +V C N  YGC+E + Y     HE  C+  PCSCP   C + G  K++ +
Sbjct  138  RAMEKVIETSRVSCTNAKYGCKERMLYVNRFSHEKLCVFAPCSCPVLDCNYTGYYKDLNS  197

Query  632  HFTNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            H   +H + + + F     ++++ ++  I LQE+  G V VV          V V CIAP
Sbjct  198  HVRAKH-KDEVVPFVWDVSVTIRLDKTTI-LQEEKDGEVMVVQAFRGLHVVYVVVTCIAP  255

Query  452  GSSKRR-FLYKLV  417
             + +   F Y LV
Sbjct  256  SAREVGCFSYYLV  268



>ref|XP_010470534.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 isoform X1 
[Camelina sativa]
Length=425

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 131/257 (51%), Gaps = 18/257 (7%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
             TL + D+LDCP+C  +LT  +FQC+NGHIAC+SCC KL + CPSC  PIG NRCR +EK
Sbjct  158  GTLFELDLLDCPVCCDALTDHIFQCDNGHIACSSCCTKLRHTCPSCTFPIGINRCRIMEK  217

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            +V+++ VPCPN  +GC E+  Y K   HE  C    C CP   C + G  K +Y+H+   
Sbjct  218  IVKAIIVPCPNAKHGCTETFSYGKELAHEKKCSFVLCYCPALNCNYSGLYKNLYSHYAAN  277

Query  617  HVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS-S  444
            H    KR  +     + L    +   LQE   G + VV    +P G    V CIAP S  
Sbjct  278  HKDTDKRFRYGYSHHVYLDIETKISVLQEYADGPLVVVQCFKEPQGMYFTVNCIAPPSPG  337

Query  443  KRRFLYKLVARGEEENCGCKGGSGEKTTSI--KLEAVAENIPKWDPSAALKIFLLVPGNV  270
              +F Y +       +    G S   T+S   KL  V+   PK D       F+LVP  +
Sbjct  338  VGKFSYDI-------SYSTAGNSMTFTSSKMNKLPEVSFQTPKKD-------FMLVPDYL  383

Query  269  ISDSWDHLKLEVCIKDL  219
                +    + +CI+ L
Sbjct  384  FDPRFLLKHMRICIRSL  400


 Score = 86.3 bits (212),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + D+LDCPIC +++T  +FQC+NGH+AC SCC+K+  KC +C  PIG  RCR +E
Sbjct  38   SGTLFELDLLDCPICCVTITSRIFQCDNGHVACLSCCVKMKKKCSACTLPIGKYRCRRME  97

Query  800  KVVESLKV  777
            +VVE++ V
Sbjct  98   RVVEAVVV  105



>ref|XP_002305940.2| seven in absentia family protein [Populus trichocarpa]
 gb|EEE86451.2| seven in absentia family protein [Populus trichocarpa]
Length=406

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 147/291 (51%), Gaps = 48/291 (16%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCE---NGHIACASC------------------  873
            G+I   L DP+VLDCP C  +LTIP+FQ     +  I    C                  
Sbjct  123  GAIFVALSDPEVLDCPTCCETLTIPVFQSYAFISFEIRIEGCYHLTSFGLGAGNLTIEPG  182

Query  872  ----------CIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKL  723
                        KL +KCPSCA PIG NRCRA+EKV+ESLKV C N  YGC E+I ++K 
Sbjct  183  TSWEMVVVLQSKKLQHKCPSCAMPIGDNRCRAIEKVLESLKVRCSNWRYGCRENICFSKK  242

Query  722  RDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV-QAKRITFNSPRQISLKKNQRFI  546
             +H+  C H  C+CP   C F GSSK++Y H   +H+ +     FN+   + +  N +F 
Sbjct  243  YEHDKCCSHALCTCPLLGCNFQGSSKQLYLHCRRKHLGKLTSFQFNTSFPLFITVNDKFC  302

Query  545  YLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEK  366
             LQE   GV+F++N+  D LG  + V C+   SSK  + Y+L+ R E  N          
Sbjct  303  ILQEDKEGVLFILNNRSDTLGHVITVSCMGLSSSKPGYFYELMTRAEGSN----------  352

Query  365  TTSIKLEAVAENI-PKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDLA  216
               I+ ++   N+  + D   +L   LLVP + +  ++  + L+VCI  L 
Sbjct  353  ---IRFQSSTRNVRTRVDDPPSLGC-LLVPNDFLG-TYGQITLDVCIWRLG  398



>emb|CDY47873.1| BnaA07g14180D [Brassica napus]
Length=324

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 116/193 (60%), Gaps = 3/193 (2%)
 Frame = -2

Query  992  KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRC  813
            + S+S TL+DPDVLDCPIC   L  P+FQC+NGH+AC+ CC K+ N CPSC  P+G+ RC
Sbjct  78   ESSLSVTLLDPDVLDCPICCEPLKAPIFQCDNGHLACSMCCTKVRNICPSCTLPVGYIRC  137

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYT  633
            RA+EKV+E+ +V C N  YGC+E + Y     HE  C+  PCSCP   C + G  K++ +
Sbjct  138  RAMEKVIETSRVSCTNAKYGCKERMLYVNRFSHEKLCVFAPCSCPVLDCNYTGYYKDLNS  197

Query  632  HFTNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
            H   +H + + + F     ++++ ++  I LQE+  G V VV          V V CIAP
Sbjct  198  HVRAKH-KDEVVPFVWDVSVTIRLDKTTI-LQEEKDGEVMVVQVFRGLHVVYVVVTCIAP  255

Query  452  GSSKRR-FLYKLV  417
             + +   F Y LV
Sbjct  256  SAREVGCFSYYLV  268



>ref|XP_009148656.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 4 [Brassica 
rapa]
Length=342

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 135/260 (52%), Gaps = 25/260 (10%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + DVLDCP CF  L  P+FQC NGH+AC SCC KL  KC  CA PIG  RCR +E
Sbjct  90   SMTLPNSDVLDCPCCFEPLKRPVFQCNNGHLACYSCCTKLKKKCSLCAMPIGDTRCRPIE  149

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            KV+++  V C N  YGC++S +Y+K+ +HE  C+  PCSCP R C ++GS K +  HF  
Sbjct  150  KVIKTCLVACSNAKYGCKQSTRYDKVANHEKLCVFAPCSCPVRNCNYVGSYKNLNNHFRA  209

Query  620  RHVQAKRI-------TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
             H   KRI        FNSP+   L  N   +  QE+  G + VV       G  V V  
Sbjct  210  TH---KRIPGEIMSFVFNSPKLFGLDHNDDQVIFQEEKEGDLVVVKGFKRSDGVYVTVRR  266

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL--KIFL  288
            IAP   +   L   +AR +              ++++L    EN+ K           F+
Sbjct  267  IAPIVKEIPKLSCSIARLKAH------------STLRLGFQVENVQKVGEQQVQPEDNFM  314

Query  287  LVPGNVISDSWDHLKLEVCI  228
            L+P + +S     +K+++CI
Sbjct  315  LIPSH-MSGCCHCMKMQICI  333



>ref|XP_006291706.1| hypothetical protein CARUB_v10017872mg [Capsella rubella]
 gb|EOA24604.1| hypothetical protein CARUB_v10017872mg [Capsella rubella]
Length=258

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 112/182 (62%), Gaps = 4/182 (2%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S  L+  D+LDCPIC  +LTIP+FQC+NGH+AC+SCC +L NKC +C SP+G  RC A+E
Sbjct  14   SGMLLGLDILDCPICSQALTIPIFQCDNGHLACSSCCPQLSNKCHTCDSPVGHKRCSAME  73

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
             V+ES+ VPC N T+GC ++  Y K   HE  C  + C+CP   C F G   ++Y HF +
Sbjct  74   SVLESVFVPCRNATFGCTKNESYGKKSIHEKVCSFSQCACPAPDCYFTGPYNDIYNHFVD  133

Query  620  RHV-QAKRITFNSPRQISLKKN---QRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
             H  ++K ++F S   + ++ N    + ++L E    ++F +    +P G  V + CIAP
Sbjct  134  IHCHESKSLSFESGGSVDVQMNIATDKILFLMESKKRLLFALQCFNEPHGVHVAIRCIAP  193

Query  452  GS  447
             +
Sbjct  194  SA  195



>ref|XP_010445578.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=271

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 146/277 (53%), Gaps = 21/277 (8%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGK--GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLI  858
             V+G+SN  +  + +      ++++D D LDCPIC    TIP+FQC+NGH  CASC  KL 
Sbjct  8     VNGMSNINLRKRQRTEDKTRSSMLDLDFLDCPICVEPFTIPIFQCDNGHFTCASCFPKLS  67

Query  857   NKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTP-CSC  681
             NKCPSCA P+G +RCRA+EKV+ES+ VPCPN   GC + + Y K   HE  C  +  CSC
Sbjct  68    NKCPSCALPVGHSRCRAMEKVLESIFVPCPNANLGCTKHVSYGKEATHEKECTFSQICSC  127

Query  680   PNRACKFLGSSKEVYTHFTNRHVQAKRITF--NSPRQISLKKNQRFIYLQEKTGGVVFVV  507
             P   C  + S   ++ HFT  H Q + + F  ++   + +  N + +   E    + F V
Sbjct  128   PLEDCSHICSYDNMFRHFTRDH-QNRYMLFCCDNFFNVRMNINDKILIEIEYMINLSFAV  186

Query  506   NHHMDPLGSAVNVICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAEN  330
                 +P G  V V CIAP + +   F Y L+   +        G+     S +++ + E 
Sbjct  187   QCFREPYGVYVTVSCIAPSTPEVGEFTYLLIYTVD--------GNTMTYESSEVKRILE-  237

Query  329   IPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
             +    P  +   F+L+P   +    D LK+++CI  L
Sbjct  238   VSSQRPEES---FMLIPKRFL--RGDSLKMKLCINKL  269



>ref|NP_176835.1| E3 ubiquitin-protein ligase SINA-like 2 [Arabidopsis thaliana]
 sp|Q9C6H3.1|SINL2_ARATH RecName: Full=E3 ubiquitin-protein ligase SINA-like 2; AltName: 
Full=Seven in absentia-like protein 2 [Arabidopsis thaliana]
 gb|AAG51178.1|AC079285_11 hypothetical protein [Arabidopsis thaliana]
 gb|AEE34537.1| E3 ubiquitin-protein ligase SINA-like 2 [Arabidopsis thaliana]
Length=313

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 139/277 (50%), Gaps = 24/277 (9%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             V+ V NG   G    + S TL + D+LDCPIC  +LT P+FQC+NGHIAC+SCC KL NK
Sbjct  19    VESVENG---GGDAVARSGTLFELDLLDCPICCHALTSPIFQCDNGHIACSSCCTKLRNK  75

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             CPSCA PIG  R R +E+VVE++ V CPN  +GC E   Y K   HE  C    C CP  
Sbjct  76    CPSCALPIGNFRSRIMERVVEAVMVTCPNVKHGCTEKFSYGKELIHEKDCRFALCYCPAP  135

Query  671   ACKFLGSSKEVYTHFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
              C + G  K++Y+HF   H     +I   +     L+ +++ + LQ   G ++  V    
Sbjct  136   NCNYSGVYKDLYSHFYVNHYDTWNQIGCGNFAGAWLRISEKILVLQYGQGPLI-AVQCFK  194

Query  494   DPLGSAVNVICIAP-----GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAEN  330
             +  G  V V CIAP     G       YK+               G  T   K E +   
Sbjct  195   ETQGMYVTVNCIAPCAPGVGELSFELSYKMPM------------GGNSTMMFKSEEM-NR  241

Query  329   IPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
             I K       K F+LVP   + D +  LK+E+CI+ L
Sbjct  242   IQKVSFQTPEKDFMLVPYYFLGD-FSTLKMEICIRKL  277



>ref|XP_006301755.1| hypothetical protein CARUB_v10022216mg [Capsella rubella]
 gb|EOA34653.1| hypothetical protein CARUB_v10022216mg [Capsella rubella]
Length=297

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 135/261 (52%), Gaps = 11/261 (4%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             G   G+ S TL   D+LDCP+C  +LT+P+FQC+NGHIAC+SCC +L  +C SC  PIG 
Sbjct  37    GGDVGARSGTLFKLDLLDCPVCCHALTVPIFQCDNGHIACSSCCTELRYRCRSCTFPIGN  96

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
              RCR +EKVV+S+ +PCPN  +GC E+  Y K   HE  C  T C CP   C + G  K+
Sbjct  97    YRCRRMEKVVKSIIIPCPNAKHGCTETFSYGKELVHEKKCSFTLCYCPAPNCNYSGLYKD  156

Query  641   VYTHFTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVI  465
             +Y H+ + H+  + +     P     + +++   LQE   G + V+     P G  V V 
Sbjct  157   LYIHYKSNHMDIENQFVCGRPLCTWWRISEKVFVLQESADGPLVVLQRFNKPGGWYVTVN  216

Query  464   CIAP-GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFL  288
             CIAP       F Y+L       + G   G  +   + K  +    I K       K F+
Sbjct  217   CIAPCAPGVGEFSYEL-------SYGTPMGGYKHIMTFK-SSEMNRIHKVSFQTPEKDFM  268

Query  287   LVPGNVISDSWDHLKLEVCIK  225
             L+P +      + LK+ +CIK
Sbjct  269   LIP-HYFQYPRNSLKMTICIK  288



>ref|XP_006285515.1| hypothetical protein CARUB_v10006956mg [Capsella rubella]
 gb|EOA18413.1| hypothetical protein CARUB_v10006956mg [Capsella rubella]
Length=377

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 107/168 (64%), Gaps = 4/168 (2%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S  L+  +VLDCPICF +LTIP+FQC+NGH+AC+SCC KL NKCP+CASP+G  RC A+E
Sbjct  144  SGMLLGLNVLDCPICFETLTIPIFQCDNGHLACSSCCPKLSNKCPTCASPVGHKRCTAME  203

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            KV+ES+ +PC N  +GC + + Y K   HE  C  T CSCP   C + GS  ++YTHF +
Sbjct  204  KVIESVLIPCRNTKFGCTKKVSYGKESVHEKECTFTQCSCPALDCIYTGSYYDIYTHFVD  263

Query  620  RHVQ-AKRITFNSPRQISLK---KNQRFIYLQEKTGGVVFVVNHHMDP  489
             H   +K ++F     + ++    N++ + L E    ++F +    +P
Sbjct  264  NHSHVSKPMSFVCGGVVDVQMNIANEKILVLWESKKRLLFALQCFTEP  311



>ref|XP_010445575.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=288

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 119/199 (60%), Gaps = 7/199 (4%)
 Frame = -2

Query  998  KGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFN  819
            +GK  ++  L+D ++LDCPIC  + T P+FQC+NGH+ACASCC KL NKCP CA P+G N
Sbjct  38   EGKKRLT-MLMDLEILDCPICCEAFTTPIFQCDNGHLACASCCPKLRNKCPVCALPVGHN  96

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEV  639
            RCRA+E V+ES+ +PC N   GC +++ + K  +HE  C+ + CSCP   C +  S K++
Sbjct  97   RCRAMETVLESILIPCQNAKLGCTKNVFHGKESNHEKKCVFSRCSCPALDCDYTSSYKDL  156

Query  638  YTHFTNRHV-----QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
            Y H+   H+     Q+ + + N    + +  +++ +   E    ++F +    +P G  V
Sbjct  157  YLHYIITHMDMEIYQSSKFSCNVSFIVRMNISEKMLIRTEYAKSLMFALQCFKEPYGVYV  216

Query  473  NVICIAPGSSK-RRFLYKL  420
             + CIAP   +  RF Y L
Sbjct  217  TLSCIAPSVPEIGRFSYHL  235



>ref|XP_002868828.1| hypothetical protein ARALYDRAFT_916596 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45087.1| hypothetical protein ARALYDRAFT_916596 [Arabidopsis lyrata subsp. 
lyrata]
Length=340

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 117/205 (57%), Gaps = 7/205 (3%)
 Frame = -2

Query  1040  AGIVDGVSNGVMSGKGK--GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCI  867
             + +V+G+SN  +  + +      + ++D D LDCPIC    TIP+FQC+NGH+ACASCC 
Sbjct  5     SSVVNGLSNIHLQRRQRTEDETRSAMLDLDFLDCPICVEPFTIPIFQCDNGHLACASCCP  64

Query  866   KLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPC  687
             KL NKCP+C  P+G NRCRA+E ++ES+ VPC N  +GC + + Y K   HE  CI +PC
Sbjct  65    KLSNKCPACTLPVGHNRCRAMESILESISVPCQNAKFGCTKKVSYGKQSTHEKECIFSPC  124

Query  686   SCPNRACKFLGSSKEVYTHF-TNRHVQAKRITFNSPRQISLK---KNQRFIYLQEKTGGV  519
              CP + C + G  K+VY HF  +R +      F     + L    K +  + +      +
Sbjct  125   FCPIQNCNYSGLYKDVYYHFGIHRDIGRVDCWFVLGEFVELDFDFKERAIMAMNAYKEDL  184

Query  518   VFVVNHHMDPLG-SAVNVICIAPGS  447
             +F V    DP G + V   CIAP S
Sbjct  185   LFTVQCLSDPNGITYVTASCIAPSS  209



>ref|XP_010436743.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Camelina 
sativa]
Length=210

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 111/181 (61%), Gaps = 5/181 (3%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            SATL+D   LDCPIC  +LT P+ QC+NGHI+C++CC KL NKCPSCA PI   RCRA+E
Sbjct  25   SATLLDLKALDCPICTDALTTPILQCDNGHISCSTCCNKLRNKCPSCALPIAHIRCRAME  84

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF--  627
            +V++++ VPCPN  +GC++   Y +   HE  C  + CSCP R CK+ GS K++Y+HF  
Sbjct  85   RVIKAVIVPCPNVKFGCKQKFSYGEELTHEKECTFSLCSCPARNCKYTGSYKDLYSHFKI  144

Query  626  -TNRHVQAKRITFNSPRQISLKKNQRF--IYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
                   + R TF         K   +  + +++   G++ VV+   +P G  V V CIA
Sbjct  145  HEGGRGYSYRFTFGDKFAEVYFKLTEYTSVVMKDLKDGLLSVVHCFTEPHGVYVIVSCIA  204

Query  455  P  453
            P
Sbjct  205  P  205



>ref|XP_010511495.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 5 isoform X1 
[Camelina sativa]
Length=303

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 138/271 (51%), Gaps = 21/271 (8%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             S  V++     + S  L   DVLDCPICF  L  P++QC NGH++C+SCC K+ N+C  C
Sbjct  37    SEDVVTEAQSKTQSVKLQSSDVLDCPICFEPLKKPIYQCTNGHLSCSSCCKKMNNRCSFC  96

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKY-NKLRDHEPTCIHTPCSCPNRACK  663
              SPIG  RCRA+EKV+E+  VPCPN  YGC+ES  Y N+   HE  C+   C CP + C 
Sbjct  97    RSPIGDIRCRAMEKVIEATIVPCPNAKYGCKESTTYGNESSSHEKVCVFARCFCPVQNCN  156

Query  662   FLGSSKEVYTHFTNRHVQAK----RITFNSPRQISLKKN-QRFIYLQEKTGGVVFVVNHH  498
             + GS  ++  H    H   +       F+ P    +  N ++ +  +E+  G + VV   
Sbjct  157   YGGSYTDLKGHANAAHSWKEYGLISFVFDRPLIFGMDINKKKMVVFREEQDGDLVVVQAF  216

Query  497   MDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW  318
                 G +V V CIAP +   R L             C      + T+++L    +NI K 
Sbjct  217   KGTEGVSVTVSCIAPLAPGIRKL------------SCSLAKLNQYTTLRLGLRVKNIQKV  264

Query  317   DPSAALKI-FLLVPGNVISDSWDHLKLEVCI  228
                   +  F+ +P  ++S   DH+K+++CI
Sbjct  265   SEQMQFEDGFMFIPSYMLSG--DHMKMQICI  293



>ref|XP_010551979.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase SINA-like 
7 [Tarenaya hassleriana]
Length=296

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 137/267 (51%), Gaps = 29/267 (11%)
 Frame = -2

Query  1013  GVMSGKGKGS-----ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             G   G+G+ S      + T +D  +LDC ICF  L  P+FQC+NGH+AC+ CC K+ NKC
Sbjct  36    GDDGGEGEASEKPPNFTQTFMDLRLLDCSICFEPLETPIFQCDNGHVACSPCCTKMRNKC  95

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRA  669
             PSCA PIG  R RALE V+ES+++PC N   GC+ ++ Y +   HE  CI T C CP+  
Sbjct  96    PSCAFPIGVLRNRALEDVIESIRIPCANAKQGCKRNVSYGERSSHERECIFTLCPCPSSG  155

Query  668   CKFLGSSKEVYTHFTNRHVQAKRITFNSPRQISLKKNQRFIYLQE-KTGGVVFVVNHHMD  492
             C+F G  K++Y H+        R+   S   +S++     + LQE K  G   VV  H  
Sbjct  156   CEFTGKYKDLYEHY--------RLCVAS---LSIELGDGNVVLQEDKKNGEPIVVQRHRL  204

Query  491   PLGSAVNVICIAPG-SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
             P G  V+  CIAP       F Y L     +  C  +       +  +++ V +  P  D
Sbjct  205   PHGELVSACCIAPSIPGAGEFTYTLT----DLPCVSRYCIEATASVTRVQKVTDQPPDKD  260

Query  314   PSAALKIFLLVPGNVISDSWDHLKLEV  234
                    F+L P  ++  +  H+KL++
Sbjct  261   -------FVLFPTYLVRIAGGHMKLDI  280



>ref|XP_009144236.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Brassica 
rapa]
Length=237

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 111/184 (60%), Gaps = 4/184 (2%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            SA L+D + L+CPIC + LT  +FQC+NGHIAC +CC KL NKCPSCA PIG  RCRA+E
Sbjct  44   SAKLLDLEALNCPICCVPLTSNIFQCDNGHIACPTCCNKLRNKCPSCALPIGLIRCRAME  103

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +V++++ VPCPN+  GC +   Y     HE  C  + C CP R C + GS K++Y+HF  
Sbjct  104  RVIKAVIVPCPNSMSGCIKKFSYGNELTHEKECSFSRCYCPARNCNYTGSYKDLYSHFKT  163

Query  620  RHVQ---AKRITFNSPRQISLKKNQRF-IYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
             + +   + +  F    ++     +   + ++E   G++FVV    +P G  V V CIAP
Sbjct  164  HNSERGYSYKFLFGEFAEVYFVLTEYTSVVMRENEAGLLFVVQCFSEPYGVYVTVSCIAP  223

Query  452  GSSK  441
             + +
Sbjct  224  SADE  227



>ref|XP_010424345.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=329

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 130/249 (52%), Gaps = 16/249 (6%)
 Frame = -2

Query  968  IDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVE  789
            +D +VL+C ICF +LTIP+FQC+NGH+ C+SCC K  NKCP CA PIG  RCRA+E V+ 
Sbjct  87   MDLEVLECSICFETLTIPIFQCDNGHLGCSSCCPKWCNKCPRCALPIGRIRCRAMESVLR  146

Query  788  SLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ  609
            S+ +PCPN  +GC +++ Y     H   CI + CSCP   C + GS + ++ H++     
Sbjct  147  SISIPCPNAQFGCTDNVSYGLESTHVNECIFSQCSCPALDCDYTGSYEALWWHYSYGLCV  206

Query  608  AKR---ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS-SK  441
            A R    T+  P  + +  + +     ++T  ++F V    +P G  V V C+AP S + 
Sbjct  207  APRDGSFTYKVPSTVRMNISDKIKIHADRTNELLFAVQCFREPSGVRVTVSCMAPSSPTV  266

Query  440  RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISD  261
             +F Y L    + E    K    ++   +  +   E+            F+L+P + +  
Sbjct  267  GKFSYHLSYTVDGETITYKSQDMKRILEVSFQTPLEH------------FMLIPHSSLRG  314

Query  260  SWDHLKLEV  234
                +KL +
Sbjct  315  DLLEMKLTI  323



>ref|XP_006301872.1| hypothetical protein CARUB_v10022345mg [Capsella rubella]
 gb|EOA34770.1| hypothetical protein CARUB_v10022345mg [Capsella rubella]
Length=278

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 108/189 (57%), Gaps = 3/189 (2%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             SG    + S TL+D ++LDCP+CF SLT P+F+C++GHIAC SCC K   KC +C  PIG
Sbjct  26    SGGDVVARSGTLLDLELLDCPVCFDSLTKPIFRCDSGHIACQSCCKKQRYKCSACYLPIG  85

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
               RCR LE VVE++ VPCPN  YGC E   Y K   HE  CI TPC CP   C + G  K
Sbjct  86    NYRCRILETVVEAVIVPCPNAKYGCSEKFYYGKELVHEKECIFTPCYCPAPDCNYRGMYK  145

Query  644   EVYTHFTNRH-VQAKRITFNSPRQIS--LKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
             ++Y+H+   H        F S  +    L  +++ + LQE   G + V+     P G + 
Sbjct  146   DLYSHYDANHKSWCGYDHFGSGHETDAWLPFSEKILVLQEYQDGPLVVIQGFEKPDGVSF  205

Query  473   NVICIAPGS  447
              V CIAP +
Sbjct  206   TVNCIAPSA  214



>emb|CDY10787.1| BnaA05g11490D [Brassica napus]
Length=289

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 134/273 (49%), Gaps = 41/273 (15%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            SA L+D + L+CPIC + LT  +FQC+NGHIAC +CC KL NKCPSCA PIG  RCRA+E
Sbjct  36   SAKLLDLEALNCPICCVPLTSNIFQCDNGHIACPTCCNKLRNKCPSCALPIGLIRCRAME  95

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +V++++ VPCPN+  GC +   Y     HE  C  + C CP R C + GS K++Y+HF  
Sbjct  96   RVIKAVIVPCPNSMSGCIKKFSYGNELTHEKECSFSRCYCPARNCNYTGSYKDLYSHFKT  155

Query  620  RHVQ---AKRITFNSPRQISLKKNQRF-IYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
             + +   + +  F    ++     +   + ++E   G++FVV    +P G  V V CIAP
Sbjct  156  HNSERGYSYKFLFGEFAEVYFVLTEYTSVVMRENEAGLLFVVQCFSEPYGVYVTVSCIAP  215

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP---------------KW  318
             + +                      GE +  I   AV  +IP               K 
Sbjct  216  SADE---------------------IGEFSCFISTTAVNYSIPHNIMTFKSPKVMKIRKL  254

Query  317  DPSAALKIFLLVPGNVISDSWDHLKLEVCIKDL  219
                  K F LVP +        LKL +CI  L
Sbjct  255  SSETPEKDFFLVP-SFFFPGRQALKLRICISKL  286



>gb|AES99123.2| seven in absentia family protein [Medicago truncatula]
Length=293

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 141/258 (55%), Gaps = 21/258 (8%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
            G    S  +I   +L+C  CF  LTIP+ QC+NGHI C++C  KL NKC  C+ PI    
Sbjct  6    GLYHFSPLIISNWLLNCSKCFHRLTIPVSQCDNGHIVCSTCSPKLRNKC-WCSLPISSKH  64

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C+A+E ++ S+++ CPN  +GC   I Y   R HE  CI+  C CP   C F  +S+ + 
Sbjct  65   CKAIENLMLSIEISCPNAEHGCRVKISYIGNRKHEDECIYVLCYCPILGCGFAATSEVLS  124

Query  635  THFTNRHVQAKRITFNSPRQ--ISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
             HF+ +H +  +I FN      +SLK N + I LQE+  G +F++N+    LG+AV + C
Sbjct  125  NHFSRKH-RNSQIKFNYGHSFIVSLKSNDQAIVLQEENDGKLFILNNSTILLGNAVYICC  183

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            I P SS+  + Y ++AR +             T  +KL++  +N+ ++  +      L++
Sbjct  184  IGPNSSESEYSYDILARSQ-------------TCKLKLQSFVKNVQQFTLATLPSELLVI  230

Query  281  PGNVISDSWDHLKLEVCI  228
            P      S + LKLE+CI
Sbjct  231  P----VGSSEPLKLEICI  244



>ref|XP_006301558.1| hypothetical protein CARUB_v10021992mg [Capsella rubella]
 gb|EOA34456.1| hypothetical protein CARUB_v10021992mg [Capsella rubella]
Length=259

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 136/259 (53%), Gaps = 19/259 (7%)
 Frame = -2

Query  986  SISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            ++SATL DPD LDCPICF   T P+FQC+NGH+ACASCC KL  KCPSC   IG +RCRA
Sbjct  15   TLSATL-DPDFLDCPICFEPFTTPIFQCDNGHLACASCCPKLSYKCPSCRFHIGHSRCRA  73

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +E V+ES+ VPCPN   GC +++ Y KL  H+  C    C CP   C + G    + +HF
Sbjct  74   METVLESIFVPCPNAKLGCTKNVSYGKLSTHKKECGFYLCICPLEDCNYTGLYHNMCSHF  133

Query  626  TNRHVQAKRITFNSP--RQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               H   K + F+      + +  + + +   +    ++FVV    +P G  V V CIAP
Sbjct  134  IANH-GNKYMLFHCDIISNVQINISDKILVRIDYEKNLLFVVQCFREPCGVYVTVSCIAP  192

Query  452  GSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
             S +   F Y L    +      +    ++   +  +   EN            F+L+P 
Sbjct  193  PSGEVGEFSYHLTYTVDGNTMSYESSEVKRILKLSSQRPEEN------------FMLIPQ  240

Query  275  NVISDSWDHLKLEVCIKDL  219
            +++    D L +++CIK+L
Sbjct  241  SLL--RGDSLTMKLCIKNL  257



>ref|XP_006482159.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like isoform 
X1 [Citrus sinensis]
Length=332

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/259 (38%), Positives = 149/259 (58%), Gaps = 21/259 (8%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK-CPSCASPIGFNRC  813
            G ++  L +  VL C +C   LT+P+FQCENGH+AC  CCI L  K C SC S IG +RC
Sbjct  73   GPLALILDNRKVLHCSMCDGHLTVPIFQCENGHLACCFCCITLKRKECYSCQSTIGSSRC  132

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHE-PTCIHTPCSCPNRACKFLGSSKEVY  636
             A+EK++E ++V C N+ YGC+E++ Y+K+ DH+   C +  CSCP   CKF+G+S  +Y
Sbjct  133  LAIEKILEVVRVKCQNSIYGCKETVTYSKMHDHQIYDCYYASCSCPISDCKFVGTSCHLY  192

Query  635  THFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQ-EKTGGVVFVVNHHMDPLGSAVNVIC  462
             H +  H  +  +  +N+  +I++  + +F  LQ EK   V+F++N+    LG+ V+V C
Sbjct  193  QHVSGEHNNSVVKFQYNNFFKITVNIDGKFSVLQEEKNDDVLFILNNSTGSLGNLVSVCC  252

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEA-VAENIPKWDPSAALKIFLL  285
            IA  S ++   Y +VAR       C  G+  K  S    + V  +IP   P      FLL
Sbjct  253  IA--SVRKDLYYDIVAR-------CVTGTILKIQSSTWSSKVRSDIPS--PFG----FLL  297

Query  284  VPGNVISDSWDHLKLEVCI  228
            VP  + + +   L+ E+CI
Sbjct  298  VPPYMFNCN-GQLEFEICI  315



>ref|NP_198607.1| putative E3 ubiquitin-protein ligase SINA-like 9 [Arabidopsis 
thaliana]
 sp|Q9FKD5.1|SINL9_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase SINA-like 
9; AltName: Full=Seven in absentia-like protein 9 [Arabidopsis 
thaliana]
 dbj|BAB09037.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94246.1| putative E3 ubiquitin-protein ligase SINA-like 9 [Arabidopsis 
thaliana]
Length=276

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 136/257 (53%), Gaps = 20/257 (8%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            +  L+D D+LDCPIC  +LT P+FQC+NGH+AC SCC KL NKCP+C  P+G +R RA+E
Sbjct  27   AIVLLDLDILDCPICCEALTSPIFQCDNGHLACGSCCPKLSNKCPACTLPVGHSRSRAME  86

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF--  627
             V+ES+ +PCPN  +GC +S  Y K   HE  CI + CSCP+  C + GS K++Y H+  
Sbjct  87   SVLESILIPCPNVRFGCTKSFFYGKESAHEKECIFSQCSCPSSVCDYTGSYKDLYAHYKL  146

Query  626  ---TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
               TN     KR    +    S+  + + +  +     ++  V    +P G  V V  IA
Sbjct  147  THSTNIFWNIKRFRCANFFTTSMLISDKILIKRVHEKKLLLAVQCFREPCGVYVTVSFIA  206

Query  455  PGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
            P + +   F Y+L    +      +    ++   + +E   EN            F+L+P
Sbjct  207  PSAPEVGEFSYQLSYNVDGHTVTYESPEVKRVCKVSIETPQEN------------FMLIP  254

Query  278  GNVISDSWDHLKLEVCI  228
             +++    D L+++V I
Sbjct  255  HSLLRG--DLLEMQVFI  269



>sp|Q9FM14.2|SIL11_ARATH RecName: Full=E3 ubiquitin-protein ligase SINA-like 11; AltName: 
Full=Seven in absentia-like protein 11 [Arabidopsis thaliana]
Length=314

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 132/245 (54%), Gaps = 8/245 (3%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPS--CASPIGFNRCRA  807
            SA L+D DVLDCP+CF  LTIP FQC++GHI C  C  K+ NKCP   C  PIG  RC A
Sbjct  32   SAKLLDLDVLDCPVCFEPLTIPTFQCDDGHIVCNFCFAKVSNKCPGPGCDLPIGNKRCFA  91

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +E+V+ES  VPC N  +GC +S+ Y K+  HE  C ++ CSCPN  C + GS   +Y HF
Sbjct  92   MERVLESAFVPCQNTEFGCTKSVSYEKVSSHEKECNYSQCSCPNLECNYTGSYNIIYGHF  151

Query  626  TNRHVQAKRITFN----SPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI  459
              RH+    I  +    S   + +   ++   L E    ++FVV    +  G  V V  I
Sbjct  152  MRRHLYNSTIVSSKWGYSTVDVLINIKEKVSVLWESRQKLLFVVQCFKERHGVYVTVRRI  211

Query  458  APGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            AP +S+ ++F Y+L    +  N   +    ++   +  + + ++   + P+  L  FL+ 
Sbjct  212  APPASEFKKFSYRLSYSIDGHNVTYESPEVKRLLEVNSQ-IPDDSFMFVPNCLLHGFLIK  270

Query  281  PGNVI  267
            P N +
Sbjct  271  PANEV  275



>ref|XP_009139756.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Brassica 
rapa]
Length=266

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 105/184 (57%), Gaps = 7/184 (4%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            +++ DVL CPIC    TIP+FQC+NGH+AC+SCC KL NKCPSCA P+G +RCRALE V+
Sbjct  15   ILNLDVLSCPICIEPFTIPIFQCDNGHLACSSCCPKLRNKCPSCAWPVGHSRCRALETVL  74

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF-----  627
            ES  +PC N  +GC E + Y +   HE TC  +PCSCP + C ++GS K+VY H+     
Sbjct  75   ESTSIPCQNAEFGCTEKLTYGEESTHENTCSFSPCSCPVQDCNYIGSYKDVYVHYKKLIH  134

Query  626  TNRHVQAKRITFNSPRQISLKKN--QRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
             N    ++R          +K N     +        ++F V       G  V V CIAP
Sbjct  135  KNPQSTSQRYRVRCGESFCVKMNISDNLVIGTLYKERLLFTVQSFRKSNGVYVTVSCIAP  194

Query  452  GSSK  441
             S K
Sbjct  195  SSPK  198



>ref|XP_003616165.1| Ubiquitin [Medicago truncatula]
Length=343

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 141/258 (55%), Gaps = 21/258 (8%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
            G    S  +I   +L+C  CF  LTIP+ QC+NGHI C++C  KL NKC  C+ PI    
Sbjct  6    GLYHFSPLIISNWLLNCSKCFHRLTIPVSQCDNGHIVCSTCSPKLRNKC-WCSLPISSKH  64

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C+A+E ++ S+++ CPN  +GC   I Y   R HE  CI+  C CP   C F  +S+ + 
Sbjct  65   CKAIENLMLSIEISCPNAEHGCRVKISYIGNRKHEDECIYVLCYCPILGCGFAATSEVLS  124

Query  635  THFTNRHVQAKRITFNSPRQ--ISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
             HF+ +H +  +I FN      +SLK N + I LQE+  G +F++N+    LG+AV + C
Sbjct  125  NHFSRKH-RNSQIKFNYGHSFIVSLKSNDQAIVLQEENDGKLFILNNSTILLGNAVYICC  183

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            I P SS+  + Y ++AR +             T  +KL++  +N+ ++  +      L++
Sbjct  184  IGPNSSESEYSYDILARSQ-------------TCKLKLQSFVKNVQQFTLATLPSELLVI  230

Query  281  PGNVISDSWDHLKLEVCI  228
            P      S + LKLE+CI
Sbjct  231  P----VGSSEPLKLEICI  244



>ref|XP_010470535.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 isoform X2 
[Camelina sativa]
Length=353

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 101/178 (57%), Gaps = 1/178 (1%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
             TL + D+LDCP+C  +LT  +FQC+NGHIAC+SCC KL + CPSC  PIG NRCR +EK
Sbjct  158  GTLFELDLLDCPVCCDALTDHIFQCDNGHIACSSCCTKLRHTCPSCTFPIGINRCRIMEK  217

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            +V+++ VPCPN  +GC E+  Y K   HE  C    C CP   C + G  K +Y+H+   
Sbjct  218  IVKAIIVPCPNAKHGCTETFSYGKELAHEKKCSFVLCYCPALNCNYSGLYKNLYSHYAAN  277

Query  617  HVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
            H    KR  +     + L    +   LQE   G + VV    +P G    V CIAP S
Sbjct  278  HKDTDKRFRYGYSHHVYLDIETKISVLQEYADGPLVVVQCFKEPQGMYFTVNCIAPPS  335


 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + D+LDCPIC +++T  +FQC+NGH+AC SCC+K+  KC +C  PIG  RCR +E
Sbjct  38   SGTLFELDLLDCPICCVTITSRIFQCDNGHVACLSCCVKMKKKCSACTLPIGKYRCRRME  97

Query  800  KVVESLKV  777
            +VVE++ V
Sbjct  98   RVVEAVVV  105



>gb|KFK35023.1| hypothetical protein AALP_AA5G224100 [Arabis alpina]
Length=275

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 132/256 (52%), Gaps = 16/256 (6%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +S  L DPD L CPIC   L IP+FQC+NGHIAC+SCC KL NKCPSCASPIG  RCRA+
Sbjct  29   LSTMLFDPDSLHCPICVEVLKIPIFQCDNGHIACSSCCPKLSNKCPSCASPIGHIRCRAM  88

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            E V+ES+ VPC N   GC +++ Y     HE  C    CSCP + C +      +Y H+ 
Sbjct  89   ETVLESVFVPCLNARLGCTKNLSYGNELAHEKECKFFTCSCPVQDCSYADFYTNLYFHYY  148

Query  623  NRHVQAK-RITFNSPRQISLKKN--QRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
              H Q+  R TF      S K N   + +  +E    ++F V    +P G  V V CIAP
Sbjct  149  LNHSQSSTRDTFVCGIPFSAKMNISDKILIRKEYNKMLLFAVQCFREPCGVYVTVSCIAP  208

Query  452  GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
             + +       V            G+     S K++ V + +    P      F+L+P +
Sbjct  209  SAPE-------VGEFSCHLSYTVDGNTMTYESPKMKMVLQ-VSFQTPQEK---FMLIPHS  257

Query  272  VISDSWDHLKLEVCIK  225
              S   D LK+E+CI+
Sbjct  258  --SLRGDVLKMEICIR  271



>emb|CDY01756.1| BnaC06g27960D [Brassica napus]
Length=297

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 126/254 (50%), Gaps = 15/254 (6%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + D+LDCP+C  +LT P+FQC+NGHIAC++CC  L N+CPSC  PIG  R R +E
Sbjct  44   SGTLFELDLLDCPVCCHTLTRPVFQCDNGHIACSACCTNLRNRCPSCTLPIGVYRNRMME  103

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +VVE++ VPCPN  +GC E   Y K   HE  C    C CP R C + G  K++Y H+ N
Sbjct  104  RVVEAIIVPCPNAKHGCTEMFSYGKELVHEKECSFALCYCPRRGCNYAGLCKDLYRHYYN  163

Query  620  RHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI---APG  450
                 +        +  +  + + + LQE   G +  +    +  G  V V CI   APG
Sbjct  164  CSSAREYFRCGYNVEAWMHISDKILVLQEGREGPLVAIQCFEEEQGVYVTVNCITPCAPG  223

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
             S+  F     +           G   KT S  L  +   I K       K F+ VP   
Sbjct  224  VSEFSFQLSYSSY----------GGAHKTMSFGLGEM-NRIQKVSFQTPDKDFMFVPHYF  272

Query  269  ISDSWDHLKLEVCI  228
            ++   D LK+ +C+
Sbjct  273  LAGRTD-LKMNICV  285



>emb|CDY27008.1| BnaC06g12240D [Brassica napus]
Length=329

 Score =   154 bits (389),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 112/188 (60%), Gaps = 3/188 (2%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
             TL+DPDVLDCPIC   L  P+FQC+NGH+AC+ CC K+ N CPSC  P+G+ RCRA+EK
Sbjct  88   VTLLDPDVLDCPICCEPLKAPIFQCDNGHLACSVCCAKVRNICPSCTLPVGYIRCRAMEK  147

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            V+E+ +V C N  YGC+E + Y     HE  C+  PCSCP   C + G  K++ +H   +
Sbjct  148  VIETSRVSCTNAKYGCKEKMLYGNRFSHEKLCVFPPCSCPVLNCNYTGYYKDLNSHVRAK  207

Query  617  HVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKR  438
            H + + I F     ++++ ++  I LQE+  G V VV          V V CIAP + + 
Sbjct  208  H-KDEVIPFVWDVSVTIRLDKTTI-LQEEKDGEVMVVQVFRGLHVVYVVVTCIAPSAREV  265

Query  437  R-FLYKLV  417
              F Y LV
Sbjct  266  GCFSYYLV  273



>gb|ADE77080.1| unknown [Picea sitchensis]
Length=293

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 136/262 (52%), Gaps = 21/262 (8%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             G GK  I+A  IDPD  +C IC   L+ P+FQC NGHIAC+SCC+ + N+CPSC  P G 
Sbjct  51    GSGKALIAA--IDPDAFECSICMEPLSPPIFQCSNGHIACSSCCVMMDNRCPSCLKPTGK  108

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
              RC A+EK++ES+KV C     GC E ++Y+++  HE  CI+ P  C    C F G S +
Sbjct  109   IRCLAIEKLIESMKVGCRYAHNGCRELVRYSQMTAHESKCIYAPYLCSVSGCSFSGPSTQ  168

Query  641   VYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVI  465
                HFT+ H        + +   + L  +++F  L+ +   ++F++ + M PLG+ V   
Sbjct  169   FSHHFTSVHGACVIHFRYEAWFTVLLATDEQFCILEGED--MIFLLQNKMKPLGNIVYAT  226

Query  464   CIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLL  285
             CI P SS+  + Y++  +        KG       S+    V  +  + D       FLL
Sbjct  227   CIGPASSEDHYSYQIEIK--------KGRRRLTMESVPRSIVGIHEIRQD-------FLL  271

Query  284   VPGNVISDSWDHLKLEVCIKDL  219
             +P     +   HL LE+  + +
Sbjct  272   IPVETYEED-GHLTLELSFRHV  292



>gb|KDP22663.1| hypothetical protein JCGZ_02505 [Jatropha curcas]
Length=330

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 113/189 (60%), Gaps = 3/189 (2%)
 Frame = -2

Query  998  KGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFN  819
            K   S+     D ++LDCPICF    IP+FQCENGH AC+SCC  +  KCPSCA PIG  
Sbjct  37   KRSSSVIVKSFDMELLDCPICFKPFDIPIFQCENGHTACSSCCQNIAKKCPSCAMPIGSI  96

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNK-LRDHEPTCIHTPCSCPNRACKFLGSSKE  642
            RCRA+E V+ES++V C N  Y C  +  Y K   +HE  C   PCSCP + CK   ++ +
Sbjct  97   RCRAIEMVLESVQVRCRNVKYRCFRTFSYGKSFFEHEKICAQFPCSCPIQGCKSKDNASD  156

Query  641  VYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVI  465
            +Y H T  H+       F+    IS   + +F++L+E+ GGV+F++++  + +G+ ++V 
Sbjct  157  LYEHCTKDHLDCVSNFIFDYAFTISFSIDDKFVFLRER-GGVLFILSNRSEKIGNFISVS  215

Query  464  CIAPGSSKR  438
             I   S+K 
Sbjct  216  RIGAPSAKE  224



>ref|XP_006656079.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase SINA-like 
10-like [Oryza brachyantha]
Length=317

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 132/248 (53%), Gaps = 15/248 (6%)
 Frame = -2

Query  1013  GVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCAS  834
             G+  G+ +G+     IDPDVLDC ICF SL  PL+QC+NGH+AC++C  KL NKC  C+ 
Sbjct  61    GLADGEVEGAGLNVQIDPDVLDCSICFDSLRPPLYQCQNGHVACSACWSKLNNKCHVCSR  120

Query  833   PIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLG  654
                F R  ALEK+VES+K  C    +GC + I Y +   HE +C   P  CP   C + G
Sbjct  121   DANFARNIALEKIVESIKSSCSYAKWGCCKFINYAQRDTHEESCPFAPSVCPIYGCGYNG  180

Query  653   SSKEVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSA  477
              +     HF +RH  +  R  ++ P  ++L+ +  F+ L  +   +  ++N+ M P G A
Sbjct  181   FTGHWSQHFLSRHRSEVLRFIYSQPFNVNLEVSVPFLALLGEDDHLFLLLNNSMMPFGHA  240

Query  476   VNVICIAPGSSKRRFLYKLVA--RGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAA  303
             ++V+C+  G+   +F Y++ A  R + EN             ++L+A   N   W     
Sbjct  241   LSVVCLRTGNLNWKFSYEIEATSRKKPEN------------RLQLKASVSNTKHWTGLYP  288

Query  302   LKIFLLVP  279
              + FLLVP
Sbjct  289   AEAFLLVP  296



>emb|CDY70665.1| BnaA02g35510D [Brassica napus]
Length=324

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 135/260 (52%), Gaps = 25/260 (10%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + DVLDCP CF  L  P+FQC NGH+AC SCC KL  KC  CA PIG  RCR +E
Sbjct  81   SMTLPNSDVLDCPCCFEPLKRPVFQCNNGHLACYSCCTKLKKKCSLCAMPIGDTRCRPIE  140

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            KV+++  V C N  YGC++S +Y+K+ +HE   +  PCSCP R C ++GS K++  HF  
Sbjct  141  KVIKTCLVACSNAKYGCKQSTRYDKVANHEKLYVFAPCSCPVRNCNYVGSYKDLNNHFRA  200

Query  620  RHVQAKRI-------TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
             H   KRI        FNSP+   L  N   +  QE+  G + VV       G  V V  
Sbjct  201  TH---KRIPGEIVSFVFNSPKLFGLDHNDDQVIFQEEKEGDLVVVKGFKRSDGVCVTVRR  257

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL--KIFL  288
            IAP   +   L   +AR +              ++++L    +N+ K           F+
Sbjct  258  IAPIVKEIPKLSCSIARLKAH------------STLRLGFQVDNVQKVGEQQVQPENNFM  305

Query  287  LVPGNVISDSWDHLKLEVCI  228
            L+P + +S     +K+++CI
Sbjct  306  LIPSH-MSGCCHCMKMQICI  324



>ref|NP_201086.1| E3 ubiquitin-protein ligase SINA-like 11 [Arabidopsis thaliana]
 gb|AED97659.1| protein with RING/U-box and TRAF-like domains [Arabidopsis thaliana]
Length=348

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 147/285 (52%), Gaps = 21/285 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPS--CASPIGFNRCRA  807
            SA L+D DVLDCP+CF  LTIP FQC++GHI C  C  K+ NKCP   C  PIG  RC A
Sbjct  32   SAKLLDLDVLDCPVCFEPLTIPTFQCDDGHIVCNFCFAKVSNKCPGPGCDLPIGNKRCFA  91

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +E+V+ES  VPC N  +GC +S+ Y K+  HE  C ++ CSCPN  C + GS   +Y HF
Sbjct  92   MERVLESAFVPCQNTEFGCTKSVSYEKVSSHEKECNYSQCSCPNLECNYTGSYNIIYGHF  151

Query  626  TNRHVQAKRITFN----SPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI  459
              RH+    I  +    S   + +   ++   L E    ++FVV    +  G  V V  I
Sbjct  152  MRRHLYNSTIVSSKWGYSTVDVLINIKEKVSVLWESRQKLLFVVQCFKERHGVYVTVRRI  211

Query  458  APGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            AP +S+ ++F Y+L    +  N      + E     +L  V   IP  D S     F+ V
Sbjct  212  APPASEFKKFSYRLSYSIDGHNV-----TYESPEVKRLLEVNSQIP--DDS-----FMFV  259

Query  281  PGNVISDSWDHLKLEVCIKDLA*DSMDTYMSGFLFCFVFWCVAEL  147
            P  ++    + L+L++ IK L    +   +SG +   V + V  L
Sbjct  260  PNCLLHG--EMLELKLGIKKLKQTCIIQKLSGLVPGSVLYIVGFL  302



>gb|KFK33270.1| hypothetical protein AALP_AA6G352900 [Arabis alpina]
Length=346

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 105/180 (58%), Gaps = 1/180 (1%)
 Frame = -2

Query  983  ISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            +  TL+D DVLDCPIC   L  P+FQC+NGH+AC+ CC K+ N+CP C  PIG+ RCRA+
Sbjct  104  LFVTLLDSDVLDCPICCEPLKTPIFQCDNGHLACSVCCTKVRNRCPCCTLPIGYIRCRAM  163

Query  803  EKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            EKV+E+ +V C N  YGC++++ Y     HE  C+ TPCSCP   C + G  K+V  H  
Sbjct  164  EKVIETSRVSCTNAKYGCKQNMLYGNRFHHEKLCVFTPCSCPIHNCNYTGYYKDVNNHVR  223

Query  623  NRHV-QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
             +H        +++  +ISL  +Q+    QE+  G V VV          V V CI P S
Sbjct  224  LKHKDDVIPFVWDASVRISLDIDQKTTVFQEEKSGEVIVVQLFQGLHVVYVTVSCIRPLS  283



>ref|XP_003616125.1| Ubiquitin [Medicago truncatula]
 gb|AES99083.1| seven in absentia family protein [Medicago truncatula]
Length=340

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 135/256 (53%), Gaps = 16/256 (6%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFM-SLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRC  813
             S+   +  P   +C IC   S +IP+FQC+N HI C++C  +L+N C  C+ PI    C
Sbjct  22   SSVKVMISFPKDFECCICLQPSSSIPVFQCDNDHIVCSTCFPQLMNNCHKCSMPISSKCC  81

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYT  633
            + +E + +S+++PCPN  YGC E+I  +  R HE  CI+ PC CP + C F+ S + +  
Sbjct  82   KVIENISQSIQMPCPNKKYGCRETISQSGKRKHEEECIYVPCYCPVKGCDFVASLEVLSN  141

Query  632  HFTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
            HF ++H  +    ++     +SL  N     LQE+  G +F +N+    LG+AVN+ CI 
Sbjct  142  HFNHKHGDSLIEFSYGHSFTVSLNSNDEAAVLQEENDGKLFTLNNSTMLLGNAVNISCID  201

Query  455  PGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
              SS+  + Y ++AR              KT+ +K  +  +NI +   +     +L++P 
Sbjct  202  VNSSEAGYSYDILARS-------------KTSRLKFHSSPKNIQRSTSATHSSEYLMIPF  248

Query  275  NVISDSWDHLKLEVCI  228
                 S   L+LE+CI
Sbjct  249  GYFGSSKP-LELEICI  263



>emb|CDY01695.1| BnaC04g30570D [Brassica napus]
Length=309

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 130/257 (51%), Gaps = 22/257 (9%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            +++ DVL CPIC    TIP+FQC+NGH+AC+SCC KL NKCPSC+ P+G +RCRA+E V+
Sbjct  15   ILNLDVLSCPICVEPFTIPIFQCDNGHLACSSCCPKLRNKCPSCSWPVGHSRCRAMETVL  74

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN---  621
            ES+ +PC N  +GC   + Y +   HE TC  +PCSCP + C + GS K+VY H+ N   
Sbjct  75   ESISIPCQNAGFGCTTKLIYGEESTHEKTCTFSPCSCPVKDCNYTGSCKDVYVHYKNLIH  134

Query  620  ----RHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
                   Q  R+       + +  +   +        ++F V       G  V V CIAP
Sbjct  135  PNPQSTSQRYRVRCGESFSVKMNISDNLVIGTLYKERLLFTVQSFRKSYGVYVIVSCIAP  194

Query  452  GSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
             S K  +F Y +    +  +   K    +K   +      EN            ++L+  
Sbjct  195  SSPKVGKFSYCITYTIDGHSITYKSPELKKIQRVSFHTPQEN------------YMLIAN  242

Query  275  NVISDSWDHLKLEVCIK  225
            + +    + L++ +CIK
Sbjct  243  SSLHG--ESLEMRICIK  257



>ref|XP_003616141.1| E3 ubiquitin-protein ligase SINA-like protein [Medicago truncatula]
 gb|AES99099.1| seven in absentia family protein [Medicago truncatula]
Length=244

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 131/230 (57%), Gaps = 14/230 (6%)
 Frame = -2

Query  965  DPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVES  786
            +P +LDC  C   LTIP+FQC+NGHI C++C  KL NK   C+  I   RC+A+E ++ S
Sbjct  8    NPKLLDCCNCSQPLTIPVFQCDNGHIFCSTCYPKLGNKRHKCSLRISSKRCKAIENLLLS  67

Query  785  LKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQA  606
            +++ CPN  +GC E I     R HE  CIH PC CP  +C F+ SS+ +  HF+++H  +
Sbjct  68   IEMSCPNVNHGCNEKISCIGKRKHEEECIHVPCCCPVSSCDFVASSEVLSKHFSDKHGDS  127

Query  605  K-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFL  429
              + ++     + +K N   I  QE+T G +F++ +    LG+A+N+ CI P S +  + 
Sbjct  128  HIKFSYGHSLIVYIKSNDETIVFQEETYGKLFILYNRATLLGNAINICCIGPNSFESEYR  187

Query  428  YKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
            Y ++AR +     CK         +KL++ A+++ +   +     FLL+P
Sbjct  188  YYILARSQ----MCK---------LKLQSFAKDVQRVAFATPSSEFLLIP  224



>ref|XP_010454972.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=289

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/270 (34%), Positives = 135/270 (50%), Gaps = 22/270 (8%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             S+ V    G    S   +D +VL+CPICF ++TIP+FQC+NGH+AC+SCC KL +KCPSC
Sbjct  28    SSSVSPTDGSKKRSTLQMDLEVLECPICFETMTIPIFQCDNGHLACSSCCPKL-SKCPSC  86

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
             A PIG  RCRA+E V+ S+ +PCPN   GC +++ Y     H   CI + CSCP   C +
Sbjct  87    ALPIGRIRCRAMESVLRSISIPCPNAKLGCTKNVSYGLESTHVKECIFSRCSCPALDCDY  146

Query  659   LGSSKEVYTHFTNRHVQAKRITFNSPRQISLKKNQRF-------IYLQEKTGGVVFVVNH  501
              GS K++  H+   +     +    P   ++  N R        IY+ +     +F V  
Sbjct  147   TGSYKDICRHYYTYNSDPATVHLYEPLMYNISFNVRMNISDKIKIYVDD-ISDRLFAVQC  205

Query  500   HMDPLGSAVNVICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIP  324
               +P G  V V CIAP + +  +F Y L              + +  T     A  + I 
Sbjct  206   FREPYGVCVTVSCIAPSAPELGKFSYHL------------SYTVDGDTMTYESADLKRIH  253

Query  323   KWDPSAALKIFLLVPGNVISDSWDHLKLEV  234
             K      L+ F+L+P + +      +KL +
Sbjct  254   KVSFQTPLEKFMLIPHSALRGEMLEMKLTI  283



>ref|XP_006391405.1| hypothetical protein EUTSA_v10018712mg [Eutrema salsugineum]
 gb|ESQ28691.1| hypothetical protein EUTSA_v10018712mg [Eutrema salsugineum]
Length=380

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/256 (37%), Positives = 136/256 (53%), Gaps = 16/256 (6%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + ++LDCPIC  +LT  +FQC+NGHIAC+SCC KL NKCP C  PIG  RCRA+E
Sbjct  68   SGTLFNLNLLDCPICCHALTSDIFQCDNGHIACSSCCTKLRNKCPFCTFPIGNYRCRAME  127

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            ++VE++ VPCPN  +GC E + Y K   H   C  + C CP   C + G  K++Y+H+  
Sbjct  128  RIVEAIMVPCPNAKHGCTEKLSYGKELVHVKECSFSLCYCPAPNCNYSGVYKDIYSHYDA  187

Query  620  RHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS-  447
             H     +      R   ++ +   + LQE+ GG + VV    +P G  V V CIAP + 
Sbjct  188  NHRNIWHQFICGCSRSACVRISGGSLVLQERRGGPLVVVQSFKEPQGVYVTVNCIAPSAP  247

Query  446  SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVI  267
               +F Y L       + G    +       +++ V+   P+ D       F+L+P    
Sbjct  248  GVGKFSYDLTY-----SIGVNSMTFGSREMNRVQKVSFQTPEKD-------FMLIPHYFQ  295

Query  266  SD-SWDHLK-LEVCIK  225
            S   +D LK LE+ I+
Sbjct  296  SHCGYDVLKTLEIRIQ  311



>ref|XP_006302575.1| hypothetical protein CARUB_v10020683mg, partial [Capsella rubella]
 gb|EOA35473.1| hypothetical protein CARUB_v10020683mg, partial [Capsella rubella]
Length=313

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 139/265 (52%), Gaps = 28/265 (11%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + +VLDCP CF  L  P+FQC NGH+AC  CCIKL  +C  C  PIG  RCRA+E
Sbjct  55   SVTLPNSNVLDCPNCFNPLKKPIFQCNNGHLACFLCCIKLKKRCSFCELPIGDVRCRAME  114

Query  800  KVVESLKVPCPNNTYGCEESIKY-NKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            K++++  V C N  +GC++S  Y NKL  HE  C+ +PCSCP + C ++GS K++  HF 
Sbjct  115  KIIKAGLVSCSNAMHGCKQSTTYGNKLLLHEKVCVFSPCSCPIKDCNYIGSYKDLNNHFR  174

Query  623  NRHVQA----KRITFNSPR----QISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
              H Q+           PR    ++ +  N   I+ +EK G V+ VV   +   G  V V
Sbjct  175  GTHKQSPGEIMSFVLKRPRIFGLELDVSDNNMVIFQEEKEGDVI-VVQRFIGSPGVYVTV  233

Query  467  ICIAPG-SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENI--PKWDPSAALK  297
              IAP     R+F              C     ++ ++++L    +NI  P+        
Sbjct  234  SHIAPMVPGVRKF-------------SCSLAKLKQYSTLRLGLRVKNIQKPRSQEEQPED  280

Query  296  IFLLVPGNVISDSWDHLKLEVCIKD  222
             F+L+P  ++  S DHLK+++C  +
Sbjct  281  DFMLIPSYML--SGDHLKMQICFGE  303



>ref|XP_010513557.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 1 [Camelina 
sativa]
Length=483

 Score =   155 bits (393),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 128/245 (52%), Gaps = 22/245 (9%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S  L++ ++LDCP+C  +LT+P+FQCENGHIAC+SCC+ L NKCP C   IG  RCR LE
Sbjct  232  SGALLELNLLDCPVCSHALTVPIFQCENGHIACSSCCMILRNKCPDCNLHIGNYRCRILE  291

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH-FT  624
            ++++++ VPCPN  +GC E + + +   HE  C+  PC CP   C + G  K++Y+H + 
Sbjct  292  RIIKAMIVPCPNAIHGCTEKVSHGQELAHEKECVFAPCYCPEPDCNYTGMYKDLYSHYYA  351

Query  623  NRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP---  453
            N    +KR      R   L   ++ + LQE   G + V+     P G  + V CIAP   
Sbjct  352  NYKNVSKRFVSGCSRHADLDLGKKILVLQENNDGPLVVIQCLNGPQGLCLTVNCIAPPTP  411

Query  452  --GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
              G    R  Y           G    S EK    K++ V+   P+       K F +VP
Sbjct  412  GVGEFSFRLSYTF---------GDVTMSFEKDKMNKIQKVSFQPPE-------KCFTVVP  455

Query  278  GNVIS  264
             + +S
Sbjct  456  SDFMS  460


 Score = 95.9 bits (237),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 3/92 (3%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            L + D+LDCP+C  +LT  +FQC+NGHIAC+SCC KL + CPSC  PIG NRCR +EKVV
Sbjct  128  LFELDLLDCPVCCDALTDHIFQCDNGHIACSSCCTKLRHICPSCTLPIGINRCRIMEKVV  187

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIH  696
            +++  PCPN  +  E S  + K R   P+ +H
Sbjct  188  KAIIFPCPNAKH--EASTSHQK-RQPVPSKVH  216



>ref|XP_010450967.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=407

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 114/192 (59%), Gaps = 5/192 (3%)
 Frame = -2

Query  1010  VMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASP  831
             + + +GK + SA L+  D+LDCPICF +LT+P+FQCENGH+AC+SCC KL  KCP+C   
Sbjct  148   IFTSEGK-TRSAMLLGLDILDCPICFHALTVPIFQCENGHVACSSCCSKLRYKCPTCELR  206

Query  830   IGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGS  651
             +G  RC  +E V+ES+ VPC N  +GC E++ Y K   HE  C  + C+CP   C   GS
Sbjct  207   VGHKRCSVMESVLESVFVPCRNAKFGCTENVSYGKESTHEKDCSFSQCACPALDCNHTGS  266

Query  650   SKEVYTHFTNRHV-QAKRITFNSPRQISLKKN---QRFIYLQEKTGGVVFVVNHHMDPLG  483
               ++Y HF N H  ++  ++F     + ++ N   ++ I L E    ++F V    +  G
Sbjct  267   YNDIYPHFFNNHCHESNSLSFVCGGSVDVEMNIASEKIIVLCESEKSLLFAVQCFNELHG  326

Query  482   SAVNVICIAPGS  447
               V + CIAP +
Sbjct  327   VYVTIRCIAPST  338



>ref|XP_010444133.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 11 [Camelina 
sativa]
Length=268

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 134/259 (52%), Gaps = 20/259 (8%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPS--CASPIGFNRCRA  807
            SA L D DVLDCP+CF  LT+P FQC++GH+ C+ C  K+ NKCP   C  PIG  RC  
Sbjct  20   SAKLSDLDVLDCPVCFEPLTVPTFQCDDGHLVCSLCLAKVSNKCPGPGCDLPIGNKRCIP  79

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +EKV+E+  VPC N  +GC  S  Y K+  HE  C ++ CSCPN  C ++GS   +Y+H+
Sbjct  80   MEKVIEAAFVPCRNAEFGCTNSFSYGKVSSHEKECNYSQCSCPNLDCNYIGSYTSIYSHY  139

Query  626  TNRHVQAKRI-TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             + H+      +F S   + +  N++ + L E    ++FVV    +  G  V +  IA  
Sbjct  140  ISSHLYENMTCSFRSSALVRININEKVLVLYEDMEKLLFVVQCFREKQGVYVTLRSIASS  199

Query  449  SSKRRFLYKLVARGEEENCGCKGGS-GEKTTSIK--LEAVAENIPKWDPSAALKIFLLVP  279
            + K +  Y L       +C   G +   K+  +K  LE  +  IP+       + ++  P
Sbjct  200  TPKEKISYWL-------SCNVDGHTLAYKSPEMKRFLEVSSHQIPE-------ESYIFFP  245

Query  278  GNVISDSWDHLKLEVCIKD  222
             +++      + L + I D
Sbjct  246  NSLLCGEMLEMSLSIVIFD  264



>ref|XP_002868826.1| hypothetical protein ARALYDRAFT_916594 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45085.1| hypothetical protein ARALYDRAFT_916594 [Arabidopsis lyrata subsp. 
lyrata]
Length=272

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 136/264 (52%), Gaps = 19/264 (7%)
 Frame = -2

Query  998  KGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFN  819
            + K    + ++D D LDCPIC    T+P+FQC+NGH+ACASCC KL NKCP+C  P+G  
Sbjct  21   QTKDETRSAMLDLDFLDCPICIEPFTVPIFQCDNGHLACASCCPKLSNKCPTCTLPVGHI  80

Query  818  RCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTC-IHTPCSCPNRACKFLGSSKE  642
            R RA+E V+ES+ +PCPN   GC  ++ Y K   HE  C     CSCP + C +  S   
Sbjct  81   RSRAMESVLESIFIPCPNAKLGCTTNVSYGKQSIHEKECSFSLLCSCPLQDCNYTSSYSN  140

Query  641  VYTHFTNRHVQAKRITF--NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
            +Y HF + H Q K + F  ++   + +  + + +   E    +VF V    +P G  V V
Sbjct  141  MYRHFISDH-QNKYMLFCCDTFANVRMNISDKILIRVEYEVSLVFAVQCFKEPCGVYVTV  199

Query  467  ICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIF  291
             CIAP   +  +F Y L    +         + E     K+  V+  IP+         F
Sbjct  200  SCIAPSFQEVGKFSYHLSYTVDGHT-----MTYESPKVKKVLKVSYQIPEES-------F  247

Query  290  LLVPGNVISDSWDHLKLEVCIKDL  219
            +L+P +++      L +++CIK L
Sbjct  248  MLIPHSLLRGEI--LDMKLCIKKL  269



>ref|XP_002864819.1| hypothetical protein ARALYDRAFT_358487 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41078.1| hypothetical protein ARALYDRAFT_358487 [Arabidopsis lyrata subsp. 
lyrata]
Length=283

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/257 (38%), Positives = 134/257 (52%), Gaps = 20/257 (8%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLI-NKCPS--CASPIGFNRCR  810
            SA L+D DVLDCPICF  LTIP FQC++GH+ C+ C  K+  N+CP   C  PIG  RC 
Sbjct  33   SAKLLDLDVLDCPICFEPLTIPTFQCDDGHLVCSFCFAKVSSNRCPGPGCDLPIGNKRCF  92

Query  809  ALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTH  630
            ++EKV+ES  VPCPN  +GC ES  Y K+  HE  C ++ CSCPN  C + GS   +Y H
Sbjct  93   SMEKVLESAFVPCPNTEFGCTESFSYGKVSSHEKECNYSQCSCPNLECNYTGSYNIIYGH  152

Query  629  FTNRHVQAKRITFN----SPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
            F   H+    I  +    S   + +  N++ + L E    ++FVV    +  G  V V  
Sbjct  153  FMRSHLYNSTICSSIWGYSSVDVRININEKVLVLWESLQKLLFVVQCFRERHGVYVTVRR  212

Query  461  IAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLL  285
            IAP +S+ ++F Y L    +  N      + E     +L  V   IP  D S     F+ 
Sbjct  213  IAPSASELKKFSYCLSYSIDGHNV-----TYESPEVKRLLEVNSQIP--DES-----FMF  260

Query  284  VPGNVISDSWDHLKLEV  234
            VP  ++      LKL +
Sbjct  261  VPNCLLRGEMLELKLGI  277



>ref|XP_009105517.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 isoform X1 
[Brassica rapa]
Length=317

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 125/254 (49%), Gaps = 15/254 (6%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + D+LDCP+C  +LT P+FQC+NGHIAC+SCC  L +KCPSC  PIG  R R +E
Sbjct  42   SGTLFELDLLDCPVCCHALTRPVFQCDNGHIACSSCCTNLRSKCPSCTLPIGVYRNRMME  101

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +VVE++ VPCPN  +GC E   Y K   HE  C    C CP R C + G  K++Y H+ N
Sbjct  102  RVVEAVIVPCPNAKHGCTEMFSYGKELVHEKECSFALCYCPKRGCNYAGLCKDLYRHYYN  161

Query  620  RHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA---PG  450
                 +        Q  +    + + LQE   G +  +    +  G  V V CIA   PG
Sbjct  162  CSSAREYFRCGYNVQAWMHIRDKILVLQEGREGPLVAIQCFEEEQGVYVTVNCIAPCVPG  221

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
             S+  F     +           G  +KT S  L  +   I +       K F+ VP + 
Sbjct  222  VSEFSFQLSYSSY----------GGADKTMSFGLGEM-NRIQRVCFQTPDKDFMFVP-HY  269

Query  269  ISDSWDHLKLEVCI  228
              D    LK+ +C+
Sbjct  270  FLDGRTSLKMNICV  283



>ref|XP_006301023.1| hypothetical protein CARUB_v10021414mg [Capsella rubella]
 gb|EOA33921.1| hypothetical protein CARUB_v10021414mg [Capsella rubella]
Length=403

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 133/263 (51%), Gaps = 19/263 (7%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL D ++LDCP+C  +LT P+FQC+NGHIAC+SCCIKL  +C SC  PIG  RCR +E
Sbjct  149  SGTLFDLNLLDCPVCSNALTSPIFQCDNGHIACSSCCIKLRYRCHSCNFPIGNYRCRRME  208

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            KVV+++ V CPN  +GC E+  Y K   HE  C    C CP   C + G  K++Y H+ +
Sbjct  209  KVVKAVIVSCPNAKHGCTETFSYGKELVHEKNCSFYLCYCPAPNCNYSGLYKDLYIHYKS  268

Query  620  RHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP---  453
             H+  + +     P       +++   LQE   G + V+    +P G  V V CIAP   
Sbjct  269  NHMDIENQFVCGRPLCTMWPISEKVFVLQESAAGPLVVLQRFNEPGGWYVTVNCIAPCAP  328

Query  452  --GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
              G       Y + A G++     +     +   +  ++  E+            F+L+P
Sbjct  329  GVGEFSFDLSYSMPAGGDKHTMTFQSSEMNRIHKVSFQSPEED------------FMLIP  376

Query  278  GNVISDSWDHLKLEVCIKDLA*D  210
             +   D  + LK+ +CI  L  D
Sbjct  377  -HYFQDPRNSLKMTICIDHLQED  398


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSL--TIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRA  807
            S TL++ D+LDCP+CF SL  T P+F+C++GH+AC+SCC K++N CPSC  PIG  RC  
Sbjct  42   SGTLLNLDLLDCPVCFDSLKKTKPIFRCDSGHVACSSCCTKMMNICPSCRHPIGEFRCSI  101

Query  806  LEKVVESLKV  777
            +EK+VE++ V
Sbjct  102  MEKLVEAIVV  111



>ref|NP_001141682.1| Ubiquitin-protein ligase/ zinc ion binding protein [Zea mays]
 gb|ACF86852.1| unknown [Zea mays]
 gb|ACG48836.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays]
 tpg|DAA54906.1| TPA: Ubiquitin-protein ligase/ zinc ion binding protein [Zea 
mays]
Length=327

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 135/266 (51%), Gaps = 15/266 (6%)
 Frame = -2

Query  1010  VMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASP  831
             V+ G+  G   +  IDPDVLDC ICF  L  PL+QC+NGH+AC SC  +L NKC  C+S 
Sbjct  73    VVGGEADGI--SVRIDPDVLDCSICFDPLQPPLYQCQNGHVACFSCWSRLTNKCHICSSD  130

Query  830   IGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGS  651
               F R  ALEKVVES+K  C    +GC + + Y     HE +C+  P  CP   C + G 
Sbjct  131   ANFVRNIALEKVVESVKSSCSYAKWGCNKLVSYACRNAHEESCLFAPSMCPIPGCGYRGF  190

Query  650   SKEVYTHF-TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
             +     HF TN +    R ++     +SL+ +  F+ L  +   +   +N ++ P G A+
Sbjct  191   TGWWSGHFLTNHNSDGLRFSYGQCFDVSLEMSVPFLVLLAEDDHLFIFINKNVIPFGHAL  250

Query  473   NVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKI  294
             +V C+  G+    FLY++ A  +          G    S++L+A   N  +W      ++
Sbjct  251   SVCCLRTGNLNWNFLYEMRATSK----------GNTKNSLQLKASVTNTREWRGLNPTEV  300

Query  293   FLLVPGNVISDSWDHLKLEVCIKDLA  216
             FLLVP      S   L L V I+ +A
Sbjct  301   FLLVPYAFSKSS--KLTLNVSIERVA  324



>ref|XP_006482392.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like [Citrus 
sinensis]
Length=274

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 142/262 (54%), Gaps = 22/262 (8%)
 Frame = -2

Query  989  GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK-CPSCASPIGFNRC  813
            GS+S TL D D LDCPICF     P++QCENGH+ C +C  K+ N  CP   SPI + R 
Sbjct  17   GSVSITLADSDFLDCPICFGPFRPPVYQCENGHMVCTTCRSKIKNDSCPFDRSPIAYTRN  76

Query  812  RALEKVVESLK-VPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            R +EK++ES+K V C N  YGC E++ Y +  DHE  C H+PCSCP   C FLGSS ++Y
Sbjct  77   RVIEKLLESVKSVSCKNAEYGCNETLGYLEKNDHEKACKHSPCSCPLSGCDFLGSSSQLY  136

Query  635  THFTNRHVQAKRITFNSPRQISLK---KNQRFIYLQE-KTGGVVFVV-NHHMDPLGSAVN  471
             HF  +H Q   + F   +  S++   KN +F+ L E +   ++FV+ N   +   + ++
Sbjct  137  QHFRAQH-QNSSVLFRYDQDFSIRLDAKNDKFLVLLEGRDDNILFVLHNARSNQQQNGLS  195

Query  470  VICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIF  291
            + CI+  S + R  YK+       N          ++S K     +N+PK         F
Sbjct  196  ISCIS-SSREARNEYKISVSFGSNNVSTLTFRSAISSSKK---QLDNLPKLG-------F  244

Query  290  LLVPGNVISDSWD-HLKLEVCI  228
             LVP   + D+ D  L L++CI
Sbjct  245  PLVPW--LLDATDGRLNLKICI  264



>ref|XP_009135925.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Brassica 
rapa]
Length=283

 Score =   150 bits (378),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 93/267 (35%), Positives = 145/267 (54%), Gaps = 28/267 (10%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
            + ++D  VLDCPIC   L+IP+FQC+NGH+AC+SCC KL NKCPSCA P+G +RCRA+E 
Sbjct  25   SAMLDFGVLDCPICIEPLSIPIFQCDNGHLACSSCCPKLKNKCPSCALPVGHSRCRAMET  84

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTP-CSCPNRACKFLGSSKEVYTHF--  627
            +++S+ +PC N  YGC ES+ + K   HE  C     C CP + C + GS  ++Y H+  
Sbjct  85   LLKSVFLPCQNAKYGCTESVAFGKEPTHEKDCTFAEYCCCPVQYCNYAGSYIDLYLHYVS  144

Query  626  TNRHVQAKRITFNSPRQIS--LKKN-------QRFIYLQEKT-GGVVFVVNHHMDPLGSA  477
            +N    +++I       IS  +K N       QR  ++Q  T   ++F V    +P G  
Sbjct  145  SNHMTVSEQIRDELCIGISCGIKMNISDKILIQRATFVQRATVERLLFAVQCFKEPFGVY  204

Query  476  VNVICIAPGSSKRR-FLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL  300
            V V CIAP   +   F Y+L+   + +    K    +K   + L+   +N          
Sbjct  205  VTVSCIAPSIQEVGPFSYRLIYTVDGQTIIYKLSEMKKIREVSLQTPQDN----------  254

Query  299  KIFLLVPGNVISDSWDHLKLEVCIKDL  219
              ++L+P +++    + L++ +CIK L
Sbjct  255  --YMLIPHSLL--CGESLEMRLCIKML  277



>emb|CDX95911.1| BnaA07g28200D [Brassica napus]
Length=294

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 125/254 (49%), Gaps = 15/254 (6%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + D+LDCP+C  +LT P+FQC+NGHIAC+SCC  L +KCPSC  PIG  R R +E
Sbjct  41   SGTLFELDLLDCPVCCHALTRPVFQCDNGHIACSSCCTNLRSKCPSCTLPIGVYRNRMME  100

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +VVE++ VPCPN  +GC E   Y K   HE  C    C CP R C + G  K++Y H+ N
Sbjct  101  RVVEAVIVPCPNAKHGCTEMFSYGKELVHEKECSFALCYCPRRGCNYAGLCKDLYRHYYN  160

Query  620  RHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA---PG  450
                 +        Q  +    + + LQE   G +  +    +  G  V V CIA   PG
Sbjct  161  CSSAREYFRCGYNVQAWMHIRDKILVLQEGREGPLVAIQCFEEEQGVYVTVNCIAPCVPG  220

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
             S+  F     +           G  +KT S  L  +   I K       K F+ VP   
Sbjct  221  VSEFSFQLSYSSY----------GGADKTMSFGLGEM-NRIQKVCFQTPDKDFMFVPHYF  269

Query  269  ISDSWDHLKLEVCI  228
            ++     LK+ +C+
Sbjct  270  LAGR-TSLKMNICV  282



>ref|XP_010451724.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=274

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 110/191 (58%), Gaps = 5/191 (3%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S  L+D ++LDCPIC  + TIP+FQC+NGH+A +SCC KL N CP CA  +G NRCRA+E
Sbjct  43   STMLMDLEILDCPICCEAFTIPIFQCDNGHLAYSSCCPKLRNLCPLCALHVGHNRCRAME  102

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
              +ES+ +PC N   GC +++ Y K  +HE  C+ + CSCP   C +  S K++Y H+  
Sbjct  103  TYLESILIPCQNAKLGCTKNVFYGKESNHEKKCVFSRCSCPALDCDYTSSYKDLYLHYII  162

Query  620  RHV-----QAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIA  456
             H+     Q+ + + N    + +  +++ +   E    ++F +    +P G  V + CIA
Sbjct  163  THMDMEIYQSSKFSCNVSFIVPMNISKKMLIRTEYAKNLMFALQCFKEPYGVYVTLSCIA  222

Query  455  PGSSKRRFLYK  423
            P       +YK
Sbjct  223  PSVDGHAVIYK  233



>ref|NP_176836.1| E3 ubiquitin-protein ligase SINA-like 3 [Arabidopsis thaliana]
 sp|Q9C6H2.1|SINL3_ARATH RecName: Full=E3 ubiquitin-protein ligase SINA-like 3; AltName: 
Full=Seven in absentia-like protein 3 [Arabidopsis thaliana]
 gb|AAG51179.1|AC079285_12 hypothetical protein [Arabidopsis thaliana]
 gb|AEE34538.1| RING/U-box and TRAF-like domain-containing protein [Arabidopsis 
thaliana]
Length=303

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 139/279 (50%), Gaps = 15/279 (5%)
 Frame = -2

Query  1022  VSNGVMSGKGKGSI---SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             VS   + G   GS    SATL++ D+LDCPIC+  L  P++QC+NGHIAC+SCC K+  K
Sbjct  21    VSMENVGGTASGSEVARSATLLELDLLDCPICYHKLGAPIYQCDNGHIACSSCCKKVKYK  80

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRD--HEPTCIHTPCSCP  678
             CP C+  IGF R R LEK+VE++ V CPN  YGC E I Y+   +  HE  C  T C CP
Sbjct  81    CPYCSLRIGFFRSRILEKIVEAVVVSCPNAKYGCTEKIPYDNESESAHERVCEFTLCYCP  140

Query  677   NRACKFLGSSKEVYTHF----TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFV  510
                CK+ G   ++Y H+       H   K   +N+       +   F+ LQE   G + V
Sbjct  141   EPECKYTGVYTDLYRHYHAEHKTDHSWFKCGEYNNAWLHVTGEKLSFLVLQEYEDGPLVV  200

Query  509   VNHHMDPLGSAVNVICIAP-GSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAE  333
             V   M+  G  V V CIAP       F   L+ R   E    +     K   +  E    
Sbjct  201   VQCSMESHGICVTVNCIAPCAPGVGEFSCHLIYRNGSEKITFESKKMNKIQKVSPENHVA  260

Query  332   N---IPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIK  225
             N   IP +    A   F+ +P  ++ D    LK+++CI+
Sbjct  261   NYKPIPYYLRGEASN-FMSIPYYLL-DEASILKMQICIR  297



>ref|XP_009132807.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Brassica 
rapa]
Length=304

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 130/247 (53%), Gaps = 23/247 (9%)
 Frame = -2

Query  947  CPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCP  768
            CP+C  +LT P+FQC+NGHIAC++CCI + NKCPSC  PIG +RCR +E+VVE++ VPCP
Sbjct  65   CPVCCHALTNPIFQCDNGHIACSACCINMRNKCPSCTLPIGIHRCRIMERVVEAIMVPCP  124

Query  767  NNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV---QAKRI  597
            N   GC +   Y K   HE  C    C CP   C + G  K++Y H+   H    ++   
Sbjct  125  NAKRGCTDKFSYGKELAHEKECSFALCYCPASDCNYAGLCKDLYRHYHANHTGYCESFTC  184

Query  596  TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI---APGSSKRRFLY  426
             FN+   + +  + + + LQE  GG +  V    +  G  V V CI   APG S+  F Y
Sbjct  185  GFNADAWMHI--SDKILVLQEGRGGPLVAVQCFEEEHGVYVTVNCIASCAPGVSE--FSY  240

Query  425  KLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHL  246
            +L               G+K+ S  L  +   I K       K F+LVP +   +  + L
Sbjct  241  QLSY-----------SHGDKSMSFGLGEM-NRIQKVSFQTPEKDFMLVP-HYFLNGRESL  287

Query  245  KLEVCIK  225
            K+++CI+
Sbjct  288  KMKICIR  294



>ref|XP_006405821.1| hypothetical protein EUTSA_v10028229mg, partial [Eutrema salsugineum]
 gb|ESQ47274.1| hypothetical protein EUTSA_v10028229mg, partial [Eutrema salsugineum]
Length=272

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 137/260 (53%), Gaps = 18/260 (7%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
            ATL+D  VLDCPIC+  L IP+FQC+NGH+AC +C  KL NKCP CA PIG NR RA+EK
Sbjct  23   ATLLDRTVLDCPICWEPLVIPIFQCDNGHLACHTCFPKLKNKCPVCAIPIGNNRNRAMEK  82

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHE-PTCIHTPCSCPNRA--CKFLGSSKEVYTHF  627
            V+ES  VPCPN   GC E++ Y +  +HE   C  + CSCP+    C + G   + + H+
Sbjct  83   VLESTIVPCPNTQLGCTENVPYGRESNHEKDYCKFSLCSCPDETNECNYTGYYDDTWLHY  142

Query  626  TNRHVQAKR--ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               H+        F  P ++ +  +++ +        V+FVV    +P G  V V CIAP
Sbjct  143  LACHLLNPYCFFAFGLPSEVQMHISEKILVRSTLEEKVLFVVQCFREPNGVYVTVKCIAP  202

Query  452  GSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
             + + R++ Y++              + E     ++  V+  IP+       K FL +  
Sbjct  203  LAPEVRKYSYRISYTSNGHT-----HTHESAEMKRIRKVSFQIPQE------KNFLFISN  251

Query  275  NVISDSWDHLKLEVCIKDLA  216
            +V+      L +E+CI ++ 
Sbjct  252  SVLRGE-KVLNMEICISEVG  270



>ref|XP_010440901.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 isoform X2 
[Camelina sativa]
Length=407

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (60%), Gaps = 5/191 (3%)
 Frame = -2

Query  1007  MSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPI  828
             ++ +GK + S  L+  D+LDCPICF +LTIP+FQC+N H+AC+SCC KL  KCP+C SP+
Sbjct  149   LTSEGK-TRSGMLLGLDILDCPICFHALTIPIFQCDNEHLACSSCCSKLRYKCPTCESPV  207

Query  827   GFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSS  648
             G  RC  +E V+ES+ VPC N  +GC E++ Y K   HE  C  + C+CP   C + GS 
Sbjct  208   GHKRCSVMESVLESVFVPCRNAKFGCTENVSYGKESTHEKDCSLSQCACPALDCNYTGSY  267

Query  647   KEVYTHFTNRHV-QAKRITFNSPRQISLKKN---QRFIYLQEKTGGVVFVVNHHMDPLGS  480
               +Y HF + H  ++  ++F     + ++ N   ++ + L E    ++F +    +  G 
Sbjct  268   SYIYAHFFDNHCHESNSLSFVCGGSVDVEMNIATEKIVVLCESEKRLLFALQCFNELHGV  327

Query  479   AVNVICIAPGS  447
              V V CIAP +
Sbjct  328   YVTVRCIAPST  338



>ref|XP_010440900.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 isoform X1 
[Camelina sativa]
Length=412

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 114/191 (60%), Gaps = 5/191 (3%)
 Frame = -2

Query  1007  MSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPI  828
             ++ +GK + S  L+  D+LDCPICF +LTIP+FQC+N H+AC+SCC KL  KCP+C SP+
Sbjct  154   LTSEGK-TRSGMLLGLDILDCPICFHALTIPIFQCDNEHLACSSCCSKLRYKCPTCESPV  212

Query  827   GFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSS  648
             G  RC  +E V+ES+ VPC N  +GC E++ Y K   HE  C  + C+CP   C + GS 
Sbjct  213   GHKRCSVMESVLESVFVPCRNAKFGCTENVSYGKESTHEKDCSLSQCACPALDCNYTGSY  272

Query  647   KEVYTHFTNRHV-QAKRITFNSPRQISLKKN---QRFIYLQEKTGGVVFVVNHHMDPLGS  480
               +Y HF + H  ++  ++F     + ++ N   ++ + L E    ++F +    +  G 
Sbjct  273   SYIYAHFFDNHCHESNSLSFVCGGSVDVEMNIATEKIVVLCESEKRLLFALQCFNELHGV  332

Query  479   AVNVICIAPGS  447
              V V CIAP +
Sbjct  333   YVTVRCIAPST  343



>sp|Q9FKD6.2|SINL8_ARATH RecName: Full=E3 ubiquitin-protein ligase SINA-like 8; AltName: 
Full=Seven in absentia-like protein 8 [Arabidopsis thaliana]
Length=263

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 133/264 (50%), Gaps = 36/264 (14%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
             K   SATL+D D+LDCPIC   LT P+FQCENGH+AC+SCC KL NKCP+C        
Sbjct  19   AKRQRSATLLDLDILDCPICCEGLTCPIFQCENGHLACSSCCPKLRNKCPAC--------  70

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
               +E ++ES+ V CPN+ +GC ES  Y K   HE  CI + CSCP+  C++ G  +++Y
Sbjct  71   --PMENILESILVTCPNDMFGCTESFLYGKKSTHEEECIFSLCSCPSLDCEYSGRYEDLY  128

Query  635  THFTNRHVQ---------AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLG  483
             H+   H+             I + +P  IS K     +Y ++    ++F V    +  G
Sbjct  129  DHYKLTHISNSYWTTNCFRSSIPYKAPMLISDKIQITRVYEKK----ILFAVQCFRESCG  184

Query  482  SAVNVICIAPGSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSA  306
              V V CIAP + +  +F Y++    +E     +    ++   +  E   EN        
Sbjct  185  VYVTVSCIAPSAPEVGQFSYQISYTVDEHTMVYRSPQMKRVRKVSFETPQEN--------  236

Query  305  ALKIFLLVPGNVISDSWDHLKLEV  234
                F+L+P N++      +KL +
Sbjct  237  ----FMLIPHNLLRSELLDIKLSI  256



>ref|XP_010496724.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 4 [Camelina 
sativa]
Length=328

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/263 (37%), Positives = 136/263 (52%), Gaps = 27/263 (10%)
 Frame = -2

Query  980  SATLIDPDVL-DCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRAL  804
            S TL + +VL DCP CF  L  P+FQC NGH+AC  CCIKL  +C  C  PIG  RCRA+
Sbjct  72   SVTLPNSNVLFDCPNCFDPLKKPIFQCNNGHLACFLCCIKLKKRCSFCKLPIGDVRCRAM  131

Query  803  EKVVESLKVPCPNNTYGCEESIKY-NKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            EKV+++  V C N+ YGC+ES  Y NKL  HE  C+  PCSCP + C ++GS K++ +HF
Sbjct  132  EKVIKAGLVSCSNSMYGCKESTTYGNKLLSHEKVCVFAPCSCPVKDCNYIGSYKDLNSHF  191

Query  626  TNRHVQA--KRITFNSPRQISL-----KKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
               H Q+  + ++    R I         +   +  QE+  G VFVV       G  V V
Sbjct  192  RGAHKQSPGEIMSLVLKRSIIFGLDLDDSDNNIVIFQEEKEGDVFVVQGFTASHGVYVTV  251

Query  467  ICIAPGS-SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAAL--K  297
              IAP     RRF              C     ++ ++++L    +NI K          
Sbjct  252  SHIAPMVPGVRRF-------------SCSVAKLKQYSTLRLGLRVKNIQKSREQEEQPED  298

Query  296  IFLLVPGNVISDSWDHLKLEVCI  228
             F+L+P  ++S   DHLK+++ I
Sbjct  299  DFMLIPSFMLSS--DHLKMQISI  319



>ref|XP_010435704.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=245

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 90/134 (67%), Gaps = 10/134 (7%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             +G+ N     K + S SA L+  DVL+CPICF +LTIP+FQCENGH+AC+SCC KL NKC
Sbjct  119   EGLRNNTHLKKRQRSSSAMLLGLDVLNCPICFEALTIPIFQCENGHLACSSCCPKLSNKC  178

Query  848   PSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRA  669
             PSCASP+G NRCRA+E V+ES+ VPC N  Y   ESI       HE  C  T CSCP   
Sbjct  179   PSCASPVGHNRCRAMESVLESVFVPCRNAKY---ESI-------HEKECTFTQCSCPALD  228

Query  668   CKFLGSSKEVYTHF  627
             C + GS   +YTHF
Sbjct  229   CSYTGSYDNIYTHF  242



>gb|KEH41208.1| seven in absentia family protein [Medicago truncatula]
Length=315

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 128/229 (56%), Gaps = 19/229 (8%)
 Frame = -2

Query  911  FQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKY  732
            F C+NGHI C++CC KL NKC  C+  I   RC+A+E ++ S+K+ C N  +GC+E I Y
Sbjct  26   FYCDNGHIVCSTCCTKLKNKCHECSLHISSKRCKAIENLLLSIKMSCSNAKHGCKEKISY  85

Query  731  NKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQA-KRITFNSPRQISLKKNQ  555
               R HE  C++  C CP   C F  SS+ +  HF ++H  +  + ++     +SLK N 
Sbjct  86   TD-RKHEEECVYVLCYCPLSGCDFAASSEVLSNHFRHKHGDSIIKFSYGYSFTVSLKSND  144

Query  554  RFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGS  375
              I LQE+  G +F++N+    LG+AVN+ CI P SS+  + Y ++AR   +NC      
Sbjct  145  EIIVLQEENDGKLFILNNRTTLLGNAVNLCCIGPNSSESNYNYDILARS--QNC------  196

Query  374  GEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
                  +KL++ A+N+ +   +      L++P      S + LKL++CI
Sbjct  197  -----ILKLQSFAKNVQQVTLATLSSELLVIPFG----SSEPLKLDICI  236



>ref|XP_006405811.1| hypothetical protein EUTSA_v10028190mg [Eutrema salsugineum]
 gb|ESQ47264.1| hypothetical protein EUTSA_v10028190mg [Eutrema salsugineum]
Length=290

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 129/246 (52%), Gaps = 16/246 (7%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             S +   ++S  L+D D+L+CP C   LTIP++QC NGHIAC+ CC ++ N CPSC   +G
Sbjct  35    STREDSNVSVYLLDKDLLECPTCCEPLTIPIYQCINGHIACSLCCKRVNNICPSCKFRVG  94

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
             + RCRA+EKV+E  +V CPN  YGC+E++ Y     H+  C   PCSCP R C + GS K
Sbjct  95    YIRCRAMEKVIEEARVSCPNAKYGCKENVSYQNPSSHDKQCGFAPCSCPVRDCNYTGSHK  154

Query  644   EVYTHFTNRHVQAKRI-TFNSPRQI--SLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
             ++  H    H +   +  +N+P  I  +L   +  I  +EK G ++ V+       G  V
Sbjct  155   DLKNHVNVEHKEGLVLFKWNTPLCIEPTLLSEEMTILREEKDGDLI-VIQGFEGTDGIFV  213

Query  473   NVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKI  294
              + CIAP ++++  L             C        +++K E   + I K       + 
Sbjct  214   TLSCIAPLANEKVIL------------SCSLELRTLRSTLKQEVTVKTIQKTSEEEPEED  261

Query  293   FLLVPG  276
             F+LVP 
Sbjct  262   FVLVPS  267



>ref|XP_010511494.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase SINA-like 
4 [Camelina sativa]
Length=326

 Score =   149 bits (375),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/263 (37%), Positives = 133/263 (51%), Gaps = 29/263 (11%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL   +VLDCP CF  L  P+FQC NGH+AC  CCIKL  +C  C  PIG  RCRA+E
Sbjct  72   SVTLPSSNVLDCPNCFDPLKKPIFQCNNGHLACFLCCIKLKKRCSLCKLPIGDVRCRAME  131

Query  800  KVVESLKVPCPNNTYGCEESIKY-NKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            KV+++  V C N  YGC+ES  Y NKL  HE  C+  PCSCP + C ++GS K++ +HF 
Sbjct  132  KVIKAGLVSCSNAMYGCKESTTYGNKLLSHEKICVFAPCSCPXKDCNYIGSYKDLNSHFR  191

Query  623  NRH----------VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
            + H          V  + I F     + L  +   +  QE+  G VFVV       G  V
Sbjct  192  DAHKKSPGEIMSLVLKRPILFG----LELDDSDNIVIFQEEKEGDVFVVQGFTASHGVYV  247

Query  473  NVICIAPGS-SKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALK  297
             V  IAP     R+F   L    +          G +  +I+     E  P+ D      
Sbjct  248  TVSHIAPMVPGVRKFSCSLAKLKQYSTLRL----GLRVKNIQKSREQEEQPEDD------  297

Query  296  IFLLVPGNVISDSWDHLKLEVCI  228
             F+L+P  ++  S D++K+++ I
Sbjct  298  -FMLIPSFML--SGDNIKMQISI  317



>ref|XP_010456725.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=280

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 117/208 (56%), Gaps = 8/208 (4%)
 Frame = -2

Query  1019  SNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSC  840
             S+ V    G    S   +D +VL+CPICF +LT P+FQC++GH+AC+SCC KL NKCP+C
Sbjct  17    SSSVSPTDGSKKRSTLQMDLEVLECPICFETLTKPIFQCDDGHLACSSCCPKLSNKCPTC  76

Query  839   ASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKF  660
             A PIG  RCRA+E V+ S+ +PCPN  +GC +++ Y     H   CI + CSCP   C +
Sbjct  77    AFPIGHIRCRAMESVLGSISIPCPNAKFGCTDNVSYGLESTHVKECIFSRCSCPALDCDY  136

Query  659   LGSSKEV----YTHFTNRHVQAKRITF---NSPRQISLKKNQRFIYLQEKTGGVVFVVNH  501
              GS + V    Y++ ++R        F    +   + +  + +     + T  ++FVV  
Sbjct  137   TGSYRNVCKHYYSYISSRSTPLHHYAFLLYKASSTVRMNISDKIKIHVDYTNELLFVVQC  196

Query  500   HMDPLGSAVNVICIAPGSSKR-RFLYKL  420
               +     V V CIAP S+K  +F Y+L
Sbjct  197   FRESYSVCVTVSCIAPSSAKVGKFSYQL  224



>ref|XP_004962639.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10-like isoform 
X1 [Setaria italica]
Length=331

 Score =   149 bits (375),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 135/278 (49%), Gaps = 24/278 (9%)
 Frame = -2

Query  1022  VSNGVMSGKGKGSISATL----------IDPDVLDCPICFMSLTIPLFQCENGHIACASC  873
             V  G   G G+ ++   +          IDPDVLDC ICF  L  PL+QC+NGH+AC SC
Sbjct  57    VGAGTAEGSGRNAVETVVGGEADGISVRIDPDVLDCSICFEPLQPPLYQCQNGHVACFSC  116

Query  872   CIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHT  693
               +L NKC  C+    F R  ALEKVVES+K  C    +GC + + Y+    HE +C+  
Sbjct  117   WSRLTNKCHICSYDANFARNIALEKVVESVKSSCSYAKWGCRKLVSYSLRHAHEESCLFA  176

Query  692   PCSCPNRACKFLGSSKEVYTHFTNRHVQ--AKRITFNSPRQISLKKNQRFIYLQEKTGGV  519
             P  CP   C + G +     HF   H    + R ++    ++SL+ +  F+ L  +   +
Sbjct  177   PSICPIPGCGYKGFTGWWSGHFLTNHNTDGSLRFSYGQWFEVSLEMSVPFLVLLAEDDHL  236

Query  518   VFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAV  339
               +VN ++ P G A++V C+  G+    F Y++ A  +               +++L+A 
Sbjct  237   FLLVNKNVLPFGHALSVGCLRTGNLNWNFTYEMRAASK----------ANTENNLQLKAC  286

Query  338   AENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIK  225
               NI +W      + FLLVP        + L L VCI+
Sbjct  287   VTNIREWQGLHPTEAFLLVPYAFCKS--NKLTLNVCIQ  322



>emb|CDM80861.1| unnamed protein product [Triticum aestivum]
Length=281

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/262 (31%), Positives = 134/262 (51%), Gaps = 17/262 (6%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLI-NKCPSCASPIG  825
             G+  G      +  D LDCP+CF  LT P++QC  GH  C+SC  KL+ NKC  C++   
Sbjct  17    GESSGKRQNVTMGMDALDCPVCFHPLTPPIYQCSVGHFVCSSCRPKLVRNKCHLCSAETT  76

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
             F RC  +E+++ES+ V C N  YGC + + Y +  +HE  C +TPC CP  +C F G + 
Sbjct  77    FKRCLGMERLMESVTVACCNANYGCAQKLTYYQREEHEEACPNTPCFCPESSCSFAGPTD  136

Query  644   EVYTHFTNRHVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
              +  HF ++H      I +    +  L+    F+  +E+   V+F++N  ++P+G A++V
Sbjct  137   ALLEHFASQHKWPCTTIKYYEDVKFHLEPGLHFLRTEER---VIFLLNVALEPVGHAISV  193

Query  467   ICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFL  288
             +CI P  +  +F  ++       +C   G     T  I+   +++ +PK          L
Sbjct  194   VCIQPKGTNSKFKCQM-----SYSCFTTGYYQSSTYKIRSSLLSDGLPK-------GYNL  241

Query  287   LVPGNVISDSWDHLKLEVCIKD  222
             ++P + + D    + L  CI D
Sbjct  242   ILPKDEVPDDGKGIPLRFCIHD  263



>ref|XP_010916810.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 6 [Elaeis 
guineensis]
Length=360

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 144/297 (48%), Gaps = 60/297 (20%)
 Frame = -2

Query  968  IDPDVLDCPICFMSLTIPLFQ---------------------------------------  906
            IDPDVLDC  C   L  PLF+                                       
Sbjct  78   IDPDVLDCSSCGTPLRAPLFEAGYSRFLFSAWFVSFVIEIMFYGSVMLSDAADGSFVAIV  137

Query  905  -----CENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEES  741
                 C+NGH+AC  CC  L NKC  C+ PIG  RC ALE ++E++K+PCPN+ +GC ++
Sbjct  138  VVNLDCDNGHVACFLCCAILENKCHVCSLPIGSRRCPALETIIEAMKIPCPNSRFGCRKT  197

Query  740  IKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAKRITFNSPR--QISL  567
            I Y +   HE +C+  P SCP  +C F G +  +  H  N H    +I+F+  R  +++L
Sbjct  198  IPYTQKCTHEESCLFAPFSCPISSCTFQGLTACLSRHIQNEHHSTPQISFSYNRFFEVAL  257

Query  566  KKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGC  387
            ++ + F+ L+ K G +  ++N   +P GSA+++ C+ PGS++    YK+  +        
Sbjct  258  QQKEPFLVLRGKDGRIFLLLNAGSEPYGSALSIACMRPGSTEWGLEYKIRVK--------  309

Query  386  KGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDLA  216
                  K   + L+A  +NI +    +    FL+VP +  SDS   + ++V I+ + 
Sbjct  310  -----RKRRELHLKASPKNIRELKVGSPAGSFLVVP-HEFSDSSGVISIDVLIRHIG  360



>gb|KFK34836.1| hypothetical protein AALP_AA5G199400 [Arabis alpina]
Length=282

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 110/203 (54%), Gaps = 20/203 (10%)
 Frame = -2

Query  1004  SGKGKGSISAT---------LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK  852
             SG G GS + T         L D DV+DC +CF +LTIP+FQC+NGH+AC++CC KL  +
Sbjct  5     SGDGNGSSTKTSQKRQRTGMLTDLDVMDCSVCFDTLTIPIFQCDNGHMACSTCCEKLRKR  64

Query  851   CPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNR  672
             C +C  P    R R +E+V+E LKVPCPN  +GC E + Y++   H   C    C+CP R
Sbjct  65    CATCTYPT-IIRNRGMERVLELLKVPCPNAEFGCSEEVIYDEKSAHFKQCTFAQCTCPFR  123

Query  671   ACKFLGSSKEVYTH---------FTNRHVQAKRITFNSPRQISLKKNQRFIYL-QEKTGG  522
             +C F GS K+VY H         +  R    ++     P  +SL   +R +   Q K GG
Sbjct  124   SCGFTGSYKDVYEHSVAKHSGEGYGYRFSSLEKFECGKPLYLSLSGGERLVLKEQTKEGG  183

Query  521   VVFVVNHHMDPLGSAVNVICIAP  453
              + VV+      G   +V CIAP
Sbjct  184   ELVVVDCFKSTDGEKFSVSCIAP  206



>emb|CBI33566.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 2/115 (2%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             G S+G  + +   S+S  L DP+VLDC IC   L++P+FQCENGHIAC+SCC KL N+CP
Sbjct  89    GTSSGSEANR-DASVSVILTDPEVLDCSICLEPLSVPVFQCENGHIACSSCCTKLSNRCP  147

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIH-TPCS  684
             SC+ PIG+NRCRA+EKV+ES+KV C N  YGC+E++ Y K  DHE TC +  PCS
Sbjct  148   SCSWPIGYNRCRAIEKVLESVKVSCQNTAYGCKETVSYGKKHDHEVTCNYLLPCS  202



>ref|XP_009105214.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Brassica 
rapa]
Length=354

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 97/168 (58%), Gaps = 1/168 (1%)
 Frame = -2

Query  947  CPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCP  768
            CP+CF +LT  +FQC+NGHIAC+SCC +L NKCP+CA PIG NRCR +E+VVES+ VPCP
Sbjct  58   CPVCFQALTQHVFQCDNGHIACSSCCRELRNKCPACALPIGNNRCRIMERVVESVTVPCP  117

Query  767  NNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ-AKRITF  591
            N  +GC E   Y K  DHE  C    C CP   C + G  K++YTH+   H   + R   
Sbjct  118  NAKHGCTEKFSYGKELDHEKECGFALCYCPAPDCNYAGVYKDLYTHYDANHKDTSTRFVC  177

Query  590  NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
             +  +  L        LQE   G + VV       G +V V CIAP +
Sbjct  178  GTLHRTYLGTVSTTSVLQEYRDGPLVVVQGFEVAHGLSVTVNCIAPSA  225



>emb|CDY52473.1| BnaA04g27970D [Brassica napus]
Length=284

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/245 (36%), Positives = 130/245 (53%), Gaps = 18/245 (7%)
 Frame = -2

Query  947  CPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCP  768
            CPIC+  LT+P+FQC+NGH+AC+SCC KL NKCP+CASPIG  RCRA+E V+ES+  PCP
Sbjct  51   CPICYEPLTVPIFQCDNGHLACSSCCPKLSNKCPACASPIGDKRCRAMENVLESIFTPCP  110

Query  767  NNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAK-RITF  591
            N   GC +++ Y K   H   C  + CSCP   C++ GS K +  H+   H  ++    F
Sbjct  111  NAKMGCTKNVSYGKESTHLKQCSFSLCSCPVVNCRYAGSYKNLSDHYCLTHPDSECSDCF  170

Query  590  NSPRQISLKKN--QRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSK-RRFLYKL  420
                  S++ N   + + L E    ++F V    +P G  V V CIAP + +   F Y L
Sbjct  171  ICGLSFSVQTNISDKILVLWEYKKHLLFTVECFAEPYGVNVAVSCIAPCAPEVGEFSYNL  230

Query  419  VARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKL  240
                +      +    ++   +  +   EN            F+L+P +++    D LK+
Sbjct  231  SYTVDGHTVTYESPEVKRVLQVSGQTPQEN------------FMLIPHSLLRG--DLLKM  276

Query  239  EVCIK  225
            ++CIK
Sbjct  277  KLCIK  281



>gb|ADE77895.1| unknown [Picea sitchensis]
Length=261

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 112/195 (57%), Gaps = 3/195 (2%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             G G G      IDPD  +C IC   L+ P+FQC NGHIAC+SCC  + N+C SC +PIG 
Sbjct  17    GGGSGKTLIATIDPDAFECIICMEPLSPPIFQCTNGHIACSSCCFLMNNRCHSCLNPIGK  76

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
              RC A+EK++ES+KV C    +GC E ++Y+++  H+  CI+ P SC    C F G S  
Sbjct  77    IRCLAIEKLIESMKVGCIYAHHGCRELVRYSQITAHQSKCIYAPYSCSVSGCSFSGPSIR  136

Query  641   VYTHFTNRHVQAK-RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVI  465
                HFT+ H   K +  + +   + L  +++F  L+ +   +VF++ + M  LG+ V V 
Sbjct  137   FSDHFTSVHGACKMQFRYEAWFTVLLATDEQFCILEGED--MVFLLQNKMKFLGNMVYVT  194

Query  464   CIAPGSSKRRFLYKL  420
              I P SS+    Y++
Sbjct  195   YIGPASSEEHCSYQI  209



>emb|CAC80703.1| SIAH1 protein [Brassica napus]
Length=351

 Score =   147 bits (370),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 98/168 (58%), Gaps = 1/168 (1%)
 Frame = -2

Query  947  CPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCP  768
            CP+CF +LT  +FQC+NGHIAC+SCC +L NKCP+CA PIG NRCR +E+VVES+ VPCP
Sbjct  58   CPVCFQALTQHVFQCDNGHIACSSCCRELRNKCPACALPIGNNRCRIMERVVESVTVPCP  117

Query  767  NNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ-AKRITF  591
            N  +GC E   Y K   HE  C    C CP   C + G  K++YTH+   H   + R   
Sbjct  118  NAKHGCTEKFSYGKELAHEKECRFALCYCPAPDCNYAGVYKDLYTHYDANHKDTSTRFVC  177

Query  590  NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
            ++  +  L        LQE   G + VV   +   G +V V CIAP +
Sbjct  178  DTLHRTYLGTVSTTSVLQEYRDGPLVVVQGFVVAHGLSVTVNCIAPSA  225



>emb|CAB89182.1| SIAH1 protein [Brassica napus var. napus]
Length=351

 Score =   147 bits (370),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 98/168 (58%), Gaps = 1/168 (1%)
 Frame = -2

Query  947  CPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCP  768
            CP+CF +LT  +FQC+NGHIAC+SCC +L NKCP+CA PIG NRCR +E+VVES+ VPCP
Sbjct  58   CPVCFQALTQHVFQCDNGHIACSSCCRELRNKCPACALPIGNNRCRIMERVVESVTVPCP  117

Query  767  NNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ-AKRITF  591
            N  +GC E   Y K   HE  C    C CP   C + G  K++YTH+   H   + R   
Sbjct  118  NAKHGCTEKFSYGKELAHEKECRFALCYCPAPDCNYAGVYKDLYTHYDANHKDTSTRFVC  177

Query  590  NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
            ++  +  L        LQE   G + VV   +   G +V V CIAP +
Sbjct  178  DTLHRTYLGTVSTTSVLQEYRDGPLVVVQGFVVAHGLSVTVNCIAPSA  225



>ref|XP_010485288.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 11 [Camelina 
sativa]
Length=268

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/256 (32%), Positives = 126/256 (49%), Gaps = 14/256 (5%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPS--CASPIGFNRCRA  807
            SA L D DVLDCP+CF  LT+P FQC++GH+ C+ C  K+ NKCP   C  PIG  RC  
Sbjct  20   SAKLSDLDVLDCPVCFEPLTVPTFQCDDGHLVCSLCLAKVSNKCPGPGCDLPIGNKRCFP  79

Query  806  LEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF  627
            +EKV+E+  VPC N  +GC  +  Y K+  HE  C ++ C CPN  C ++GS   +Y+H+
Sbjct  80   MEKVLEAAFVPCRNAEFGCPNTFSYGKVSSHEKECSYSQCFCPNLDCNYIGSYTSIYSHY  139

Query  626  TNRHVQAKRI-TFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             + H+      +F S   + +  N++ + L E    ++FV     +  G  V +  IA  
Sbjct  140  ISSHLYENMTCSFRSSALVRININEKVLVLYEDMEKLLFVFQCFRERHGVYVTLRSIASS  199

Query  449  SSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNV  270
            + K +  Y L    +      K    ++     LE  +  IP+       + ++  P   
Sbjct  200  TPKEKISYWLSCSADGHTLAYKSPEMKRF----LEVSSHQIPE-------ESYIFFPNRF  248

Query  269  ISDSWDHLKLEVCIKD  222
            +      + L + I D
Sbjct  249  LCGEMLEMSLSIVIFD  264



>ref|NP_849853.1| E3 ubiquitin-protein ligase SINA-like 4 [Arabidopsis thaliana]
 sp|Q9C9M0.1|SINL4_ARATH RecName: Full=E3 ubiquitin-protein ligase SINA-like 4; AltName: 
Full=Seven in absentia-like protein 4 [Arabidopsis thaliana]
 gb|AAG60080.1|AC013288_14 hypothetical protein [Arabidopsis thaliana]
 gb|AEE34540.1| putative E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=329

 Score =   146 bits (368),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/264 (35%), Positives = 135/264 (51%), Gaps = 27/264 (10%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL + +VL+CP CF  L  P+FQC NGH+AC  CCIKL  +C  C  PIG  RCRA+E
Sbjct  75   SVTLPNSNVLECPNCFDPLKKPIFQCNNGHLACFLCCIKLKKRCSFCKLPIGDVRCRAME  134

Query  800  KVVESLKVPCPNNTYGCEESIKY-NKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFT  624
            KV+++  V C N  YGC++S  Y N+L+ HE  C+  PCSCP + C ++G  K++  HF 
Sbjct  135  KVIKAGLVSCSNAIYGCKQSTTYGNQLQSHEKVCVFAPCSCPIKDCNYIGFYKDLINHFR  194

Query  623  NRHV----QAKRITFNSPRQISLK---KNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVI  465
              H           F+ P    L     ++  I+++EK G  +FVV   +   G    V 
Sbjct  195  ATHKVSPGDINSFVFDRPVIFGLDLDSSDKMVIFVEEKQGN-LFVVQGFIGSHGVYATVS  253

Query  464  CIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW--DPSAALKI  294
             IAP   + R+F              C        ++++L    +NI K         + 
Sbjct  254  HIAPMVPEVRKF-------------SCSLARLRPYSTLRLGLEVKNIQKLRSQEEQPQED  300

Query  293  FLLVPGNVISDSWDHLKLEVCIKD  222
            FLL+P  ++  + DH+K+E+ I D
Sbjct  301  FLLIPSYMV--NGDHMKMEISIGD  322



>ref|NP_001057483.2| Os06g0311300 [Oryza sativa Japonica Group]
 gb|EEE65591.1| hypothetical protein OsJ_21114 [Oryza sativa Japonica Group]
 dbj|BAF19397.2| Os06g0311300 [Oryza sativa Japonica Group]
Length=321

 Score =   145 bits (367),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 129/252 (51%), Gaps = 16/252 (6%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             G +  + +G+ +G +S   IDPDVLDC ICF SL  PL+QC+NGH+AC SC  KL NKC 
Sbjct  62    GPAEEMANGEVEGGLSVQ-IDPDVLDCSICFESLRPPLYQCQNGHVACFSCWSKLSNKCH  120

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRAC  666
              C+    F R  ALEK+VES+K  C    +GC + I Y +   HE  C+  P  CP   C
Sbjct  121   ICSRDAKFARNIALEKIVESIKSSCSYAKWGCCKFINYAQRDAHEEACLFAPSVCPISNC  180

Query  665   KFLGSSKEVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDP  489
              + G +     HF   H     R  +  P +++++ +  F+    +   +  + N+++ P
Sbjct  181   GYRGFTGRWSGHFLTSHSSDVMRFIYGQPFEVNIEVSVPFLVFLGEDDHLFLLQNNNLTP  240

Query  488   LGSAVNVICIAPGSSKRRFLYKLVA--RGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
              G A +V+C+  G+    F Y++ A  R + EN             ++L+A   N  +W 
Sbjct  241   FGHAFSVVCLRSGNLNWMFSYQIEATSRKKPEN------------RLQLKASVTNTRQWT  288

Query  314   PSAALKIFLLVP  279
                  + FLLVP
Sbjct  289   GIYPSEAFLLVP  300



>emb|CDM86649.1| unnamed protein product [Triticum aestivum]
Length=278

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 110/205 (54%), Gaps = 4/205 (2%)
 Frame = -2

Query  1001  GKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGF  822
             GK +   +   +D D+LDCP+CF+ L  P+FQC  GH  C+SC  KL +KC  C+ P  +
Sbjct  21    GKRRKVATDVTMDLDILDCPVCFLPLRPPIFQCTLGHAICSSCRDKLQDKCCLCSLPTVY  80

Query  821   NRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKE  642
             NRC  +E VVES+K+ C N+++GC   I Y +  DHE  C H PC CP   C F G +K 
Sbjct  81    NRCHMVENVVESIKLACSNSSHGCTARITYYQKEDHEKGCQHAPCFCPETGCSFSGPTKV  140

Query  641   VYTHFTNRH---VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVN  471
             +  HF   H      K + +    +I+L   Q    L    G  +F+VN  M+ LG  ++
Sbjct  141   LLEHFLGEHDWCYGEKDLRYGKTYRITLLGVQGPTVLMGNDGH-LFLVNMTMESLGGVIS  199

Query  470   VICIAPGSSKRRFLYKLVARGEEEN  396
             V C+ P  S  RF  +L     E++
Sbjct  200   VCCVEPHISASRFKCRLALLCGEQS  224



>gb|EEC80479.1| hypothetical protein OsI_22706 [Oryza sativa Indica Group]
Length=321

 Score =   145 bits (366),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 129/252 (51%), Gaps = 16/252 (6%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             G +  + +G+ +G +S   IDPDVLDC ICF SL  PL+QC+NGH+AC SC  KL NKC 
Sbjct  62    GPAEEMANGEVEGGLSVQ-IDPDVLDCSICFESLRPPLYQCQNGHVACFSCWSKLSNKCH  120

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRAC  666
              C+    F R  ALEK+VES+K  C    +GC + I Y +   HE  C+  P  CP   C
Sbjct  121   ICSRDAKFARNIALEKIVESIKSSCSYAKWGCCKFINYAQRDAHEEACLFAPSVCPISNC  180

Query  665   KFLGSSKEVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDP  489
              + G +     HF   H     R  +  P +++++ +  F+    +   +  + N+++ P
Sbjct  181   GYRGFTGRWSGHFLTSHSSDVVRFIYGQPFEVNIEVSVPFLVFLGEDDHLFLLQNNNLTP  240

Query  488   LGSAVNVICIAPGSSKRRFLYKLVA--RGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
              G A +V+C+  G+    F Y++ A  R + EN             ++L+A   N  +W 
Sbjct  241   FGHAFSVVCLRSGNLNWMFSYQIEATSRKKPEN------------RLQLKASVTNTRQWT  288

Query  314   PSAALKIFLLVP  279
                  + FLLVP
Sbjct  289   GIYPSEAFLLVP  300



>emb|CDX96140.1| BnaA07g25910D [Brassica napus]
Length=349

 Score =   145 bits (367),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 97/168 (58%), Gaps = 1/168 (1%)
 Frame = -2

Query  947  CPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCP  768
            CP+CF +LT  +FQC+NGHIAC+SCC +L NKCP+CA PIG NRCR +E+VVES+ VPCP
Sbjct  57   CPVCFQALTQHVFQCDNGHIACSSCCRELRNKCPACALPIGNNRCRIMERVVESVTVPCP  116

Query  767  NNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ-AKRITF  591
            N  +GC E   Y K   HE  C    C CP   C + G  K++YTH+   H   + R   
Sbjct  117  NAKHGCTEKFSYGKELAHEKECRFALCYCPAPDCNYAGVYKDLYTHYDANHKDTSTRFVC  176

Query  590  NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGS  447
             +  +  L        LQE   G + VV   +   G +V V CIAP +
Sbjct  177  GTLHRTYLGTVSTTSVLQEYRDGPLVVVQGFVVAHGLSVTVNCIAPSA  224



>ref|XP_010511491.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 2 [Camelina 
sativa]
Length=345

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 106/193 (55%), Gaps = 4/193 (2%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            L D  +LDCP+C  +LT P+F+C++GHIAC+SCC K   KC +C+ PIG  RCR +E++V
Sbjct  104  LFDLHLLDCPVCSNALTAPIFECDSGHIACSSCCKKQRYKCTACSLPIGNYRCRIMERLV  163

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF-TNRH  615
            E++ +PCPN  +GC E   Y K   H+  CI  PC CP   C + G  K++Y+H+ TN  
Sbjct  164  EAIFIPCPNAKHGCREMFYYGKKLVHQKECIFAPCYCPALGCNYSGLYKDLYSHYETNHK  223

Query  614  VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI---APGSS  444
               K           +  + + + LQE   G + V+     P G +V V CI   APG  
Sbjct  224  CGKKHFRSRHDADAWVHVDDKILVLQEYRDGPLVVIQCFQKPEGVSVTVNCIAPSAPGVG  283

Query  443  KRRFLYKLVARGE  405
            +  FL      GE
Sbjct  284  EFSFLLSYSREGE  296


 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S TL+D D+  CP+C  SLTIP+F+C+NGHIAC+SCC K+ N CP C   IG  RC  +E
Sbjct  32   SGTLVDLDLFYCPVCSDSLTIPIFRCDNGHIACSSCCTKMKNVCPDCGDSIGDFRCLIME  91

Query  800  KVVESLKV  777
            K++E+  V
Sbjct  92   KILEAFDV  99



>emb|CDX99687.1| BnaC04g34440D [Brassica napus]
Length=283

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 145/268 (54%), Gaps = 18/268 (7%)
 Frame = -2

Query  1016  NGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCA  837
             + V SG G    S  L+D D+LDCPICF  LTIP+FQC+NGH+AC+SCC KL NKCP+CA
Sbjct  27    SSVSSGDGAKKRSLMLLDSDLLDCPICFEPLTIPIFQCDNGHLACSSCCPKLSNKCPACA  86

Query  836   SPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFL  657
             SPIG  RCRA+E V+ES+ +PCPN   GC +++ Y K   H   C  + CSCP   C++ 
Sbjct  87    SPIGDKRCRAMENVLESIFIPCPNAKMGCTKNVSYGKESTHLIQCSFSLCSCPVVNCRYA  146

Query  656   GSSKEVYTHFTNRHVQAK-RITFNSPRQISLKKN--QRFIYLQEKTGGVVFVVNHHMDPL  486
             GS K +  H+   H  ++    F      S++ N   + + L E    ++F V    +  
Sbjct  147   GSYKNLSDHYCLTHPDSECSDCFICGLSFSVQTNISDKILVLWEYKKHLLFTVECFEETY  206

Query  485   GSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPS  309
             G  V V CIAP + +   F Y L             G      S +++ V + +    P 
Sbjct  207   GVNVAVSCIAPCAPEVGEFSYNLSYT--------VNGHTVTYESPEVKRVLQ-VSGQTPQ  257

Query  308   AALKIFLLVPGNVISDSWDHLKLEVCIK  225
             A    F+L+P +++    D LK+++CIK
Sbjct  258   AN---FMLIPHSLLRG--DLLKMKLCIK  280



>emb|CDM80812.1| unnamed protein product [Triticum aestivum]
Length=307

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 105/179 (59%), Gaps = 3/179 (2%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINK--CPSCASPIGFNRCRALEK  798
            +IDP+VLDC ICF  L  P+FQC  GH+ C+ C  KLINK  C +C+ P G+NRC ALEK
Sbjct  14   IIDPEVLDCTICFDPLQPPVFQCAVGHVICSPCQGKLINKENCNTCSLPGGYNRCYALEK  73

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            ++ESL++PC N  YGC     Y+++ DH  +C H PC CP   C F GS+  +  H T  
Sbjct  74   ILESLRIPCANAAYGCTVKTHYHEVEDHGKSCPHAPCFCPEPGCNFAGSTVALLAHLTGG  133

Query  617  HVQ-AKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSS  444
            H+  +  + +N    + +K     ++ ++++   +        P GSA +V+C+ P ++
Sbjct  134  HMWPSTELEYNVKLTLEVKAGVHVLHRRDRSPFFLVKFTPAPPPYGSAASVLCVDPDAT  192



>ref|XP_009140166.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Brassica 
rapa]
Length=284

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 129/249 (52%), Gaps = 26/249 (10%)
 Frame = -2

Query  947  CPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCP  768
            CPIC+  LT+P+FQC+NGH+AC+SCC KL NKC +CASPIG  RCRA+E V+ES+  PCP
Sbjct  51   CPICYEPLTVPIFQCDNGHLACSSCCPKLSNKCHACASPIGDKRCRAMENVLESIFTPCP  110

Query  767  NNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAK-----  603
            N   GC +++ Y K   H   C  + CSCP   C++ GS K +  H+   H  ++     
Sbjct  111  NAKMGCTKNVSYGKESTHLKQCSFSLCSCPVVNCRYAGSYKNLSDHYCLTHPDSECSDCF  170

Query  602  --RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSK-RRF  432
               ++F     IS     + + L E    ++F V    +P G  V V CIAP + +   F
Sbjct  171  ICGLSFTVQTNIS----DKILVLWEYKKHLLFTVECFAEPYGVNVAVSCIAPCAPEVGEF  226

Query  431  LYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWD  252
             Y L    +      +    ++   +  +   EN            F+L+P +++    D
Sbjct  227  SYNLSYTVDGHTVTYESPDVKRVLQVSGQTPQEN------------FMLIPNSLLRG--D  272

Query  251  HLKLEVCIK  225
             LK+++CIK
Sbjct  273  LLKMKLCIK  281



>ref|XP_002442006.1| hypothetical protein SORBIDRAFT_08g006830 [Sorghum bicolor]
 gb|EES15844.1| hypothetical protein SORBIDRAFT_08g006830 [Sorghum bicolor]
Length=326

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 134/266 (50%), Gaps = 15/266 (6%)
 Frame = -2

Query  1010  VMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASP  831
             V+ G+  G   +  IDPDVLDC ICF  L  PL+QC+NGH+ C SC  +L NKC  C+  
Sbjct  72    VVGGEADGI--SVRIDPDVLDCSICFEPLQPPLYQCQNGHVVCFSCWSRLTNKCHICSHD  129

Query  830   IGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGS  651
               F    ALEKVVES+K  C    +GC + + Y     HE +C++ P  CP   C++ G 
Sbjct  130   ANFVPNIALEKVVESVKSYCSYAKWGCNKLVSYACRNAHEESCLYAPSVCPIPGCEYRGF  189

Query  650   SKEVYTHF-TNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAV  474
             +     HF TN +      ++    ++SL+ +  F+ L  +   +   +N ++ P G A+
Sbjct  190   TGWWSGHFLTNHNNDGLCFSYGQCFEVSLEMSVPFLVLLAEDDHLFIFINKNVIPFGHAL  249

Query  473   NVICIAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKI  294
             +V C+  G+    F Y++ A            +G    S++L+A   N  +W   +  + 
Sbjct  250   SVCCLRNGNLNGNFFYEMRAT----------SNGNTENSLQLKASVTNTREWQGLSPTEA  299

Query  293   FLLVPGNVISDSWDHLKLEVCIKDLA  216
             FLLVP   I  S   L L V I+ +A
Sbjct  300   FLLVPYAFIKSS--KLTLNVSIERVA  323



>ref|XP_006285250.1| hypothetical protein CARUB_v10006614mg [Capsella rubella]
 gb|EOA18148.1| hypothetical protein CARUB_v10006614mg [Capsella rubella]
Length=262

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 134/258 (52%), Gaps = 22/258 (9%)
 Frame = -2

Query  971  LIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVV  792
            ++D DVLDCP+CF   TIP+ QC NGH AC+SC  KL  KC SC+  IG  RCRA+E V+
Sbjct  17   MLDYDVLDCPVCFEPPTIPILQCGNGHWACSSCLPKL-KKCHSCSLTIGRIRCRAMESVL  75

Query  791  ESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHV  612
            ES+ +PCPN  +GC +++ Y K   H   CI + CSCP + C + GS K +Y H    H 
Sbjct  76   ESILIPCPNAMFGCTKNLSYGKQSTHVKDCIFSQCSCPFQECNYSGSYKNLYDHSFQSHS  135

Query  611  QAK------RITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
             +        I  +   ++ LK + + +  +E    ++FVV    +P    V V C+AP 
Sbjct  136  SSYPFPWIPHIACDISFRVLLKISNKILVAKEFLKKLLFVVQCFKEPNVLRVTVSCLAPS  195

Query  449  SSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPGN  273
            + +  RF Y L    + E    +    ++   +  +   E+            F+L+P  
Sbjct  196  APEVGRFSYHLSYTVDGETVTYESPEVKRILKVSSQRPEES------------FMLIPEC  243

Query  272  VISDSWDHLKLEVCIKDL  219
            ++    D+L +++CIK L
Sbjct  244  LLRG--DYLDMKLCIKKL  259



>dbj|BAD61768.1| SIAH1 protein-like [Oryza sativa Japonica Group]
Length=577

 Score =   146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/252 (34%), Positives = 129/252 (51%), Gaps = 16/252 (6%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             G +  + +G+ +G +S   IDPDVLDC ICF SL  PL+QC+NGH+AC SC  KL NKC 
Sbjct  62    GPAEEMANGEVEGGLSVQ-IDPDVLDCSICFESLRPPLYQCQNGHVACFSCWSKLSNKCH  120

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRAC  666
              C+    F R  ALEK+VES+K  C    +GC + I Y +   HE  C+  P  CP   C
Sbjct  121   ICSRDAKFARNIALEKIVESIKSSCSYAKWGCCKFINYAQRDAHEEACLFAPSVCPISNC  180

Query  665   KFLGSSKEVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDP  489
              + G +     HF   H     R  +  P +++++ +  F+    +   +  + N+++ P
Sbjct  181   GYRGFTGRWSGHFLTSHSSDVMRFIYGQPFEVNIEVSVPFLVFLGEDDHLFLLQNNNLTP  240

Query  488   LGSAVNVICIAPGSSKRRFLYKLVA--RGEEENCGCKGGSGEKTTSIKLEAVAENIPKWD  315
              G A +V+C+  G+    F Y++ A  R + EN             ++L+A   N  +W 
Sbjct  241   FGHAFSVVCLRSGNLNWMFSYQIEATSRKKPEN------------RLQLKASVTNTRQWT  288

Query  314   PSAALKIFLLVP  279
                  + FLLVP
Sbjct  289   GIYPSEAFLLVP  300



>gb|KEH28223.1| seven in absentia family protein [Medicago truncatula]
Length=315

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 125/232 (54%), Gaps = 18/232 (8%)
 Frame = -2

Query  908  QCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYN  729
            QC+NGHI C++C  KL NKC +C+ PI    C+A E ++ S+++ CPN  +GC E I Y 
Sbjct  23   QCDNGHIVCSTCSTKLRNKCHNCSLPISSKHCKAAENLLLSIEMSCPNAKHGCNEKISYI  82

Query  728  KLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAK-RITFNSPRQISLKKNQR  552
              R HE  CIH PC CP  +C F+ SS+ +Y HF+N+    + +  +     +SLK N +
Sbjct  83   GKRRHEKECIHAPCYCPVPSCHFVASSEVLYKHFSNKQRDTQIKFFYGHSFIVSLKSNDQ  142

Query  551  FIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSG  372
             I  QE   G +F +++    +G+AVN+  I P   +  + Y ++AR E     CK    
Sbjct  143  TIVFQEAGYGKLFDLSNKTMQMGNAVNICGIGPNFYESEYSYDILARSEM----CK----  194

Query  371  EKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKDLA  216
                 +KL++  ++  +   +     FL++P      S + LKLE+CI  + 
Sbjct  195  -----LKLQSFGKDFQRVTSANLSSEFLVIPFG----SSEPLKLEICIASIT  237



>ref|XP_003559018.1| PREDICTED: putative E3 ubiquitin-protein ligase SINA-like 9 isoform 
X1 [Brachypodium distachyon]
Length=329

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 126/257 (49%), Gaps = 16/257 (6%)
 Frame = -2

Query  995  GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNR  816
            G G IS   ID D+LDC ICF  L+ PL+QC+NGH+AC SC  +L NKC  C+    F R
Sbjct  80   GTGGISMR-IDTDLLDCSICFEPLSPPLYQCQNGHVACFSCWSRLSNKCHVCSHDAIFAR  138

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
              ALEK+VES+K  C    +GC + + Y +   HE  C+  P +CP   C + G +    
Sbjct  139  NIALEKIVESIKSSCAYAKWGCSKLVSYAQRSVHEEACLFAPSTCPIPGCGYRGFTGCWS  198

Query  635  THFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI  459
             HF   H       T+    +++L  +  F+ L  +   +  ++N +M P G A  V+C+
Sbjct  199  GHFLVDHSADCLHFTYGQSFEVNLAVSLPFLVLLGEDDHLFLLLNKNMMPFGHAFTVVCL  258

Query  458  APGSSKRRFLYKLVA--RGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLL  285
              G+    F Y++ A  RG   NC            ++L+A   N  +W      + FLL
Sbjct  259  RNGNLNWNFSYEIEAASRGNPGNC------------LRLKASVTNTKEWGGLHPAEAFLL  306

Query  284  VPGNVISDSWDHLKLEV  234
            VP    S +   L + V
Sbjct  307  VPYAFCSSANQTLSVSV  323



>gb|KFK41067.1| hypothetical protein AALP_AA2G081300 [Arabis alpina]
Length=321

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 110/214 (51%), Gaps = 5/214 (2%)
 Frame = -2

Query  1025  GVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCP  846
             GV+      +    +    I  ++L+CP+CF +LTIP FQC+N HIAC+SCC KL NKCP
Sbjct  27    GVTVSANRNRDGSEVITMEIPRNLLECPVCFHALTIPTFQCDNRHIACSSCCTKLSNKCP  86

Query  845   SCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRAC  666
             +C  P G  RCR  E +VE+  VPCPN   GC E   Y K   HE  C    C CP   C
Sbjct  87    TCKVPTGKIRCRFAESIVEANIVPCPNAILGCTEKFPYGKELAHEEKCAFALCYCPEPNC  146

Query  665   KFLGSSKEVYTHFTNRHVQAKRITF--NSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMD  492
              + G  +++Y+H+   H Q K   F   + R   L  + +   +QE   G + VV +   
Sbjct  147   NYTGKYQDLYSHYYANH-QRKWDYFYCGTSRTTFLYNSMKNEVIQEYREGPLVVVQYFKV  205

Query  491   PLGSAVNVICIAP-GSSKRRFLYKL-VARGEEEN  396
               G  V V CIAP  S   +F Y +  +RG   N
Sbjct  206   EQGVHVTVNCIAPCASGVGKFSYHISYSRGHHTN  239



>ref|XP_006286814.1| hypothetical protein CARUB_v10003728mg [Capsella rubella]
 gb|EOA19712.1| hypothetical protein CARUB_v10003728mg [Capsella rubella]
Length=276

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 132/262 (50%), Gaps = 24/262 (9%)
 Frame = -2

Query  977  ATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEK  798
            +T+++ D+LDCPIC    TIP+FQC+NGH+ACASCC KL+NKCP+CA PIG  RCRA+E 
Sbjct  28   STILNLDLLDCPICVEPFTIPIFQCDNGHLACASCCPKLMNKCPACALPIGNFRCRAMEN  87

Query  797  VVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNR  618
            V+ES+ VPCPN   GC ++I Y     H   C  + C CP   C + G+  ++Y H  + 
Sbjct  88   VLESISVPCPNAKLGCTKNITYGTESTHVKECPLSLCMCPVPKCDYQGTYNDLYGHL-DS  146

Query  617  HVQAKRITFNSPRQISLKKNQRFIYLQEKT--------GGVVFVVNHHMDPLGSAVNVIC  462
            H+      +  P  +  K    ++ L E           G++F V+      G  V V  
Sbjct  147  HILDNIGKYYFPFALG-KVLGVYVDLNETALTVMKGNKEGLLFAVHCVSKANGVYVTVGY  205

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            IAP S              E +C       ++T + K   V +NI K       + F+LV
Sbjct  206  IAPCSMDVG----------EFSCDISTTVEQRTIAFKSMKV-KNIQKLSSKIPREDFMLV  254

Query  281  PGNVISD-SWDHLKLEVCIKDL  219
            P   +S   W    L++C+  L
Sbjct  255  PSYFMSGRRW--FMLKICVTKL  274



>ref|XP_006289541.1| hypothetical protein CARUB_v10003085mg [Capsella rubella]
 gb|EOA22439.1| hypothetical protein CARUB_v10003085mg [Capsella rubella]
Length=234

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 116/237 (49%), Gaps = 21/237 (9%)
 Frame = -2

Query  1028  DGVSNGVMSGK--GKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLIN  855
             +GVSN  M  K   K +    ++D DVLDCP+CF  LTIP+FQCENGH+AC+SCC KL  
Sbjct  9     NGVSNINMRKKQRNKDNKRTAILDFDVLDCPVCFEPLTIPIFQCENGHLACSSCCPKLSK  68

Query  854   KCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPN  675
              C +C  PIG  RCR +E V+ S+ +PCPN  +GC +   Y     HE  C+ + CSCP 
Sbjct  69    MCHACDLPIGHIRCRLMESVLSSISIPCPNAKFGCFDIFSYELESTHEKECLFSQCSCPA  128

Query  674   RACKFLGSSKEVYTHFTNRHVQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHM  495
               C + GS +                  N    I +   ++     + +  ++FVV    
Sbjct  129   LDCVYTGSYR------------------NKSSTIRMNIKKKIKIKVDSSKKLLFVVQCFR  170

Query  494   DPLGSAVNVICIAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENI  327
             +P G  V V CIAP + +  +F Y L    +      K    ++   +  +   EN 
Sbjct  171   EPYGVCVTVSCIAPSAPEIGKFSYHLSYTVDGHTMTYKSPDIKRVLEVSFQTPLENF  227



>ref|XP_006302255.1| hypothetical protein CARUB_v10020292mg, partial [Capsella rubella]
 gb|EOA35153.1| hypothetical protein CARUB_v10020292mg, partial [Capsella rubella]
Length=449

 Score =   142 bits (357),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 131/265 (49%), Gaps = 17/265 (6%)
 Frame = -2

Query  995  GKGSI---SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
            G+G +   S  L + ++L+CP+C  +LT  +FQC+N HIAC+SCC KL + CPSC  PIG
Sbjct  143  GEGDVVVRSGKLFELNLLNCPVCSDALTGLIFQCDNEHIACSSCCTKLRHICPSCTLPIG  202

Query  824  FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
              RCR +E+VV+++ VPCPN  +GC E+  Y K   HE  C    C CP   C + G  K
Sbjct  203  IYRCRIMEEVVKAVIVPCPNAKHGCTETFSYGKELIHEKKCSFALCYCPASNCNYSGVYK  262

Query  644  EVYTHFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
            ++Y+H+   H    KR ++       L  +   +  QE   G + VV    +P G  +  
Sbjct  263  DLYSHYAANHKNIYKRFSYGYSHHACLGIDCNIVVFQEYGDGPLVVVQCFKEPQGVFLTA  322

Query  467  ICIAPGSSKRRFL-YKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIF  291
             CIAP +     L Y L              +  KT + K  +    I K       K F
Sbjct  323  NCIAPSAPGVGNLSYDL-----------SYSTAGKTVTFK-SSEMNRIQKVSFQTPEKDF  370

Query  290  LLVPGNVISDSWDHLKLEVCIKDLA  216
            +++P  ++S       + +CI++L 
Sbjct  371  MIIPDYLLSRVGLLKSIRICIRNLG  395


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  974  TLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKV  795
            TL + D+L+CP C  SLT P+FQC+NGHIAC+SCC K  N+C SC  PIG  R R +E+V
Sbjct  43   TLFELDLLECPSCCHSLTSPIFQCDNGHIACSSCCAKTRNECLSCKLPIGKYRSRIMERV  102

Query  794  VESLKVPCPN  765
            VE++ VP P+
Sbjct  103  VEAVIVPLPS  112



>ref|XP_006301282.1| hypothetical protein CARUB_v10021683mg [Capsella rubella]
 gb|EOA34180.1| hypothetical protein CARUB_v10021683mg [Capsella rubella]
Length=309

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 106/204 (52%), Gaps = 3/204 (1%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             SG    + S TL   D+LDCPICF  L  P+FQC NGHIAC +CC KL+NKCPSC  P+G
Sbjct  50    SGDDVIARSGTLFALDLLDCPICFNPLATPIFQCVNGHIACCTCCAKLMNKCPSCTLPLG  109

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSK  645
               RC  LEKVVE++ VPC N  +GC E + Y K   HE  C      CP   C +     
Sbjct  110   NYRCLILEKVVEAVIVPCGNAKHGCLEKLSYCKKLAHEKVCDSYVLHCPAPECNYSAFHL  169

Query  644   EVYTHFTNRH-VQAKRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNV  468
             ++Y H+T+ H   + R          +   ++ + LQE     +F++   M   G  V V
Sbjct  170   DLYRHYTSCHKASSSRFRCGQYDDALINIREQVLVLQEYDDLPLFILQSFMGAHGVHVAV  229

Query  467   ICIAPGSSKRRFL-YKLV-ARGEE  402
               +AP +     L Y L+  RG E
Sbjct  230   NVLAPSAQGLWELGYDLIYQRGNE  253



>ref|XP_010436734.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 7 [Camelina 
sativa]
Length=248

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 2/137 (1%)
 Frame = -2

Query  1031  VDGVSNGVMSGKGK--GSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLI  858
             V+G SN  +  K +        + D DVLDCP+C   LTIP+FQC+NGH+AC+SCC KL 
Sbjct  8     VNGSSNISLQKKQRTEDKTRPAMFDFDVLDCPLCCEPLTIPIFQCDNGHLACSSCCPKLS  67

Query  857   NKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCP  678
             NKCPSCA  +G NRCRA+E V+ES+ +PC N T+GC   I Y K   HE  C  T CSCP
Sbjct  68    NKCPSCALRVGNNRCRAMESVLESIYIPCRNATFGCALKISYGKDTTHEEECAFTQCSCP  127

Query  677   NRACKFLGSSKEVYTHF  627
                  +  S + +Y H+
Sbjct  128   IEDYNYTCSYRNLYAHY  144



>ref|XP_003616137.1| Ubiquitin [Medicago truncatula]
Length=1337

 Score =   142 bits (359),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/228 (35%), Positives = 124/228 (54%), Gaps = 18/228 (8%)
 Frame = -2

Query  908  QCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLKVPCPNNTYGCEESIKYN  729
            QC+NGHI C++C  KL NKC +C+ PI    C+A E ++ S+++ CPN  +GC E I Y 
Sbjct  23   QCDNGHIVCSTCSTKLRNKCHNCSLPISSKHCKAAENLLLSIEMSCPNAKHGCNEKISYI  82

Query  728  KLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAK-RITFNSPRQISLKKNQR  552
              R HE  CIH PC CP  +C F+ SS+ +Y HF+N+    + +  +     +SLK N +
Sbjct  83   GKRRHEKECIHAPCYCPVPSCHFVASSEVLYKHFSNKQRDTQIKFFYGHSFIVSLKSNDQ  142

Query  551  FIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRFLYKLVARGEEENCGCKGGSG  372
             I  QE   G +F +++    +G+AVN+  I P   +  + Y ++AR E     CK    
Sbjct  143  TIVFQEAGYGKLFDLSNKTMQMGNAVNICGIGPNFYESEYSYDILARSE----MCK----  194

Query  371  EKTTSIKLEAVAENIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCI  228
                 +KL++  ++  +   +     FL++P      S + LKLE+CI
Sbjct  195  -----LKLQSFGKDFQRVTSANLSSEFLVIPFG----SSEPLKLEICI  233



>ref|XP_006403041.1| hypothetical protein EUTSA_v10006392mg [Eutrema salsugineum]
 gb|ESQ44494.1| hypothetical protein EUTSA_v10006392mg [Eutrema salsugineum]
Length=284

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 133/259 (51%), Gaps = 21/259 (8%)
 Frame = -2

Query  992  KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRC  813
            K + +ATL+D DV+DCP+CF +LTIP++QC+NGH+ C +C  KL  KC +C+  IG +R 
Sbjct  38   KKNRTATLLDLDVIDCPVCFNTLTIPIYQCDNGHVICYTCHKKLRKKCATCSLHIG-SRN  96

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYT  633
            RA+E+V++ L+VPCPN+ +GC +++ Y++   H   C  T   CP   C F GS +++Y 
Sbjct  97   RAMEQVLQHLRVPCPNSEFGCPKNVTYDERSRHLQQCDFTQGPCPFNRCNFTGSYEDIYV  156

Query  632  HFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGG--VVFVVNHHMDPLGSAVNVIC  462
            H    H+++       +P  I  +  +R +  ++ T G   + VV     P G  +   C
Sbjct  157  HTNAEHLKSLDMFECGNPVFIHPESGERVVLKEQTTEGGRKLVVVECFTTPQGRIIYAYC  216

Query  461  IAPGSSK-RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLL  285
            I P   +   F Y L       +  C   S ++   +  E   E+            F+ 
Sbjct  217  IGPMVPRTHEFSYSLKLYSSNGDRLCFESSLKQVRQVSGEQPDEH------------FMF  264

Query  284  VPGNVISDSWDHLKLEVCI  228
            VP ++  D     KL +CI
Sbjct  265  VPSHMCPD----YKLHICI  279



>ref|XP_006405815.1| hypothetical protein EUTSA_v10028270mg [Eutrema salsugineum]
 gb|ESQ47268.1| hypothetical protein EUTSA_v10028270mg [Eutrema salsugineum]
Length=270

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 105/182 (58%), Gaps = 4/182 (2%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            SA L+D + L+CPIC   LT  ++QC++GHIAC+ CC +L N CP C  PIG   C A+E
Sbjct  22   SAKLLDLEALNCPICRDPLTTSIYQCDSGHIACSICCEELGNICPYCDFPIGQIHCSAME  81

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHF--  627
            +V++S+ VPCPN   GC +S  Y     H+  CI + C CP   C + GS K++Y+HF  
Sbjct  82   RVLQSVLVPCPNAKLGCTKSFSYGTELTHKRECIFSRCYCPAENCDYSGSYKDLYSHFGI  141

Query  626  -TNRHVQAKRITFNSPRQISLKKNQRF-IYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
               R        F+ P +I  + ++   + ++E   G++FVV+   +P G  V V  IAP
Sbjct  142  HKGRGRYNYLFLFDQPAEIYFELSEYTSVVMKENKNGLLFVVHCFREPHGIYVTVNFIAP  201

Query  452  GS  447
             +
Sbjct  202  SA  203



>gb|KFK29798.1| hypothetical protein AALP_AA7G181000 [Arabis alpina]
Length=346

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 130/258 (50%), Gaps = 16/258 (6%)
 Frame = -2

Query  992  KGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRC  813
            K S SA L   +VLDCP C+  L  P++QC+NGHIAC+SCC KL   C  C + IG  RC
Sbjct  93   KSSQSAKLQSTEVLDCPTCYEPLQKPIYQCKNGHIACSSCCKKLNKICSFCRAHIGDIRC  152

Query  812  RALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYT  633
            RA+EKV+E+  VPCPN  YGC+ +  Y     H+  C+   CSCP   C ++GS K + +
Sbjct  153  RAMEKVIEAAIVPCPNEKYGCKVTTMYCDQSSHKKVCLFIRCSCPVPNCDYVGSYKNLRS  212

Query  632  HFTNRHVQAKRITFNSPRQISLKKN---QRFIYLQEKTGGVVFVVNHHMDPLGSAVNVIC  462
            H  + H   + + F   R +    +    + + L+E+  G + VV       G  V V  
Sbjct  213  HAGDAHPWNEGVVFGIDRPLMFNMDLDKYKTVVLKEEKEGDLIVVQAFKGSKGVYVTVKR  272

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            IAP +   R     +A+  + +    G   +K   ++ +   E+   W           +
Sbjct  273  IAPMTPSLRDFSCSLAKLNQYSTLRIGMMVKKIQKVREQMHPEDNVMW-----------I  321

Query  281  PGNVISDSWDHLKLEVCI  228
            P N+++ S+   K+++CI
Sbjct  322  PPNMLNHSY--WKMQICI  337



>ref|XP_006284296.1| hypothetical protein CARUB_v10005465mg [Capsella rubella]
 gb|EOA17194.1| hypothetical protein CARUB_v10005465mg [Capsella rubella]
Length=276

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 128/259 (49%), Gaps = 20/259 (8%)
 Frame = -2

Query  974  TLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKV  795
              ID DVL+CPIC+  L IP+FQC+ GH+AC  C  KL  KCP CA PIG  RC+A+E V
Sbjct  16   VFIDLDVLNCPICYEPLAIPVFQCDMGHVACHVCWPKLKRKCPICALPIGNKRCKAMESV  75

Query  794  VESLKVPCPNNTYGCEESIKYNKLRDHE-PTCIHTPCSCPN--RACKFLGSSKEVYTHFT  624
            + S  VPCPN   GC +S+ Y    DHE   C    CSCP     C + GS  ++  H+ 
Sbjct  76   LRSFNVPCPNAHLGCTKSVPYGGDSDHEKKYCRFAICSCPEIVNECSYTGSLDDLLGHYI  135

Query  623  NRHVQAKR---ITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAP  453
              H Q K      F  PR + +  N +   +      ++F V    +P G  V V CIAP
Sbjct  136  THH-QLKEGCLFIFGMPRTVRMPINDKVFVITILRRILMFAVQCFREPSGVYVAVNCIAP  194

Query  452  GSSKR-RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVPG  276
             + +  +F Y++        C C   S E    ++   V+   P+ D        + VP 
Sbjct  195  LAPEVGKFSYRISYSSNGRIC-CSHKSLEMKRVLR---VSSQTPQDDDC------MFVPN  244

Query  275  NVISDSWDHLKLEVCIKDL  219
             ++    + L++E+CI ++
Sbjct  245  RLLRG--EVLEMELCISEV  261



>ref|XP_006300896.1| hypothetical protein CARUB_v10021270mg [Capsella rubella]
 gb|EOA33794.1| hypothetical protein CARUB_v10021270mg [Capsella rubella]
Length=294

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 132/277 (48%), Gaps = 37/277 (13%)
 Frame = -2

Query  1004  SGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIG  825
             SG    + +  L D D+L+CPIC   L  P+FQC NGHI C+ C IK+ NKCPSC+  IG
Sbjct  9     SGDDMSARTGMLSDLDLLECPICCNQLASPIFQCMNGHIICSGCKIKVKNKCPSCSKFIG  68

Query  824   FNRCRALEKVVESLKVPCPNNTYGCEESIKYNK-LRDHEPTCIHTPCSCPNRACKFLGSS  648
              NR R  E+++E++  PC N  YGC + + Y K L DHE  C  T C CP   C F G  
Sbjct  69    NNRSRITERLLEAVFFPCRNAGYGCTKKLSYGKELVDHEKECNDTVCYCPEPYCPFAGFD  128

Query  647   KEVYTHFTNRH---VQAKRITFNSPRQISLKK--NQRFIYLQEKTGGVVFVVN--HHMDP  489
             K +Y HF   H     A R+       + ++   NQ  I LQE   G + ++      D 
Sbjct  129   KSLYHHFNVCHKDCTYASRLRSGQHVDVYVQVNINQAMIVLQEDHHGPLVILQSFRKADG  188

Query  488   LGSAVNVIC-IAPGSSK-------RRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAE  333
             L   VN++   APG  K       RR   K +   +E N         +   +  EA   
Sbjct  189   LAVIVNLLAPSAPGDVKLGCNLFYRRGQVKFMYDSDEMN---------RIQKVSFEAPRS  239

Query  332   NIPKWDPSAALKIFLLVPGNVISDSWDHLKLEVCIKD  222
             N            +L +P  V+ +S+  +K+E+ I++
Sbjct  240   N------------YLSIPYEVLDESFVFMKMEIRIRE  264



>ref|XP_010435714.1| PREDICTED: E3 ubiquitin-protein ligase SINA-like 10 [Camelina 
sativa]
Length=196

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = -2

Query  1028  DGVSNGVMSGKGKGSISATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKC  849
             D V N ++  K     S TL+D DVL+CPIC   L IP++QC NGHIAC SC  K+ + C
Sbjct  28    DKVKN-MLRNKSYARTSVTLLDQDVLECPICCEPLKIPIYQCTNGHIACTSCWTKVKSIC  86

Query  848   PSCASPIGFN-RCRALEKVVESLKVPCPNNTYGCEE-SIKYNKLRDHEPTCIHTPCSCPN  675
             PSC   +    RCRA+EKV+E+  VPCPN  YGC+E +I Y  L  HE  C+    SCP 
Sbjct  87    PSCQQSVRKQFRCRAMEKVIEAAIVPCPNANYGCKEINISYTHLSSHEKLCLFAKYSCPV  146

Query  674   RACKFLGSSKEVYTHFTNRH  615
             R C + GSSK++Y H    H
Sbjct  147   RNCNYTGSSKDLYNHVCANH  166



>ref|XP_010660351.1| PREDICTED: uncharacterized protein LOC100263780 isoform X3 [Vitis 
vinifera]
Length=630

 Score =   137 bits (346),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 114/197 (58%), Gaps = 15/197 (8%)
 Frame = -2

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C  +E VVES++  C N  YGC+E++ Y K  +HE TC + PC+CP   C F+GSS+++ 
Sbjct  430  CGDIEVVVESVRKACQNKEYGCKETLDYMKKSEHEETCSYAPCTCPLLECDFVGSSEQLS  489

Query  635  THFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI  459
             HF+++H  + +R  +N P+ ISL  N+ F+ LQ +  G++F++N  ++ +G+ + + CI
Sbjct  490  LHFSSKHWDSGRRFRYNCPQAISLGMNEPFLVLQAEEDGILFLLNKGIEAIGNTIMITCI  549

Query  458  APGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
             P SSK  FLY LV             SG   +S++L++  +N P          FLL+P
Sbjct  550  KPSSSKETFLYDLV-------------SGRGISSLRLKSFTQNFPGRVEGFPPVDFLLIP  596

Query  278  GNVISDSWDHLKLEVCI  228
               ++ S   L +EVCI
Sbjct  597  FRFLNSS-RQLNVEVCI  612



>ref|XP_010660347.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660348.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660349.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660350.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
Length=635

 Score =   137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 114/197 (58%), Gaps = 15/197 (8%)
 Frame = -2

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C  +E VVES++  C N  YGC+E++ Y K  +HE TC + PC+CP   C F+GSS+++ 
Sbjct  435  CGDIEVVVESVRKACQNKEYGCKETLDYMKKSEHEETCSYAPCTCPLLECDFVGSSEQLS  494

Query  635  THFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI  459
             HF+++H  + +R  +N P+ ISL  N+ F+ LQ +  G++F++N  ++ +G+ + + CI
Sbjct  495  LHFSSKHWDSGRRFRYNCPQAISLGMNEPFLVLQAEEDGILFLLNKGIEAIGNTIMITCI  554

Query  458  APGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
             P SSK  FLY LV             SG   +S++L++  +N P          FLL+P
Sbjct  555  KPSSSKETFLYDLV-------------SGRGISSLRLKSFTQNFPGRVEGFPPVDFLLIP  601

Query  278  GNVISDSWDHLKLEVCI  228
               ++ S   L +EVCI
Sbjct  602  FRFLNSS-RQLNVEVCI  617



>ref|XP_010660346.1| PREDICTED: uncharacterized protein LOC100263780 isoform X1 [Vitis 
vinifera]
Length=637

 Score =   137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 114/197 (58%), Gaps = 15/197 (8%)
 Frame = -2

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C  +E VVES++  C N  YGC+E++ Y K  +HE TC + PC+CP   C F+GSS+++ 
Sbjct  437  CGDIEVVVESVRKACQNKEYGCKETLDYMKKSEHEETCSYAPCTCPLLECDFVGSSEQLS  496

Query  635  THFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICI  459
             HF+++H  + +R  +N P+ ISL  N+ F+ LQ +  G++F++N  ++ +G+ + + CI
Sbjct  497  LHFSSKHWDSGRRFRYNCPQAISLGMNEPFLVLQAEEDGILFLLNKGIEAIGNTIMITCI  556

Query  458  APGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLVP  279
             P SSK  FLY LV             SG   +S++L++  +N P          FLL+P
Sbjct  557  KPSSSKETFLYDLV-------------SGRGISSLRLKSFTQNFPGRVEGFPPVDFLLIP  603

Query  278  GNVISDSWDHLKLEVCI  228
               ++ S   L +EVCI
Sbjct  604  FRFLNSS-RQLNVEVCI  619



>emb|CDY36211.1| BnaC06g27550D [Brassica napus]
Length=361

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 124/251 (49%), Gaps = 22/251 (9%)
 Frame = -2

Query  959  DVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLK  780
            ++LDCP C   L  P++QC NGHI C+ C  ++  +CP C  PIG  RCRA+E V+ES  
Sbjct  92   EILDCPTCLEPLRGPIYQCVNGHITCSPCLPRVYKQCPVCRIPIGNIRCRAMEMVIESSA  151

Query  779  VPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAKR  600
            VPC    YGC+E+  Y   + HE  C +  C CP   C + G+ KEV  H   +H     
Sbjct  152  VPCRYAIYGCKETTLYGD-QAHEKVCPYIRCQCPVTNCSYTGAYKEVEAHARLQHSWDVE  210

Query  599  ----ITFNSPR--QISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKR  438
                  FN+P+   I+L +  R ++ +EK G ++ V        G  V V  IAP S   
Sbjct  211  HLIPFVFNTPQIFSINLARTSRAVFQEEKEGDMIVVQTFKRTNGGVCVTVSHIAPLSLGL  270

Query  437  RFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKW-DPSAALKIFLLVPGNVISD  261
            R            N  C        T+++L  + + I K  +     + FL +P  ++SD
Sbjct  271  R------------NLSCSLAKLNAYTTLRLGVMVKKIQKLREQEEPREDFLFIPDYMLSD  318

Query  260  SWDHLKLEVCI  228
              +HLK+++C+
Sbjct  319  --NHLKMQICV  327



>ref|XP_006285302.1| hypothetical protein CARUB_v10006683mg [Capsella rubella]
 gb|EOA18200.1| hypothetical protein CARUB_v10006683mg [Capsella rubella]
Length=269

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 101/181 (56%), Gaps = 6/181 (3%)
 Frame = -2

Query  980  SATLIDPDVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALE  801
            S+T++  DVL C +CF  LT+P+FQC  GH+AC+SCC KL NKC +CA P G NRC A+E
Sbjct  27   SSTMMYLDVLHCHVCFKPLTVPIFQCGEGHLACSSCCPKLSNKCHACALPFGKNRCIAME  86

Query  800  KVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTN  621
            +V+ES+ VPCPN  YGC   + Y K + H   C    CSCP   C + G  K++Y HF +
Sbjct  87   RVLESMCVPCPNAKYGCTAKLSYWKKQSHVKECNFPRCSCPALGCDYTGPYKDLYQHFLD  146

Query  620  RHVQAKRITFNSPRQISLK---KNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPG  450
                     F   +   ++   K++  +  +E    ++F V    +     VNV  IAP 
Sbjct  147  TTTSG---VFTCGKYFDVRINIKDKVCVIKRECKERLLFAVQCFKETDDVCVNVSIIAPA  203

Query  449  S  447
            +
Sbjct  204  T  204



>ref|XP_006482158.1| PREDICTED: uncharacterized protein LOC102612380 [Citrus sinensis]
Length=620

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 121/207 (58%), Gaps = 16/207 (8%)
 Frame = -2

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C  +E VV+S++  C N  YGC E++ Y K  DHE TC++ PCSCP  +C F+GSS+++ 
Sbjct  426  CGDIESVVDSVRSVCRNREYGCNETVDYTKNNDHEETCMYAPCSCPLLSCNFVGSSEQLS  485

Query  635  THFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVF-VVNHHMDPLGSAVNVIC  462
             HF+++H  + +R  +N+P  ISL+ ++ F+ LQ +  GV+F ++   ++ +G+ V + C
Sbjct  486  LHFSSKHWDSGRRFRYNNPLSISLRIDEEFLVLQAEEDGVLFLLIKCVIENIGNTVMITC  545

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            I+P SSK ++LY LVA             G   + ++L+++ EN P          FLL+
Sbjct  546  ISPSSSKVKYLYDLVA-------------GRGISCLRLKSLTENFPGLVEGFPPMDFLLI  592

Query  281  PGNVISDSWDHLKLEVCIKDLA*DSMD  201
            P   +  S+  L LEVCI +    S+D
Sbjct  593  PSRFLG-SFGELNLEVCIWNSTEFSLD  618



>ref|XP_006391410.1| hypothetical protein EUTSA_v10018780mg [Eutrema salsugineum]
 gb|ESQ28696.1| hypothetical protein EUTSA_v10018780mg [Eutrema salsugineum]
Length=353

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 124/256 (48%), Gaps = 31/256 (12%)
 Frame = -2

Query  959  DVLDCPICFMSLTIPLFQCENGHIACASCCIKLINKCPSCASPIGFNRCRALEKVVESLK  780
            DVLDCP C   L  P++QC NGH+AC+SC  KL  KCP C   IG  RCRALE V+E+  
Sbjct  108  DVLDCPTCNEPLKRPIYQCTNGHLACSSCLHKLRKKCPFCRLDIGDIRCRALEIVLEASI  167

Query  779  VPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQAKR  600
            VPC N  +GC E+  Y+    HE  CI   CSCP   C ++GS  +V +H  + H     
Sbjct  168  VPCRNTVHGCTETTSYDTQSKHEKVCIFVRCSCPLPNCSYIGSYTDVESHTRSVHSWDSD  227

Query  599  ----ITFNSPRQISLK-KNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRR  435
                   +SP+  S+  + Q+    QE+  G + VV       G  + V  I+P +    
Sbjct  228  NFIPFVLDSPQIFSMNLRKQKTTVFQEEKKGDLIVVQAFKGSDGVYMTVSSISPLTPGL-  286

Query  434  FLYKLVARGEEENCGCKGGSGEKTTSIKL-------EAVAENIPKWDPSAALKIFLLVPG  276
                        N  C        T+++L       + V E + K D S     F+L+P 
Sbjct  287  -----------PNFSCSLAKLNSYTTLRLGLMVKKIQKVEEQLEKPDVS-----FMLIPT  330

Query  275  NVISDSWDHLKLEVCI  228
             ++S   DHLKL++CI
Sbjct  331  YMLSG--DHLKLQICI  344



>emb|CDM80859.1| unnamed protein product [Triticum aestivum]
Length=282

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 101/178 (57%), Gaps = 5/178 (3%)
 Frame = -2

Query  959  DVLDCPICFMSLTIPLFQCENGHIACASCCIKLI-NKCPSCASPIGFNRCRALEKVVESL  783
            D LDCP+CF  L  P++QC  GH  C+SC  KL+ N C  C++   F RC  +E+++ES+
Sbjct  31   DALDCPVCFHPLRPPIYQCSVGHFICSSCRPKLVRNNCHLCSAETTFKRCLGMERLMESV  90

Query  782  KVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVYTHFTNRHVQ-A  606
             VPC N  YGC E + Y +  +HE  C   PC CP  +C F G +  +  HF ++H    
Sbjct  91   MVPCSNAKYGCAEKLTYYQEEEHEKACPSAPCFCPASSCSFAGPTDALLEHFASQHKWPC  150

Query  605  KRITFNSPRQISLKKNQRFIYLQEKTGGVVFVVNHHMDPLGSAVNVICIAPGSSKRRF  432
              I ++     SL+    F+ ++++    +F++N  ++  G A++V+CI P ++  +F
Sbjct  151  TTIKYSEDVNFSLEPGLHFLRIKDRE---IFLLNVALEAFGHAISVVCIQPKATNSKF  205



>gb|KDO63134.1| hypothetical protein CISIN_1g043878mg, partial [Citrus sinensis]
Length=648

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 121/207 (58%), Gaps = 16/207 (8%)
 Frame = -2

Query  815  CRALEKVVESLKVPCPNNTYGCEESIKYNKLRDHEPTCIHTPCSCPNRACKFLGSSKEVY  636
            C  +E VV+S++  C N  YGC E++ Y K  DHE TC++ PCSCP  +C F+GSS+++ 
Sbjct  454  CGDIESVVDSVRSVCRNREYGCNETVDYTKNNDHEETCMYAPCSCPLLSCNFVGSSEQLS  513

Query  635  THFTNRHVQA-KRITFNSPRQISLKKNQRFIYLQEKTGGVVF-VVNHHMDPLGSAVNVIC  462
             HF+++H  + +R  +N+P  ISL+ ++ F+ LQ +  GV+F ++   ++ +G+ V + C
Sbjct  514  LHFSSKHWDSGRRFRYNNPLSISLRIDEEFLVLQAEEDGVLFLLIKCVIENIGNTVMITC  573

Query  461  IAPGSSKRRFLYKLVARGEEENCGCKGGSGEKTTSIKLEAVAENIPKWDPSAALKIFLLV  282
            I+P SSK ++LY LVA             G   + ++L+++ EN P          FLL+
Sbjct  574  ISPSSSKVKYLYDLVA-------------GRGISCLRLKSLTENFPGLVEGFPPMDFLLI  620

Query  281  PGNVISDSWDHLKLEVCIKDLA*DSMD  201
            P   +  S+  L LEVCI +    S+D
Sbjct  621  PSRFLG-SFGELNLEVCIWNSTEFSLD  646



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3685527018540