BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77520_g1_i1 len=1201 path=[1179:0-1200]

Length=1201
                                                                      Score     E

ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    323   3e-104   
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    319   9e-103   
ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      316   5e-102   
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      301   3e-96    
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 281   2e-88    
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                276   2e-86    
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             265   3e-82    
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter S...    261   2e-80    
ref|XP_007043874.1|  Senescence-associated gene 29                      260   3e-80    
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    258   2e-79    
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    258   3e-79    
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      256   6e-79    
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             256   2e-78    
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    253   2e-77    
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    253   3e-77    
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             251   4e-77    
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         251   1e-76    
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    251   1e-76    
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    251   1e-76    
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    247   2e-75    
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    246   1e-74    
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    245   2e-74    
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      244   7e-74    
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    243   7e-74    
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-73    
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    241   1e-73    
emb|CDP13388.1|  unnamed protein product                                243   2e-73    
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    243   2e-73    
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    242   2e-73    
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             242   3e-73    Populus trichocarpa [western balsam poplar]
emb|CAN71371.1|  hypothetical protein VITISV_023352                     241   3e-73    Vitis vinifera
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      242   4e-73    Vitis vinifera
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    241   5e-73    
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    241   6e-73    Vitis vinifera
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    241   7e-73    
gb|KHN39181.1|  Bidirectional sugar transporter N3                      241   7e-73    
ref|NP_001239695.1|  uncharacterized protein LOC100777741               240   8e-73    
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    240   1e-72    
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             239   2e-72    
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             239   2e-72    Populus trichocarpa [western balsam poplar]
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    239   4e-72    
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    239   4e-72    
ref|XP_002511126.1|  conserved hypothetical protein                     239   4e-72    Ricinus communis
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    239   4e-72    
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    239   6e-72    
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          238   9e-72    
ref|NP_001067955.1|  Os11g0508600                                       238   1e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002514863.1|  conserved hypothetical protein                     237   1e-71    Ricinus communis
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    237   2e-71    
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    237   2e-71    
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    236   3e-71    
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    237   4e-71    
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    237   4e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    236   6e-71    
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 235   1e-70    
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    235   1e-70    
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-70    
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    234   2e-70    
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            235   3e-70    
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    234   3e-70    
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    234   5e-70    
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    234   8e-70    
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 232   1e-69    
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    234   1e-69    
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    232   2e-69    
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             231   2e-69    
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    232   2e-69    
gb|ACV71016.1|  UPA16                                                   233   2e-69    Capsicum annuum
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         232   2e-69    
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         232   2e-69    
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    232   3e-69    
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    232   3e-69    
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    231   3e-69    
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      232   4e-69    
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    231   4e-69    
dbj|BAJ94651.1|  predicted protein                                      231   6e-69    
gb|KHN03192.1|  Bidirectional sugar transporter N3                      230   6e-69    
gb|EPS72542.1|  hypothetical protein M569_02215                         228   9e-69    
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    230   1e-68    
gb|KHN24976.1|  Bidirectional sugar transporter N3                      229   1e-68    
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    229   1e-68    
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    230   1e-68    
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         230   1e-68    
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    230   2e-68    
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    230   2e-68    
ref|XP_002873602.1|  nodulin MtN3 family protein                        230   2e-68    
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    230   2e-68    
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    229   3e-68    
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    229   3e-68    
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    229   3e-68    
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    229   4e-68    
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    229   4e-68    
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    228   5e-68    
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             228   5e-68    
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    229   5e-68    
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    228   6e-68    
gb|KHN24975.1|  Bidirectional sugar transporter N3                      228   7e-68    
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    228   7e-68    
dbj|BAJ85621.1|  predicted protein                                      228   8e-68    
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    228   9e-68    
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    228   9e-68    
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-67    
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    227   1e-67    
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    226   1e-67    
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    227   1e-67    
ref|NP_001242732.1|  uncharacterized protein LOC100810962               226   1e-67    
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      226   2e-67    
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    228   2e-67    
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    226   3e-67    
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          226   3e-67    Sorghum bicolor [broomcorn]
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    227   4e-67    
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    226   4e-67    
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    225   6e-67    
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 229   7e-67    
ref|XP_002511125.1|  conserved hypothetical protein                     225   7e-67    Ricinus communis
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    226   7e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             226   7e-67    
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         225   7e-67    
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    224   8e-67    
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    224   8e-67    
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    224   9e-67    
gb|EAY83053.1|  hypothetical protein OsI_38270                          225   1e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-66    
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 225   1e-66    
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-66    
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-66    
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-66    
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    225   2e-66    
ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    225   2e-66    
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         224   2e-66    
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-66    
gb|ACU23483.1|  unknown                                                 223   2e-66    Glycine max [soybeans]
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    223   2e-66    
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    224   3e-66    
ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    223   4e-66    
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    224   4e-66    
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    224   4e-66    
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    223   5e-66    
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    223   5e-66    
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    222   7e-66    
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    223   7e-66    
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    223   8e-66    
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         223   1e-65    
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      223   1e-65    
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    221   1e-65    
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    223   1e-65    
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    222   1e-65    
ref|NP_001131289.1|  mtN3-like protein                                  222   2e-65    Zea mays [maize]
ref|NP_001237418.1|  N3 protein                                         221   2e-65    
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    222   2e-65    
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    221   3e-65    
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    222   3e-65    
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    221   3e-65    
gb|KEH21448.1|  bidirectional sugar transporter                         221   3e-65    
emb|CDY53626.1|  BnaC03g71480D                                          221   3e-65    
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             221   3e-65    
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    221   4e-65    
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    221   5e-65    
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             221   5e-65    
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    219   6e-65    
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             220   6e-65    
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    229   6e-65    
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    220   6e-65    
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    220   6e-65    
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             220   8e-65    
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             219   8e-65    
emb|CDX69663.1|  BnaA10g20120D                                          220   9e-65    
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            220   9e-65    
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         220   9e-65    
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    220   9e-65    
ref|NP_001132836.1|  hypothetical protein                               222   1e-64    Zea mays [maize]
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    221   1e-64    
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    220   1e-64    
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    226   1e-64    
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      221   1e-64    
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    220   1e-64    
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    221   1e-64    Oryza sativa Indica Group [Indian rice]
gb|AAM65389.1|  senescence-associated protein (SAG29)                   220   1e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001046944.1|  Os02g0513100                                       220   1e-64    Oryza sativa Japonica Group [Japonica rice]
emb|CDX78511.1|  BnaA03g04230D                                          219   1e-64    
ref|NP_196821.1|  senescence-associated protein 29                      219   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             219   2e-64    Populus trichocarpa [western balsam poplar]
emb|CDX97233.1|  BnaC09g43920D                                          219   2e-64    
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             219   2e-64    
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          219   2e-64    Sorghum bicolor [broomcorn]
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               219   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      219   2e-64    
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    219   3e-64    
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    218   4e-64    
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 225   4e-64    
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    218   5e-64    
ref|NP_001241307.1|  uncharacterized protein LOC100810946               217   5e-64    
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    218   5e-64    
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    218   6e-64    
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    218   6e-64    
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    217   6e-64    Medicago truncatula
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             217   9e-64    
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    217   9e-64    
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    218   1e-63    
gb|AFK39311.1|  unknown                                                 216   1e-63    
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    217   1e-63    
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    216   2e-63    
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             217   2e-63    
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          217   2e-63    Sorghum bicolor [broomcorn]
emb|CAC44123.1|  N3 like protein                                        215   2e-63    Medicago truncatula
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             216   2e-63    
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    219   2e-63    
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 218   2e-63    
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    216   2e-63    
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    216   3e-63    
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    216   3e-63    
emb|CDX91144.1|  BnaC02g04530D                                          216   3e-63    
gb|AFK35161.1|  unknown                                                 215   3e-63    
ref|XP_002865823.1|  nodulin MtN3 family protein                        216   3e-63    
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   216   3e-63    
gb|KEH20983.1|  bidirectional sugar transporter                         215   3e-63    
gb|AHL43546.1|  nodule-specific sucrose transporter                     215   4e-63    
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    215   4e-63    
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               216   4e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    216   4e-63    
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    214   4e-63    
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    216   5e-63    
ref|XP_002322281.2|  N3 like family protein                             215   5e-63    Populus trichocarpa [western balsam poplar]
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    215   6e-63    
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    216   6e-63    
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         216   7e-63    
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    215   7e-63    
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    215   8e-63    
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      214   9e-63    
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    214   9e-63    
emb|CDX85668.1|  BnaA02g01450D                                          215   1e-62    
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    214   1e-62    
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    215   1e-62    
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          216   1e-62    Sorghum bicolor [broomcorn]
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    214   1e-62    
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    214   1e-62    
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    215   1e-62    
ref|NP_001149087.1|  MTN3                                               214   2e-62    Zea mays [maize]
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          214   2e-62    Sorghum bicolor [broomcorn]
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             214   2e-62    
ref|XP_004301046.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    214   2e-62    
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    214   2e-62    
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    214   2e-62    
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    214   2e-62    
gb|AFK48645.1|  unknown                                                 213   2e-62    
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    213   2e-62    
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    213   3e-62    
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    213   3e-62    
gb|EPS64389.1|  hypothetical protein M569_10392                         212   3e-62    
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    214   3e-62    
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             213   4e-62    
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    213   4e-62    
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    213   6e-62    
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    213   7e-62    
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      212   7e-62    
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    212   8e-62    Vitis vinifera
ref|NP_001141106.1|  uncharacterized protein LOC100273190               213   8e-62    Zea mays [maize]
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    212   8e-62    
gb|ACG28570.1|  MTN3                                                    212   1e-61    Zea mays [maize]
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    211   1e-61    
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    212   1e-61    
emb|CDY08093.1|  BnaA06g16330D                                          212   1e-61    
dbj|BAK04274.1|  predicted protein                                      212   1e-61    
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    211   2e-61    
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    211   2e-61    
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    211   2e-61    
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    210   2e-61    
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    211   2e-61    
emb|CDX84877.1|  BnaA03g13530D                                          211   2e-61    
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     209   3e-61    
emb|CDX87161.1|  BnaC09g04760D                                          211   3e-61    
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    211   3e-61    
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    211   3e-61    
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    211   4e-61    
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    210   5e-61    
emb|CDX77928.1|  BnaC03g52910D                                          210   6e-61    
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      211   6e-61    
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             210   6e-61    
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    209   6e-61    
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 211   7e-61    
emb|CDX83046.1|  BnaA01g20460D                                          210   7e-61    
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    209   7e-61    
emb|CDY05867.1|  BnaC08g20440D                                          210   7e-61    
ref|XP_010037372.1|  PREDICTED: bidirectional sugar transporter S...    209   8e-61    
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         209   8e-61    
ref|NP_001141654.1|  hypothetical protein                               210   9e-61    
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    209   9e-61    
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    209   9e-61    
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    209   1e-60    
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                209   1e-60    
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                209   1e-60    
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                209   1e-60    
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    209   1e-60    
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    209   1e-60    
emb|CDP03543.1|  unnamed protein product                                208   1e-60    
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             209   1e-60    
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    209   2e-60    
ref|NP_001240121.1|  uncharacterized protein LOC100800347               208   2e-60    
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    207   3e-60    
ref|NP_001149028.1|  LOC100282648                                       208   4e-60    
emb|CDY16863.1|  BnaA09g05190D                                          207   5e-60    
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     207   5e-60    
ref|XP_002321731.1|  N3 like family protein                             207   6e-60    
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    207   6e-60    
emb|CDX68492.1|  BnaC01g25700D                                          207   8e-60    
emb|CBI15715.3|  unnamed protein product                                207   8e-60    
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    207   9e-60    
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    206   1e-59    
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     206   1e-59    
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    205   1e-59    
ref|XP_002862913.1|  nodulin MtN3 family protein                        207   1e-59    
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 207   1e-59    
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    206   1e-59    
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    207   1e-59    
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      206   1e-59    
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                205   2e-59    
ref|XP_002865824.1|  nodulin MtN3 family protein                        206   2e-59    
ref|XP_002511128.1|  conserved hypothetical protein                     206   2e-59    
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    206   2e-59    
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    207   2e-59    
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    205   3e-59    
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    205   4e-59    
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             204   4e-59    
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 206   4e-59    
emb|CDX71659.1|  BnaC09g27000D                                          205   4e-59    
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     204   5e-59    
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    205   5e-59    
gb|AAM65058.1|  MtN3-like protein                                       205   5e-59    
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             205   5e-59    
gb|KHN33482.1|  Bidirectional sugar transporter SWEET15                 204   5e-59    
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    204   5e-59    
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    205   6e-59    
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               205   7e-59    
gb|KGN63457.1|  hypothetical protein Csa_1G001290                       204   7e-59    
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    204   7e-59    
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    204   7e-59    
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                205   8e-59    
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 204   8e-59    
emb|CDX88041.1|  BnaA06g26320D                                          204   1e-58    
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         204   1e-58    
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    204   1e-58    
emb|CDY69440.1|  BnaCnng63490D                                          201   1e-58    
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    203   2e-58    
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    202   2e-58    
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    203   2e-58    
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   204   3e-58    
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    203   3e-58    
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    203   3e-58    
ref|XP_002877629.1|  nodulin MtN3 family protein                        203   3e-58    
ref|XP_002867630.1|  nodulin MtN3 family protein                        202   3e-58    
emb|CDX80379.1|  BnaC07g30650D                                          202   4e-58    
emb|CBI32263.3|  unnamed protein product                                204   5e-58    
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    202   5e-58    
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    202   6e-58    
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             202   7e-58    
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              202   7e-58    
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    202   8e-58    
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    202   8e-58    
emb|CDP21121.1|  unnamed protein product                                201   1e-57    
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         201   1e-57    
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               201   1e-57    
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             201   2e-57    
ref|NP_001149496.1|  MTN3                                               201   2e-57    
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    201   2e-57    
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    200   2e-57    
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    200   3e-57    
emb|CDY24854.1|  BnaA08g14560D                                          199   4e-57    
dbj|BAK07340.1|  predicted protein                                      200   4e-57    
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                200   5e-57    
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    200   6e-57    
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    199   6e-57    
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    200   6e-57    
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    199   6e-57    
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    199   7e-57    
ref|XP_002462642.1|  hypothetical protein SORBIDRAFT_02g029430          199   8e-57    
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             200   8e-57    
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    199   8e-57    
ref|XP_007050795.1|  Medicago truncatula MTN3                           200   9e-57    
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             196   9e-57    
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    199   9e-57    
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    198   1e-56    
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               199   1e-56    
ref|XP_002511127.1|  conserved hypothetical protein                     199   1e-56    
gb|KDP22571.1|  hypothetical protein JCGZ_26402                         198   1e-56    
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    198   2e-56    
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    198   2e-56    
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    197   2e-56    
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       197   2e-56    
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 197   2e-56    
emb|CDY34333.1|  BnaA01g14360D                                          197   3e-56    
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    196   4e-56    
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    197   4e-56    
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    197   4e-56    
emb|CDY03395.1|  BnaC01g16870D                                          197   4e-56    
gb|KCW61900.1|  hypothetical protein EUGRSUZ_H04596                     196   4e-56    
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    197   5e-56    
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    196   5e-56    
gb|AES73031.2|  sugar efflux transporter for intercellular exchan...    194   5e-56    
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             196   5e-56    
ref|XP_002520679.1|  conserved hypothetical protein                     197   6e-56    
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         196   6e-56    
emb|CDY70861.1|  BnaCnng70080D                                          194   6e-56    
emb|CDP21733.1|  unnamed protein product                                196   6e-56    
ref|XP_006376915.1|  hypothetical protein POPTR_0012s10500g             196   7e-56    
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         197   9e-56    
gb|AGL98401.1|  sucrose transporter SWEET9                              196   1e-55    
emb|CDX92666.1|  BnaC07g39240D                                          196   1e-55    
gb|AFK36312.1|  unknown                                                 196   1e-55    
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 196   2e-55    
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    195   2e-55    
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    196   2e-55    
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    195   2e-55    
ref|XP_002321730.2|  N3 like family protein                             195   2e-55    
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    195   2e-55    
gb|ACJ84828.1|  unknown                                                 195   3e-55    
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 197   4e-55    
emb|CDP21120.1|  unnamed protein product                                194   5e-55    
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    194   6e-55    
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     194   6e-55    
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    194   7e-55    
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             194   9e-55    
gb|KCW61425.1|  hypothetical protein EUGRSUZ_H04154                     192   9e-55    
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             193   9e-55    
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    194   1e-54    
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    193   1e-54    
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    193   1e-54    
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             193   1e-54    
ref|XP_010041902.1|  PREDICTED: bidirectional sugar transporter S...    192   2e-54    
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    192   2e-54    
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    192   2e-54    
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   192   2e-54    
gb|KEH21559.1|  bidirectional sugar transporter                         191   3e-54    
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    192   4e-54    
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    190   4e-54    
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    192   4e-54    
gb|KCW49075.1|  hypothetical protein EUGRSUZ_K026741                    191   5e-54    
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    193   5e-54    
gb|AGV54262.1|  bidirectional sugar transporter SWEET12                 193   6e-54    
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    191   6e-54    
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    191   9e-54    
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   189   2e-53    
emb|CDP09549.1|  unnamed protein product                                190   2e-53    
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               189   2e-53    
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             191   2e-53    
gb|AFK47472.1|  unknown                                                 189   2e-53    
gb|EAZ45313.1|  hypothetical protein OsJ_29956                          190   2e-53    
gb|EAZ09693.1|  hypothetical protein OsI_31976                          190   2e-53    
gb|EMT31640.1|  Protein RUPTURED POLLEN GRAIN 1                         189   5e-53    
ref|XP_011069431.1|  PREDICTED: bidirectional sugar transporter N...    187   7e-53    
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    188   8e-53    
ref|XP_007030241.1|  Nodulin MtN3 family protein isoform 2              189   1e-52    
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    188   1e-52    
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    187   2e-52    
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    186   2e-52    
emb|CDP14988.1|  unnamed protein product                                187   2e-52    
ref|XP_004974017.1|  PREDICTED: bidirectional sugar transporter S...    188   3e-52    
gb|KDO83122.1|  hypothetical protein CISIN_1g025761mg                   186   3e-52    
ref|XP_004174114.1|  PREDICTED: bidirectional sugar transporter S...    184   5e-52    
gb|EMS50325.1|  Bidirectional sugar transporter SWEET11                 186   6e-52    
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    184   9e-52    
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    185   2e-51    
gb|EMS53873.1|  Bidirectional sugar transporter SWEET14                 186   3e-51    
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    184   5e-51    
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    184   7e-51    
gb|KHN17480.1|  Bidirectional sugar transporter SWEET15                 183   1e-50    
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      181   2e-50    
dbj|BAJ99068.1|  predicted protein                                      183   3e-50    
ref|XP_010528779.1|  PREDICTED: bidirectional sugar transporter S...    181   4e-50    
gb|EYU34244.1|  hypothetical protein MIMGU_mgv1a022710mg                180   4e-50    
ref|XP_008218389.1|  PREDICTED: bidirectional sugar transporter N...    178   5e-50    
gb|KDO64485.1|  hypothetical protein CISIN_1g020739mg                   179   5e-50    
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    182   5e-50    
ref|NP_001148964.1|  LOC100282584                                       182   7e-50    
ref|NP_001136928.1|  hypothetical protein                               181   7e-50    
tpg|DAA48249.1|  TPA: MTN3                                              181   8e-50    
ref|XP_002465280.1|  hypothetical protein SORBIDRAFT_01g035490          181   1e-49    
ref|XP_006659632.1|  PREDICTED: bidirectional sugar transporter S...    180   2e-49    
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    179   3e-49    
ref|NP_001062354.1|  Os08g0535200                                       179   4e-49    
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    178   5e-49    
ref|XP_009103141.1|  PREDICTED: bidirectional sugar transporter S...    176   7e-49    
gb|KCW49089.1|  hypothetical protein EUGRSUZ_K02696                     177   8e-49    
gb|ABD78942.1|  disease resistant allele xa13                           179   8e-49    
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    176   8e-49    
ref|XP_002444688.1|  hypothetical protein SORBIDRAFT_07g026040          177   3e-48    
ref|XP_003524473.1|  PREDICTED: bidirectional sugar transporter S...    175   1e-47    
ref|XP_010682692.1|  PREDICTED: bidirectional sugar transporter S...    174   1e-47    
ref|XP_009417933.1|  PREDICTED: bidirectional sugar transporter S...    174   1e-47    
emb|CDY08964.1|  BnaC08g11940D                                          173   7e-47    
ref|XP_004984398.1|  PREDICTED: bidirectional sugar transporter S...    173   8e-47    
ref|XP_006371147.1|  hypothetical protein POPTR_0019s04590g             171   8e-47    
ref|XP_006411131.1|  hypothetical protein EUTSA_v10017080mg             172   1e-46    
ref|XP_006651370.1|  PREDICTED: bidirectional sugar transporter S...    173   2e-46    
gb|EMS67211.1|  Bidirectional sugar transporter SWEET12                 172   2e-46    
gb|ACU14542.1|  unknown                                                 169   3e-46    
gb|EMT31030.1|  Protein RUPTURED POLLEN GRAIN 1                         169   8e-46    
ref|XP_002881628.1|  nodulin MtN3 family protein                        169   1e-45    
ref|XP_006388397.1|  hypothetical protein POPTR_0198s00220g             168   1e-45    
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    169   1e-45    
gb|KFK36797.1|  hypothetical protein AALP_AA4G172400                    169   2e-45    



>ref|XP_009612477.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   323 bits (827),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/263 (67%), Positives = 215/263 (82%), Gaps = 3/263 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI DLHHPWL VFG+LGNIISIFV+LAPV  F RIY+ KSTMG+ SVPYV+A+FSSMLW
Sbjct  1    MAIFDLHHPWLFVFGVLGNIISIFVFLAPVPTFRRIYKEKSTMGFQSVPYVVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFL  441
            MYYAFIKKNATLLISINS G + ETIYI IFL++AS +ARR  +K L   IGG +++IFL
Sbjct  61   MYYAFIKKNATLLISINSFGCIVETIYISIFLLYASKEARRQTVKLLVSLIGGLYTLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ FP +G +R+ +VGWICVA ++AVFA+PLSIV QV RTKSVEFLPF LSFFLTLSA+M
Sbjct  121  VTLFPLNGALRVQVVGWICVAVAVAVFAAPLSIVCQVVRTKSVEFLPFTLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WFGYGL+ KDL IALPN+LGFFLG++Q+LLY +YRN KP  E  K V EH+VN+ +LG S
Sbjct  181  WFGYGLLQKDLCIALPNVLGFFLGMIQMLLYGLYRNVKPAAELEKKVPEHVVNIVVLGNS  240

Query  802  NQLVHPVDSGRNISDGVTEINME  870
             Q +HPV S +N  D + +++ E
Sbjct  241  EQ-IHPVKSEKN-EDMIKKLDEE  261



>ref|XP_009777590.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=315

 Score =   319 bits (817),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 214/267 (80%), Gaps = 3/267 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI DLHHPWL VFG LGNIISIFV+LAPV  F RIY+ KSTMG+ SVPYV+A+FSSMLW
Sbjct  1    MAIFDLHHPWLFVFGALGNIISIFVFLAPVPTFRRIYKEKSTMGFQSVPYVVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFL  441
            MYYAFIKKNA LLISINS G + ETIYI IFL++AS +ARR  +K L   IGG +++IFL
Sbjct  61   MYYAFIKKNAILLISINSFGCIVETIYISIFLLYASKEARRQTVKLLVSLIGGLYTLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ FP +G +R+ +VGWICVA ++AVFA+PLSIV QV RTKSVEFLPF LSFFLTLSA+M
Sbjct  121  VTLFPLNGALRVQVVGWICVAVAVAVFAAPLSIVFQVVRTKSVEFLPFTLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WFGYGL+ KDL IALPN+LGFFLG++Q+LLY +YR  KP  E  K V EHIVN+ ++G S
Sbjct  181  WFGYGLLQKDLCIALPNVLGFFLGMIQMLLYGLYRKVKPAAELEKKVPEHIVNIVVVGNS  240

Query  802  NQLVHPVDSGRNISDGVTEINMENNDQ  882
             Q +HPV S +N  D + +++ E N +
Sbjct  241  EQ-IHPVKSEKN-EDMIKKLDEEENRE  265



>ref|XP_004239304.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=295

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/280 (60%), Positives = 213/280 (76%), Gaps = 16/280 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ DLHHPWL VFG+LGN+ISI V+LAPV  F RI + KSTMGY SVPYV+A+FSSMLW
Sbjct  1    MALFDLHHPWLFVFGVLGNVISILVFLAPVPAFRRICKEKSTMGYQSVPYVVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFL  441
            MYYAFIKKNA LL+SINS G + ETIYI IF+++AS +ARR  ++ L L IGG +++IFL
Sbjct  61   MYYAFIKKNAILLVSINSFGCIVETIYITIFILYASKEARRQTVQLLVLLIGGLYTLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ FP +G +R+ +VGWICV  ++ VFA+PLSIV QV RT++VEF+PF LSFFLTLSA+M
Sbjct  121  ITLFPLNGVLRVQVVGWICVTVAVGVFAAPLSIVFQVVRTRTVEFMPFTLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WFGYGL++KDL IALPN+LGFFLG++Q+LLY IYRNAKP ++  K V EH VN E     
Sbjct  181  WFGYGLLLKDLCIALPNVLGFFLGMIQMLLYGIYRNAKPAIDLEKKVCEHAVNSEQ----  236

Query  802  NQLVHPVDSGRNISDGVTEINM--------ENNDQGE*KM  897
               ++PVDS     +   EINM         NN++ E ++
Sbjct  237  ---IYPVDSEDVNFNDTEEINMAAIVPVVVANNNENEERL  273



>ref|XP_011071246.1| PREDICTED: bidirectional sugar transporter N3 [Sesamum indicum]
Length=297

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/269 (60%), Positives = 206/269 (77%), Gaps = 5/269 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D+HHPW   FG+LGNIIS+FVYLAP+  F RIY+ +STMG+ S+PYV+A+FS+MLW
Sbjct  1    MAVFDIHHPWAFTFGVLGNIISVFVYLAPLPTFFRIYKERSTMGFDSLPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            MYYAF+K NA LLISIN  G V E IYI I+L +AS KAR +  K L L  +G  ++IFL
Sbjct  61   MYYAFLKTNAILLISINLFGCVIEAIYIFIYLFYASKKARTHTAKLLSLINVGLLALIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +++F F G IR+ +VGWICVA S++VFA+PL+IV QV RT+SVEF+PF LSFFLTLSAVM
Sbjct  121  LTFFIFKGPIRVHVVGWICVAVSVSVFAAPLTIVFQVVRTRSVEFMPFPLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WF YGL  KDL +ALPN+LGFFLGLLQ+LLY I+RN KP   E+K + EH++N+ +LGT 
Sbjct  181  WFAYGLFQKDLCVALPNVLGFFLGLLQMLLYGIFRNVKP-ENEDKKLPEHVINIMVLGTP  239

Query  802  NQLVHPVDSGRNISDGVTEINMENNDQGE  888
               VHPVDS +N  D +     EN D+ +
Sbjct  240  E--VHPVDS-QNCPDKIGVSQEENKDEED  265



>ref|XP_010090683.1| Bidirectional sugar transporter N3 [Morus notabilis]
 gb|EXB40347.1| Bidirectional sugar transporter N3 [Morus notabilis]
Length=286

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 200/269 (74%), Gaps = 4/269 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI ++ HPW   FGILGNIIS+ VYLAPV+ F R+YR KST  +HS+PY++A+FSSMLW
Sbjct  1    MAIFNIQHPWTFTFGILGNIISVLVYLAPVTTFYRVYRKKSTEDFHSLPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +A LLI+INS G V E IYI +F+V+A S A++  +K   L  +G FS+IFL
Sbjct  61   LYYALLKTDAMLLITINSFGCVIEMIYITMFIVYAPSHAKKLTIKFFALMNVGMFSLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F      R+ ++GWICVA S++VFA+PLSIV QV RT+SVEF+PF LSFFLTLSA+ 
Sbjct  121  VTQFAVGHSYRVQVLGWICVAISVSVFAAPLSIVAQVIRTRSVEFMPFTLSFFLTLSAIT  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WF YGL++KD+ IA+PN+LGF LGLLQ+LLYAIYRN K   ++ K + EH+ N   L TS
Sbjct  181  WFAYGLLLKDICIAVPNVLGFVLGLLQMLLYAIYRNYKTEEDQEKKLSEHMRNT--LATS  238

Query  802  NQLVHPVDSGRNISDGVTEINMENNDQGE  888
            +Q VHPVD+ +   D   +++ E++   +
Sbjct  239  DQ-VHPVDNAKYNGDHDDKVSKEHDRHHD  266



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 201/280 (72%), Gaps = 16/280 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI D+HHPW   FG+LGNIISIFVYLAP+  F RI++ KSTMG+ S+PY +A+FS+MLW
Sbjct  1    MAIFDIHHPWAFTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFL  441
            +YYAF+K NA LLISIN+ G + ETIYI +FL +AS KAR    K L  + +G  S+IF+
Sbjct  61   LYYAFLKTNAVLLISINTFGCIVETIYISMFLFYASKKARGRTAKLLGVVNVGVLSLIFV  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V++F F G+ R+ +VGWICVA S+ VFA+PLSIV QV RT+SVEF+PF LSFFLTLSAVM
Sbjct  121  VTFFIFKGQNRVHVVGWICVAVSVCVFAAPLSIVFQVVRTRSVEFMPFPLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAK-----PVVEENK-----NVQEH  771
            WFGYGL  KDL +A+PN+LGF LG+LQ++LY I+RN K      V +E K        +H
Sbjct  181  WFGYGLFEKDLCVAVPNVLGFILGVLQMVLYGIFRNVKAEAINDVDDEKKMGVITTDHDH  240

Query  772  IVNVEMLGTSNQLVHPVDSGRNISDGVT-EINMENNDQGE  888
            ++N+ +LGT     H   S  +  D VT +  + ++D  E
Sbjct  241  VINIMVLGTP----HKKSSSTSQYDDVTIKAQVSDDDYHE  276



>ref|XP_007222479.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
 gb|EMJ23678.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
Length=277

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 189/268 (71%), Gaps = 5/268 (2%)
 Frame = +1

Query  88   AILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWM  267
            A+ D HHPW   FGILGN+IS  VYLAPV  F  IY+ KST G+ SVPY++A+FS MLW 
Sbjct  3    ALADSHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLWF  62

Query  268  YYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLV  444
            YYA +KKNA LLI+INS G V ETIYI++F+ +A   AR+  LK   F+ +G F  I ++
Sbjct  63   YYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVL  122

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            S F    E R+ ++GWI VA S+ VFA+PLSIV QV RT+SVEF+PF LSFFLTLSAVMW
Sbjct  123  SHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVMW  182

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNV---QEHIVNVEMLG  795
            F YGL +KD+ IA+PN+LGF LGLLQ+LLYAIYRN KP+ ++ K +    +H+ NV  L 
Sbjct  183  FSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNRKPIEDDEKKIPAADQHVKNVVGLT  242

Query  796  T-SNQLVHPVDSGRNISDGVTEINMENN  876
            T +   VHPVD      D   E++  ++
Sbjct  243  TLATSEVHPVDPPPRDHDKSVEVDAGSH  270



>ref|XP_004310113.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 195/273 (71%), Gaps = 6/273 (2%)
 Frame = +1

Query  88   AILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWM  267
            A+ D HHPW   FGILGN+IS  VYLAPV  F RI++ KST G+ SVPY++A+FS+ LW+
Sbjct  3    AVADAHHPWAFTFGILGNLISFMVYLAPVPTFYRIFKKKSTEGFQSVPYLVALFSATLWL  62

Query  268  YYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLV  444
            YYA +K+NA LLI+IN+ G V ET+YI +++V+A+  +R+  +K L F+ +G FS+I ++
Sbjct  63   YYAMLKQNAVLLITINTFGSVIETLYIAMYIVYATKASRKFTIKLLGFMNLGLFSLILVI  122

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
              + F  E R  ++GWI VA S+ VFA+PLSIV  V RTKSVEF+PF LSFFLTLSAVMW
Sbjct  123  LQYAFHSEYRAPVLGWINVAISVCVFAAPLSIVAHVIRTKSVEFMPFSLSFFLTLSAVMW  182

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV---EENKNVQEHIVNVEMLG  795
            F YGL +KD+ IALPN+LGF LGLLQ+LLYAIYRN KPV+   E+     E + ++ +L 
Sbjct  183  FAYGLFLKDICIALPNVLGFILGLLQMLLYAIYRNRKPVIFDPEDKLRAPEQMKSIVILS  242

Query  796  T-SNQLVHPVDSGR-NISDGVTEINMENNDQGE  888
            T     VHPVD+   + +DG      + N +G+
Sbjct  243  TIPTSEVHPVDAKHCDGNDGEDVDGKDGNKEGD  275



>ref|XP_007043874.1| Senescence-associated gene 29 [Theobroma cacao]
 gb|EOX99705.1| Senescence-associated gene 29 [Theobroma cacao]
Length=287

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 196/272 (72%), Gaps = 10/272 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++  HH W + FG+ GNIIS+ VYLAPV  F RIYR KST  + S+PY +A+FSSMLW
Sbjct  1    MAVMGDHHSWAVAFGVFGNIISVLVYLAPVPTFYRIYRKKSTESFQSLPYQVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIF  438
            +YYA IKK+A LLI+INS G + ET+YI I++ +AS  +R +A+K LF  + +G FS+I 
Sbjct  61   LYYALIKKDAFLLITINSFGCIVETMYISIYIAYASKNSRMSAMK-LFVGMNVGLFSLIL  119

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +++ F     IRI L+GWICVA S++VFA+PL+IV +V RT SVEF+PF LSFFLTLSA+
Sbjct  120  ILTRFLVKSSIRIQLLGWICVAISVSVFAAPLNIVARVIRTGSVEFMPFNLSFFLTLSAI  179

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE--HIVNVEML  792
            MWF YGL +KD+ +ALPN+LGF LG+LQ+LLYA+YRN K  +EE K  ++   +V +  +
Sbjct  180  MWFAYGLFIKDICVALPNVLGFVLGMLQMLLYAVYRNTKKAIEEKKPPEQLKTVVVLSTI  239

Query  793  GTSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
            G S   V+PVD   + +   T+   EN   GE
Sbjct  240  GASE--VYPVDIQPDANSNKTK---ENEQTGE  266



>gb|KHG20984.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=289

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 193/273 (71%), Gaps = 6/273 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++  HH   +VFGILGNIIS+ V+LAPV  F RIY+ KST  + S+PY +A+FS MLW
Sbjct  1    MAVMADHHSLAVVFGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA IKK A LLI+INS G V ETIYI +FL +AS  +R +A+K LF+   +G FS I 
Sbjct  61   LYYALIKKGAFLLITINSFGCVVETIYISMFLAYASKNSRMSAMK-LFISMNLGLFSFIL  119

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +++ F     IRI ++GWICVA S++VFA+PL+I+ +V RTKSVEF+PF LSFFLTLSAV
Sbjct  120  ILTHFLLKSSIRIQVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAV  179

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKNVQEHI--VNVEM  789
            MWF YGL +KDL +ALPN+LGF LG+LQ+LLYAIYR+++ V +EE K   E +  +NV +
Sbjct  180  MWFAYGLFIKDLCVALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLPAEQMKSINVVL  239

Query  790  LGTSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
                   VHPV    +  D   E N  N   GE
Sbjct  240  TTLGASEVHPVVLDIHTDDTKEEDNKNNEPTGE  272



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 191/278 (69%), Gaps = 10/278 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FGILGNIIS  VYLAP+  F R+Y+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARR-NALKELFLCIGGFSIIFL  441
            +YYAFIK +A LL++INSIG V ET+YI+++L +A  KAR   A   L L +G F +I L
Sbjct  61   IYYAFIKADAYLLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+     G  R+ ++GW+CV+FSI+VF +PLSI+  V RTKSVEF+PF+LSFFLT+SA+ 
Sbjct  121  VTLMVAKGPERVHVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTMSAIA  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WF YGL+ KD+ +ALPNILGF  G++Q+ +Y  Y+  + V  +++ V EHI+ +  +GTS
Sbjct  181  WFSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGTEKVAYDHQKVAEHIITITKVGTS  240

Query  802  NQL--VHPVD-------SGRNISDGVTEINMENNDQGE  888
             +   VHP+D        G   +D   +   E  + G+
Sbjct  241  ERTSEVHPIDVIGSPAVHGEENADKEGQERHEPTNDGD  278



>ref|XP_008222221.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=282

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 186/269 (69%), Gaps = 10/269 (4%)
 Frame = +1

Query  88   AILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWM  267
            A+ D HHPW   FGILGN+IS  VYLAP+  F  IY+ KST G+ SVPY++A+FS MLW 
Sbjct  3    ALADSHHPWAFTFGILGNVISFLVYLAPMPTFYGIYKKKSTQGFQSVPYLVALFSGMLWF  62

Query  268  YYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLV  444
            YYA +KKNA LLI+INS G V ETIYI++F+ +A   AR+  LK   F+ +G F  I ++
Sbjct  63   YYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVL  122

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            S F    E R+ ++GWI VA S+ VFA+PLSIV QV RT+SVEF+PF LSFFLTLSAVMW
Sbjct  123  SHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVMW  182

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN--------VQEHIVN  780
            F YGL +KD+ IA+PN+LGF LGLLQ+LLYAIYRN + V+ E+            +H+ N
Sbjct  183  FSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNREQVIIEDDEKKIPAAAAADQHVKN  242

Query  781  VEMLGT-SNQLVHPVDSGRNISDGVTEIN  864
            V  L T +   VHPVD   +  D   E++
Sbjct  243  VVGLTTLATSEVHPVDPPPHDHDKSVEVD  271



>ref|XP_006438820.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
 ref|XP_006483041.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Citrus 
sinensis]
 gb|ESR52060.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
Length=305

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 196/277 (71%), Gaps = 13/277 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI+  HH W + FGILGNIIS  VYLAPV  F RIYR KST  + S+PY++A+FSSMLW
Sbjct  1    MAIMFDHHQWGVAFGILGNIISFLVYLAPVPTFYRIYRKKSTESFQSLPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
             YYA +K+NA LL++IN  G V ETIYI++F+ +A  K  RN+  +LF+   +G FS+I 
Sbjct  61   FYYALVKQNAFLLVTINCFGCVIETIYIILFITYAP-KGSRNSTVKLFVSMNVGVFSLIL  119

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L++ F  +   RI ++GWICVA S++VFA+PLSIV QV RTKSVEF+PF LSFFLTLSA+
Sbjct  120  LLTHFLATDSTRILILGWICVAVSVSVFAAPLSIVAQVIRTKSVEFMPFILSFFLTLSAI  179

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE----HIVNVE  786
            MWF YGL  KD+ +ALPNI+GF LGL Q+LLY IY+NA  V+ E K + E     IV + 
Sbjct  180  MWFAYGLFQKDICVALPNIVGFLLGLTQMLLYVIYKNANKVIIEEKKLPEAQLKSIVVLS  239

Query  787  MLGTSNQLVHPVDSGRNISDGVTEINM---ENNDQGE  888
             LG S   V+PVD   + +D  T++N    EN+ + +
Sbjct  240  NLGASE--VYPVDIHPDDAD-TTDVNQGPKENHQETD  273



>ref|XP_008389921.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 192/267 (72%), Gaps = 10/267 (4%)
 Frame = +1

Query  91   ILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMY  270
            + D HHP    FG+LGN++S  VYLAPV  F RIYR KST G+HSVPY++A+FSSMLW+Y
Sbjct  4    VADSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWLY  63

Query  271  YAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLV  444
            YA +KKNA LLI+INS G   E IYI+IF+V+A   AR+  +K LF  + +G F++I +V
Sbjct  64   YASLKKNAMLLITINSFGSFAEMIYIVIFVVYAPKDARKLTVK-LFGIMNVGLFTLILVV  122

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            S F  S   R+ ++GWI VA S +VFA+PLSIV QV RT+SVEF+PF LSFFLTLSA+MW
Sbjct  123  SHFLVSRAYRVPVLGWINVAISTSVFAAPLSIVSQVIRTRSVEFMPFRLSFFLTLSAIMW  182

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------EHIVNVE  786
            F YGL +KD+ +A+PN+LGF LGLLQ+LLYA+YRN K V+ E+   +      +H+ N+ 
Sbjct  183  FAYGLFLKDICVAIPNVLGFVLGLLQMLLYAMYRNRKQVIIEDHEKKLPAATPDHVKNIV  242

Query  787  MLGT-SNQLVHPVDSGRNISDGVTEIN  864
            ++ T +   VHP D+  N  +   ++N
Sbjct  243  IIATLAASEVHPADAQPNNRNDDGDVN  269



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 194/274 (71%), Gaps = 9/274 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D+HHPW   FG+LGNIIS+ VYLAPV  FIRIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAMFDVHHPWTFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YY  +K +A LLI+INS+G V ET YI +F+V+A  KAR  A+K L L  +G F  I L
Sbjct  61   IYYGLLKPDAHLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
             + F   G  R+ ++G ICVAFS++VFA+PLSI+  V R+KSVEF+PF LSFFLTLSAVM
Sbjct  121  FTLFLAKGSNRVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAK--PVVEENKNVQEHIVNVEMLG  795
            WF YG ++KD  IALPNILGF  G+ Q++LYAIY++A    + E+ + V EH+++V  L 
Sbjct  181  WFSYGFLLKDFYIALPNILGFIFGVAQMVLYAIYKDANRSNIEEQQQKVNEHVIDVIKLN  240

Query  796  T-SNQLVHPVDSGR-----NISDGVTEINMENND  879
            + ++  V PV+  +     N+  G  E    ++D
Sbjct  241  SVASPEVCPVELTKIVDVSNLGLGNKEHEQTDHD  274



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 188/250 (75%), Gaps = 6/250 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAIL+ H+   L FG+LGNIIS  VYLAP+  F RIY+ KST G+ S+PY++A+FSSMLW
Sbjct  1    MAILNTHNHLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLW  60

Query  265  MYYAFIK-KNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSII  435
            +YYA +K  +ATLLI+INS+G V ET+YI++F V+A++ AR+  +K LF  + +G F++I
Sbjct  61   LYYAVLKPADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVK-LFVVMNVGSFALI  119

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            FLV++F   G +RI +VGW+CVA S+ VFA+PLSIV QV RTK+VEF+PF LS FLTLSA
Sbjct  120  FLVTFFTMHGALRIQVVGWVCVAISVGVFAAPLSIVTQVIRTKNVEFMPFNLSLFLTLSA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLG  795
            + WF YG  +KD+ IA+PN+LGF LGL+Q+LLYA+YRN K  +   +   +++V V  LG
Sbjct  180  ITWFSYGFFLKDICIAIPNVLGFTLGLVQMLLYAMYRNGKSKIVTEEEAMKNVVVVSPLG  239

Query  796  TSNQLVHPVD  825
            T     +PV 
Sbjct  240  TCEG--YPVQ  247



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 184/249 (74%), Gaps = 2/249 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+L  H P    FG+LGNIIS+ VYLAPV  F+RIYR KST G+HS+PY++A+FSSMLW
Sbjct  1    MAVLSTHQPLAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            ++YA +KK+  LL++IN  G   ETIYI +++ +AS + R +  + L  + I  FS I L
Sbjct  61   LHYAMLKKDVFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
             + F   G IR+ ++GWICVA S++VFASPLSIV QV RT+SVEF+PF LSFFLTLSAVM
Sbjct  121  FTHFLMKGSIRVQVLGWICVAVSVSVFASPLSIVAQVVRTRSVEFMPFTLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT-  798
            WF YG   K++ +ALPNILGF LGLLQ+LLYAIYR AK VV E K  ++++ ++ +L T 
Sbjct  181  WFAYGFTTKNMCVALPNILGFILGLLQMLLYAIYRKAKVVVIEEKLPEKNLKSIVILSTL  240

Query  799  SNQLVHPVD  825
             N  V+PVD
Sbjct  241  GNSEVYPVD  249



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 187/254 (74%), Gaps = 4/254 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ ++HHPW   FG+LGN+IS  VYLAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MALFNIHHPWTFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K +A LLI+INS G   ET+YI++F+++AS K R   +K L L  +G F +I L
Sbjct  61   IYYAFLKPDAHLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLNVGTFCLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F   G  R  +VGW+CVAFS++VFA+PLSI+  V RTKSVEF+PF LSFFLTLSAVM
Sbjct  121  LTLFLAHGTKRAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKNVQEHIVNVEMLGT  798
            WF YG + KDL +ALPNILGF  G+LQ+LLY IY+++K V +EE K   EHI++V  L +
Sbjct  181  WFSYGFLQKDLYVALPNILGFIFGILQMLLYVIYKDSKKVIIEEQKVNNEHIIDVRKLNS  240

Query  799  SNQ--LVHPVDSGR  834
            +     V  VD  R
Sbjct  241  TENPAEVRSVDLTR  254



>ref|XP_009336454.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 190/267 (71%), Gaps = 10/267 (4%)
 Frame = +1

Query  91   ILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMY  270
            + D HHP    FG+LGN++S  VYLAPV  F RIYR KST G+HSVPY++A+FSSMLW Y
Sbjct  4    VADSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWFY  63

Query  271  YAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLV  444
            YA +KKNA LLI+INS G   E  YI+IF+V+A   AR+  +K LF  + +G F++I +V
Sbjct  64   YASLKKNAMLLITINSFGSFAEMTYIVIFVVYAPRDARKLTVK-LFGIMNVGLFTLILVV  122

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            S F  S   R+ ++GWI VA S +VFA+PLSIV QV RT+SVEF+PF LSFFLTLSAVMW
Sbjct  123  SHFLVSRAYRVPVLGWINVAISTSVFAAPLSIVAQVIRTRSVEFMPFRLSFFLTLSAVMW  182

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------EHIVNVE  786
            F YGL +KD+ IA+PN+LGF LGLLQ+LLYA+YRN K  + E+   +      +H+ N+ 
Sbjct  183  FAYGLFLKDICIAIPNVLGFVLGLLQMLLYAMYRNRKQEILEDHEKKLPAATPDHVNNIV  242

Query  787  MLGT-SNQLVHPVDSGRNISDGVTEIN  864
            ++ T +   VHPVD+  N  +   ++N
Sbjct  243  IIATLAASEVHPVDAQPNNRNDDGDVN  269



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 196/270 (73%), Gaps = 10/270 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+  + H     FGILGNIIS  V+LAPV  FIRI++ KST  + S+PY++A+FSSMLW
Sbjct  1    MAVTSILH-LAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLW  59

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            +YYA +KK+  LL++INS G + ET YI I++V+A+ ++R + +K L  + +G FS+I L
Sbjct  60   LYYAMLKKDTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILL  119

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F  SG +R+ ++GW+CVA S+ VFA+PL+I+ QV RTKSVEF+PF LSFFLTLSAVM
Sbjct  120  LAHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVM  179

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENK-NVQEHIVNVEMLGT  798
            WF YGL++KDL +ALPNILGF LGLLQ++LY IYRNA+ V E+ K    + IV +  +G 
Sbjct  180  WFAYGLLLKDLCVALPNILGFILGLLQMVLYGIYRNAQKVEEKKKLPALKSIVILSAVGG  239

Query  799  SNQLVHPVDSGRNISDGVTEINMENNDQGE  888
                ++PVD+  +++ G      E +DQ E
Sbjct  240  PG--IYPVDAEPDVNGGA-----EEHDQTE  262



>ref|XP_008340254.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
 ref|XP_008353052.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 191/270 (71%), Gaps = 11/270 (4%)
 Frame = +1

Query  85   MAIL-DLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MAI+ D HHP    FGILGN+IS  VYL+PV  F RIYR KST G+HSVPY++A+FSSML
Sbjct  1    MAIVADSHHPLAFTFGILGNLISTMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSML  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSII  435
            W+YYA +KKNA +LI+INS G   E IYI++F V+A  +AR+  +K LF  + +G F++I
Sbjct  61   WLYYALVKKNAMMLITINSFGSFVEIIYIVMFXVYAPKEARKLTVK-LFGIMNVGLFTMI  119

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
             +VS F      R+ ++GWI VA S +VF +PLSIV QV RT+SVEF+PF LSFFLTLSA
Sbjct  120  LVVSHFLVGSAYRVPILGWINVAISTSVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN------VQEHIV  777
            V+WF YG ++KD+ +A+PN LGF LGLLQ+LLY IYRN + V+ ++        + E + 
Sbjct  180  VIWFAYGYLLKDICVAIPNFLGFVLGLLQMLLYGIYRNREQVIIDDHEKKLPGAIHEDVK  239

Query  778  NVEMLGT-SNQLVHPVDSGRNISDGVTEIN  864
            N+ ++ T +   VHPVD   N  +  T++N
Sbjct  240  NIVIIATLAASEVHPVDDQPNNRNNDTDVN  269



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 182/269 (68%), Gaps = 2/269 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HP    FG+LGN+IS  V+LAP+  F R+YR KST G+HSVPYV+A+FS MLW
Sbjct  1    MAGLSLQHPLPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKE-LFLCIGGFSIIFL  441
            +YYAF+K N+ LLI+INS G+  ETIYI I+L++A  KAR   ++  + L +  F+ I L
Sbjct  61   IYYAFVKTNSMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++   F G  R++++GWICV FSI+VFA+PLS++  V RTKSVEF+PF+LSFFLTLSA+ 
Sbjct  121  LTQLVFKGSNRVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIA  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WFGYGL  KD+ + LPN+LGF  G+ Q+LLY IY+  K VV E   V EHI+ +  L T+
Sbjct  181  WFGYGLFTKDIYVQLPNVLGFVFGIAQMLLYIIYKKKKNVVVE-PTVPEHILKIAELITT  239

Query  802  NQLVHPVDSGRNISDGVTEINMENNDQGE  888
                  V    N        + E  D G+
Sbjct  240  PASELQVSIEENDRKKKANEDAEGVDNGK  268



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 182/269 (68%), Gaps = 12/269 (4%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HHP    FGILGNI+S  V+LAP+  F R+Y+ KST G+ SVPYV A+FS+M+W+YYAF+
Sbjct  7    HHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALFSAMIWIYYAFL  66

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPF  459
            K +  LLI+INS G V ETIYI I+L +A+ +AR + L+ L L   GGF +I L+S F  
Sbjct  67   KSHVILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGFCLILLLSRFLS  126

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R+ ++GW+CV FS+ VFA+PLS++  V RTKSVEF+PF LSFFLTLSAVMW  YGL
Sbjct  127  QGPTRVEVLGWVCVTFSVGVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGL  186

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNV----EMLGTSN-  804
            ++KDL +A PNI+GF  G++Q+ LY  YRN K + EE   + EH  +V     +L T+  
Sbjct  187  LLKDLYVATPNIIGFSFGVVQMALYTKYRNTKTIGEE--KLPEHKADVVKQITILTTTPE  244

Query  805  ---QLVHPVDSGRNISDGVTEINMENNDQ  882
               Q+  PV S  N +D      + N DQ
Sbjct  245  VEVQVQAPVTSDANGTDAHQNSEL-NTDQ  272



>ref|XP_003524088.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
 gb|KHN22921.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=283

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 196/277 (71%), Gaps = 23/277 (8%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI + H+   L FG+LGN+IS  VYLAP+  F RIY+ KST G+ S+PY++A+FSSMLW
Sbjct  1    MAIFNGHNHLALGFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLW  60

Query  265  MYYAFIK-KNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSII  435
            +YYA +K  +ATLLI+INS+G V E +YI++F ++A+  AR   +K LF+   +G F++I
Sbjct  61   LYYASLKPADATLLITINSLGCVIEIVYIIMFTIYATKDARNLTVK-LFMVMNVGSFALI  119

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            FLV++F   G +R+ +VGW+CV+ ++ VFA+PLSIV QV RTK+VEF+PF LS FLT+SA
Sbjct  120  FLVTYFAMHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEH-------I  774
            VMWF YGL++KD+ IA+PNILGF LGLLQ+LLYAIYRN K   +E    +EH       +
Sbjct  180  VMWFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVVTKEEHALEAMKNV  239

Query  775  VNVEMLGTSNQLVHPVDSGRNISDGVTEINMENNDQG  885
            V V  LGT    V+PV           EIN  NN QG
Sbjct  240  VVVNPLGTCE--VYPVIG--------KEIN--NNGQG  264



>ref|XP_011036129.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Populus 
euphratica]
Length=282

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 194/276 (70%), Gaps = 15/276 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++++ HP    FGILGNIIS  VYLAPV  FIRI R KST  + S+PY++A+FSSMLW
Sbjct  1    MAVMNMQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            +YYA +K +A LL++INS G V E+IYI I++ +A+ ++R + +K L  + +G FS+I L
Sbjct  61   LYYAMLKNDAILLVTINSFGCVIESIYIAIYIAYATRESRVSTIKLLVSMNMGLFSLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F  SG  R+  +GW+CVAFS+ VFA+PLSIV Q+ RTKSVEF+PF LSFFLTLSAVM
Sbjct  121  LTHFLASGSTRVKALGWLCVAFSVCVFAAPLSIVKQIIRTKSVEFMPFTLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVN----VEM  789
            WF YGL +KDL +ALPNILGF LGLLQ+LLY IYRNAK      K +   I+     +  
Sbjct  181  WFAYGLFIKDLCVALPNILGFVLGLLQMLLYGIYRNAK-----KKKIPAEILKSSVILST  235

Query  790  LGTSNQLVHPVDSGRNIS---DGVTEINMENNDQGE  888
            LG S   V+PVD+  ++S      TE + EN    +
Sbjct  236  LGASE--VYPVDAQPDVSAAEHDQTEESKENEKSTD  269



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 168/228 (74%), Gaps = 3/228 (1%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HHP    FGILGNI+S  V+LAP+  F R+Y+ KST G+ SVPYV A+FS+M+W+YYAF+
Sbjct  7    HHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFL  66

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPF  459
            K +  LLI+INS G V ETIYI I+L +A+  AR + L+ L L   GGF +I L+S F  
Sbjct  67   KSHVILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLS  126

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R+ ++GW+CV FS++VFA+PLS++  V RTKSVEF+PF LSFFLTLSAVMW  YGL
Sbjct  127  QGPTRVEVLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGL  186

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNV  783
            ++KDL +A PNILGF  G++Q+ LYA YRN K +VEE   + EH  +V
Sbjct  187  LLKDLYVATPNILGFSFGVVQMALYAKYRNTKTIVEE--KLPEHKADV  232



>emb|CDP13388.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 187/264 (71%), Gaps = 12/264 (5%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH W+  FG+LGN++S+  YL P+  F RIYR KSTMGY ++PYV+A+ S+MLWMYYA +
Sbjct  8    HHRWVFAFGVLGNLVSVIAYLGPLPTFYRIYREKSTMGYEALPYVVALSSAMLWMYYALL  67

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWFPF  459
            K  ATLLISINS+G + ET+YIL ++++AS +AR++ +K +  L +G    IF+V+ F  
Sbjct  68   KP-ATLLISINSLGCIIETLYILFYILYASKQARKHTIKLVGMLNVGLICAIFVVANFAL  126

Query  460  SG-EIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
                +RI +VGWICVAFS++VFA+PLSIV QV RT++ EF+P  LS  LTLSAVMWF YG
Sbjct  127  KEVSVRIMVVGWICVAFSVSVFAAPLSIVFQVVRTRNAEFMPVALSATLTLSAVMWFFYG  186

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVH  816
             +  D+ + +PNI+GFFLG+LQ++LY IYR  KP+V E K V EH++N+ ML  S+  VH
Sbjct  187  FLKADMCVTVPNIMGFFLGVLQMMLYVIYRKPKPLVAE-KKVPEHVINIVMLCNSD--VH  243

Query  817  PVDSGRNISDGVTEINMENNDQGE  888
            PV       D  T  N + N   +
Sbjct  244  PV------VDSQTSGNCDVNSTAD  261



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 179/266 (67%), Gaps = 6/266 (2%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HHP    FG+LGNI S  V+LAP+  F R+Y+ KST G+ SVPYV A+F++ +W+YYAF+
Sbjct  7    HHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIYYAFL  66

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPF  459
            K N  LLI+INS G V ETIYI I+L +A+ +AR + L  LFL   GGF +I L++ F  
Sbjct  67   KSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGFCLILLLAHFLS  126

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R++++GW+CV FS++VFA+PLS +  V RTKSVEF+PF LSFFLTLSAVMW  YGL
Sbjct  127  QGPTRVAVLGWVCVTFSVSVFAAPLSAMKMVIRTKSVEFMPFNLSFFLTLSAVMWLSYGL  186

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEM--LGTSNQL-  810
            ++KDL +A PNI+GF  GL+Q+ LYA YRN K  VEE    Q+  V  +M  L T+ +L 
Sbjct  187  LLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNVEEKLPEQKADVVKQMTILTTTPELE  246

Query  811  --VHPVDSGRNISDGVTEINMENNDQ  882
              V    S    S      +  NNDQ
Sbjct  247  VQVQAAVSSHANSTDAHPSSEHNNDQ  272



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 184/266 (69%), Gaps = 4/266 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D HHP +  FG+LGNIIS  V+LAPV  F+RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            +YYA    N TLLI+INS+G + ET+YI IF+VFA  + R + L+  L L  GGF II L
Sbjct  61   LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F   G  ++ +VGWICVAFS++VFA+PL+I+  V RTKSVEF+PF LSFFLTLSA+ 
Sbjct  121  VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAK-PVVEENKNVQEHIVNVEMLGT  798
            W  YG+ +KD+ +ALPN+LGF  G+ Q++LY IYR  +  + +E K  ++  V++ M   
Sbjct  181  WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPEQTTVDIVMKQK  240

Query  799  SNQLVHPVDSGRNISDGVTEINMENN  876
             +  V  ++    I   + EI + N 
Sbjct  241  QDSSVEAIEV--IIKTNIEEIELSNG  264



>ref|XP_002303766.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
 gb|EEE78745.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
Length=287

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 197/270 (73%), Gaps = 8/270 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+  + H     FGILGNIIS  VYLAPV  FIRI++ KST  + S+PY++A+FSSMLW
Sbjct  1    MAVTSILH-LAFTFGILGNIISTMVYLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLW  59

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            +YYA +KK+  LL++INS G V ET YI I++V+A+ ++R + +K L  + +G FS+I L
Sbjct  60   LYYAMLKKDTILLVTINSFGCVIETTYIAIYIVYATRESRVSTIKLLISMNLGLFSLILL  119

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F  SG +R+ ++GW+CVA S+ VFA+PL+I+ QV RTKSVEF+PF LSFFLTLSAVM
Sbjct  120  LAHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVM  179

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEML-GT  798
            WF YGL++KDL IALPNILGF LGLLQ+LLY IYRNA+ V E+ K   E++ ++ +L   
Sbjct  180  WFAYGLLLKDLCIALPNILGFILGLLQMLLYGIYRNAQKVEEKKKLPAENLKSIVILSAV  239

Query  799  SNQLVHPVDSGRNISDGVTEINMENNDQGE  888
                V+PVD+  +++ G      E +DQ E
Sbjct  240  GGPEVYPVDAKPDVNGGA-----EEHDQTE  264



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 186/263 (71%), Gaps = 5/263 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+  +HHP + +FGILGN+IS  VYLAP+  F +IY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MALFPIHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+  +A+LLI+INS+G V ET YI++FLV+A  KAR   +K +FL  I GF  I L
Sbjct  61   IYYAFLNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     G  R+ ++GW+C+ FS++VF +PL I+ QV RTKSVE++PF LSFFLTLSAVM
Sbjct  121  LTLLLAEGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENK--NVQEHIVNVEMLG  795
            WF YGL++KD  IA PNILGF  G++Q++LY IYRN K V+E  K   + E I++V  L 
Sbjct  181  WFFYGLMLKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQIIDVVKLS  240

Query  796  T--SNQLVHPVDSGRNISDGVTE  858
            T   +++        N   G TE
Sbjct  241  TMVCSEVNLTNQQHSNEGHGTTE  263



>ref|XP_002264875.1| PREDICTED: bidirectional sugar transporter N3 [Vitis vinifera]
 emb|CBI38167.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 187/267 (70%), Gaps = 8/267 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH   L+FGILGNIIS  VY AP   F RIY+ KS  G+HS+PY++A+FS+MLW+YYA +
Sbjct  8    HHTLGLIFGILGNIISFLVYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAMLWLYYALL  67

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+A LLI+INS G   E+ YIL++  +A  +A++  LK +  L +G FSI+ ++  F  
Sbjct  68   KKDAFLLITINSFGCAIESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILVVLIQFLL  127

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  RI++ GWIC +FS+AVFA+PLSIV +V RTKSVEF+PF LSFFLTLSA+MWF YGL
Sbjct  128  KGSNRINVFGWICASFSVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAIMWFAYGL  187

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEM---LGTSNQL  810
            +  D  +A+PNILG  LGL+Q++LY  YRNA     E K + EHI+++ M   LGTS+  
Sbjct  188  LKNDPCVAIPNILGVILGLVQMVLYGFYRNAGKEKME-KKLPEHIIDMVMLSTLGTSD--  244

Query  811  VHPVDSGRN-ISDGVTEINMENNDQGE  888
            +HP+ + +N I    +E   ++ + G 
Sbjct  245  IHPIGAQQNGIKKSGSEDVKDDEETGN  271



>gb|KHG03157.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=286

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 147/273 (54%), Positives = 196/273 (72%), Gaps = 9/273 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++  HH   + FG+LGNIIS+ VYLAP+  F RIY+ KST  + S+PY +A+FSSMLW
Sbjct  1    MALMADHHSLAVAFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA +KK A LLI+INS G V ETIYI I++ +A+  +R +A+K LF+   +  FS I 
Sbjct  61   LYYALMKKGAFLLITINSFGCVVETIYIAIYIAYATKNSRVSAIK-LFVAMNVALFSFII  119

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +++ F   G IR+ ++GWICVA S++VFA+PL++V +V RTKSVEF+PF LSFFLTLSAV
Sbjct  120  ILTHFLVKGSIRVQVLGWICVAISVSVFAAPLNVVARVIRTKSVEFMPFNLSFFLTLSAV  179

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT  798
            MWF YGL MKDL +ALPN++GF LG+LQ+LLYAIYRN++ V+EE K + E +  V +L T
Sbjct  180  MWFAYGLFMKDLCVALPNVIGFVLGMLQMLLYAIYRNSEKVIEE-KKIPEQMKGVVVLST  238

Query  799  -SNQLVHPVDSGRNISDGV--TEINMENNDQGE  888
                 V+PV  G +I   V   E   EN   GE
Sbjct  239  LGPSEVYPV--GVDIEPDVKPKEDTTENEQTGE  269



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 179/241 (74%), Gaps = 3/241 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+  +HHP + +FGILGN+IS  VYLAP+  F +IY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MALFPIHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+  +A+LLI+INS+G V ET YI++FLV+A  KAR   +K +FL  I GF  I L
Sbjct  61   IYYAFLNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     G  R+ ++GW+C+ FS++VF +PL I+ QV RTKSVE++PF LSFFLTLSAVM
Sbjct  121  LTLLLAEGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENK--NVQEHIVNVEMLG  795
            WF YGL++KD  IA PNILGF  G++Q++LY IYRN K V+E  K   + E I++V  L 
Sbjct  181  WFFYGLMLKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKVLENEKLPELSEQIIDVVKLS  240

Query  796  T  798
            T
Sbjct  241  T  241



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 197/276 (71%), Gaps = 27/276 (10%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            L+ H+   L FG+LGN+IS  VYLAP+  F RIY+ KST G+ S+PY++A+FSSMLW+YY
Sbjct  3    LNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYY  62

Query  274  AFIK-KNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIFLV  444
            A +K  +ATLLI+INS+G V E +YI++F ++A+  AR   +K LF+   +G F++IFLV
Sbjct  63   ASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVK-LFMVMNVGSFALIFLV  121

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            ++F   G +R+ +VGW+CV+ ++ VFA+PLSIV QV RTK+VEF+PF LS FLTLSAVMW
Sbjct  122  TYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTLSAVMW  181

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP-----VVEENKNVQ---EHIVN  780
            F YGL++KD+ IA+PNILGF LGLLQ+LLYAIYRN K        +E K ++   +++V 
Sbjct  182  FFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKNVVV  241

Query  781  VEMLGTSNQLVHPVDSGRNISDGVTEINMENND-QG  885
            V  LGT    V+PV            IN ENN+ QG
Sbjct  242  VNPLGTCE--VYPV------------INKENNNGQG  263



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 196/276 (71%), Gaps = 27/276 (10%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            L+ H+   L FG+LGN+IS  VYLAP+  F RIY+ KST G+ S+PY++A+FSSMLW+YY
Sbjct  3    LNSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYY  62

Query  274  AFIK-KNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIFLV  444
            A +K  +ATLLI+INS+G V E +YI++F ++A+  AR   +K LF+   +G F++IFLV
Sbjct  63   ASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVK-LFMVMNVGSFALIFLV  121

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            ++F   G +R+ +VGW+CV+ ++ VFA+PLSIV QV RTK VEF+PF LS FLTLSAVMW
Sbjct  122  TYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKDVEFMPFNLSLFLTLSAVMW  181

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP-----VVEENKNVQ---EHIVN  780
            F YGL++KD+ IA+PNILGF LGLLQ+LLYAIYRN K        +E K ++   +++V 
Sbjct  182  FFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKNVVV  241

Query  781  VEMLGTSNQLVHPVDSGRNISDGVTEINMENND-QG  885
            V  LGT    V+PV            IN ENN+ QG
Sbjct  242  VNPLGTCE--VYPV------------INKENNNGQG  263



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 181/263 (69%), Gaps = 20/263 (8%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H      FG+LGN+IS  V+LAP++ F RI++ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+A LL++INS G V E IYI++++ +A+  AR   LK  F + +G F++I LV+ F  
Sbjct  65   KKDAMLLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLVTHFAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G +R+ ++GWICV+ SI+VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYGL
Sbjct  125  HGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHP  819
             +KD+ IALPN+LGF LGLLQ+LLYAIYRN    V++   + E    +E L T       
Sbjct  185  FLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDK---IMEKKAPLEPLKTV------  235

Query  820  VDSGRNISDGVTEINMENNDQGE  888
                      V E  +E   QG+
Sbjct  236  ----------VIETGLEEKQQGK  248



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 184/270 (68%), Gaps = 9/270 (3%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W  VFG+LGNIIS  V+L+P+  F +IY+ KST GY S+PYVIA+FS MLW+YYAF+K N
Sbjct  7    WAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKTN  66

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TLLI+INS G++ ETIY+ +FL +A  KAR N +K L L  +GGF  I LV+ F F G 
Sbjct  67   TTLLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILVTQFLFKGV  126

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R  +VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLT+SAVMWF YGL++K
Sbjct  127  VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLLK  186

Query  649  DLRIALPNilgfflgllqillYAIYRNA-KPVVEENKNVQEHIVNVEMLG-----TSNQL  810
            D+ IA PNILGF  G+LQ++LYA+YR   KP+V  N  VQ  ++ ++        T  Q+
Sbjct  187  DVNIAAPNILGFIFGILQMILYAMYRKKHKPIVNVNVEVQNPVIILDDNKKIPELTEEQI  246

Query  811  VHPVDSGRNISDGVTEI--NMENNDQGE*K  894
            +  V  G+ +  G  ++   +  N   E K
Sbjct  247  IDIVKLGKLVCSGKIQMASTLNQNASKEVK  276



>ref|XP_006436901.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
 gb|ESR50141.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
Length=285

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 190/272 (70%), Gaps = 5/272 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M +   H PW+  FG+LGNI+S  V+LAP+  F R+ + KST G+ S+PYV+A+FS+MLW
Sbjct  1    MTMFSTHDPWVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +KK+A LLI+IN+ G V ETIY+ +++ FA  +AR   L+ L L   GGF  I L
Sbjct  61   IYYAMMKKDAFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILL  120

Query  442  VSWFPFSGE-IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +S F   G   R+ L+GWICV FS++VFA+PLSI+  V RTKSVEF+PFYLS FLTL+AV
Sbjct  121  LSHFLAKGSAARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN-VQEHIVNVEMLG  795
            MWF YGL +KD+ +A+PN+LGF  G++Q++LYAIYRN + VV E+ N V EH V+V  L 
Sbjct  181  MWFFYGLFLKDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTVDVVKLS  240

Query  796  TSNQLVHPVDSG-RNISDGVTEINMENNDQGE  888
            T+N       +  RN  D   E + + NDQ E
Sbjct  241  TNNMTASEEQTNSRNNFDDKNE-HEQANDQHE  271



>ref|XP_002299333.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
 gb|EEE84138.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
Length=282

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 195/273 (71%), Gaps = 9/273 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++++ HP    FGILGNIIS  VYLAPV  FIRI R KST  + S+PY++A+FSSMLW
Sbjct  1    MAVMNMQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            +YYA +K +  LL++INS G V ETIYI I++ +A+ +++ + +K L  + +G FS+I L
Sbjct  61   LYYAMLKNDEILLVTINSFGCVIETIYIAIYIAYATRESKVSTIKLLLSMNMGLFSLIIL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F  SG  R+  +GW+CVAFS+ VFA+PL+IV Q+ RTKSVEF+PF LSFFLTLSAV+
Sbjct  121  LTHFLASGSTRVKALGWLCVAFSVCVFAAPLNIVKQIIRTKSVEFMPFTLSFFLTLSAVI  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT-  798
            WF YGL +KD+ +ALPNILGF LGLLQ+LLY IYRNA    E+ K   E++ ++ +LGT 
Sbjct  181  WFAYGLFIKDMCVALPNILGFVLGLLQMLLYGIYRNA----EKKKIPAENLKSIVILGTL  236

Query  799  SNQLVHPVDSGRNISDG---VTEINMENNDQGE  888
                V+PVD   ++S      TE + EN    E
Sbjct  237  GASEVYPVDPQPDVSAAEHDQTEESKENEKSME  269



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 186/272 (68%), Gaps = 10/272 (4%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W  VFG+LGNIIS  V+L+P+  F +IY+ KST GY S+PYVIA+FS MLW+YYAF+K N
Sbjct  7    WAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKTN  66

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TLLI+INS G++ ETIY+ +FL +A  KAR N +K L L  +GGF  I +V+ F F G 
Sbjct  67   TTLLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVVTQFVFKGV  126

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R  +VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLT+SAVMWF YGL++K
Sbjct  127  VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLLK  186

Query  649  DLRIALPNilgfflgllqillYAIYR--NAKPVVEENKNVQEHIVNVEMLG-----TSNQ  807
            D+ IA PNILGF  G+LQ++LYA+YR  + KP+V  N  VQ  ++ ++        T  Q
Sbjct  187  DVNIAAPNILGFIFGILQMILYAMYRKKDNKPIVNVNVEVQNPVIILDDNKKIPELTEEQ  246

Query  808  LVHPVDSGRNISDGVTEI--NMENNDQGE*KM  897
            ++  V  G+ +  G  ++   +  N   E K+
Sbjct  247  IIDIVKLGKLVCSGKIQMASTLNQNAAKEVKL  278



>ref|XP_003576036.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brachypodium 
distachyon]
Length=300

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/285 (47%), Positives = 190/285 (67%), Gaps = 18/285 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   YLAP+S F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPWAFAFGLLGNVISFMTYLAPLSTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+IN+ G V ETIYI+++L +A  +A+    K L L  +G F +I L
Sbjct  61   IYYALLKSDGCLLITINTAGCVIETIYIVVYLAYAPKQAKLFTAKILLLLNVGVFGMILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     GE R+ ++GW+CV FS++VF +PLS++  V RT+SVEF+PF LS  LTLSAV+
Sbjct  121  LTLLLSEGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFNLSLSLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEE---------NKNVQE  768
            WF YGL++KD  +ALPNILGF  G++Q+ LYA+YRN+  +PV +E            V E
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNSTPRPVTKEVDAESHDGAAPKVPE  240

Query  769  HIVNVEMLG-----TSNQLVHP-VDSGRNISDGVTEINMENNDQG  885
            H+VN+  LG     T+   +HP ++S     +GV     ++ + G
Sbjct  241  HVVNIGKLGAVELKTTEVFIHPAIESPPTKENGVAHGAEQSREGG  285



>ref|XP_002511126.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51728.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 188/270 (70%), Gaps = 6/270 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI + H+P + VFG+LGNI+S  V+LAPV  F+R+ + KST G+ S PYV+++FS+MLW
Sbjct  1    MAIFNTHNPSVFVFGLLGNIVSFVVFLAPVPTFLRVCKKKSTEGFQSFPYVVSLFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +A LLI+INS+G + ETIYI +F+ +A  +AR   LK L L   GGF +I L
Sbjct  61   LYYASLKSDAFLLITINSVGCLIETIYITLFITYAPKQARITTLKILLLLNFGGFCLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +S F   G  R +++GW+CV FS++VFA+PLS++  V RTKSVEF+PFYLSFFLTLSA+M
Sbjct  121  LSHFLAKGSERATILGWVCVIFSVSVFAAPLSVMRIVIRTKSVEFMPFYLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            W  YGL++KDL IA+PNILG   G+LQ++LY IY+N K VVEE K  + ++ NV++    
Sbjct  181  WLFYGLLLKDLYIAVPNILGLVFGVLQMILYVIYKNVKTVVEEPKLPEHNVDNVKLSAVI  240

Query  802  NQLVHP---VDSGRNISDGV--TEINMENN  876
               V       S  N  DG    E  M +N
Sbjct  241  TCEVQQEVCSQSQPNGDDGAHNKEQKMHDN  270



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 183/266 (69%), Gaps = 4/266 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D HHP +  FG+LGNIIS  V+LAPV  F+RI + KST G+ SVPYV+A+FS+MLW
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            +YYA    N TLLI+INS+G + ET+YI IF+VFA  + R + L+  L L  GGF II L
Sbjct  61   LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F   G  ++ +VGWICVAFS++VFA+PL+I+  V RTKSVEF+PF LSFFLTLSA+ 
Sbjct  121  VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAK-PVVEENKNVQEHIVNVEMLGT  798
            W  YG+ +KD+ +ALPN+LGF  G+ Q++LY IYR  +  + +E K  ++  V++ M   
Sbjct  181  WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPEQTTVDIVMKQK  240

Query  799  SNQLVHPVDSGRNISDGVTEINMENN  876
             +  V  ++    I   + EI + N 
Sbjct  241  QDSSVEAIEV--IIKTNIEEIELSNG  264



>ref|XP_009349481.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 143/272 (53%), Positives = 189/272 (69%), Gaps = 15/272 (6%)
 Frame = +1

Query  85   MAIL-DLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MAI+ D HHP    FGILGN+IS  VYL+PV  F RIYR KST G+HSVPY++A+FSSML
Sbjct  1    MAIVADSHHPLAFTFGILGNLISAMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSML  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSII  435
            W YYA +K NA +LI+INS G   E IYI++F+V+A  +AR+  +K LF  + +G F++I
Sbjct  61   WFYYALVKTNAMMLITINSFGSFVEIIYIVMFVVYAPKEARKLTVK-LFGIMNVGLFTMI  119

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
             +VS F      R+ ++GWI VA S  VF +PLSIV QV RT+SVEF+PF LSFFLTLSA
Sbjct  120  LIVSHFLVGSAYRVPILGWINVAISTGVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ---------E  768
            VMWF YGL++KD+ + +PN+LGF LGLLQILLY I RN + V+ ++   +         +
Sbjct  180  VMWFAYGLLLKDICVVIPNVLGFVLGLLQILLYGICRNREQVIIDDHEKKLPAATHENVK  239

Query  769  HIVNVEMLGTSNQLVHPVDSGRNISDGVTEIN  864
            +IV + +L  S   VHPVD   N  +  T++N
Sbjct  240  NIVIIAILAASE--VHPVDDQPNNCNNDTDVN  269



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 189/270 (70%), Gaps = 10/270 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L +HHPW   FG+LGNIIS  VYL+P+  F R+Y+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAFLSVHHPWAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            +YYA +K +  LLI+IN++G + E+IYI +++++A  KA+    K  + L +G F +I L
Sbjct  61   IYYALLKTDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F   G  R+ ++GW+CV FS+ VFA+PLSI+  V +TKSVEF+PF LSF LTLSAVM
Sbjct  121  LTLFFVQGPKRVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE--HIVNVEMLG  795
            WF YGL+ KD  IALPN+LGF  G++Q++LY IY+  K    + K  ++  +IV +  LG
Sbjct  181  WFSYGLLTKDFYIALPNVLGFIFGIIQMVLYIIYKGTKKAFIDKKLPEQVVNIVKISTLG  240

Query  796  TSNQLVHPVD----SGRNISDGVTEINMEN  873
            +S+  V P++    SG  ++D V E ++E 
Sbjct  241  SSD--VFPINGQAVSGECVTDSV-EKSLEQ  267



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 187/288 (65%), Gaps = 26/288 (9%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA + L HPW   FG+LGNIIS   YLAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+INS G V ETIYI ++LV+A  KA+    K L L  +G F +I L
Sbjct  61   IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +G+ RI ++GW+CV FS++VF +PLSI+  V RTKSVEF+PF LSF LT+SAV+
Sbjct  121  LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------------  765
            WF YGL++KD  +ALPN+LGF  G++Q+ LYA+YRN+ P     K V+            
Sbjct  181  WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSA  240

Query  766  ----EHIVNVEMLGTS-----NQLVHPVDSGRNISDGVTEINMENNDQ  882
                EH+VN+  L  +      + VHPVD    +     E   E +D+
Sbjct  241  AGVKEHVVNIAKLSAAVDVVKTREVHPVD----VESPPAEAPPEEDDK  284



>ref|XP_002514863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47417.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 182/253 (72%), Gaps = 6/253 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI+  H P    FGILGNIISI VYLAPV  F RIYR KST G+ S+PY++A+FSSMLW
Sbjct  1    MAIISTHPPLAFAFGILGNIISILVYLAPVPTFYRIYRKKSTEGFQSLPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            +YYA +KK+  LL++IN+ G V ETIYI++++++A+ K R +  K L  + +G F+ I L
Sbjct  61   LYYAMLKKDVFLLVTINAFGCVIETIYIIMYIIYATKKNRVSTFKVLTSMNLGLFAFIIL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
             S F     +R  ++GWICVA S+ VFA+PLSIV QV +T+SVEF+PF LSFFLTLSA+M
Sbjct  121  FSHFLVKSSVRAQVLGWICVAVSVCVFAAPLSIVAQVIKTRSVEFMPFNLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT-  798
            WF YGL  KD  +ALPN+LGF LGLLQ++LY IYR AK V+ E K + EH+  + +L T 
Sbjct  181  WFAYGLSTKDTCVALPNVLGFILGLLQMVLYVIYRKAKKVILEEK-LPEHLKTIVVLSTL  239

Query  799  ---SNQLVHPVDS  828
                 QLV PV S
Sbjct  240  GNSEQQLVTPVGS  252



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 184/270 (68%), Gaps = 7/270 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FGILGNIIS  VYLAP+  F R+ R KST G+HSVPYV+A+FS+ LW
Sbjct  1    MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            ++YAF+K NA LLI+IN++G V ET Y++++  +A   A+    K + L  +G F +I +
Sbjct  61   IFYAFLKTNAGLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAKLVLLVNVGMFGLILV  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     G  R+ ++GWIC++FS++VF +PLSI+  V RTKSVEF+PF LSFFLT SAV+
Sbjct  121  LTLLFARGAKRVEVLGWICMSFSVSVFVAPLSIIRLVIRTKSVEFMPFSLSFFLTWSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WFGYGL+ KDL +ALPN+LGF  G+LQ++LY  YRN    + E K + EHI +   LGT+
Sbjct  181  WFGYGLLTKDLYVALPNVLGFIFGVLQMVLYVAYRNKDKAMVEQK-LPEHIAS--KLGTA  237

Query  802  NQL--VHPVDSGRNISDGVTEINMENNDQG  885
             ++  ++ +     + +   E   E + QG
Sbjct  238  EKVLEIYAIGVEEKVPNRAQE-EQEEDKQG  266



>ref|XP_008440025.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=291

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 182/271 (67%), Gaps = 3/271 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D HHP +  FG+LGNIIS  V+LAPV  F+RI + KST G+ SVPYV+A+FS+MLW
Sbjct  1    MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            +YYA    N TLLI+INS+G + ET+YI IF+VFA  + R + L+  L L  GGF II L
Sbjct  61   LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F   G  ++ +VGWICVAFS++VFA+PL+I+  V RTKSVEF+PF LSFFLTLSA+ 
Sbjct  121  VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEH--IVNVEMLG  795
            W  YG+ +KD+ +ALPN+LGF  G+ Q++LY IYR  +  + +   + E   + ++ M  
Sbjct  181  WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKYEIAIAKEMKLPEQTKMDDIAMKQ  240

Query  796  TSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
              +  V  ++     +    E+   NND  +
Sbjct  241  KQDSSVEAIEVIITTNIEEIELGNGNNDDDD  271



>ref|XP_004490502.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=270

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 192/270 (71%), Gaps = 12/270 (4%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            ++ H     VFGILGNIIS  V+LAP+  F RI++ KST G+ S+PY++A+FSSMLW+YY
Sbjct  1    MEKHIHLAFVFGILGNIISFMVFLAPLPTFYRIWKKKSTQGFQSLPYLVALFSSMLWLYY  60

Query  274  AFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIFLVS  447
            A +K NA LLI+INS G V ETIYI+I+ ++A+  AR   +K LF+   +G F++IF  +
Sbjct  61   AIVKTNARLLITINSFGCVIETIYIVIYTIYATKDARILTVK-LFMVMNVGSFALIFFTT  119

Query  448  WFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWF  627
             F   G +R+ ++GWICV+F++ VFA+PL IV +V RTKSVEF+PF LSFFLTLSA+MWF
Sbjct  120  QFGMHGSLRVQVLGWICVSFAVCVFAAPLCIVAKVIRTKSVEFMPFNLSFFLTLSAIMWF  179

Query  628  GYGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK--NVQEHIVNVEMLGT  798
             YGL++KD+ IALPN+LGF LGLLQ+LLYAIY + +K  ++E+   N   ++V V  LGT
Sbjct  180  AYGLLLKDICIALPNVLGFTLGLLQMLLYAIYNKGSKVSIKEDYALNPMTNVVVVNPLGT  239

Query  799  SNQLVHP-----VDSGRNISDGVTEINMEN  873
               +  P        G++ ++   E N+EN
Sbjct  240  CEVVTIPDIDIVTTQGKDGAEE-KEKNVEN  268



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 175/239 (73%), Gaps = 6/239 (3%)
 Frame = +1

Query  100  LHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAF  279
            +HHP  L FG+LGNIIS  V+LAP+  F +IY+ K+T G+ ++PY +A+FS MLW+YYA 
Sbjct  3    IHHPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYYAL  62

Query  280  IKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            +K++AT LI+INS+G V ET+Y+ IFL ++  KAR + +K L L  + G+ ++ +++ F 
Sbjct  63   LKQDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTLFL  122

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              GEIR+ +VGWIC+ F++ VFA+PL I+ +V RTKSVEF+PF LSFFLTL AVMWF YG
Sbjct  123  AKGEIRLKVVGWICLVFNLTVFAAPLCILKKVIRTKSVEFMPFPLSFFLTLGAVMWFFYG  182

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVV--EENKNVQE---HIVNVEMLGT  798
             ++KD  IA PNILGF  G+ Q++LY +Y+NAK VV  EE   VQE   HI+ V  + T
Sbjct  183  FLLKDYNIAFPNILGFMFGIAQMVLYIVYKNAKKVVLLEEPSKVQELSDHIIEVMKIST  241



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/288 (47%), Positives = 187/288 (65%), Gaps = 26/288 (9%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA + L HPW   FG+LGNIIS   YLAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+INS G V ETIYI ++LV+A  KA+    K L L  +G F +I L
Sbjct  61   IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +G+ RI ++GW+CV FS++VF +PLSI+  V RTKSVEF+PF LSF LT+SAV+
Sbjct  121  LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------------  765
            WF YGL++KD  +ALPN+LGF  G++Q+ LYA+YRN+ P     K V+            
Sbjct  181  WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSA  240

Query  766  ----EHIVNVEMLGTS-----NQLVHPVDSGRNISDGVTEINMENNDQ  882
                EH+VN+  L  +      + VHPVD    +     E   + +D+
Sbjct  241  AGVKEHVVNIAKLSAAVDVVKTREVHPVD----VESPPAEAPPQEDDK  284



>ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=296

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 185/279 (66%), Gaps = 11/279 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FGILGNIIS  VY+AP+  F R+Y  KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLDHPWAFTFGILGNIISFMVYVAPLPTFYRVYIKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARR-NALKELFLCIGGFSIIFL  441
            +YYA IK ++ LL++INSIG + ET+YI+++L +A  KAR   A   L L +G F +I L
Sbjct  61   IYYALIKTDSYLLVTINSIGCIIETMYIIMYLSYAPKKARIFTAQILLLLNVGLFGLIVL  120

Query  442  VSWFPFSG-EIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            ++     G   ++ ++GW+CV+FSI+VF +PLSI+  V RTKSVEF+PF+LSFFLTLSA+
Sbjct  121  LTLLLAKGPREQVRVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTLSAI  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT  798
             WF YGL+ KD+ +ALPNILGF  G++Q+ +Y  Y+ AK    +   V EHI+ +  LGT
Sbjct  181  AWFSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGAKRAAYDQNKVAEHIITMAKLGT  240

Query  799  SNQ--LVHPVD-------SGRNISDGVTEINMENNDQGE  888
              +   VHP+D        G   +D   +   E    G+
Sbjct  241  GERSSEVHPIDVISSPGVHGEEDADREDQERHEPTHDGD  279



>ref|XP_007038077.1| Medicago truncatula MTN3, putative [Theobroma cacao]
 gb|EOY22578.1| Medicago truncatula MTN3, putative [Theobroma cacao]
Length=289

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 187/274 (68%), Gaps = 8/274 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M +    +PW+ + G+LGNI S  V+LAP+  FIR+ + KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGVFATDNPWVFISGLLGNISSFVVFLAPLPTFIRVCKKKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            MYYAF+K  A LL++INS G V ET YI I++ +A  +AR   L+ L L   GGF  I L
Sbjct  61   MYYAFVKSGAFLLVTINSFGCVVETAYIAIYIAYAPKQARMFTLRILLLMNFGGFCSILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            VS F   G  R+ ++GWICVAF+  VFA+PLSI+ QV RTKSVEF+PFYLSFFLTLSA+M
Sbjct  121  VSRFLAKGSNRVEVLGWICVAFATGVFAAPLSIIRQVIRTKSVEFMPFYLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT-  798
            W  YG+ +KDL IA+PN+LGF  GLLQ++LYAIYRN+K V +E +   EH +++  L T 
Sbjct  181  WLLYGIFLKDLYIAIPNVLGFIFGLLQMVLYAIYRNSKTVTKEVE-APEHSIDITKLSTV  239

Query  799  ----SNQLVHPVDSGRNISDGVTEINMENNDQGE  888
                  ++    D   + S G  ++  E +DQ E
Sbjct  240  MNSEVQEMSSEPDVAHDKSIGSCKVQNE-HDQRE  272



>ref|XP_006493253.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X2 [Citrus sinensis]
Length=285

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 189/272 (69%), Gaps = 5/272 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M +   H P +  FG+LGNI+S  V+LAP+  F R+ + KST G+ S+PYV+A+FS+MLW
Sbjct  1    MTMFSTHDPSVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +KK+A LLI+IN+ G V ETIY+ +++ FA  +AR   L+ L L   GGF  I L
Sbjct  61   IYYAMMKKDAFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILL  120

Query  442  VSWFPFSGE-IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +S F   G   R+ L+GWICV FS++VFA+PLSI+  V RTKSVEF+PFYLS FLTL+AV
Sbjct  121  LSHFLAKGSAARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN-VQEHIVNVEMLG  795
            MWF YGL +KD+ +A+PN+LGF  G++Q++LYAIYRN + VV E+ N V EH V+V  L 
Sbjct  181  MWFFYGLFLKDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTVDVVKLS  240

Query  796  TSNQLVHPVDSG-RNISDGVTEINMENNDQGE  888
            T+N       +  RN  D   E + + NDQ E
Sbjct  241  TNNMTASEEQTNSRNNFDDKNE-HEQANDQHE  271



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 182/280 (65%), Gaps = 26/280 (9%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNIIS  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW+YYAF+K N
Sbjct  8    WAFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TL+I+INS G   ETIY+  +L +A  KAR   LK L L  +GGF +I LV+ F F G 
Sbjct  68   TTLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVTQFLFKGA  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
             R   VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  128  ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  649  DLRIALPNilgfflgllqillYAIY-----------------RNAKPVVEENKN------  759
            D+ IA+PNILGF LG+LQI+LY IY                 +N   +V+EN N      
Sbjct  188  DINIAIPNILGFILGILQIVLYIIYNKKEKAILKEQKLPEKIQNHVIIVDENNNQKLPEL  247

Query  760  VQEHIVNVEMLGT--SNQLVHPVDSGRNISDGVTEINMEN  873
             +EHI+++  LG+  S+  +H      N + GV    +EN
Sbjct  248  TEEHIIDIVKLGSLISSGKIHVASCLHNSTCGVEAAKVEN  287



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 189/268 (71%), Gaps = 12/268 (4%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H  W  VFG+LGN+IS  V+LAP+  F +IY+ KS+ G+ S+PYV+A+FSSMLW+YYAF+
Sbjct  5    HETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAFV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFP  456
            KK+A+LL I+INS G V ETIY+ IFLV+A SK R   +K L  L + GF  + L + + 
Sbjct  65   KKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
             +G  R++++GWIC+ F+I+VFA+PL I+ +V +TKSVEF+PF LSF LT++AVMWF YG
Sbjct  125  TTGSKRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE---HIVNVEMLGTSNQ  807
            L++KD  IALPN LGF  G++Q++LY IYRNAK   +E   ++E   HI+NV  L     
Sbjct  185  LLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKK--DEPMKLEELNSHIINVGKLSR---  239

Query  808  LVHPVDSGRNISDG-VTEINMENNDQGE  888
             + P +      +G VTEI +E+ +  E
Sbjct  240  -MEPSEPNHATKNGTVTEITIEDPNGKE  266



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 184/269 (68%), Gaps = 6/269 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA     +  + +FG+LGN+ S+ V+LAPV  F R+Y+ KST G+ SVPYV+A+FS+M+W
Sbjct  1    MAAFATDNLGVFIFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKE-LFLCIGGFSIIFL  441
            +YYA +K +  LLI+INS+G V ETIYI +++ +A+ +AR   L+  L L  GGF +I L
Sbjct  61   LYYATLKSDLILLITINSVGCVIETIYIALYIAYATKQARIFTLRLILLLNFGGFCLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +S F   G +R +++GW+C +F+++VFA+PLSI+  V RTKSVEF+P  LSFFLTLSA M
Sbjct  121  LSHFLAKGSLRATVLGWVCTSFAVSVFAAPLSIIRVVIRTKSVEFMPLPLSFFLTLSATM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHI-VNVEMLGT  798
            W  YGL++KDL +A+PN++G   G+LQ++LY IYR  K V+ E + VQE I  ++E   T
Sbjct  181  WLMYGLMLKDLCVAIPNVMGLIFGVLQMVLYVIYRKNKTVLVEEQKVQEQIKADIEKAET  240

Query  799  ----SNQLVHPVDSGRNISDGVTEINMEN  873
                  Q++    +  N S    +IN EN
Sbjct  241  IIMAEVQVISTESNNNNESKEKEKINHEN  269



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 180/259 (69%), Gaps = 16/259 (6%)
 Frame = +1

Query  136  GNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATLLISIN  315
            GNI+S  V+LAP+  F R+Y+ KST G+ SVPYV A+FS+M+W+YYAF+K +  LLI+IN
Sbjct  3    GNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSHVILLITIN  62

Query  316  SIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGEIRISLVGW  492
            S G V ETIYI I+L +A+  AR + L+ L L   GGF +I L+S F   G  R+ ++GW
Sbjct  63   SFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLSQGPTRVEVLGW  122

Query  493  ICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLRIALPN  672
            +CV FS++VFA+PLS++  V RTKSVEF+PF LSFFLTLSAVMW  YGL++KDL +A PN
Sbjct  123  VCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLLKDLYVATPN  182

Query  673  ilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNV----EMLGTSN----QLVHPVDS  828
            ILGF  G++Q+ LYA YRN K +VEE   + EH  +V    ++L T+     Q+  PV S
Sbjct  183  ILGFSFGVVQMALYAKYRNTKTIVEE--KLPEHKADVVKQIKILTTTPEVEVQVQAPVTS  240

Query  829  GRNISDGVTEINMENNDQG  885
              N +D       +N+++G
Sbjct  241  DTNSTDA-----HQNSERG  254



>ref|XP_004980522.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=299

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 181/267 (68%), Gaps = 19/267 (7%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HP    FG+LGNIIS   YLAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLDHPLAFTFGLLGNIISFMTYLAPLPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARR-NALKELFLCIGGFSIIFL  441
            +YYA +K +  LLI++N+ G V ET+YI ++L +A  KA+   A+  L L +G F +I L
Sbjct  61   IYYALLKSDEFLLITVNAAGCVIETLYITMYLAYAPKKAKLFTAMILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +GE R+ L+GW+CV F+++VF +PLSI+ QV RT+SVEF+PF+LS  LT+SAV+
Sbjct  121  LTMLLAAGEKRVVLLGWVCVGFAVSVFVAPLSIIRQVVRTRSVEFMPFFLSLSLTVSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP-------------VVEENKNV  762
            WF YGL++KD  +ALPN++GF  G++Q+ LYA+YRNA P             VV++   V
Sbjct  181  WFLYGLLIKDKYVALPNVIGFTFGVIQMGLYALYRNATPRVPAKEVADVKATVVDDTFKV  240

Query  763  QEHIVNVEMLGTS-----NQLVHPVDS  828
             EH+V +  LG          VHPV+S
Sbjct  241  PEHVVTIAKLGAPAVEILTSEVHPVES  267



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 169/245 (69%), Gaps = 1/245 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H P    FGILGNI+S  V+LAPV  F R+Y+ KST G+ S+PY+ A+FS+ +W+YYA +
Sbjct  5    HSPLAFAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIYYASL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPF  459
            K +  LLI+IN  G V ETIYI +++ +A  KAR N L+ L L   GGF +I  +S F  
Sbjct  65   KSDEMLLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLLVNFGGFCLILFLSHFLT  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R+ ++GW+CVAFS++VFA+PLSI+  V RTKSVEF+PF LSFFLTLSA+MW  YGL
Sbjct  125  QGPTRVKVLGWVCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAIMWLFYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHP  819
            ++KDL +A PNILGF  G++Q++LYA YRN K V+ + + V EH    + +   N  V P
Sbjct  185  LLKDLYVAAPNILGFSFGVVQMILYAAYRNKKTVLVDEEKVPEHKTADDFVKQINITVLP  244

Query  820  VDSGR  834
                +
Sbjct  245  SPKAQ  249



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 183/254 (72%), Gaps = 8/254 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H  W  +FG+LGN+IS  V+LAP+  F +IY+ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFP  456
            KK+A+LL I+INS G V ETIY+ IFL++A SK R   +K L  L + GF  + L + + 
Sbjct  65   KKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
             +G  R+S++GWIC+  +I+VFA+PL I+ +V +TKSVEF+PF LSFFLT++AVMWF YG
Sbjct  125  TTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKNVQE---HIVNVEMLG--T  798
            L++KD  IALPN LGF  G++Q++LY IYRNAKP  +EE   VQE   HI++V      T
Sbjct  185  LLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTKVQELNGHIIDVVKPNHVT  244

Query  799  SNQLVHPVDSGRNI  840
             N  V  +++  N+
Sbjct  245  KNGPVPVIETASNV  258



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 166/230 (72%), Gaps = 1/230 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HHP    FG+LGNI S  V+LAP+  F R+Y+ KST G+ SVPYV A+F++ +W+YYAF+
Sbjct  7    HHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIYYAFL  66

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPF  459
            K N  LLI+INS G V ETIYI I+L +A+ +AR + L+ LFL   GGF  I L++ F  
Sbjct  67   KSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFLVNFGGFCFILLLAHFLS  126

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R++++GW+CV FS++VFA+PLS++  V  TKSVEF+PF LSFFLTLSAVMW  YGL
Sbjct  127  QGPTRVAVLGWVCVTFSVSVFAAPLSVMKMVIHTKSVEFMPFNLSFFLTLSAVMWLSYGL  186

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEM  789
            ++KDL +A PNI+GF  GL+Q+ LYA YRN K  VE+    Q+  V  +M
Sbjct  187  LLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNVEKKLPEQKADVVKQM  236



>ref|XP_003551863.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=271

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 180/266 (68%), Gaps = 9/266 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH     FG+LGN+IS  V+LAPV  F RIY+ KST  + S+PY++A+FSSMLW+YYA +
Sbjct  5    HHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYAML  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLVSWFP  456
            K++A LLI+INS G V E IYI++++ +A+  AR   +K LF  + +  F++I LV+ F 
Sbjct  65   KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIK-LFSAMNMSSFALILLVTHFA  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G +R+ ++GWICV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYG
Sbjct  124  VHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYR--NAKPVVEENKNVQ--EHIVNVEMLGTSN  804
            L +KD+ IALPN+LGF LGLLQ+LLY IYR  N K    E   V+  + I  V  LGT  
Sbjct  184  LFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNEKSPVEPLKSIAVVNPLGTGE  243

Query  805  QLVHPVDSGRNISDGVTEINMENNDQ  882
              V PV+     +        +   Q
Sbjct  244  --VFPVEEDEQAAKKSQGDGDDKKGQ  267



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/261 (51%), Positives = 188/261 (72%), Gaps = 9/261 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H  W  VFG+LGN+IS  V+LAP+  F +IY+ K+  G+ S+PYV+A+FSSMLW+YYA +
Sbjct  5    HETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIYYALV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            KK+A+LL I+INS G V E+IY+ IFL++A SK R   +K L L  + GF  + L + + 
Sbjct  65   KKDASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLSTLYF  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
             +G  R+S++GWIC+ F+I+VFA+PL I+ +V +TKSVE++PF LSFFLT++AVMWF YG
Sbjct  125  TTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKP-VVEENKNVQE---HIVNVEMLGT--  798
            L++KD  IALPN LGF  G++Q++LY +YRNAKP  +EE   +QE   HIV+V  LGT  
Sbjct  185  LLLKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEPTKLQELNGHIVDVVKLGTMA  244

Query  799  SNQLVHPVDSGRNISDGVTEI  861
             ++  H   SG  +++  T +
Sbjct  245  PSEPNHVTKSGA-VTETATNV  264



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 180/267 (67%), Gaps = 14/267 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA +  H  W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW
Sbjct  1    MAAISGH--WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K N TL+I+INS G   ETIY+  +L +A  KAR   +K L L  +GGF +I L
Sbjct  59   VYYAFLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G  R   VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAVM
Sbjct  119  VTQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK---NVQEHIVNVEM  789
            WF YGL++KD+ IA+PN+LGF LG+LQI+LY IY +  K +++E K    +Q H++ V+ 
Sbjct  179  WFFYGLLVKDINIAIPNVLGFVLGILQIVLYVIYNKKEKAILKEEKVPEKIQNHVIIVDD  238

Query  790  LG-------TSNQLVHPVDSGRNISDG  849
                     T  Q++  V  G  IS G
Sbjct  239  YNNQKLPELTEEQIIDIVKLGSLISSG  265



>gb|ACV71016.1| UPA16 [Capsicum annuum]
Length=301

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 181/284 (64%), Gaps = 29/284 (10%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNIIS  V+L+P+  F  IY+ K+  GY S+PYVIA+FSSMLW+YYAF+K N
Sbjct  8    WAFAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TLLI+INS GI  ETIY+ ++L +A  KAR + +K L L  +GGF  I LV+ F F G 
Sbjct  68   VTLLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLVTQFLFKGV  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R  +VGWIC+ F+++VF +PL IV QV +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  128  VRGQIVGWICLIFALSVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVV-----------------EENKN------  759
            D+ IA PN+LGF  G+LQI+LYAIY   + V+                 ++N N      
Sbjct  188  DINIAAPNVLGFIFGVLQIVLYAIYSKKEKVILKEQKLPEIQKPAVIVADDNTNANKKLP  247

Query  760  --VQEHIVNVEMLG---TSNQLVHPVDSGRNISDGVTEINMENN  876
                E I+++  L    T  +  H      +++ GV   N+ENN
Sbjct  248  ELTHEQIIDIVKLAGLLTCTEKSHVATCPHDVNCGVEATNVENN  291



>gb|EMT20480.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=287

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 187/280 (67%), Gaps = 16/280 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L L HPW   FG+LGN+IS   YLAP+  F RIYR+KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSLQHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+INS G + ETIYI+++L +A  +A+    K L L  +G F +I L
Sbjct  61   IYYALLKSDELLLITINSAGCIIETIYIVMYLAYAPKQAKIFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     GE R+ ++GW+CV FS++VF +PLSI+  V RT+SVEF+PF LS  LT+SAV+
Sbjct  121  LTLLLAGGEKRVVMLGWVCVGFSVSVFVAPLSIIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV---EENKNVQEHIVNVEML  792
            WF YGL++KD  +ALPNILGF  G++Q+ LYAIY NA P +   E ++ + EH++NV  L
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYAIYCNATPTLAPKEVDRPLPEHVINVAKL  240

Query  793  GTSNQL-------VHPVDSGRNI----SDGVTEINMENND  879
            G +  +       V P  +  NI    S    EI++E  D
Sbjct  241  GPTATIELNMPAAVQP-PTKENIVACASGETKEISVEKVD  279



>gb|EMT22394.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=296

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 187/285 (66%), Gaps = 17/285 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L + HPW   FG+LGN+IS   YLAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSVQHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+INS G V ETIYI+++L +A  +AR    K L L  +G F +I L
Sbjct  61   IYYALLKSDEYLLITINSAGCVIETIYIVLYLAYAHKQARIFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +GE RI ++GW+CV FS++VF +PLS++  V RT+SVEF+PF LS  LT SAV+
Sbjct  121  LTLLLTAGERRIVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP---------VVEENKNVQ--E  768
            WF YGL++KD  +ALPNILGF  G++Q+ LYA+YRNA P          V ++  V+  E
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNATPRPAPKEVDAPVSDDGAVKPSE  240

Query  769  HIVNVEMLGTSNQLV-----HPVDSGRNISDGVTEINMENNDQGE  888
            H+VN+  LG +   +     +PVD   ++ +G  + N      GE
Sbjct  241  HVVNIAKLGPAATAIELNTHYPVDPPPSMKEGAAKENGVACASGE  285



>ref|XP_009614916.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X2 [Nicotiana tomentosiformis]
Length=298

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 168/231 (73%), Gaps = 4/231 (2%)
 Frame = +1

Query  97   DLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            D    W   FG+LGNI+S FV+L+P+  F +IYR KST GY S+PYV+A+FS+MLW+YYA
Sbjct  3    DFSGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYRKKSTEGYQSIPYVVALFSAMLWIYYA  62

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI-GGFSIIFLVSWF  453
            F+K N TLLI+INS G   ETIY+  +L +A  KAR   +K L L +  GF  I LV+ F
Sbjct  63   FLKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVLVTQF  122

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
             F G +R+ +VGWIC+ FS+ VF SPL I+ QV +TKS E++PF+LS FLTLSAVMWF Y
Sbjct  123  LFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVMWFFY  182

Query  634  GLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENK--NVQEHIV  777
            GL++KD  IA+PN+LGF LG+LQ++LY +Y   + V V+E+K   +Q H++
Sbjct  183  GLLLKDFNIAIPNVLGFILGILQMVLYVMYNKKEEVIVKEHKFPELQNHVI  233



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/281 (48%), Positives = 181/281 (64%), Gaps = 19/281 (7%)
 Frame = +1

Query  97   DLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            + H+P    FG+LGNIIS  V+LAPV  F+RIY+ KST G+ S+PYV+A+FS+MLW+YYA
Sbjct  6    NTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYA  65

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWF  453
                N TLLI+INS+G + ETIY+ IF+VFA  + R + L+  L L  GGF II LV+ F
Sbjct  66   SFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
               G  R+ +VGWICVAFSI+VFA+PL+I+  V RTKSVEF+PFYLSFFLTLSA  W  Y
Sbjct  126  LVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  634  GLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEEN--KNVQEHIVNVEMLGTSNQ  807
            G+ +KD+ IA+PNI GF  G+ Q++LY IY+  +  +E    ++  ++ V V     S++
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNTVIVSAATNSDK  245

Query  808  LVHPVDS-------GRNISDGVTEI---------NMENNDQ  882
                  S       G  + D VT           N+E N Q
Sbjct  246  QKQHSSSLPSNNLVGAAVDDDVTTTTKNGIDPINNLEENHQ  286



>ref|XP_009411801.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 185/264 (70%), Gaps = 7/264 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HP    FG+LGN+IS  V+LAP+  F R+YR KST G+HS+PYV+A+FS MLW
Sbjct  1    MAGLSLQHPLPFTFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSLPYVVAVFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKE-LFLCIGGFSIIFL  441
            +YYA++K ++ LLI+INS G+  ET YI I+L++A  K R  +++  + L +  F+ I L
Sbjct  61   IYYAYVKTDSILLITINSFGVFIETAYITIYLIYAPKKTRIMSMRIFVLLNVVVFAAIIL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++   F+G IR+ ++GWICV FS++VFA+PLS++  V RTKSVEFLPFYLSFFLTLSA+ 
Sbjct  121  LTQLLFTGSIRLKVLGWICVGFSVSVFAAPLSVIRLVIRTKSVEFLPFYLSFFLTLSAIA  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEML--G  795
            WFGYGL  KD+ + LPN+LGF  G+ Q++LY +Y+  K VV E   + EHIV +  L   
Sbjct  181  WFGYGLFTKDIYVQLPNVLGFLFGVAQMVLYIVYKKKKNVVVEPAGI-EHIVRIAELAIA  239

Query  796  TSNQL---VHPVDSGRNISDGVTE  858
             +++L   V   D  +  S+G TE
Sbjct  240  PASELQAGVEENDHRKKASEGSTE  263



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 184/267 (69%), Gaps = 10/267 (4%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H P ++ FGILGN++S  V+LAPV  F RIY+ KST G+ SVPYV A+FS+M+W+YYAF+
Sbjct  7    HSPLVIAFGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFL  66

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPF  459
            K +  LLI+IN+ G + ETIYI +++ +A  +AR  AL+ L L   GGF +I L+S F  
Sbjct  67   KSDEFLLITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFLA  126

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R+ ++GW+CVAFS++VFA+PLSI+  V RTKS   +PF LSFFLTLSAVMW  YGL
Sbjct  127  QGPTRVEVLGWVCVAFSVSVFAAPLSIMRVVIRTKS---MPFSLSFFLTLSAVMWLFYGL  183

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEH----IVNVEMLGTSNQ  807
            ++KDL +A PNILGF  G+ Q++LYAIYRN K V+ E++ +  H    +  +++L T+ +
Sbjct  184  LLKDLYVACPNILGFTFGVAQMILYAIYRNKKTVLVEDQKLPVHKGDVVKQIQILSTTPE  243

Query  808  LVHPVDSGRNISDGVT--EINMENNDQ  882
            +   V +    S   T  E   +N DQ
Sbjct  244  VEIQVQAAAVSSHANTDNENCEQNKDQ  270



>ref|XP_010027258.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=294

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 186/290 (64%), Gaps = 22/290 (8%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA  D HH W L FGILGNI+S FV+LAP   F RIY+ KST G+ S+PY++A+FSSMLW
Sbjct  1    MAFFDHHHFWTLTFGILGNIVSFFVFLAPAPTFYRIYKEKSTEGFQSIPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K ++ LLI+INS G V E +YI I++ +A   AR + +K   L  +G FS++ L
Sbjct  61   LYYAFLKGHSFLLITINSFGCVIEMVYIAIYIAYALRAARSSTIKLFALMNVGLFSLLIL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +  F  +G+ R ++ GWIC   S++VFA+PL IV +V RTKSVEF+PF LSFFLTLSA+M
Sbjct  121  IIHFIPNGDARTTVFGWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WFGYG   KD  I +PNI+GF LGL Q++LY  YRN   ++ +++ + E +    +  TS
Sbjct  181  WFGYGFFQKDWCIMIPNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEKLPQHVVHPTS  240

Query  802  NQ--LVHPV--------DSGRNISD-----------GVTEINMENNDQGE  888
             +  +VHPV        + G   +D           G  E+ +  ND G 
Sbjct  241  GRASVVHPVTVEISLPINGGEARADEQQPQPSQLPEGAVEVVVSGNDPGS  290



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 179/275 (65%), Gaps = 17/275 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L   HPW   FG+LGN+IS   YLAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSAQHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+IN+ G V ETIYI+++L +A  +AR    K L L  +G F +I L
Sbjct  61   IYYALLKSDEYLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +GE R+ ++GW+CV FS+ VF +PLS++  V RT+SVEF+PF LS  LT SAV+
Sbjct  121  LTLLLTAGERRVVMLGWVCVGFSVCVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENK-----------NVQE  768
            WF YGL++KD  +ALPNILGF  G++Q+ LYA+YRNA P+    +              E
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNATPIPAPKEMDAPESEDGAVKAPE  240

Query  769  HIVNVEMLGTSNQLV-----HPVDSGRNISDGVTE  858
            H+VN+  LGT+   +     HPV+    + +G  +
Sbjct  241  HVVNIAKLGTAAAAIELNTNHPVEPPPPMKEGTAK  275



>gb|KHN03192.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=271

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 180/266 (68%), Gaps = 9/266 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH     FG+LGN+IS  V+LAPV  F RIY+ KST  + S+PY++A+FSSMLW+YYA +
Sbjct  5    HHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYAML  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLVSWFP  456
            K++A LLI+INS G V E IYI++++ +A+  AR   +K LF  + +  F++I LV+ F 
Sbjct  65   KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIK-LFSAMNMSSFALILLVTHFA  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G +R+ ++GWICV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYG
Sbjct  124  VHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYR--NAKPVVEENKNVQ--EHIVNVEMLGTSN  804
            L +KD+ IALPN+LGF LGLLQ+LLY IYR  N K    +   V+  + I  V  LGT  
Sbjct  184  LFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNDKSPVEPLKSIAVVNPLGTGE  243

Query  805  QLVHPVDSGRNISDGVTEINMENNDQ  882
              V PV+     +        +   Q
Sbjct  244  --VFPVEEDEQAAKKSQGDGDDKKGQ  267



>gb|EPS72542.1| hypothetical protein M569_02215, partial [Genlisea aurea]
Length=219

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 161/219 (74%), Gaps = 1/219 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH   L FGILGNIIS FVY +P+  F RIY+ KSTM + S+PY +A+FS+MLWMYYAF+
Sbjct  1    HHHIGLAFGILGNIISFFVYFSPMPTFWRIYKEKSTMEFDSLPYAVALFSAMLWMYYAFL  60

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWFPF  459
            K ++ LLI+INS G V +T Y+ ++ ++AS  ARR  LK L  + +G   +I  VS+  F
Sbjct  61   KPHSFLLITINSFGCVIQTFYLTLYFIYASRPARRQCLKILGIMNVGALGLILGVSYICF  120

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G IR+ +VGW CVA S+ VFA+PL IV+ V +T+S EF+PFYLSFFLTLSAVMWFGYG+
Sbjct  121  EGHIRVQVVGWACVAVSVGVFAAPLRIVIHVVKTRSAEFMPFYLSFFLTLSAVMWFGYGI  180

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENK  756
               DL IA+PN++GF LGL+Q+LL+  YR AK   +E K
Sbjct  181  FQHDLCIAIPNVVGFALGLVQMLLFLAYREAKTNEKEGK  219



>ref|XP_003530901.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=272

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 178/246 (72%), Gaps = 8/246 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH     FG+LGN+IS  V+LAPV  F RIY+ KST  + S+PY++A+FSSMLW+YYA +
Sbjct  5    HHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLVSWFP  456
            K++A LLI+INS G V E IYI++++ +A+  AR   +K LF  + +  F++I LV+ F 
Sbjct  65   KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIK-LFSAMNMTSFAVILLVTHFG  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G +R+ ++GWICV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYG
Sbjct  124  VHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVH  816
            L +KD+ IALPN+LGF LGLLQ+LLY IYR       +  N  E  ++V+ L  +  +V+
Sbjct  184  LFLKDICIALPNVLGFVLGLLQMLLYTIYRKG----NKKTNTNEKSLSVKPL-KNIAVVN  238

Query  817  PVDSGR  834
            P+ +G 
Sbjct  239  PLGTGE  244



>gb|KHN24976.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=272

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 178/246 (72%), Gaps = 8/246 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH     FG+LGN+IS  V+LAPV  F RIY+ KST  + S+PY++A+FSSMLW+YYA +
Sbjct  5    HHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLVSWFP  456
            K++A LLI+INS G V E IYI++++ +A+  AR   +K LF  + +  F++I LV+ F 
Sbjct  65   KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIK-LFSAMNMTSFAVILLVTHFG  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G +R+ ++GWICV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYG
Sbjct  124  VHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVH  816
            L +KD+ IALPN+LGF LGLLQ+LLY IYR       +  N  E  ++V+ L  +  +V+
Sbjct  184  LFLKDICIALPNVLGFVLGLLQMLLYTIYRKG----NKKTNTNEKSLSVKPL-KNIAVVN  238

Query  817  PVDSGR  834
            P+ +G 
Sbjct  239  PLGTGE  244



>ref|XP_010037379.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
Length=265

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 164/228 (72%), Gaps = 3/228 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI    +PW+L+FG+LGNIISI V+LAPV  F RI R KST G+ SVPYV+++FS+MLW
Sbjct  1    MAIFTTDNPWVLIFGVLGNIISIVVFLAPVPTFCRICRKKSTEGFESVPYVVSLFSAMLW  60

Query  265  MYYAFIKK--NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGGFSIIF  438
            +YYA +K   +A LL+++NS+G   ETIYI ++L +A  +A+   L  L L  GG+  I 
Sbjct  61   LYYASLKSEPSAFLLLTVNSVGCAIETIYIALYLAYAPKQAKMMTLTLLLLNFGGYCSIL  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L+S F   G +R+ LVGWICVA S+AVFA+PLS++  V RTKSVEFLPF LSFFL LSAV
Sbjct  121  LLSHFLAKGSVRVQLVGWICVALSVAVFAAPLSVIRMVIRTKSVEFLPFSLSFFLMLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKN  759
             W  YGL +KDL +A PN+LG   G+LQ+ L+AIYR    V  EE KN
Sbjct  181  TWLLYGLFLKDLYVAGPNVLGVIFGVLQMALHAIYRKGNTVATEEEKN  228



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = +1

Query  97   DLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            + H+P    FG+LGNIIS  V+LAPV  F+RIY+ KST G+ S+PYV+A+FS+MLW+YYA
Sbjct  6    NTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYA  65

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWF  453
                N TLLI+INS+G + ETIY+ IF+VFA  + R + L+  L L  GGF II LV+ F
Sbjct  66   SFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
               G  R+ +VGWICVAFSI+VFA+PL+I+  V RTKSVEF+PFYLSFFLTLSA  W  Y
Sbjct  126  LVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  634  GLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEEN--KNVQEHIVNVEMLGTSNQ  807
            G+ +KD+ IA+PNI GF  G+ Q++LY IY+  +  +E    ++  ++IV V     S++
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNIVIVSAATNSDK  245



>gb|EMT11081.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=285

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 178/260 (68%), Gaps = 12/260 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGNIIS    LAP+  F RI+++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA +K    LLISIN+ G V ET+YI+++LV+A  KA+    K  + L + GF +I L
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F F GE R+  +GWICV FS+ VF +PLSI+ +V +TKSVE++PF LS  LTLSAV+
Sbjct  121  LTLFAFHGETRVISLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENK--------NVQEHIV  777
            WF YGL++KD  +ALPNILGF  G++Q++LY  Y NA PVV + K        + +EH+V
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVSDLKEGKEGLKMSAEEHVV  240

Query  778  NVEM---LGTSNQLVHPVDS  828
             + +     +S  +V PV  
Sbjct  241  VINVGKSEKSSGAVVRPVTE  260



>ref|XP_009403777.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 182/270 (67%), Gaps = 9/270 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FGILGNIIS  VYLAP+  F R+YR KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYRGKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKAR-RNALKELFLCIGGFSIIFL  441
            + YAF+K +A LLI+INS G V E++Y++++  +A   A+   A   L L +G F  I L
Sbjct  61   VLYAFLKTDAFLLITINSFGCVIESVYVVLYFTYAPKLAKILTAKLVLVLNVGMFGSILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     G  R+ ++GWIC+ FS++VF +PLSI+  V RTKSVEF+PF LSFFLTLS+++
Sbjct  121  LTLLLPDGLKRVRVLGWICMCFSVSVFVAPLSIIRLVIRTKSVEFMPFMLSFFLTLSSIV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WF YG + KD  +ALPN+LGF  GLLQ+ LY  ++  KP   E + + EHI+++ MLG  
Sbjct  181  WFAYGCLTKDKFVALPNVLGFAFGLLQMGLYLAFKCMKPTAVEPR-LPEHIISISMLGVE  239

Query  802  NQLVHPVD-SGRNISDGVTEINMENNDQGE  888
               V+P+D     ++D   E   EN D+ E
Sbjct  240  ---VYPIDWKTPEVND---EEKAENGDRKE  263



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 175/258 (68%), Gaps = 12/258 (5%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW+YYAF+K N
Sbjct  8    WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TL+I+INS G   ETIY+  +L +A  KAR   +K L L  +GGF  I LV+ F F G 
Sbjct  68   TTLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLVTQFLFKGA  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
             R   VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  128  ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  649  DLRIALPNilgfflgllqillYAIY-RNAKPVVEENK---NVQEHIVNVEMLG-------  795
            D+ IA+PN+LGF LG+LQI+LY IY +  K +++E K    +Q H++ V+          
Sbjct  188  DINIAIPNVLGFILGILQIVLYVIYNKKEKAILKEQKLPAKIQNHVIIVDENNNQKLPEL  247

Query  796  TSNQLVHPVDSGRNISDG  849
            T  Q++  V  G  IS G
Sbjct  248  TEEQIIDIVKLGSLISSG  265



>ref|XP_002873602.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49861.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=295

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 192/279 (69%), Gaps = 14/279 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH    +FGILGN+IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMINHHLLAFIFGILGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA IKK+A LLI+INS G V ET+YI +F  +A+   R +ALK LF+   +  FS+I 
Sbjct  61   LYYALIKKDAFLLITINSFGCVVETLYIAMFFAYATKDKRISALK-LFIAMNVAFFSLIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   +  +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFVVETPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEH----IV  777
            VMWF YGL + D+ IA+PN++GF LGLLQ++LY +YRN+  KP +E+  N  E     IV
Sbjct  180  VMWFAYGLFLNDICIAIPNVVGFVLGLLQMVLYGVYRNSNEKPEMEKKINSSEQQLKSIV  239

Query  778  NVEMLGTSNQLVHPV--DSGRNISDGVTEINMENNDQGE  888
             +  LG S   VHPV  +S   +SD V   ++    + E
Sbjct  240  VMSPLGVSE--VHPVVTESVDPLSDAVHHEDLSKATKVE  276



>ref|XP_008356571.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Malus 
domestica]
Length=295

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 189/270 (70%), Gaps = 11/270 (4%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + L H   L FG+LGNIIS+ V+LAPV  F  IY+ K+T G+ ++PYVI + SSML++YY
Sbjct  1    MALQHTLSLAFGLLGNIISLLVFLAPVPTFYTIYKKKTTEGFQALPYVIGLLSSMLYIYY  60

Query  274  AFIKK----NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIG-GFSIIF  438
            A +K+    +ATLLI+INS+G V ET+YI +FL +A  KAR +    LFL  G  ++++ 
Sbjct  61   ALLKEEIKYDATLLITINSVGSVIETLYISLFLFYAPKKARISNATLLFLLNGFSYAVMV  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +++ F  +GE+RI +VGWIC+ FSI+VF +PL ++ QV RTKSVEF+PF LSFFLTL AV
Sbjct  121  VLTRFLATGEMRIKIVGWICLVFSISVFVAPLGVLRQVXRTKSVEFMPFPLSFFLTLGAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEEN---KNVQEHIVNVEM  789
             WF YG ++KD  IALPNILGFFLG++Q+++Y +Y+NAK V+E+    + + EHI++V  
Sbjct  181  AWFFYGFLIKDFYIALPNILGFFLGVVQMVVYIVYKNAKEVLEDQPKGQELSEHIIDVRK  240

Query  790  LGTSNQLVHPVDSGRNISDGVTEINMENND  879
            + T   LV P  S   I     +I  + N+
Sbjct  241  IST---LVCPEMSPAVILQPTVDITSDMNE  267



>ref|XP_010037364.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
 gb|KCW49072.1| hypothetical protein EUGRSUZ_K02672 [Eucalyptus grandis]
Length=285

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 165/234 (71%), Gaps = 2/234 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI    + W+L FG+LGNIISI V+LAPV  F RI R KST G+ SVPYV+++FS+MLW
Sbjct  1    MAIFTTDNLWVLTFGVLGNIISIVVFLAPVPTFWRICRRKSTEGFESVPYVVSLFSAMLW  60

Query  265  MYYAFIKK--NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGGFSIIF  438
            +YYA +K   NA LLI++NS+G V ETIY+ +++ +A  KAR   L+ L L  GG+  I 
Sbjct  61   LYYASLKSESNAFLLITVNSVGCVIETIYVALYIAYAPKKARMLTLRLLLLNFGGYCSIL  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L+S F   G  R+ LVGWICVA S+AVFA+PLS++  V RTKSVEF+PF LSFFL LSAV
Sbjct  121  LLSHFLAKGSARVQLVGWICVALSVAVFAAPLSVIRMVIRTKSVEFMPFSLSFFLMLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVN  780
             W  YGL +KDL +A PN+LG   G+LQ+ L+AIYR    +V E +N    +V 
Sbjct  181  TWLLYGLFLKDLYVACPNVLGVTFGVLQMALHAIYRKGNTIVMEAENNDTSVVK  234



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 179/267 (67%), Gaps = 14/267 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA +  H  W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW
Sbjct  1    MAGISGH--WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K N TL+I+INS G   ETIY+  +L +A  KAR   +K L L  +GGF +I L
Sbjct  59   IYYAFLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G  R   VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVM
Sbjct  119  VTQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK---NVQEHIVNVEM  789
            WF YGL++KD+ IA+PN+LGF LG+ Q++LY IY +  K +++E K    +Q H++ V+ 
Sbjct  179  WFFYGLLVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKAILKEQKLSEKIQNHVIIVDE  238

Query  790  LG-------TSNQLVHPVDSGRNISDG  849
                     T  Q++  V  G  IS G
Sbjct  239  NNNQKLPELTEEQIIDIVKLGSLISSG  265



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 183/289 (63%), Gaps = 28/289 (10%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA +  H  W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW
Sbjct  1    MAAISGH--WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K N TL+I+INS G   ETIY+  +L +A  KAR   +K L L  +GGF +I L
Sbjct  59   IYYAFLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G  R   VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAVM
Sbjct  119  VTQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP-----------------VVEE  750
            WF YGL++KD+ IA+PN+LGF LG+ Q++LY IY   +                  +V+E
Sbjct  179  WFFYGLLVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKANLKEQKLPEKIQNHVIIVDE  238

Query  751  NKN------VQEHIVNVEMLGT--SNQLVHPVDSGRNISDGVTEINMEN  873
            N +       +E I+++  LG+  S+  +H      N + GV    +EN
Sbjct  239  NNSQKLPELTEERIIDIVKLGSLISSGKIHVASCLHNSTCGVEAAKVEN  287



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 188/287 (66%), Gaps = 15/287 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HP    FG+LGNIIS   YLAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            +YYA +K N  LLI+IN+ G V ET+YI ++L +A  KA+    K  L L +G F +I L
Sbjct  61   IYYALLKSNECLLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +G+ R+ ++GW+CV FS++VF +PLSI+ QV RT+SVEF+PF LS  LT+SAV+
Sbjct  121  LTLLLSAGQNRLVILGWVCVGFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP------VVEENKN---VQEHI  774
            WF YGL++KD  +ALPN+LGF  G++Q+ LYA+YRNA P      V ++ ++   V EH+
Sbjct  181  WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYALYRNATPRVPAKEVADDKEDIIKVPEHV  240

Query  775  VNVEMLGT-----SNQLVHPVDSGRNISDGVTEINMENNDQGE*KMI  900
            V +  LG          V PV+S     +   E  M   ++ + K++
Sbjct  241  VTIAKLGAPAVELKTHEVRPVESPPMEEEVKPESGMAAAEKEQDKVM  287



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/290 (48%), Positives = 183/290 (63%), Gaps = 29/290 (10%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA +  H  W   FG+LGNIIS  V+L+P+  F RIY+ KST GY S+PYV+A+FSSMLW
Sbjct  1    MAGISGH--WAFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K N TLLI+INS G+  ETIY+  +L +A  KA+   +K L L  +GGF  I L
Sbjct  59   IYYALLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVM
Sbjct  119  VTQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRN--------------AKP---VVEE  750
            WF YGL++KD+ IA PN+LGF  G+LQI+LYAIY                 KP   VV+E
Sbjct  179  WFFYGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQKPEVIVVDE  238

Query  751  NKN-------VQEHIVNVEMLG--TSNQLVHPVDSGRNISDGVTEINMEN  873
            N N        QE I+++  LG    +  V+      + + GV    +EN
Sbjct  239  NMNSKKLPELTQEQIIDIVKLGLLVCSDKVNVASLPHDTTCGVKAPKVEN  288



>ref|XP_006664549.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Oryza 
brachyantha]
Length=256

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/256 (50%), Positives = 177/256 (69%), Gaps = 8/256 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   YLAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            ++YA IK N  LLI+IN+ G V ETIYI+I+L +AS KA+    K L  L +G F +I L
Sbjct  61   IFYALIKSNEALLITINAAGCVIETIYIVIYLAYASKKAKVFTTKILLGLNVGVFGVILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     GE R+  +GW+CVAFS++VF +PLSI+ +V +T+SVE++PF LS  LTLSA++
Sbjct  121  LTLLLSKGENRVVSLGWVCVAFSVSVFVAPLSIIRRVVQTRSVEYMPFSLSLTLTLSAIV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------EHIVNV  783
            WF YGL++KD  +ALPN+LGF  G++Q+ LY  Y NA PV  E K  +      + +VNV
Sbjct  181  WFLYGLLIKDKYVALPNVLGFTFGVVQMGLYVFYMNATPVAGEGKEGKLAAEEPQVVVNV  240

Query  784  -EMLGTSNQLVHPVDS  828
             ++  T ++    +D 
Sbjct  241  GKLTATPDRSSGEIDK  256



>ref|XP_006289174.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
 gb|EOA22072.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
Length=286

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 138/277 (50%), Positives = 191/277 (69%), Gaps = 14/277 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   ++FGILGN +S  V +AP+  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVVMNHHLLTIIFGILGNAVSFLVLVAPLPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG--FSIIF  438
            +YYA IKKNA LLI+INS G V +TIYI +FL +A+   R +A+K LF+ I    FS+I 
Sbjct  61   LYYALIKKNAFLLITINSFGCVVQTIYIAMFLAYATRDKRISAMK-LFIAINVVFFSLIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            LV+ F   +  +++S++GWICVA S+AVFA+PL IV +V +TKSVE++PF LSFFLT+SA
Sbjct  120  LVTHFVVKTPTLQVSVLGWICVAISVAVFAAPLMIVARVVKTKSVEYMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEH----IV  777
            VMWFGYGL + D+ IA+PN++GF LG+LQ++LY +YRNA  KP +E+  N+ E     IV
Sbjct  180  VMWFGYGLFLNDICIAIPNVVGFVLGMLQMVLYCVYRNASEKPEIEKKINLSEQQLKSIV  239

Query  778  NVEMLGTSNQLVHPVDSGR--NISDGVTEINMENNDQ  882
             +  LG S   VHPV +      SD V      N ++
Sbjct  240  VMSPLGVSE--VHPVVTASVGPPSDAVHHEEPSNGNR  274



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 182/274 (66%), Gaps = 26/274 (9%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA + L HPW   FG+LGNIIS   YLAP+  F RIY++KST G+ S+PYV+A+FS+MLW
Sbjct  1    MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+INS G V ET+YI ++LV+A  KAR    + L L  +G F +I L
Sbjct  61   IYYALLKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLLLLVNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +G  R+ ++GW+CV FS++VF +PLSI+  V RTKSVEF+PF LS  LT+SAV+
Sbjct  121  LTLLLSAGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP-----VVEE------------  750
            WF YGL++KD  +ALPN+LGF  G++Q+ LYA+YRN+ P     V +E            
Sbjct  181  WFLYGLLIKDKYVALPNVLGFTFGVIQMGLYAMYRNSTPKRSTMVAKEVEATATDDDDAA  240

Query  751  --NKNVQEHIVNVEMLGTS------NQLVHPVDS  828
                 V+EH+VN+  L  +       + VHPV+S
Sbjct  241  SPTAGVKEHVVNIAKLSAAAAIDVKTREVHPVES  274



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = +1

Query  97   DLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            + H+P    FG+LGNIIS  V+LAPV  F+RIY+ KST G+ S+PYV+A+FS+MLW+YYA
Sbjct  6    NTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAMLWLYYA  65

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWF  453
                N TLLI+INS+G + ETIY+ IF+VFA  + R + L+  L L  GGF II LV+ F
Sbjct  66   SFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILLVTHF  125

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
               G  ++ +VGWICVAFSI+VFA+PL+I+  V RTKSVEF+PFYLSFFLTLSA  W  Y
Sbjct  126  LVHGSNQVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSATSWLLY  185

Query  634  GLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEEN--KNVQEHIVNVEMLGTSNQ  807
            G+ +KD+ IA+PNI GF  G+ Q++LY IY+  +  +E    ++  ++IV V     S++
Sbjct  186  GVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNIVIVSAATNSDK  245



>gb|KHN24975.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=273

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 184/266 (69%), Gaps = 7/266 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H      FG+LGN+IS  V+LAP++ F RI++ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+A LL++INS G V E IYI++++ +A+  AR   LK  F + +G F++I LV+ F  
Sbjct  65   KKDAMLLLTINSFGCVIEIIYIILYITYATGDARNLTLKLFFAMNVGAFALILLVTHFAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G +R+ ++GWICV+ SI+VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYGL
Sbjct  125  HGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVE---ENKNVQEHIVNVEMLGTSNQL  810
             +KD+ IALPN+LGF LGLLQ+LLYAIYRN    V+   E K   E + +V +      L
Sbjct  185  FLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKILEKKAPPEPLKSVVIETGEVFL  244

Query  811  VHPVDSGRNISDGVTEI---NMENND  879
            V     G+   +   E    +  NND
Sbjct  245  VEGKQQGKKSKENSEEKEKSDEPNND  270



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 165/226 (73%), Gaps = 4/226 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA +  H  W   FG+LGNI+S  V+L+P+  F RIY+ KST GY S+PYV+A+FSSMLW
Sbjct  1    MAGISGH--WAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K N TLLI+INS G+  ETIY+ ++L +A  KAR   +K L L  +GGF  I L
Sbjct  59   IYYAFLKTNTTLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVM
Sbjct  119  VTQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK  756
            WF YGL++KD+ IA PN+LGF  G+LQI+LY IY +  K +++E K
Sbjct  179  WFFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQK  224



>dbj|BAJ85621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 181/278 (65%), Gaps = 13/278 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L + HPW   FG+LGNIIS    LAP+  F RI+++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA +K    LLI+IN+ G V ET+YI+++LV+A  KA+    K  L L + GF +IFL
Sbjct  61   IFYALVKTGEGLLITINAAGCVIETVYIIMYLVYAPRKAKIFTAKIVLLLNVAGFGLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F F GE R+  +GWICV FS+ VF +PLSI+ +V +TKSVE++PF LS  LTLSAV+
Sbjct  121  LTLFAFHGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV----EENKN-----VQEHI  774
            WF YGL++KD  +ALPNILGF  G++Q++LY  Y NA PVV    +E K       ++H+
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVASDAKEGKEAWKVPAEDHV  240

Query  775  VNVEMLGTSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
            V + +          V   R ++D       E    G+
Sbjct  241  VVINVGKADKSSCAEV---RPVADVPRRCAAEAAAPGQ  275



>ref|XP_009802194.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana sylvestris]
Length=298

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 180/265 (68%), Gaps = 13/265 (5%)
 Frame = +1

Query  97   DLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            D    W   FG+LGNI+S FV+L+P+  F +IY+ KST  Y S+PYV+A+FS+M W+YYA
Sbjct  3    DFSGHWAFTFGVLGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYA  62

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI-GGFSIIFLVSWF  453
            F+K N TLLI+INS G   ETIY+  +L +A  KAR   +K L L + GGF  I LV+  
Sbjct  63   FLKSNTTLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQL  122

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
             F G +R+ +VGWIC+ FS+ VF SPL I+ QV +TKSVE++PF++S FLTLSAV WF Y
Sbjct  123  LFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFY  182

Query  634  GLIMKDLRIALPNilgfflgllqillYAI-YRNAKPVVEENK--NVQEHIV------NVE  786
            GL++KD  IA+PN+LGF +G+LQ++ Y I Y+  + +V+E+K   +Q H++      N+ 
Sbjct  183  GLLLKDFNIAIPNVLGFIVGILQMVFYVIYYKKEEVIVKEHKFPEIQNHVIILHNDKNLP  242

Query  787  MLGTSNQLVHPVDSGRNISDGVTEI  861
             L T  Q++  V  G  IS   TEI
Sbjct  243  EL-TEEQIIDIVKLGSLIS--CTEI  264



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 169/253 (67%), Gaps = 25/253 (10%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNI+S  V+L+P+  F RIY+ KST GY S+PYV+A+FSSMLW+YYAF+K N
Sbjct  5    WAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  64

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TLLI+INS G+  ETIY+  +L +A  KAR   +K L L  +GGF  I LV+ F F G 
Sbjct  65   TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFLFKGA  124

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  125  VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  184

Query  649  DLRIALPNilgfflgllqillYAIYRN--------------AKP---VVEENKN------  759
            D+ IA PN+LGF  G++QI+LY IY                 KP   VV+EN N      
Sbjct  185  DINIAAPNVLGFIFGIVQIVLYVIYSKKEKANLKEPKLPEIQKPAVIVVDENMNKKKIPE  244

Query  760  -VQEHIVNVEMLG  795
              QE I+++  LG
Sbjct  245  LTQEQIIDIVKLG  257



>ref|XP_010419882.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/281 (49%), Positives = 195/281 (69%), Gaps = 16/281 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++  HH    +FGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MAVIIDHHLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI--GGFSIIF  438
            +YYA IK++A LLI+INS G V ETIYI +F  +A+   R +A+K LF+ I    FS+I 
Sbjct  61   LYYALIKQDAFLLITINSFGCVVETIYIAMFFAYATRDKRISAMK-LFIAINVAFFSMIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   +  I++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFVVRTPTIQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEH----IV  777
            VMWF YGL + D+ IA+PN++GF LG+LQ++LY +YRN+  KP +E+  N+ E     IV
Sbjct  180  VMWFAYGLFLHDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKINLSEQQLKSIV  239

Query  778  NVEMLGTSNQLVHPV--DSGRNISDGV--TEINMENNDQGE  888
             +  LG S   VHPV  +    +SD V   +++   N++ E
Sbjct  240  VMSPLGVSE--VHPVVTEPVGPLSDAVHHEDLSKVTNEKEE  278



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 183/270 (68%), Gaps = 2/270 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA   +H PW+  FG+LGN +S  V+LAP+  F RI R KST G+ S+PYV+A+FS+M+W
Sbjct  1    MASFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +A LLI+INS+G   E IYI +++ +A  +AR   L+ L L   GGF  + L
Sbjct  61   LYYASLKSDALLLITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +S F   G  R+ ++GW+CV FS++VFA+PLSI+  V RT+SVEF+PF LSFFLTLSA+M
Sbjct  121  LSHFFVKGSNRVKVLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT-  798
            W  YG+++KD  IA+PNILGF  G+LQ++LY IY+N+K  V     + ++  ++  L + 
Sbjct  181  WLFYGVLLKDFYIAIPNILGFIFGVLQMVLYVIYKNSKTAVPMEPTLPQNSNDIAKLSSI  240

Query  799  SNQLVHPVDSGRNISDGVTEINMENNDQGE  888
            S ++   V    N  D  TE + + ++Q +
Sbjct  241  SCEMKPAVCPQSNEEDDHTENSKDPSNQEK  270



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 182/259 (70%), Gaps = 15/259 (6%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H  W  +FG+LGN+IS  V+LAP+  F +IY+ KS+ G+ S+PYV+A+FSSMLW+YYA +
Sbjct  5    HETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYALV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFP  456
            KK+A+LL I+INS G V ETIY+ IFLV+A SK R   +K L  L + GF  + L + + 
Sbjct  65   KKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
             +G  R+S++GWIC+ F+I+VFA+PL I+ +V +T+SVEF+PF LS  LT++AVMWF YG
Sbjct  125  TTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSLSLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKP-VVEENKNVQE---HIVNVEMLGTSN  804
            L++KD  IALPN LGF  G++Q++LY +YRNAKP  +EE   VQE   HI++V       
Sbjct  185  LLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTKVQELNGHIIDV-------  237

Query  805  QLVHPVDSGRNISDGVTEI  861
              V P  + +N    V EI
Sbjct  238  --VKPNHATKNGHVPVIEI  254



>ref|XP_009601079.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 173/263 (66%), Gaps = 8/263 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            +HP +  FGILGNI S  V+++PV  F  I + KS  G+ SVPYV+A+FSSMLW+YYA +
Sbjct  3    NHPLIFAFGILGNIFSFMVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMV  62

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPF  459
            K N TL+I+INS G + ETIY+ I+  +A+  AR   L+  L L  GGF +I  ++    
Sbjct  63   KTNETLIITINSFGCIAETIYVAIYFAYATKNARMQTLRLVLLLNFGGFGLILFLTQILC  122

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R  +VGWIC+AFSI+VF +PLSI+ +V RTKSVEF+PF LS  LTLSAVMWF YGL
Sbjct  123  KGPKRAEVVGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGL  182

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS-NQLVH  816
            +++D+ + +PNI G  LG+LQ++LY IYRNAKP   E K +   +   E   T+ N  V+
Sbjct  183  LLRDIYVTVPNIAGIILGMLQMVLYGIYRNAKPNEAEEKKLPTVVKLEEQQPTTVNSEVN  242

Query  817  PV-----DSGRNISDGVTEINME  870
            PV     DS  N  D     N+E
Sbjct  243  PVSFPSTDSTEN-EDAKDGKNLE  264



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/254 (51%), Positives = 181/254 (71%), Gaps = 8/254 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H  W  +FG+LGN+IS  V+LA +    +IY+ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HETWAFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFP  456
            KK+A+LL I+INS G V ETIY+ IFL++A SK R   +K L  L + GF  + L + + 
Sbjct  65   KKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
             +G  R+S++GWIC+  +I+VFA+PL I+ +V +TKSVEF+PF LSFFLT++AVMWF YG
Sbjct  125  TTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKNVQE---HIVNVEMLG--T  798
            L++KD  IALPN LGF  G++Q++LY IYRNAKP  +EE   VQE   HI++V      T
Sbjct  185  LLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTKVQELNGHIIDVVKPNHVT  244

Query  799  SNQLVHPVDSGRNI  840
             N  V  +++  N+
Sbjct  245  KNGPVPVIETASNV  258



>ref|XP_003620983.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=268

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+     FG+LGN+IS  V+LAP++ F RIY+ KST G+ S+PY++A+FSSMLW+YYAF+
Sbjct  5    HNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAFL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+  LLI+INS G V E IYI++++++A+  AR+  +K L  + IG F +I LV+ +  
Sbjct  65   KKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKYAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G IR+ ++GWICV+ S++VFA+PL+IV QV RTKSVEF+PF LSF LTLSA+MWFGYGL
Sbjct  125  HGPIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQL  810
             +KD+ IALPN+LGF LGL+Q++LY IYRN       +K   + +V    LG + ++
Sbjct  185  FLKDICIALPNVLGFALGLVQMILYCIYRNGDKKKANSKAALKSVVIESSLGGTGEV  241



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/287 (46%), Positives = 182/287 (63%), Gaps = 19/287 (7%)
 Frame = +1

Query  85   MAILDL-HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MA L++  H W   FGILGNIIS+ V+L+P+  F R+YR KST G+ S PYV+ +FS +L
Sbjct  1    MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLL  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKE-LFLCIGGFSIIF  438
            WMYYAF+K  A LL++IN +G   ET+YI ++L++A   AR    K  L L +G F +I 
Sbjct  61   WMYYAFLKSGAELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIA  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            LV+    +G +R+ +VGWICVA ++ VFA+PLSI+  V RTKSVEF+P  LSFFL LSAV
Sbjct  121  LVTMLVSAGTLRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP---VVEENKNVQEHI----V  777
            +WF YGL+ KD+ +A+PN+LGF  G+ Q+ LY  YRN  P   VV +   + EH+     
Sbjct  181  IWFAYGLLKKDVFVAVPNVLGFVFGVAQMALYMAYRNKSPAITVVHQEMKLPEHVKEVTT  240

Query  778  NVEMLGTSNQ-------LVHPVD-SGRNISDGVTE--INMENNDQGE  888
            N ++ G   +        VHP+D    + + G  E  IN+E    G 
Sbjct  241  NTKLGGAPTEGRISCGAEVHPIDVMPTSAAAGADEQAINVEEAAAGR  287



>gb|KEH21447.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=279

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 176/237 (74%), Gaps = 1/237 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+     FG+LGN+IS  V+LAP++ F RIY+ KST G+ S+PY++A+FSSMLW+YYAF+
Sbjct  5    HNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAFL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+  LLI+INS G V E IYI++++++A+  AR+  +K L  + IG F +I LV+ +  
Sbjct  65   KKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKYAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G IR+ ++GWICV+ S++VFA+PL+IV QV RTKSVEF+PF LSF LTLSA+MWFGYGL
Sbjct  125  HGPIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQL  810
             +KD+ IALPN+LGF LGL+Q++LY IYRN       +K   + +V    LG + ++
Sbjct  185  FLKDICIALPNVLGFALGLVQMILYCIYRNGDKKKANSKAALKSVVIESSLGGTGEV  241



>ref|XP_002450786.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
 gb|EES09774.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
Length=291

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 185/284 (65%), Gaps = 20/284 (7%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPV--SIFIRIYRAKSTMGYHSVPYVIAIFSSM  258
            MA L L HP    FG+LGNIIS   YLAP+    F RIY++KST G+ SVPYV+A+FS+M
Sbjct  1    MAGLSLQHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALFSAM  60

Query  259  LWMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSII  435
            LW+YYA +K N  LLI+INS G V ET+YI+++L++A  KA+    K L L  +G F +I
Sbjct  61   LWIYYALLKSNEFLLITINSAGCVIETLYIVMYLLYAPKKAKLFTAKILLLLNVGVFGLI  120

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
             L++    +G+ R+ ++GW+CVAFS++VF +PLSI+ QV RT+SVEF+PF LS  LT+SA
Sbjct  121  LLLTLLLSAGQHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSA  180

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ----------  765
            V+WF YGL++KD  +ALPN+LGF  G++Q+ LYA+YRNA P V   K V           
Sbjct  181  VVWFLYGLLIKDKYVALPNVLGFSFGVVQMGLYALYRNATPRVPPAKEVTDDDAAADGTF  240

Query  766  ----EHIVNVEMLGTSNQLVHP--VDSGRNISDGVTEINMENND  879
                EH+V +  L T+   V P   +  +   +G T      ND
Sbjct  241  KLPGEHVVTIAKL-TAVPAVSPQLQEEAKPADNGTTPAPAPAND  283



>ref|XP_009614915.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana tomentosiformis]
Length=302

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 169/235 (72%), Gaps = 8/235 (3%)
 Frame = +1

Query  97   DLHHPWLLVFGILGNIISIFVYLAPVSI----FIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            D    W   FG+LGNI+S FV+L+P+ +    F +IYR KST GY S+PYV+A+FS+MLW
Sbjct  3    DFSGHWAFTFGVLGNIVSFFVFLSPLYVRRPTFYKIYRKKSTEGYQSIPYVVALFSAMLW  62

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI-GGFSIIFL  441
            +YYAF+K N TLLI+INS G   ETIY+  +L +A  KAR   +K L L +  GF  I L
Sbjct  63   IYYAFLKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVL  122

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G +R+ +VGWIC+ FS+ VF SPL I+ QV +TKS E++PF+LS FLTLSAVM
Sbjct  123  VTQFLFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVM  182

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENK--NVQEHIV  777
            WF YGL++KD  IA+PN+LGF LG+LQ++LY +Y   + V V+E+K   +Q H++
Sbjct  183  WFFYGLLLKDFNIAIPNVLGFILGILQMVLYVMYNKKEEVIVKEHKFPELQNHVI  237



>ref|XP_008239633.1| PREDICTED: bidirectional sugar transporter SWEET10 [Prunus mume]
Length=291

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 172/238 (72%), Gaps = 8/238 (3%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + + HP  L FG+LGNIIS  V+LAPV  F  +Y+ K+  G+ ++PYVIA+ SSML++YY
Sbjct  1    MAIQHPLTLAFGLLGNIISFLVFLAPVPTFYTVYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  274  AFIKK----NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIF  438
            A +K+    +AT LI+INS G V ET+YI +FL +A  KAR + L  +FL  + G+ ++ 
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNVFGYGLMM  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +++ F  +GEIR+ +VGWIC+ FS++VF +PL ++ QV RTKSVEF+PF LSFFLTL AV
Sbjct  121  MLTHFLATGEIRLKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ---EHIVNV  783
             WF YGL++KD  IA PNILGF  G+ Q++LY +Y+N K V+EE   VQ   EHI++V
Sbjct  181  TWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLEEQPKVQELSEHIIDV  238



>ref|XP_010027262.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=274

 Score =   225 bits (574),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 181/280 (65%), Gaps = 22/280 (8%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA  D HH W   FGILGNI+S FV+LAPV  F RIYR K T  + S+PY++A+FSSMLW
Sbjct  1    MAFFDHHHLWTFTFGILGNIVSFFVFLAPVPTFYRIYRNKKTEDFQSIPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIF  438
            +YYA +K ++ LLI+INS G V E +YI I++ +A  ++ RN+  +LF  + +G FS++ 
Sbjct  61   LYYALLKGHSFLLITINSFGCVIEMMYIAIYIAYA-LRSTRNSTIKLFALMNMGLFSLLI  119

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L++ F  +G+ R ++ GWIC   S++VFA+PLSIV +V +T SVEF+PF LSFFLTLSA+
Sbjct  120  LITHFIPNGDARTTVFGWICTTISVSVFAAPLSIVARVVQTNSVEFMPFSLSFFLTLSAI  179

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT  798
            MWFGYG  + DL + +PNI+GF LGL Q++LY  YRN        + + +H V+      
Sbjct  180  MWFGYGFFLLDLDMQIPNIVGFVLGLSQMVLYGYYRN-------REELPQHDVHPPSGKA  232

Query  799  SNQLVHPVDSGRNISD----------GVTEINMENNDQGE  888
            S   VHPV  G   +D          G  E+ +  +D G 
Sbjct  233  SE--VHPVKGGEARADEQQPQLSQPKGAVEVVVSGDDPGS  270



>gb|EMS48886.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=395

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 168/230 (73%), Gaps = 2/230 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L + HPW   FG+LGNIIS    LAP+  F RI+++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA +K    LLI+IN+ G V ETIYI+++LV+A  KA+    K  L L I GF +IFL
Sbjct  61   IFYALVKTGEGLLITINAAGCVIETIYIVMYLVYAPRKAKIFTAKIVLLLNIAGFGLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F F GE R+  +GWICV FS+ VF +PLSI+ +V +TKSVE++PF LS  LTLSA++
Sbjct  121  LTVFAFQGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAIV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEEN-KNVQE  768
            WF YGL++KD  +ALPNILGF  G++Q++LY  Y NA PVV  + K V+E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVTSDVKEVKE  230



>ref|XP_002511125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51727.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 173/266 (65%), Gaps = 4/266 (2%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HHP +  FG+LGNIISI ++L+P+  FIR+Y+ KST G+ S+PYV+A+FS MLW+YYA +
Sbjct  6    HHPLIFTFGVLGNIISILMFLSPMFTFIRVYKKKSTEGFQSIPYVVALFSCMLWIYYAML  65

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPF  459
            K    LL+SINS G + +TIYI++F+ +A  KA+   L+ LFL    GF  I  ++ F  
Sbjct  66   KSGDYLLLSINSFGCLVQTIYIVLFIFYAEKKAKILTLQLLFLMNFAGFLAIVALTRFFA  125

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R+ +VGW CVA S  +FA+PLS++  V RTKSVEF+PF LS FLTLSA+MW  YG+
Sbjct  126  KGSSRLHIVGWFCVAVSAVLFAAPLSVIRLVVRTKSVEFMPFTLSLFLTLSAIMWLLYGV  185

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVE--ENKNVQEHIVNVEMLGTSNQLV  813
            ++KDL IALPNI G   G +Q++LY IYR+ K V+E  E  ++   I   E+      L 
Sbjct  186  LLKDLYIALPNIFGLVFGAIQMVLYVIYRDGKKVIELPEKIDMDSPIKTFEVHAAVVSLP  245

Query  814  HPVDSGR-NISDGVTEINMENNDQGE  888
             P D+ + N  D   E    N D  E
Sbjct  246  IPDDNYQVNKEDNPNEQRKPNADSTE  271



>sp|Q2QR07.1|SWT13_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET13; Short=OsSWEET13 
[Oryza sativa Japonica Group]
 gb|ABA98216.1| N3 like protein, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ20456.1| hypothetical protein OsJ_36063 [Oryza sativa Japonica Group]
 dbj|BAH01364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGS56390.1| major disease resistance protein xa25 [Oryza sativa Indica Group]
Length=296

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 167/237 (70%), Gaps = 1/237 (0%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   YLAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            ++YA IK N  LLI+IN+ G V ETIYI+++L +A  KA+    K L L  +G F +I L
Sbjct  61   IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     GE R+  +GW+CVAFS++VF +PLSI+ +V +++SVE++PF LS  LTLSAV+
Sbjct  121  LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEML  792
            WF YGL++KD  +ALPNILGF  G++Q+ LY  Y NA PV  E K  +  +   E L
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEEL  237



>ref|XP_007209422.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
 gb|EMJ10621.1| hypothetical protein PRUPE_ppa009422mg [Prunus persica]
Length=293

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 172/238 (72%), Gaps = 8/238 (3%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + + HP  L FG+LGNIIS  V+LAPV  F  IY+ K+  G+ ++PYVIA+ SSML++YY
Sbjct  1    MAIQHPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYY  60

Query  274  AFIKK----NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIF  438
            A +K+    +AT LI+INS G V ET+YI +FL +A  KAR + L  +FL  + GF ++ 
Sbjct  61   ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMM  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L++ F  +GE+R+ +VGWIC+ FS++VF +PL ++ +V RTKSVEF+PF LSFFLTL AV
Sbjct  121  LLTHFLATGEMRLKIVGWICLVFSLSVFVAPLGVLRRVIRTKSVEFMPFPLSFFLTLGAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ---EHIVNV  783
             WF YGL++KD  IA PNILGF  G+ Q++LY +Y+N K V+EE   VQ   EHI++V
Sbjct  181  TWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLEEQPKVQELSEHIIDV  238



>gb|EMT20808.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=290

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 164/229 (72%), Gaps = 1/229 (0%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L + HPW   FG+LGN+IS    LAP+  F RI+++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA +K    LLISIN+ G V ET+YI+++LV+A  KA+    K  + L I GF +IFL
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYADRKAKIFTAKIVVLLNIAGFGLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F F GE R+  +GWICV FS+ VF +PLSI+ +V +TKSVE++PF LS  LTLSA++
Sbjct  121  LTLFAFHGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE  768
            WF YGL++KD  +ALPNILGF  G++Q++LY  Y N  PV  + K  +E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPVASQVKEGKE  229



>ref|XP_010037373.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
Length=266

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 163/229 (71%), Gaps = 4/229 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI    +P +L+FG+LGNIISI V+LAPV  F RI R KST G+ SVPYV+++FS+MLW
Sbjct  1    MAIFTTDNPRVLIFGVLGNIISIVVFLAPVPTFWRICRRKSTEGFESVPYVVSLFSAMLW  60

Query  265  MYYAFIKKNAT--LLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSII  435
            +YYA +K  +T  LLI++NS+G   ETIYI ++L +A  +AR+     L L   GG+  I
Sbjct  61   LYYASLKSESTAFLLITVNSVGCAIETIYIALYLAYAPKQARQMMTGTLLLLNFGGYCSI  120

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
             L+S F   G  R+ LVGWICVA S+AVFA+PLS++  V RTKSVEFLPF LSFFL LSA
Sbjct  121  LLLSHFLAKGSARVQLVGWICVALSVAVFAAPLSVIRMVIRTKSVEFLPFSLSFFLMLSA  180

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKN  759
            V W  YGL +KDL +A PN+LG   G+LQ+ L+AIYR    + +EE +N
Sbjct  181  VTWLLYGLFLKDLYVAGPNVLGVIFGVLQMALHAIYRKGNTIAMEEEEN  229



>ref|XP_004491680.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=257

 Score =   224 bits (571),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 172/256 (67%), Gaps = 13/256 (5%)
 Frame = +1

Query  124  FGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATLL  303
            FG+LGN+IS  V+LAP++ F RIY+ KST  + S+PY++A+FSSMLW+YYA +K N  LL
Sbjct  12   FGMLGNVISFMVFLAPMTTFYRIYKKKSTEQFQSLPYLVALFSSMLWLYYALVKTNEFLL  71

Query  304  ISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPFSGEIRIS  480
            I+INS G + E IYIL+++ +A   AR+  LK L  + +G F +I  V+ +   G +R+ 
Sbjct  72   ITINSFGCLVEIIYILLYITYAPKDARKLTLKLLLAMNMGSFGLILSVTHYAMHGALRVQ  131

Query  481  LVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLRI  660
            ++GWICV+ S++VFA+PL+IV QV RTKSVEF+PF LSF LTLSA+MWFGYGL +KD+ I
Sbjct  132  VLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLFLKDICI  191

Query  661  ALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHPVDSGRNI  840
            ALPN+LGF LGL+Q++LY IYRN       NK      V   +    N  V PV     I
Sbjct  192  ALPNVLGFVLGLVQMILYGIYRNG------NKKATLKTVVSSL---ENGEVFPVQEDHEI  242

Query  841  SDGVTEINMENNDQGE  888
             +   E   E N   E
Sbjct  243  GNKNKE---EKNKSME  255



>ref|XP_003532319.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=273

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H      FG+LGN+IS  V+LAP++ F RI++ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+A LL++INS G V E IYI++++ +A+  AR   LK  F + +G F++I LV+ F  
Sbjct  65   KKDAMLLLTINSFGCVIEIIYIILYITYATGDARNLTLKLFFAMNVGAFALILLVTHFAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G +R+ ++GWICV+ SI+VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYGL
Sbjct  125  HGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEE  750
             +KD+ IALPN+LGF LGLLQ+LLYAIYRN    V++
Sbjct  185  FLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDK  221



>gb|EAY83053.1| hypothetical protein OsI_38270 [Oryza sativa Indica Group]
 gb|AGS56391.1| disease susceptible protein Xa25 [Oryza sativa Indica Group]
Length=293

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 167/237 (70%), Gaps = 1/237 (0%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   YLAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            ++YA IK N  LLI+IN+ G V ETIYI+++L +A  KA+    K L L  +G F +I L
Sbjct  61   IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     GE R+  +GW+CVAFS++VF +PLSI+ +V +++SVE++PF LS  LTLSAV+
Sbjct  121  LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEML  792
            WF YGL++KD  +ALPNILGF  G++Q+ LY  Y NA PV  E K  +  +   E L
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPVAGEGKEGKGKLAAAEEL  237



>ref|XP_004962649.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Setaria 
italica]
Length=300

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 173/259 (67%), Gaps = 13/259 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA   L HPW   FG+LGN+IS   +LAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGFSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA IK N  LLI+IN  G V E+IY++++ V+A  KAR    K  L L +G F  I L
Sbjct  61   IFYALIKSNEVLLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
             +   F G+ RI  +GWICVAFS+ VF +PLSI+ +V +T+SVE++PF LS  LTLSAV+
Sbjct  121  FTLLVFHGDKRIVTLGWICVAFSVGVFVAPLSIIKRVIQTRSVEYMPFSLSLTLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN-------VQEHI-V  777
            WF YGL++KD  +ALPNILGF  G++Q++LY  Y N  PVV + K          EH+ V
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVFYMNKTPVVADGKEAGKLPTAADEHVLV  240

Query  778  NVEMLGTS----NQLVHPV  822
            N+  L  +    +  VHPV
Sbjct  241  NIAKLSPALPERSSGVHPV  259



>gb|EMS51422.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=290

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 164/229 (72%), Gaps = 1/229 (0%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L + HPW   FG+LGN+IS    LAP+  F RI+++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA +K    LLISIN+ G V ET+YI+++LV+A  KA+    K  + L I GF +IFL
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNITGFGLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F F GE R+  +GWICV FS+ VF +PLSI+ +V +TKSVE++PF LS  LTLSA++
Sbjct  121  LTLFAFHGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE  768
            WF YGL++KD  +ALPNILGF  G++Q++LY  Y N  PV  E K  +E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPVASEVKEGKE  229



>ref|XP_009762335.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
sylvestris]
Length=299

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 173/264 (66%), Gaps = 11/264 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA     H W   FG+LGNI+S  V+L+P+  F +IY+ KS  GY S+PYVIA+FSSMLW
Sbjct  1    MAGFSTDH-WAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLW  59

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K N TLLI+INS G+  ETIY+  +L +A  KAR   +K L L  +GGF  I L
Sbjct  60   IYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVL  119

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVM
Sbjct  120  VTQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  179

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WF YGL++KD+ IA PN+LGF  G+LQI+LY IY       +EN  ++E     ++    
Sbjct  180  WFFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSK-----KENAILKEQ----KLPEIQ  230

Query  802  NQLVHPVDSGRNISDGVTEINMEN  873
             Q V  +D   N +  + E+  E 
Sbjct  231  KQAVILLDENMNNNKKLPELTQEQ  254



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/290 (47%), Positives = 182/290 (63%), Gaps = 29/290 (10%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA +  H  W   FG+LGNI+S  V+L+P+  F  I++ KST GY S+PYV+A+FSSMLW
Sbjct  1    MAGISGH--WAFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K N TLLI+INS G+  ETIY+  +L +A  KA+   +K L L  +GGF  I L
Sbjct  59   IYYALLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVM
Sbjct  119  VTQFLFKGAVRGQIVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRN--------------AKP---VVEE  750
            WF YGL++KD+ IA PN+LGF  G+LQI+LYAIY                 KP   VV+E
Sbjct  179  WFFYGLLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQKPAVIVVDE  238

Query  751  NKN-------VQEHIVNVEMLG--TSNQLVHPVDSGRNISDGVTEINMEN  873
            N N        QE I+++  LG    +  V+      + + GV    +EN
Sbjct  239  NMNSKKLPELTQEQIIDIVKLGLLVCSDKVNVASRPHDTTCGVKAPKVEN  288



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 167/234 (71%), Gaps = 2/234 (1%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFG+LGNI+S  VYLAPV  F +IY+ KST G+ SVPYV+ +FS+MLW+YYAF+K + TL
Sbjct  8    VFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTTL  67

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS+G   +T YI  FL +A+ KA+ + +K L  + + G  +I  ++ F   G  R 
Sbjct  68   LITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGLGLIIFLTQFFAKGSNRA  127

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             +VGWIC+ FS  VF +PL ++ QV RTKSVE++PF LSFFLTLSAVMWF YGL+ KD  
Sbjct  128  QIVGWICLIFSFCVFVAPLGVLRQVIRTKSVEYMPFQLSFFLTLSAVMWFLYGLLRKDYN  187

Query  658  IALPNilgfflgllqillYAIYRNAKPVVEENK-NVQEHIVNVEMLGTSNQLVH  816
            IA+PN+LGF LG++Q+ LY IY+NAK V +E K  V E + + + L  S +++ 
Sbjct  188  IAIPNVLGFSLGVIQMTLYLIYKNAKKVTKEVKLEVTEIVADDKELKLSEEILK  241



>ref|XP_010453373.1| PREDICTED: bidirectional sugar transporter SWEET15 [Camelina 
sativa]
Length=296

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 191/279 (68%), Gaps = 14/279 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++  H     +FGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MAVMIDHQLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI--GGFSIIF  438
            +YYA IK++A LLI+INS G V ETIYI +F  +A+ + R +A+K LF+ I    FS+I 
Sbjct  61   LYYALIKQDAFLLITINSFGCVVETIYIAMFFAYATREKRISAMK-LFIAINVAFFSLIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   +  +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFVVKTPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEH----IV  777
            VMWF YGL + D+ IA+PN++GF LG+LQ++LY IYRN+  KP +E+  N  E     IV
Sbjct  180  VMWFAYGLFLHDICIAIPNVVGFVLGMLQMVLYGIYRNSSEKPEMEKKINSSEQQLKSIV  239

Query  778  NVEMLGTSNQLVHPV--DSGRNISDGVTEINMENNDQGE  888
             +  LG S   VHPV  +    +SD V   ++    + E
Sbjct  240  VMSPLGVSE--VHPVVTEPVGPLSDAVHHEDLSKVTKEE  276



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 162/226 (72%), Gaps = 3/226 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA     H W   FG+LGNI+S  V+L+P+  F +IY+ KS  GY S+PYVIA+FSSMLW
Sbjct  1    MAGFSTDH-WAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLW  59

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K N TLLI+INS G+  ETIY+  +L +A  KAR   +K L L  +GGF  I L
Sbjct  60   IYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVL  119

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVM
Sbjct  120  VTQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  179

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK  756
            WF YGL++KD+ IA PN+LGF  G+LQI+LY IY +  K +++E K
Sbjct  180  WFFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQK  225



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 164/229 (72%), Gaps = 1/229 (0%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L + HPW   FG+LGN+IS    LAP+  F RI+++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA +K    LLISIN+ G V ET+YI+++LV+A  KA+    K  + L I GF +IFL
Sbjct  61   IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNIAGFGLIFL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F F GE R+  +GWICV FS+ VF +PLSI+ +V +TKSVE++PF LS  LTLSA++
Sbjct  121  LTLFAFHGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE  768
            WF YGL++KD  +ALPNILGF  G++Q++LY  Y N  P+  + K  +E
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPMASQVKEGKE  229



>ref|XP_010492063.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/281 (48%), Positives = 195/281 (69%), Gaps = 16/281 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++  HH    +FGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MAVMIDHHLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI--GGFSIIF  438
            +YYA IK++A LLI+INS G V ETIYI +F  +A+   R +A+K LF+ I    FS+I 
Sbjct  61   LYYALIKQDAFLLITINSFGCVVETIYIAMFFAYATRDKRISAMK-LFITINVAVFSLIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   +  +++S++GWICVA S++VFA+PL IV +V +T+SVEF+PF LSFFLT+SA
Sbjct  120  MVTHFVVKTPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTRSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEH----IV  777
            VMWF YGL + D+ IA+PN++GF LG+LQ++LY +YRN+  KP +E+  ++ E     IV
Sbjct  180  VMWFAYGLFLHDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKIHLSEQQLKSIV  239

Query  778  NVEMLGTSNQLVHPV--DSGRNISDGV--TEINMENNDQGE  888
             +  LG S   VHPV  +    +SD V   +++   N++ E
Sbjct  240  VMSPLGVSE--VHPVVTEPVGPLSDAVHHEDLSKVTNEKEE  278



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 182/259 (70%), Gaps = 15/259 (6%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H  W  +FG+LGN+IS  V+LAP+  F +IY+ KS+ G+ S+PYV+A+FSSMLW+YYA +
Sbjct  5    HETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYALV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFP  456
            KK+A+LL I+INS G V ETI++ IFLV+A SK R   +K L  L + GF  + L + + 
Sbjct  65   KKDASLLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
             +G  R+S++GWIC+ F+I+VFA+PL I+ +V +T+SVEF+PF LS  LT++AVMWF YG
Sbjct  125  TTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSSSLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKP-VVEENKNVQE---HIVNVEMLGTSN  804
            L++KD  IALPN LGF  G++Q++LY +YRNAKP  +EE   VQE   HI++V       
Sbjct  185  LLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTKVQELNGHIIDV-------  237

Query  805  QLVHPVDSGRNISDGVTEI  861
              V P  + +N    V EI
Sbjct  238  --VKPNHATKNGHVPVIEI  254



>ref|XP_010037381.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
 gb|KCW49081.1| hypothetical protein EUGRSUZ_K02684 [Eucalyptus grandis]
Length=265

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 161/228 (71%), Gaps = 3/228 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI    + W+L+FG+LGNI+SI V++APV  F RI R KST G+ SVPYV+++FS+MLW
Sbjct  1    MAIFTTDNTWVLIFGVLGNIVSIVVFMAPVPTFCRICRKKSTEGFESVPYVVSLFSAMLW  60

Query  265  MYYAFIKKNAT--LLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGGFSIIF  438
            +YYA +K  ++  LL+ +NS+G   ETIYI ++L +A  +AR   L  L L  GG+  I 
Sbjct  61   LYYASLKSESSAFLLLMVNSVGCAIETIYIALYLTYAPKQARMMTLTLLLLNFGGYCSIL  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L+S F   G  R+ LVGWICVA S AVFA+PLS++  V RTKSVEFLPF LSFFL LSAV
Sbjct  121  LLSHFLAKGSARVQLVGWICVALSAAVFAAPLSVIRMVIRTKSVEFLPFSLSFFLMLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV-EENKN  759
             W  YGL +KDL +A PN+LG   G+LQ+ L+AIYR    VV EE KN
Sbjct  181  TWLLYGLFLKDLYVAGPNVLGVIFGVLQMALHAIYRKRNKVVAEEEKN  228



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 177/275 (64%), Gaps = 12/275 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L  P   +FGILGNIIS  V+L+P+  F RIYR KST G+ SVPYV+A+ S ML 
Sbjct  1    MAGLSLEQPLPFIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLL  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKE-LFLCIGGFSIIFL  441
            +YYA +K NA LLI+INS G   ET YI I+L++A+ KAR   ++  + L +  F+ I L
Sbjct  61   IYYALVKTNAVLLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++   F+G  R+++VGWICV FS+ VFA+PLSI+  V RTKSVEF+PFYLSFFLTL+A+ 
Sbjct  121  LTRLAFTGPDRVTVVGWICVGFSLCVFAAPLSIIRLVIRTKSVEFMPFYLSFFLTLNAIA  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN------VQEHIVNV  783
            WFGYG   KDL + LPN+LGF  G++Q+++Y +Y+N       NK       V EH V +
Sbjct  181  WFGYGFFTKDLYVELPNVLGFVFGVVQMVVYMLYKN-----NNNKKDAAVAAVPEHRVKI  235

Query  784  EMLGTSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
              L ++      V       +  +  + ++ D+ E
Sbjct  236  AELSSAPASELQVSLEEKDQNKRSMEDSQDTDKNE  270



>ref|XP_009599477.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 166/242 (69%), Gaps = 1/242 (0%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYVIA+FSSMLW+YYAF+K N
Sbjct  7    WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTN  66

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TLLI+INS G+  ETIY+  +L +A  KAR   +K L L  + GF  I L++ F F G 
Sbjct  67   TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLTVVAGFGAIILIAQFLFKGV  126

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
             R  +VGW+C+ FS+ VF +PL IV +V +TKSVEF+P  LS FLTLSAVMWF YGL++K
Sbjct  127  ARGQVVGWVCLVFSLCVFVAPLCIVRKVIKTKSVEFMPLLLSVFLTLSAVMWFFYGLLLK  186

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHPVDS  828
            D+ IA PNILG   G+LQI+LY IY   +  + + +N+ E   +V +L  + +L    + 
Sbjct  187  DINIAAPNILGLIFGILQIVLYVIYNKKEKHILKEQNLPELQNHVIILDDNKKLPELTEE  246

Query  829  GR  834
             +
Sbjct  247  HK  248



>ref|XP_009787633.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 164/226 (73%), Gaps = 4/226 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA +  H  W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW
Sbjct  1    MAGISGH--WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K N TLLI+INS G+  ETIY+  +L +A  KA+   +K L L  +GGF  I L
Sbjct  59   IYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+ F F G +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVM
Sbjct  119  VTQFLFKGAVRGQVVGWICLVFSLCVFIAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK  756
            WF YGL++KD+ IA PN+LGF  G+LQI+LY IY +  K +++E K
Sbjct  179  WFFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQK  224



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 172/260 (66%), Gaps = 13/260 (5%)
 Frame = +1

Query  85   MAILDL-HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MA L++    W   FGILGNIIS+ V+L+P+  F R+YR KST G+ S PYV+ +FS ML
Sbjct  1    MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIF  438
            W++YA +K  A LL++IN +G V ET+YI ++LV+A   AR    K L  L +G F ++ 
Sbjct  61   WIFYALLKTGAVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVS  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            LV+    +G +R+ ++GWICV+ +++VFA+PLSI+ QV RTKSVEF+PF LSFFL LSAV
Sbjct  121  LVTMVLSNGNLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP----VVEENKNVQEHIVNV-  783
            +WF YG + KD+ +A PN+LGF  GL Q+ LY  YRN KP    V+ E   + EH+  V 
Sbjct  181  IWFAYGALKKDVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVKLPEHVKEVA  240

Query  784  ------EMLGTSNQLVHPVD  825
                  E   +    VHP+D
Sbjct  241  AAPVAHEGRASCGAEVHPID  260



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 165/233 (71%), Gaps = 1/233 (0%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFG+LGNI+S  VYLAPV  F +IY+ KST G+ SVPYV+ +FS+MLW+YYAF+K + TL
Sbjct  8    VFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTTL  67

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS+G   +T YI  FL +A+ KA+ + +K L  + + G  +I L++ F   G  R 
Sbjct  68   LITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGLGLIILLTQFFSKGSNRA  127

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             +VGWIC+ FS  VF +PL ++ QV R+KSVE++PF LSFFLTLSAVMWF YGL+ KD  
Sbjct  128  QIVGWICLIFSFCVFVAPLGVLRQVIRSKSVEYMPFQLSFFLTLSAVMWFFYGLLRKDYN  187

Query  658  IALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVH  816
            IA+PN+LGF LG++Q+ LY IY+NAK V +E +      V  E L  S +++ 
Sbjct  188  IAIPNVLGFSLGVIQMTLYLIYKNAKKVTKEVRLENTETVVDEELKLSEEMLK  240



>ref|XP_004235334.1| PREDICTED: bidirectional sugar transporter SWEET12 [Solanum lycopersicum]
Length=298

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 179/271 (66%), Gaps = 15/271 (6%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNI+S  V+L+P+  F  IY+ KST GY S+PYV+A+FSSMLW+YYA +K N
Sbjct  6    WAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSN  65

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
              LLI+INS G+  ETIY+ ++L++A +KAR + +K L L  +GGF  I L++ F F G 
Sbjct  66   MPLLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEFLFKGV  125

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  126  VRGQIVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  185

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE------HIVNVEMLGTS---  801
            D+ IA PN+LGF  G+LQI+LYAIY   + V+ + + + E       + N  M+ T+   
Sbjct  186  DINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQTPAVIVKNENMMNTTKKL  245

Query  802  -----NQLVHPVDSGRNISDGVTEINMENND  879
                  Q++  V  G  +    T++    ND
Sbjct  246  PELTQEQIIDIVKLGLLVCSDKTQVATCPND  276



>ref|XP_004491681.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=259

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 183/255 (72%), Gaps = 10/255 (4%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+     FG+LGN+IS  V+LAP+S F RIY+ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWFPF  459
            KK+A LLI+INS G V E IYI++++++A   AR+   K L  + +G  ++I LV+ +  
Sbjct  65   KKDAFLLITINSFGCVIEIIYIILYIIYAPRDARKLTFKLLSAMNVGSLALILLVTQYAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G +R+ ++GWICV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSAVMWFGYGL
Sbjct  125  HGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAVMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRN--AKPVVEENKNVQEHIVNVEMLGTSNQLV  813
             +KD+ IALPN+LGF LGLLQ+LLYAIYRN   K + +E K   E + ++ +     QLV
Sbjct  185  FLKDICIALPNVLGFVLGLLQMLLYAIYRNRGEKTIQKEKKTPIEPLKSIVI---ETQLV  241

Query  814  HPVDSGRNISDGVTE  858
               +      DG +E
Sbjct  242  EKNEQ----KDGKSE  252



>ref|XP_006493252.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X1 [Citrus sinensis]
Length=290

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 182/257 (71%), Gaps = 5/257 (2%)
 Frame = +1

Query  130  ILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATLLIS  309
            I+GNI+S  V+LAP+  F R+ + KST G+ S+PYV+A+FS+MLW+YYA +KK+A LLI+
Sbjct  21   IIGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLWIYYAMMKKDAFLLIT  80

Query  310  INSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGEI-RISL  483
            IN+ G V ETIY+ +++ FA  +AR   L+ L L   GGF  I L+S F   G   R+ L
Sbjct  81   INAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILLLSHFLAKGSAARLRL  140

Query  484  VGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLRIA  663
            +GWICV FS++VFA+PLSI+  V RTKSVEF+PFYLS FLTL+AVMWF YGL +KD+ +A
Sbjct  141  LGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAVMWFFYGLFLKDVYVA  200

Query  664  LPNilgfflgllqillYAIYRNAKPVVEENKN-VQEHIVNVEMLGTSNQLVHPVDSG-RN  837
            +PN+LGF  G++Q++LYAIYRN + VV E+ N V EH V+V  L T+N       +  RN
Sbjct  201  VPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTVDVVKLSTNNMTASEEQTNSRN  260

Query  838  ISDGVTEINMENNDQGE  888
              D   E + + NDQ E
Sbjct  261  NFDDKNE-HEQANDQHE  276



>ref|XP_010534707.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=300

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 139/293 (47%), Positives = 194/293 (66%), Gaps = 32/293 (11%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++  HH   + FG+LGN IS  V+LAP   F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MALMINHHFMAVTFGVLGNAISFLVFLAPAPTFYRIYKKKSTESFRSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA +K+NA LLI+INS G V ET+YI +F  ++S   R +A+K LF+   +G FS+I 
Sbjct  61   LYYALLKRNAFLLITINSFGCVIETLYIALFFAYSSKDKRISAMK-LFMAMNVGLFSLIL  119

Query  439  LVSWF----PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLT  606
             V+ F    P S   RI ++GWICV+ S++VFA+PL++V +V RTKSVEF+PF LSFFLT
Sbjct  120  SVTHFLVKNPNS---RIVVLGWICVSISVSVFAAPLTVVARVIRTKSVEFMPFTLSFFLT  176

Query  607  LSAVMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA-KPVVEENKNVQEH----  771
            +SAVMWF YGL ++D+ IA+PN+LGF LG++Q++LY IYRN+ KP +E+    Q+     
Sbjct  177  ISAVMWFAYGLFLRDICIAIPNVLGFALGMVQMILYGIYRNSEKPNLEKKVPDQQQQLKT  236

Query  772  IVNVEMLGTSNQLVHPVD-------------SGRNISDG--VTEINMENNDQG  885
            IV    LG S   V+PVD             + R  SDG    +I+ E + +G
Sbjct  237  IVVSSPLGVSE--VYPVDVTSQSDGDEGEKVTPRGASDGQDTAKISKEPSSEG  287



>gb|EMT09236.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=310

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 180/290 (62%), Gaps = 25/290 (9%)
 Frame = +1

Query  85   MAILDL-HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MA L++  H W   FGILGNIIS+ V+L+P+  F R+YR KST G    PY++ +FS +L
Sbjct  1    MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGVQPTPYLVTLFSCLL  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSII  435
            WMYYAF+K  + LL++IN++G V E++YI ++LV+A   AR    K LF  L +G F +I
Sbjct  61   WMYYAFLKSGSELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAK-LFIGLDVGLFGLI  119

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
             LV+     G +R+ +VGWICVA ++ VFA+PLSI+  V RTKSVEF+PF LSFFL LSA
Sbjct  120  ALVTMLASYGPLRVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP----VVEENKNVQEHIVNV  783
            V+WF YG + KD+ +A+PN+LG   G+ Q+ LY  YRN KP    +V E   + EH+  V
Sbjct  180  VIWFAYGALKKDIFVAMPNVLGLLFGVAQMALYMAYRNKKPATVVLVHEEMKLPEHVKEV  239

Query  784  ------------EMLGTSNQLVHPVD-----SGRNISDGVTEINMENNDQ  882
                        E   +    VHP+D     +    + G  + ++  +DQ
Sbjct  240  AGGAKPQGGAPTEGRISCGAEVHPIDVLPAVAVDEQAAGAADEDVIRDDQ  289



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 170/245 (69%), Gaps = 7/245 (3%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            +D  H +   FG+LGNIIS  V+L+P+  F  IY+ KST GY S+PYV+A+FSSMLW+YY
Sbjct  3    VDFGH-YAFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIYY  61

Query  274  AFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSW  450
            A +K N  LLI+INS G+  ETIY+  +L +A  KAR + +K L L  +GGF  I LV+ 
Sbjct  62   ALLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTE  121

Query  451  FPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFG  630
            F F G +R  +VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAVMWF 
Sbjct  122  FLFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  631  YGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK----NVQEHIVNVEMLG  795
            YGL++KD+ IA PN+LGF  G+LQI+LYAIY +  K +++E K       E IV  E + 
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEIQKTEVIVKDENMN  241

Query  796  TSNQL  810
             + +L
Sbjct  242  ANKKL  246



>ref|XP_009779208.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Nicotiana sylvestris]
Length=264

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 164/236 (69%), Gaps = 3/236 (1%)
 Frame = +1

Query  124  FGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATLL  303
            FGILGNIIS  V+++PV  F  I + KS  G+ SVPYV+A+FSSMLW+YYA  K N TL+
Sbjct  4    FGILGNIISFTVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMTKTNETLI  63

Query  304  ISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRIS  480
            I+INS G + ETIYI I+  +A+ K R   L+  L L  GGF +I  ++     G  R  
Sbjct  64   ITINSFGCIAETIYIAIYFAYATKKTRMQTLRLVLLLNFGGFGLILFLTQILCKGAKRAE  123

Query  481  LVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLRI  660
            ++GWIC+AFSI+VF +PLSI+ +V RTKSVEF+PF LS  LTLSAVMWF YGL+++D+ +
Sbjct  124  VIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLLRDIYV  183

Query  661  ALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS-NQLVHPVD  825
             +PNI G  LG+LQ++LY IYRNAKP   E K +   +V +E L T  N  V+PV 
Sbjct  184  TVPNIAGMVLGVLQMVLYGIYRNAKPNQAEEKKL-PTVVKLEELPTKVNSEVYPVS  238



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 176/286 (62%), Gaps = 23/286 (8%)
 Frame = +1

Query  85   MAILDLH-HPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MA L +  + W   FGILGNIIS+ V+L+P+  F R+YR KST G+ S PYV+ +FS ML
Sbjct  1    MAFLSMERNTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIF  438
            WMYYAF+K  A LL++IN +G V ET+Y+ ++L +A+   R    + L  L +G F +I 
Sbjct  61   WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIA  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            LV+     G +R+ ++GW+CVA S++VFA+PLSI+  V RTKSVEF+PF LSFFL LSAV
Sbjct  121  LVTLLLPQGALRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP--------VVEENKNVQEHI  774
            +WFGYGL+ KD+ +ALPN+LGF  G+ Q+ LY  YR  KP           +   + EH+
Sbjct  181  IWFGYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRTKKPPASSSSSAAAGQEIKLPEHV  240

Query  775  VNV------------EMLGTSNQLVHPVDSGRNISDGVTEINMENN  876
              V            E   +    VHP+D     +  V E+ ++  
Sbjct  241  KEVTTIVAKAGAAPPEGRASCGAEVHPIDDALP-APTVVEVKVDEE  285



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 176/260 (68%), Gaps = 14/260 (5%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W  VFG+LGNI+S  V+L+P+  F  IY+ K+  GY S+PYV+A+FSSMLW+YYAF+K N
Sbjct  8    WAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFLVSWFPFSGE  468
             TLLI+IN+ G+  ETIY++ +L++A  K+R   +K L L  +GGF  I LV+ F F G 
Sbjct  68   TTLLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILVTQFLFKGV  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            IR  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  128  IRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIY-RNAKPVVEENK--NVQ--EHIVNVEMLG------  795
            D+ IA PNILGF  G+LQ++LY IY +  K +++E K   +Q  E IV  E +       
Sbjct  188  DINIAAPNILGFIFGVLQMILYVIYSKKEKAILKEQKLPEIQKGEVIVKDENMNADKKFP  247

Query  796  --TSNQLVHPVDSGRNISDG  849
              T  Q++  V  G  +  G
Sbjct  248  ELTQEQIIDIVRLGLMVCKG  267



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 171/241 (71%), Gaps = 10/241 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HP    FG+LGNIIS   YLAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLLHPMAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K N  LLI+INS G V ET+YI ++L++A  KA+    K L L  +G F +I L
Sbjct  61   IYYALLKSNELLLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +G+ R+ ++GW+CVAFS++VF +PLSI+ QV RT+SVEF+PF LS  LT+SAV+
Sbjct  121  LTLLLSAGQRRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV---------EENKNVQEHI  774
            WF YGL++KD  +ALPN++GF  G++Q+ LYA+YRNA P V          ++K   EH+
Sbjct  181  WFLYGLLIKDKYVALPNVIGFSFGVVQMGLYALYRNATPRVPAKDVADDASKDKAPGEHV  240

Query  775  V  777
            V
Sbjct  241  V  241



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 176/254 (69%), Gaps = 8/254 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H  W  VFG+LGN+IS  V+LAP+  F +IY+ KST  + S+PYV+A+FSSMLW+YYA +
Sbjct  5    HETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIYYALV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFP  456
            KK+A+LL I+INS G V ETIY+ IFL++A SK R   +K L  L + GF  + L + + 
Sbjct  65   KKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
             +G  R++++GWIC+ F+I+VFA+PL I+ +V +TKSVEF+PF LSFFLT++AVMWF YG
Sbjct  125  TTGSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAK--PVVEENKNVQEHIVNVEMLGTSNQL  810
            L++KD  +ALPN LGF   ++Q++LY IYRNAK   +  + + +  H ++V  L      
Sbjct  185  LLLKDYYVALPNTLGFLFSIIQMVLYLIYRNAKTPDLPMKLQELNSHTIDVGKLSR----  240

Query  811  VHPVDSGRNISDGV  852
            + P +      +G 
Sbjct  241  MEPSEPNHVTKNGT  254



>ref|XP_009421186.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 176/263 (67%), Gaps = 6/263 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW    GILGNIIS+ V+LAP+  F R+Y  KST G+ SVPYV+A+FS MLW
Sbjct  1    MAGLSLDHPWAFTIGILGNIISLMVFLAPLPTFYRVYTRKSTEGFQSVPYVVALFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
              YAF+K +A LLI+INSIG   ET+YI+I+L +A   A+    K  L + +G F +I L
Sbjct  61   FCYAFLKTDAYLLITINSIGCAIETVYIVIYLTYAPKVAKIFTAKLVLVVNVGMFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     G  R+   GWICV+FS++VF +PLS++  V RTKSVEF+P  LSFFLTLSA++
Sbjct  121  LTLLLAEGSKRVGAFGWICVSFSVSVFVAPLSVIRLVMRTKSVEFMPVSLSFFLTLSAIV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WF YGL+ KD+ + LPN++GF  G+LQ++LY  YR+   V  E+K + EHI+++  L   
Sbjct  181  WFAYGLLTKDIYVGLPNVVGFIFGILQMVLYVAYRDKNRVAIEHK-LPEHIISIAKLSAE  239

Query  802  N-QLVHPVDSGRNI---SDGVTE  858
                ++P+DS   +    D V E
Sbjct  240  KASEIYPIDSATPVVHDQDTVQE  262



>ref|XP_006347653.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 178/268 (66%), Gaps = 11/268 (4%)
 Frame = +1

Query  106  HPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIK  285
            HP +  FGILGN++S  V++APV  F RI + KS+ G+HS+PYV+ +FS+MLW+YYA +K
Sbjct  8    HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  286  KNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFS  462
             N TLLI+INS G + ETIY+ I+  +A+ KAR   L   L L  G F +I  ++     
Sbjct  68   TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  463  GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLI  642
            G  R  ++GWIC+AFSI+VF +PLSI+ +V RTKSVEF+PF LS  LT+SAVMWF YGL+
Sbjct  128  GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  643  MKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS--NQLVH  816
            +KD+ +A+PNI G  LG+LQ++LY IYRN+K      K     +V V+    +  N  V+
Sbjct  188  LKDVYVAVPNISGMILGVLQMILYGIYRNSKSNNVATKKELPTVVKVDQEQPTKVNCEVY  247

Query  817  PVDSGRNISDGVTEINMENNDQGE*KMI  900
            PV+        ++ ++ EN +  + K++
Sbjct  248  PVN--------ISSLDSENGEGKDGKIL  267



>ref|XP_006363981.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=300

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 170/245 (69%), Gaps = 7/245 (3%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            +D  H +   FG+LGNI+S  V+L+P+  F  IY+ KST GY S+PYV+A+FSSMLW+YY
Sbjct  3    VDFGH-YAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYY  61

Query  274  AFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSW  450
            A +K N  LLI+INS G+  ETIY+  +L +A  KAR + +K L L  +GGF  I LV+ 
Sbjct  62   ALLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTE  121

Query  451  FPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFG  630
            F F G +R  +VGW+C+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAVMWF 
Sbjct  122  FLFKGVVRGQIVGWVCLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  631  YGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK----NVQEHIVNVEMLG  795
            YGL++KD+ IA PN+LGF  G+LQI+LYAIY +  K +++E K       E IV  E + 
Sbjct  182  YGLLLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQKLPEMQKPEVIVKDENMN  241

Query  796  TSNQL  810
             + +L
Sbjct  242  ANKKL  246



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 169/238 (71%), Gaps = 6/238 (3%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W  VFG+LGNI+S  V+L+P+  F  IY+ K+  GY S+PYV+A+FSSMLW+YYAF+K N
Sbjct  8    WAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFLVSWFPFSGE  468
             TLLI+IN+ G+  ETIY+  +L +A  K+R   +K L L  +GGF  I LV+ F F G 
Sbjct  68   TTLLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILVTEFLFKGA  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            IR  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  128  IRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIY-RNAKPVVEENK--NVQ--EHIVNVEMLGTSNQ  807
            D+ IA PNILGF  G+LQ++LY IY +  K +++E K   +Q  E IV  E + T+ +
Sbjct  188  DINIAAPNILGFIFGILQMILYVIYSKKEKAILKEQKLPEIQKAEVIVKDENMNTNKK  245



>gb|KEH21448.1| bidirectional sugar transporter [Medicago truncatula]
Length=268

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+     FG+LGN+IS  V+LAP+S F RIY+ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWFPF  459
            KK+A LLI+INS G V ETIYI++++++A   AR    K L  + +G F++I +V+ +  
Sbjct  65   KKDAFLLITINSFGCVVETIYIILYIIYAPRDARNLTFKLLSAMNVGSFALILIVTNYAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G +R+ ++GW+CV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA MWFGYGL
Sbjct  125  HGPLRVQVLGWVCVSLSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNA  732
             +KD+ IALPN+LGF LGLLQ+LLYAIYRN 
Sbjct  185  FLKDICIALPNVLGFVLGLLQMLLYAIYRNG  215



>emb|CDY53626.1| BnaC03g71480D [Brassica napus]
Length=291

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 185/275 (67%), Gaps = 11/275 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M I+  HH   ++FGILGN IS  V+LAP+  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGIMINHHLLAIIFGILGNAISFCVFLAPLPTFYRIYKNKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            +YYA IK++A LLI+INS G + ETIYI +F  +A+   R  A+K  F + +  FS+I +
Sbjct  61   LYYALIKQDAFLLITINSFGCIVETIYIALFFAYATRGKRIAAMKLFFTINVAFFSLILM  120

Query  442  VSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            V+ F   S  +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LS FLT+SAV
Sbjct  121  VTHFAVKSPSLQVSIIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSLFLTISAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------EHIVN  780
            MWF YG  + D+ IA+PN++GF LG+LQ++LY +YRN+   ++  K +       + IV 
Sbjct  181  MWFAYGAFLHDICIAIPNVVGFILGMLQMVLYGVYRNSGVKIDAEKKINSLDQQLKTIVV  240

Query  781  VEMLGTSNQLVHPVD-SGRNISDGVTEINMENNDQ  882
            +  LG S   VHPVD +   +SD V   +    ++
Sbjct  241  ISQLGVSE--VHPVDITVDPLSDAVHHEDPSKQEE  273



>ref|XP_006281748.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
 gb|EOA14646.1| hypothetical protein CARUB_v10027907mg [Capsella rubella]
Length=290

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/275 (47%), Positives = 187/275 (68%), Gaps = 21/275 (8%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFGILGN+IS FV LAP+  FIRIY+ KS+ GY SVPYVI++FS+MLW+YYA IKK+A +
Sbjct  11   VFGILGNVISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAVM  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS   V + +YI +F  +A  K +   +K  LF+ +  F +IF  ++FP  G  R+
Sbjct  71   LITINSFAFVIQIVYISLFFFYAPKKDKILTVKFVLFVDVFAFGLIFFSTYFPIHGNKRV  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ F+++VF +PL I+ +V +TKS EF+PF LSFFLTLSAVMWF YGL++KD  
Sbjct  131  QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDKN  190

Query  658  IALPNilgfflgllqillYAIYRNA-----KPVVEENKNVQEHIVNVEMLGT---SNQL-  810
            IALPN+LGF  G+LQ++L+ IY+       +P V + +++ EH+V+V  L +   ++Q+ 
Sbjct  191  IALPNVLGFIFGVLQMVLFVIYKKPGTKVLEPSVIKLQDISEHVVDVVRLSSMVCNSQMR  250

Query  811  -VHPVDSGRNISD---------GVTEINMENNDQG  885
             + P DS  ++ D         G  E N +NN + 
Sbjct  251  TLVPQDSA-DMEDTIDIEEKMKGDIEKNKDNNKEA  284



>ref|XP_008392727.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=295

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 184/273 (67%), Gaps = 14/273 (5%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + LHH   L FG+LGNIIS+ V+LAPV  F  +Y+ K+T G+ ++PYVI + SSM+++YY
Sbjct  1    MALHHTLSLAFGLLGNIISLLVFLAPVPTFYTVYKKKTTEGFQALPYVIGLLSSMMYVYY  60

Query  274  AFIKK----NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIF  438
            A +K+    +ATL+I+INS+G V ETIYI +FL +A  KAR +    LFL  +  + ++ 
Sbjct  61   ALLKEELKEDATLVITINSVGCVIETIYIXLFLFYAPKKARISTATLLFLLNLFSYGMMV  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +++ F  +GE R  +VGWIC+ FS++VF +PL ++ QV RTKSVEF+PF LSFFLTL AV
Sbjct  121  VLTRFLATGETRFKIVGWICLVFSLSVFVAPLGVLRQVIRTKSVEFMPFPLSFFLTLGAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ---EHIVNVEM  789
             WF YG ++KD  IA PNILGFF G++Q+ +Y +Y+NAK  +E+   VQ   EHI++V  
Sbjct  181  AWFFYGFLIKDYYIAFPNILGFFFGVVQMAVYVVYKNAKKFLEDQPKVQELSEHIIDVMK  240

Query  790  LGTSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
            + T   LV P  S   I +   +I    ND  E
Sbjct  241  IST---LVCPELSPAVILNPTVDI---TNDMIE  267



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 175/270 (65%), Gaps = 14/270 (5%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNI+S  V+L+P+  F  IY+ KST GY S+PYV+A+FSSMLW+YYA +K N
Sbjct  8    WAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
              LLI+INS G+  ETIY+ ++L +A  KAR   +K L L  +GGF  I LV+   F G 
Sbjct  68   MPLLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILVTELLFKGA  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            IR  +VGWIC+ FS+ VF +PL IV +V +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  128  IRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE-----HIVNVEMLGTS----  801
            D+ IA PN+LGF  G+LQI+LYAIY   + V+ + + + E      IV  E + T+    
Sbjct  188  DINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQKLPEIQTPGVIVKDENMHTNKKLP  247

Query  802  ----NQLVHPVDSGRNISDGVTEINMENND  879
                 Q++  V  G  +    T++    ND
Sbjct  248  ELTQEQIIDIVKLGLLVCSDKTQVATCPND  277



>ref|XP_006399805.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
 gb|ESQ41258.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
Length=297

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 180/256 (70%), Gaps = 12/256 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M I+  HH   +VFG LGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGIMINHHLLAIVFGALGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA IK+NA LLI+INS G V ET+YI +F  +A+   R  A+K LF+   +  FS+I 
Sbjct  61   LYYALIKQNAFLLITINSFGCVVETLYIAMFFAYATKDKRIAAMK-LFITMNVAFFSLIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   S  +++S++GW+CVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFVVKSPTLQVSVIGWVCVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEH----IV  777
            VMWF YGL + D+ IA+PN++GF LG++Q++LY +YRN+  K  +E+  N  +     IV
Sbjct  180  VMWFAYGLFLHDICIAIPNVVGFILGMVQMVLYGVYRNSGEKLDIEKKVNTSDQQLKSIV  239

Query  778  NVEMLGTSNQLVHPVD  825
             +  LG S   VHP+D
Sbjct  240  VMSPLGVSE--VHPID  253



>ref|XP_010039123.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
Length=237

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 163/237 (69%), Gaps = 2/237 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI    +PW+L+FG+LGNIISI V+LAPV  F RI R KST G+ SVPYV+++ S+MLW
Sbjct  1    MAIFTTENPWVLIFGVLGNIISIVVFLAPVPTFCRICRKKSTEGFESVPYVVSLSSAMLW  60

Query  265  MYYAFIKKNAT--LLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGGFSIIF  438
            +YYA +K  ++  LLI++NS+G   ETIYI ++L +A  +AR   L+ L L  GG+  I 
Sbjct  61   LYYASLKSESSAFLLITVNSVGCAVETIYIALYLTYAPKQARMMTLRLLLLNFGGYCSIL  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L+S F   G  R+ LVG ICVA S+AVFA+PLS++  V  TKSVEF+PF LS FL LSAV
Sbjct  121  LLSHFLTKGSARVQLVGRICVALSVAVFAAPLSVIRMVICTKSVEFMPFSLSSFLMLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEM  789
             W  YGL +KDL +A PN+LG   G+LQ+ L+AIYR    VV E +N    +   E+
Sbjct  181  TWLLYGLFLKDLYVAGPNVLGVIFGVLQMALHAIYRKRNKVVTEEENNDTSVWKAEL  237



>ref|XP_006436900.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
 ref|XP_006493251.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Citrus 
sinensis]
 gb|ESR50140.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
Length=271

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 182/269 (68%), Gaps = 6/269 (2%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + +HH W   FG+LGNI S  V LAP+  F +IY+ KST G+ SVPYVI++FS+M+W+YY
Sbjct  1    MAIHHSWATAFGLLGNITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYY  60

Query  274  AFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSW  450
            A +K+NA  L++IN+   V +TIYI +++ +A  K R   +K L L  I GF  I L+++
Sbjct  61   ALLKQNAIFLMTINTFCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAICLLTF  120

Query  451  FPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFG  630
            F   G IR  ++G+IC+ F+++VFA+PL IV +V +TKSVE++PF LSFFLT+ AV WF 
Sbjct  121  FLSKGAIREKILGYICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWFF  180

Query  631  YGLIMKDLRIALPNilgfflgllqillYAIYRNA-KPVVEENK--NVQEHIVNVEMLGT-  798
            YGL++KDL +A+PN+LGF  G+LQ++LY IY+N  K +VE+ K   + EH+V+V  L T 
Sbjct  181  YGLLIKDLNVAIPNVLGFIFGVLQMILYVIYKNPNKKIVEQTKLQELSEHVVDVVKLSTM  240

Query  799  -SNQLVHPVDSGRNISDGVTEINMENNDQ  882
              ++L   V     I +   EI M+    
Sbjct  241  VCSELNSVVPQLSAIQNEDNEIVMKKQTD  269



>ref|XP_004235342.2| PREDICTED: uncharacterized protein LOC101265905 [Solanum lycopersicum]
Length=599

 Score =   229 bits (584),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 175/260 (67%), Gaps = 9/260 (3%)
 Frame = +1

Query  82   EMAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            E ++  +   W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYV+A+FSSML
Sbjct  300  EASMAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSIPYVVALFSSML  359

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIF  438
            W+YYAF+K N TLLI+INS G+  ETIY+  +L +A  K R   +K L L  +GGF  I 
Sbjct  360  WIYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIV  419

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L++ F F G +R  +VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAV
Sbjct  420  LITEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVKQVIKTKSVEYMPLLLSIFLTLSAV  479

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT  798
            +WF YGL++KD+ IA+PN+LGF LG+LQ++LY IY   +  + + + + E +        
Sbjct  480  VWFFYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEKAILKEQKLPEKL--------  531

Query  799  SNQLVHPVDSGRNISDGVTE  858
             N ++  +D     S G+TE
Sbjct  532  QNHMIISMDEKNKNSPGLTE  551


 Score =   223 bits (569),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 167/255 (65%), Gaps = 10/255 (4%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FGILGNIIS  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW+YYA +K N
Sbjct  8    WAFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TLLI+INS G+  ETIY+  +L +A  K R   +K L L  +GGF  I LV+ F F G 
Sbjct  68   TTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLVTEFLFKGV  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R  +VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAV+WF YGL++K
Sbjct  128  VRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHPVDS  828
            D+ IA PN+LGF  G+LQI+LY IY   + V+ + + + E              V   D 
Sbjct  188  DINIAAPNVLGFIFGILQIVLYVIYNKKEKVILKEQKLPE---------IQKAAVIVSDD  238

Query  829  GRNISDGVTEINMEN  873
              N++  + E+  E 
Sbjct  239  NTNVNKKLPELTQEQ  253



>ref|XP_004235470.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=276

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 173/265 (65%), Gaps = 21/265 (8%)
 Frame = +1

Query  106  HPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIK  285
            HP +  FGILGN++S  V++APV  F RI + KS+ G+HS+PYV+ +FS+MLW+YYA +K
Sbjct  8    HPLVYTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  286  KNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFS  462
             N TLLI+INS G + ETIY+ I+  +A+ KAR   L   L L  G F +I  ++     
Sbjct  68   TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  463  GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLI  642
            G  R  ++GWIC+AFSI+VF +PLSI+ +V RTKSVEF+PF LS  LT+SAVMWF YGL+
Sbjct  128  GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  643  MKDLRIALPNilgfflgllqillYAIYRNAK----------PVV-----EENKNVQEHI-  774
            +KD+ +A+PNI G  LG+LQ++LY IYRN+K          P+V     E+   V   + 
Sbjct  188  LKDVYVAVPNIPGMILGVLQMILYGIYRNSKSNNVATEKELPIVVKVDQEQPTKVNSEVY  247

Query  775  -VNVEMLGTSNQLVHPVDSGRNISD  846
             VN+  L + N        G+N+ D
Sbjct  248  PVNISSLDSEN---GEAKDGKNLQD  269



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 161/223 (72%), Gaps = 1/223 (0%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFG+LGN++S  V+LAP+  F +IY+ KST G+ SVPYV+ +FS+MLW+YYAF+K + TL
Sbjct  7    VFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTTL  66

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGEIRI  477
            LI+INS+G   ++ YI  +L FA   AR   +K L L    GF +I ++++F   G  R 
Sbjct  67   LITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLAKGSNRA  126

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
            + VGWIC+ FS+ VF +PL +V QV RTKS E++PF LSFFLT+SA++WF YG + KD  
Sbjct  127  NFVGWICLVFSLCVFVAPLCVVRQVLRTKSAEYMPFLLSFFLTISAIVWFFYGFLRKDYN  186

Query  658  IALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVE  786
            IA+PN+LGF  G+LQ++LY IYRN K +V+EN+ +   I+ VE
Sbjct  187  IAIPNVLGFIFGVLQMVLYLIYRNGKTLVQENQQLPAGIIAVE  229



>ref|XP_007137872.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
 gb|ESW09866.1| hypothetical protein PHAVU_009G162900g [Phaseolus vulgaris]
Length=291

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 172/267 (64%), Gaps = 13/267 (5%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H P   +FG+LGN+ S   +LAP+  F R+ + KST G+ SVPYV A+FS+MLW++YA++
Sbjct  3    HSPLSFLFGVLGNVASFVCFLAPLPTFYRVCKKKSTEGFQSVPYVAALFSAMLWIFYAYV  62

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFLVSWFPF  459
            K   TLLI+INS G V ETIY+ IFL +   KAR + L+ + L   GGF  I L++    
Sbjct  63   KTGETLLITINSFGCVIETIYLAIFLTYCPKKARMSTLRMIVLFNFGGFCTIVLLTHLLA  122

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G  R+ L+GWICV F+ +VFA+PLSI+  V RTKSVEFLPF LS  L LSA+MW  YG+
Sbjct  123  KGAGRVKLLGWICVVFATSVFAAPLSIIRVVIRTKSVEFLPFPLSMLLLLSAIMWLLYGI  182

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHP  819
             +KD+ + LPN++G   G++QI+LY +YRN K +  +N+ + EH  +++    +N+ V P
Sbjct  183  SLKDIYVTLPNVVGLTFGVIQIVLYMMYRNNKTL--KNEKLPEHKGDID----NNENVAP  236

Query  820  VDSGRNISD------GVTEINMENNDQ  882
              S  N         GV EI  +  DQ
Sbjct  237  TVSAENQEQEVNPQAGVVEIGEKKEDQ  263



>ref|XP_007148462.1| hypothetical protein PHAVU_006G210800g [Phaseolus vulgaris]
 gb|ESW20456.1| hypothetical protein PHAVU_006G210800g [Phaseolus vulgaris]
Length=273

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 175/266 (66%), Gaps = 4/266 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAIL  H+PW   FGILGNIIS+ VYLAP   F RIY+ K T G+ S+PY++A+FSS LW
Sbjct  1    MAILGSHNPWAAAFGILGNIISLMVYLAPAHTFYRIYKKKCTEGFQSLPYLVALFSSSLW  60

Query  265  MYYA-FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIF  438
            +YYA F  K++  LI+INS+G V E +YI+IF+ +A   A+   +K +  + +G  ++I 
Sbjct  61   LYYASFNIKHSVFLITINSLGCVIEIVYIVIFIKYAHKDAKNLTIKLVAAMNLGSLALIL  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            LV+ F  +  +++ ++GWIC   S++VFA+PLSI+ QV RTKSV+F+PF LSF LTL+A+
Sbjct  121  LVTHFALNASLQVKVIGWICDIVSLSVFAAPLSIMAQVVRTKSVQFMPFSLSFSLTLNAI  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGT  798
            MW  YGL  KD  +ALPN+ G  LGLLQ++LYAIYRN        +     IV V  LG 
Sbjct  181  MWLAYGLFNKDNCVALPNVGGVALGLLQMVLYAIYRNCGARELATEGGMRTIVVVNPLGP  240

Query  799  SNQLVHPVDSGRNISDGVTEINMENN  876
            +   V P+     ++D V E + +  
Sbjct  241  AE--VFPIAENDEVNDEVAEDHAQEK  264



>emb|CDX69663.1| BnaA10g20120D [Brassica napus]
Length=298

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 181/267 (68%), Gaps = 18/267 (7%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   +VFGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG--FSIIF  438
            + YA IK++A LLI+INS G V ETIYI +F  +A+   R  A+K LFL I    FS+I 
Sbjct  61   LCYALIKQDAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMK-LFLTINVAFFSLIL  119

Query  439  LVSWFPFS-GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F      +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------EHIV  777
            VMWF YGL + D+ IA+PN++GF LG++Q+LLY IYRN    ++  K +       + +V
Sbjct  180  VMWFAYGLFLHDICIAIPNVVGFILGMVQMLLYGIYRNPGEKLDTEKKMNPSDQQLKSVV  239

Query  778  NVEMLGTSNQLVHPVDSGRNISDGVTE  858
             +  LG S   VHP+D      D +TE
Sbjct  240  VMSPLGVSE--VHPID------DNMTE  258



>ref|XP_010093933.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
 gb|EXB54896.1| Bidirectional sugar transporter SWEET10 [Morus notabilis]
Length=295

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 183/271 (68%), Gaps = 13/271 (5%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH   L FG+LGNI+S  V+LAP+  F +IY+ KS  G+ S+PYVIA+ SSMLW+YYA +
Sbjct  4    HHYLTLAFGLLGNIVSFMVFLAPIPTFHKIYKKKSAEGFQSLPYVIALLSSMLWIYYALL  63

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+A LLI+INS+G V ET+YI +FL +A  K R   +K L  L + G+ ++ +++ F  
Sbjct  64   KKDALLLITINSVGCVIETVYIALFLFYAPKKTRIETVKLLLMLNVVGYGLMLVLTIFLA  123

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             GE R+  VGWIC+AF+++VFA+PL I+ QV RTKSVEF+PF LSFFLTL AVMWF YGL
Sbjct  124  EGEKRLQAVGWICLAFNLSVFAAPLCIMRQVIRTKSVEFMPFPLSFFLTLGAVMWFFYGL  183

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE------HIVNVEMLGTS  801
            ++KD  IA PN+LGFF G+ Q+ LY +Y+NAK  +     +QE       +V +  L   
Sbjct  184  LLKDYNIAFPNVLGFFFGIAQMALYIVYKNAKKTILLEPKLQELSEHVIDVVKISALVCP  243

Query  802  NQLVHPV-----DSGRNISDGVTEINMENND  879
             +L +PV     D+G   +D +T+   EN+ 
Sbjct  244  TEL-NPVFIQTNDTGSTGNDKITDHENENHQ  273



>gb|EMT20481.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=293

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 171/249 (69%), Gaps = 13/249 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L L HPW   FG+LGNIIS   YLAP+  F RIYR+KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSLEHPWAFAFGLLGNIISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K +  LLI+INS G V ETIYI+++L +A  +A+    K L L  +G F +I L
Sbjct  61   IYYALLKSDELLLITINSAGCVIETIYIIMYLTYAPKQAKLFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     GE R+ ++GW+CV FS++VF +PLS++  V RT+SVEF+PF LS  LT+SAV+
Sbjct  121  LTLLLAGGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA----------KPVVEENKNVQ--  765
            WF YGL++KD  +ALPNILGF  G++Q+ LYA+Y NA           P+ +    V+  
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYCNAMPRQAPKEVDDPMSDHGAAVKAP  240

Query  766  EHIVNVEML  792
            EH+VN+  L
Sbjct  241  EHVVNISKL  249



>ref|XP_004241452.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
lycopersicum]
Length=287

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNIIS FV+L+P+  F  IY+ KST GY S+PYV+A+FS+MLW+YYAF+K N
Sbjct  8    WTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFLVSWFPFSGE  468
             TLL++IN+ G   ET+Y+  +L +A  KAR   +K L L + G F  I L++ F F G 
Sbjct  68   TTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIILITQFLFKGA  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            IR  +VGWIC+ FS+ VF +PL IV QV +TKSVE++PF LS FLTLSAVMWF YGL++K
Sbjct  128  IRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEENKN---VQEHIVNVE  786
            D  IA+PN+LGF  G+LQ++LY +Y   + VV + +N   +++H++ +E
Sbjct  188  DFNIAIPNVLGFIFGILQMILYVMYNKKEKVVIKEQNLPELKDHVIIIE  236



>ref|NP_001132836.1| hypothetical protein [Zea mays]
 gb|ACF81848.1| unknown [Zea mays]
 tpg|DAA42015.1| TPA: hypothetical protein ZEAMMB73_422539 [Zea mays]
Length=344

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HP    FG+LGNIIS   YLAP+  F RIYR KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPMAFAFGLLGNIISFMTYLAPLPTFCRIYRNKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +K N  LLI+INS G V ET+YI  +L++A +KA+    K L L  +G F +I L
Sbjct  61   IYYALLKSNEFLLITINSAGCVIETLYIATYLLYAPNKAKLFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++    +G  R+ ++GW+CVAFS++VF +PLSI+ QV RT+SVEF+PF LSF LT SAV+
Sbjct  121  LTLLLSAGPHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSFSLTASAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV  744
            WF YGL++KD  +ALPN+LGF  G++Q+ +YA+YRNA P V
Sbjct  181  WFLYGLLIKDKYVALPNVLGFTFGVVQMGMYALYRNATPRV  221



>gb|AHB08882.1| bidirectional sugar transporter SWEET14-like protein [Suaeda 
glauca]
Length=323

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 158/224 (71%), Gaps = 1/224 (0%)
 Frame = +1

Query  100  LHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAF  279
            +H+PW+  FGILGNIIS  V+LAP+  FIR+Y+ KST G+ SVPYV+AIFS+MLW+YYA 
Sbjct  4    IHNPWVFAFGILGNIISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYAM  63

Query  280  IKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            +K N+ LLI+IN  G++ ETIY+ IF+ +A  +AR + LK L L   GGF  I L+  + 
Sbjct  64   LKGNSVLLITINIAGVIIETIYVAIFITYAPRQARISTLKLLMLLNFGGFCGIILLCHYL  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G+ R+ L GWICVAFSI+VF +PLS++  V RTKSVE++PF LS  LTL+A +WF YG
Sbjct  124  AKGQARLQLYGWICVAFSISVFVAPLSVIRTVIRTKSVEYMPFNLSCCLTLTATVWFFYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE  768
             + KDL + LPN++GF  G+ Q+ LY +Y        E + + E
Sbjct  184  FVQKDLYVTLPNVVGFIFGIAQMTLYLVYSRKYGKEAEKQKLPE  227



>ref|XP_006347346.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=287

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNIIS FV+L+P+  F  IY+ KST GY S+PYV+A+FS+MLW+YYAF+K N
Sbjct  8    WTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFLVSWFPFSGE  468
             TLL++IN+ G   ET+Y+  +L +A  KAR   +K L L + G F  I LV+ F F G 
Sbjct  68   TTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVLVTQFLFKGA  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            IR  +VGWIC+ FS+ VF +PL IV QV +TKSVE++PF LS FLTLSAVMWF YGL++K
Sbjct  128  IRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVMWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEENKN---VQEHIVNVE  786
            D  IA+PN+LGF  G+LQ++LY +Y   + VV + +N   +++H++ +E
Sbjct  188  DFNIAIPNVLGFIFGILQMILYVMYNKKEEVVIKEQNLPELKDHVIILE  236



>ref|XP_006347652.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=482

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNIIS  V+L+P+  F +IY+ KST GY S+PYV+A+FSSMLW+YYAF+K N
Sbjct  8    WAFAFGVLGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFLVSWFPFSGE  468
             TLLI+IN+ G+  ETIY+  +L +A  KAR   +K L L  +GGF  I +V+ F F G 
Sbjct  68   TTLLITINTFGVFIETIYVGFYLFYAPKKARVQTIKMLSLFVVGGFGAIIVVTQFLFKGA  127

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            IR  +VGWIC+ FS+ VF +PL IV QV +TKSVE++P  LS FLTLSAVMWF YGL++K
Sbjct  128  IRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  649  DLRIALPNilgfflgllqillYAIY-RNAKPVVEENK  756
            D+ IA PN+LGFF G+LQI+LY IY +  K +++E K
Sbjct  188  DINIAAPNVLGFFFGILQIVLYVIYSKKEKAILKEQK  224


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 98/150 (65%), Gaps = 12/150 (8%)
 Frame = +1

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            + F F G +R  +VGWIC+ FS+ VF +PL I  QV +TKSVE++P  LS FLTLSAV+W
Sbjct  306  TEFLFKGAVRGQVVGWICLIFSLCVFVAPLGI-RQVIKTKSVEYMPLLLSIFLTLSAVVW  364

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIY-RNAKPVVEENK---NVQEH-IVNVEM  789
            F YGL++KD+ IA+PN+LGF LG+LQ++LY IY +  K +++E K    +Q H I++++ 
Sbjct  365  FFYGLLLKDINIAIPNVLGFILGILQMVLYVIYNKKEKAILKEQKLPEKLQNHMIISIDE  424

Query  790  LG------TSNQLVHPVDSGRNISDGVTEI  861
                    T  Q++  V  G  IS G   I
Sbjct  425  KNKNFPELTEEQIIDIVKLGSLISSGKIHI  454



>ref|XP_010678288.1| PREDICTED: bidirectional sugar transporter N3 [Beta vulgaris 
subsp. vulgaris]
Length=324

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 176/285 (62%), Gaps = 23/285 (8%)
 Frame = +1

Query  100  LHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAF  279
            +HHPW+  FG+LGN+IS  V+LAP+  FIR+Y+ KST G+ SVPYV+AIFS+MLW+YYA 
Sbjct  4    IHHPWVFAFGLLGNVISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIYYAL  63

Query  280  IKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFP  456
            +K N+ LLI+IN  G++ ETIY+ I++ +A  +AR + LK  LF+   GF  I L   + 
Sbjct  64   LKGNSVLLITINVAGVIIETIYVAIYITYAPRQARISTLKLLLFMNFCGFCTIVLFCHYL  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
               E R+ + GWICVAFSI+VFA+PLS++  V  TKSVE++P  LS  LTL+A +WF YG
Sbjct  124  VKAENRLQVFGWICVAFSISVFAAPLSVMRTVISTKSVEYMPINLSISLTLTATIWFLYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENK------NVQEHIVNVEMLGT  798
             + KDL I LPN++GF  G+ Q+ LY+IYR      ++ K       V++  V ++ + +
Sbjct  184  FVQKDLYITLPNVVGFMFGVAQMGLYSIYRKYDIKAKKEKLPEVASPVKQETVEIDTINS  243

Query  799  SNQLVHPVD---------------SGRNISDGVTEINMENNDQGE  888
            S       D               +G N  D + +  + N D  E
Sbjct  244  SPNKTESEDYIPPHEKTPEIEVVVTG-NKDDDIDDEQLGNKDHQE  287



>ref|XP_003576225.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Brachypodium 
distachyon]
Length=292

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 172/245 (70%), Gaps = 8/245 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   YLAP+  FIRIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLEHPWAFAFGLLGNVISFMSYLAPIPTFIRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFL  441
            +YYA +K N +LLI+IN+ G V ETIY++++ V+A  KA+    K + L  GG F +I  
Sbjct  61   IYYALVKSNESLLITINAAGCVIETIYVVMYFVYAPRKAKLFTAKIMLLLNGGVFGVILF  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
             + F   GE R+  +GWICVAFS++VF +PLSI+ +V +T+SVE++PF LS  LTLSAV+
Sbjct  121  CTLFLAHGEKRVVSLGWICVAFSVSVFVAPLSIIGRVIKTRSVEYMPFSLSLSLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN------VQEH-IVN  780
            WF YGL++KD  +ALPNILGF  G++Q+ LY  Y N  P+V  +         +EH +VN
Sbjct  181  WFLYGLLIKDKYVALPNILGFSFGVVQMALYMFYMNKTPIVRGDGKEGKLPAAEEHVVVN  240

Query  781  VEMLG  795
            +  LG
Sbjct  241  MAKLG  245



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 154/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FGILGN+IS+ V+L+P+  F R+YR KST G+ S PYV+ +FS MLWMYYAF+K  
Sbjct  11   WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPFSGE  468
            A LL++IN +G V ET+Y+ ++L +A   AR    K L  L IG F +I LV+     GE
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLLLSRGE  130

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R+ ++GWICVA S++VFA+PLSI+  V RTKSVEF+PF LSFFL LSAV+WF YGL+ K
Sbjct  131  LRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYGLLKK  190

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPV  741
            D+ +ALPN+LGF  G+ Q+ LY  YR+ KP+
Sbjct  191  DVFVALPNVLGFVFGVAQMALYMAYRSKKPL  221



>gb|AAM65389.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
Length=292

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 191/276 (69%), Gaps = 11/276 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH    +FGILGN+IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVIINHHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA IKK+A LLI+INS G V ET+YI +F  +A+ + R +A+K LF+   +  FS+I 
Sbjct  61   LYYALIKKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMK-LFIAMNVAFFSLIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   +  +++S++GWICVA S++VFA+PL IV +V +TKSVE++PF LSFFLT+SA
Sbjct  120  MVTHFVVKTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEH---IVNVE  786
            VMWF YGL + D+ IA+PN++GF LGLLQ++LY +YRN+    E+  + +E    IV + 
Sbjct  180  VMWFAYGLFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEEQLKSIVVMS  239

Query  787  MLGTSNQLVHPV--DSGRNISDGVTEINMENNDQGE  888
             LG S   VHPV  +S   +S+ V   ++    + E
Sbjct  240  PLGVSE--VHPVVTESVDPLSEAVHHEDLSKVTKVE  273



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 154/211 (73%), Gaps = 1/211 (0%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FGILGN+IS+ V+L+P+  F R+YR KST G+ S PYV+ +FS MLWMYYAF+K  
Sbjct  11   WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPFSGE  468
            A LL++IN +G V ET+Y+ ++L +A   AR    K L  L IG F +I LV+     GE
Sbjct  71   AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLLLSRGE  130

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
            +R+ ++GWICVA S++VFA+PLSI+  V RTKSVEF+PF LSFFL LSAV+WF YGL+ K
Sbjct  131  LRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYGLLKK  190

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPV  741
            D+ +ALPN+LGF  G+ Q+ LY  YR+ KP+
Sbjct  191  DVFVALPNVLGFVFGVAQMALYMAYRSKKPL  221



>emb|CDX78511.1| BnaA03g04230D [Brassica napus]
Length=292

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/255 (49%), Positives = 178/255 (70%), Gaps = 10/255 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   ++FGILGN IS  V+LAP+  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMINHHLLAIIFGILGNAISFCVFLAPLPTFYRIYKNKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFL  441
            +YYA IK++A LLI+INS G + ETIYI +F  +A+   R  A+K  F + +  FS+I +
Sbjct  61   LYYALIKQDAFLLITINSFGCIVETIYIALFFAYATRDKRIAAMKLFFTINVAFFSLILM  120

Query  442  VSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            ++ F   S  +++S++GWICV+ S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SAV
Sbjct  121  ITHFAVRSPSLQVSVIGWICVSISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------EHIVN  780
            MWF YG  + D+ IA+PN++GF LG+LQ++LY IYRN+   ++  K +       + IV 
Sbjct  181  MWFAYGAFLHDICIAIPNVVGFILGMLQMVLYGIYRNSGVKIDTEKKINSSEQQLKTIVV  240

Query  781  VEMLGTSNQLVHPVD  825
            +  LG S   VHPVD
Sbjct  241  MSQLGVSE--VHPVD  253



>ref|NP_196821.1| senescence-associated protein 29 [Arabidopsis thaliana]
 sp|Q9FY94.1|SWT15_ARATH RecName: Full=Bidirectional sugar transporter SWEET15; Short=AtSWEET15; 
AltName: Full=Senescence-associated protein 29 [Arabidopsis 
thaliana]
 emb|CAC05445.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
 gb|AAK76623.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AAM44982.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AED91859.1| senescence-associated protein 29 [Arabidopsis thaliana]
Length=292

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 192/276 (70%), Gaps = 11/276 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH    +FGILGN+IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMINHHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA IKK+A LLI+INS G V ET+YI +F  +A+ + R +A+K LF+   +  FS+I 
Sbjct  61   LYYALIKKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMK-LFIAMNVAFFSLIL  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   +  +++S++GWICVA S++VFA+PL IV +V +TKSVE++PF LSFFLT+SA
Sbjct  120  MVTHFVVKTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEE-NKNVQE--HIVNVE  786
            VMWF YGL + D+ IA+PN++GF LGLLQ++LY +YRN+    E+ N + Q+   IV + 
Sbjct  180  VMWFAYGLFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEQQLKSIVVMS  239

Query  787  MLGTSNQLVHPV--DSGRNISDGVTEINMENNDQGE  888
             LG S   VHPV  +S   +S+ V   ++    + E
Sbjct  240  PLGVSE--VHPVVTESVDPLSEAVHHEDLSKVTKVE  273



>ref|XP_002322282.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
 gb|EEF06409.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
Length=276

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 175/269 (65%), Gaps = 1/269 (0%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA   +H PW+  FG+LGN +S  V+LAP+  F+RI R K+T G+ S+PYV+A+FS+M+W
Sbjct  1    MASFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFLRICRKKTTEGFQSLPYVVALFSAMIW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFL  441
            +YYA +K +  LLI+INS+G   E IYI +++ +A  +AR   L+ L L   GGF  I L
Sbjct  61   LYYASLKSDVLLLITINSVGCFIEMIYIALYVAYAPKQARIATLRILILFNFGGFCSILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +S F   G  R+ ++GW CV FS++VFA+PL+I+  V RTKSVEF+PF LSFFLTLSA+ 
Sbjct  121  LSHFFVKGSNRVKVLGWACVIFSVSVFAAPLNIMRIVIRTKSVEFMPFTLSFFLTLSAIT  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            W  YG+++KD  IA+PNI+GF  G+LQ++LY IY+N K  V     +   I   ++   S
Sbjct  181  WLVYGVLVKDYYIAIPNIVGFIFGVLQMVLYVIYKNFKTAVPMEPKLPYSIDIAKLSPVS  240

Query  802  NQLVHPVDSGRNISDGVTEINMENNDQGE  888
             ++   V    N  D  T+ N ++    E
Sbjct  241  CEMKPAVCPQSNEEDDHTDQNSKDRSNQE  269



>emb|CDX97233.1| BnaC09g43920D [Brassica napus]
Length=298

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 176/254 (69%), Gaps = 8/254 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   +VFGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI--GGFSIIF  438
            + YA IK++A LLI+INS G V ETIYI +F  +A+   R  A+K LFL I    FS+I 
Sbjct  61   LCYALIKQDAFLLITINSFGCVVETIYIAMFFTYATKDKRVAAMK-LFLTINVAFFSLIL  119

Query  439  LVSWFPFS-GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F      +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEHIVN--V  783
            VMWF YGL + D+ IA+PN++GF LG++Q++LY IYRN+  K   E+  N  E  +   V
Sbjct  180  VMWFAYGLFLHDICIAIPNVVGFILGMIQMVLYGIYRNSGEKLDTEKKMNPSEQQLKSVV  239

Query  784  EMLGTSNQLVHPVD  825
             M   S   VHP+D
Sbjct  240  VMSPLSVSEVHPID  253



>ref|XP_007139100.1| hypothetical protein PHAVU_008G001200g [Phaseolus vulgaris]
 gb|ESW11094.1| hypothetical protein PHAVU_008G001200g [Phaseolus vulgaris]
Length=272

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 166/223 (74%), Gaps = 2/223 (1%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H      FG+LGN+IS  V+LAP++ F RI + KST G+ S+PY++A+FS MLW+YYA +
Sbjct  5    HSSLAFAFGMLGNVISFLVFLAPITTFYRILKKKSTEGFQSLPYLVALFSCMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPF  459
            KK+A LL++INS G V E IYI++++ +A+   R   LK  F + +G F +I LV+ F  
Sbjct  65   KKDAVLLLTINSFGCVIEIIYIILYITYATRDVRNLTLKLFFAMNVGCFVLILLVTHFAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G +R+ L+GWICV+ SI+VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYGL
Sbjct  125  HGSLRVQLLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEE-NKNVQ  765
             ++D+ IALPN+LGF LGL+Q+LLYAIYRN    V++  K  Q
Sbjct  185  FLRDICIALPNVLGFALGLIQMLLYAIYRNGNKKVDKMEKKAQ  227



>ref|XP_002442119.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
 gb|EES15957.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
Length=302

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 175/250 (70%), Gaps = 11/250 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   +LAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPWAFAFGLLGNVISFLTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA IK N T LI+IN+ G V ETIYI+++ V+A  KA+    K  L L +G F +I L
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+   F G+ R+ ++GWICV FS++VF +PLSI+ +V +TKSVE++PF LS  LTLSAV+
Sbjct  121  VTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKN--------VQEHI  774
            WF YGL++KD  +ALPNILGF  G++Q++LY +Y N  PV V E K+          EH+
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAVAEGKDAGVKLPSAADEHV  240

Query  775  -VNVEMLGTS  801
             VN+  L  +
Sbjct  241  LVNITKLSPA  250



>ref|NP_199892.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
 sp|Q9LUE3.1|SWT10_ARATH RecName: Full=Bidirectional sugar transporter SWEET10; Short=AtSWEET10 
[Arabidopsis thaliana]
 dbj|BAA96992.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAK96739.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL47380.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAM61234.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AED95992.1| bidirectional sugar transporter SWEET10 [Arabidopsis thaliana]
Length=289

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 185/272 (68%), Gaps = 16/272 (6%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFGILGNIIS FV LAP+  F+RIY+ KS+ GY S+PYVI++FS+MLWMYYA IKK+A +
Sbjct  11   VFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKDAMM  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS   V + +YI +F  +A  K +   +K  LF+ + GF  IF++++F      R+
Sbjct  71   LITINSFAFVVQIVYISLFFFYAPKKEKTLTVKFVLFVDVLGFGAIFVLTYFIIHANKRV  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ F+++VF +PL I+ +V +TKS EF+PF LSFFLTLSAVMWF YGL++KD+ 
Sbjct  131  QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  658  IALPNilgfflgllqillYAIYRNAKPVVEEN-----KNVQEHIVNVEMLGT---SNQL-  810
            IALPN+LGF  G+LQ++L+ IY+     V E      +++ EH+V+V  L T   ++Q+ 
Sbjct  191  IALPNVLGFIFGVLQMILFLIYKKPGTKVLEPPGIKLQDISEHVVDVVRLSTMVCNSQMR  250

Query  811  -VHPVDSGR-----NISDGVTEINMENNDQGE  888
             + P DS       +I + +     +N D+ E
Sbjct  251  TLVPQDSADMEATIDIDEKIKGDIEKNKDEKE  282



>ref|XP_008459891.1| PREDICTED: bidirectional sugar transporter N3 [Cucumis melo]
Length=277

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 168/228 (74%), Gaps = 3/228 (1%)
 Frame = +1

Query  103  HHPWLLVF--GILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            H P LLVF  G+LGNIIS FVYLAP+  F RI++ KST G+H++PY++A+FSS LW+ YA
Sbjct  5    HSPHLLVFTFGLLGNIISFFVYLAPLPTFYRIWQKKSTEGFHALPYLVALFSSALWLCYA  64

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWF  453
            F+K N  LLI+INS G V E +Y ++F+VFA++  R   ++    + +G F +I +   F
Sbjct  65   FLKTNTFLLITINSFGCVIEFLYFIVFIVFAANSVRMLTIRIFAMMNMGLFGLILVAIHF  124

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
              +   RI ++GWICVA S++VFA+PLSI+ QV  TKSVEF+PF LSFFLTLSA+MWF Y
Sbjct  125  ISNPSNRIDVMGWICVAVSVSVFAAPLSILRQVMTTKSVEFMPFTLSFFLTLSAIMWFAY  184

Query  634  GLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIV  777
            GL++ D+ IA+PN++GF LGLLQ+++YAIYR  K V+ E K   E +V
Sbjct  185  GLLLNDICIAIPNVVGFILGLLQMVVYAIYRKRKIVIMEEKKQPEPVV  232



>ref|XP_010025273.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=291

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/289 (45%), Positives = 182/289 (63%), Gaps = 23/289 (8%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L  +H W+  FGILGNI+S FV+LAPV  F RI R KST  + S+PY++A+FSSMLW
Sbjct  1    MDFLAHYHLWIFAFGILGNIVSFFVFLAPVPTFYRICRNKSTEEFQSIPYLVALFSSMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYAF+K ++ LLI+INS G V E +YI I++ +A   AR + +K   L  +G FS++ L
Sbjct  61   LYYAFLKGHSFLLITINSFGCVIEMVYIAIYIAYALRAARNSTIKLFALMNMGLFSLLIL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++ F  + + R ++ GWIC   S++VFA+PLSIV +V RTKSVEF+PF LSFFLTLSA+M
Sbjct  121  ITHFIPNNDARATVFGWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIM  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNV------  783
            WFGYG   KD  I +PNI+GF LGL Q+++Y  YRN +  V + K  Q   + V      
Sbjct  181  WFGYGFFQKDWCIMIPNIVGFVLGLSQMVVYGYYRNNE--VMDEKLPQHVAITVVHPPPG  238

Query  784  ---EMLGTSNQLVHPVDSGR-----------NISDGVTEINMENNDQGE  888
               E+   + ++  P+D G             + +G  E+ +  +D G 
Sbjct  239  GVSEVRPVTREISPPIDRGEARANEQQPQPSQLPEGAVEVVVSGDDLGS  287



>ref|XP_006366912.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/266 (47%), Positives = 175/266 (66%), Gaps = 11/266 (4%)
 Frame = +1

Query  106  HPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIK  285
            HP +  FGILGN++S  V++APV  F RI + KS+ G+HS+PYV+ +FS+MLW+YYA +K
Sbjct  8    HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  286  KNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFS  462
             N TLLI+INS G + ETIY+ I+  +A+ KAR   L   L L  G F +I  ++     
Sbjct  68   TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  463  GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLI  642
            G  R  ++GWIC+AFSI+VF +PLSI+ +V RTKSVEF+PF LS  LT+SAVMWF YGL+
Sbjct  128  GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  643  MKDLRIALPNilgfflgllqillYAIYRNAKP--VVEENKNVQEHIVNVEMLGTSNQLVH  816
            +KD+ +A+PNI G  LG+LQ++LY IYRN K   V  E +      V+ E     N  V+
Sbjct  188  LKDIYVAVPNIPGMILGVLQMILYGIYRNFKSNNVATEKELPTVVKVDQEQPTKVNCEVY  247

Query  817  PVDSGRNISDGVTEINMENNDQGE*K  894
            PV+        ++ ++ EN +  + K
Sbjct  248  PVN--------ISSLDSENGEAKDAK  265



>gb|EMS53876.1| Bidirectional sugar transporter SWEET14 [Triticum urartu]
Length=532

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 178/267 (67%), Gaps = 10/267 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M  L L HPW   FG+LGN+IS   YLAP+  F RIYR+KST G+ SVPYV+A+FS+MLW
Sbjct  1    MGGLSLEHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            +YYA +K +  LLI+INS G V ETIYI+++L +A  +A+    K  L L +G F +I L
Sbjct  61   IYYALLKSDELLLITINSAGCVIETIYIVMYLAYAPKQAKLFTAKILLLLNVGVFGLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++     GE R+ ++GW+CV FS++VF +PLS++  V RT+SVEF+PF LS  LT+SAV+
Sbjct  121  LTLLLAGGEKRVIMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP---VVEENKNVQEHIVNVEML  792
            WF YGL++KD  +ALPNILGF  G++Q+ LYA+Y NA P     E +  + EH++NV  L
Sbjct  181  WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYCNATPRPAPKEVDAPMPEHVINVAKL  240

Query  793  GTSNQLVHPVDSGRNISDGVTEINMEN  873
            G +  +        N    V    MEN
Sbjct  241  GPAAAM------ELNTPAAVRPPTMEN  261



>ref|XP_010678287.1| PREDICTED: bidirectional sugar transporter SWEET12 [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 188/283 (66%), Gaps = 18/283 (6%)
 Frame = +1

Query  94   LDLHH-----PWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSM  258
            +D  H     PW+ +FG+LGN IS  V+L+P+  F RIY+ KST  + S+PYV+A FS+M
Sbjct  1    MDFAHFFQNLPWITIFGLLGNTISFMVFLSPIPTFYRIYKKKSTEEFQSIPYVVAFFSAM  60

Query  259  LWMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFS-I  432
            LW+ YA++K +   L++IN  G+  ETIY++IFLV+A+ +AR +A+K+L L  + GF  I
Sbjct  61   LWLLYAYVKTDVIFLVTINCFGLFIETIYLVIFLVYANKEARISAIKQLLLFNVFGFGVI  120

Query  433  IFLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLS  612
            +F  +    +  +R+ ++GW+C+ FS  VF +PL ++ +V RTKSVE++PF+LSFFLTLS
Sbjct  121  VFFTAVIAKTTRVRLLILGWVCLVFSFCVFVAPLGVMRKVIRTKSVEYMPFFLSFFLTLS  180

Query  613  AVMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEE------NKNVQEHI  774
            AV+WF YGL+ +D+ +A+PN+LGF  G++Q++LY +YRNAKPV ++        +  + I
Sbjct  181  AVVWFFYGLLKRDVYVAVPNVLGFTFGIVQMILYMMYRNAKPVEKDIEVGKTKDSSTDQI  240

Query  775  VNVEMLGTSNQLVHPV-DSGRNISDGVTEINM----ENNDQGE  888
               E +    +   P  D+G   +  +  +NM    +NNDQ +
Sbjct  241  FVEEPVKPQPKNTTPTNDNGGVFAIQIPNLNMLNLQQNNDQDQ  283



>ref|NP_001241307.1| uncharacterized protein LOC100810946 [Glycine max]
 gb|ACU19376.1| unknown [Glycine max]
 gb|KHN17481.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=257

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 176/242 (73%), Gaps = 7/242 (3%)
 Frame = +1

Query  94   LDLHHP-WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMY  270
            + +H   W  VFG++GNIIS  V+LAP+  F +IY+ KST G+ S+PYV+A+FS+MLW+Y
Sbjct  1    MTMHRESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIY  60

Query  271  YAFIKKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLV  444
            YAF+K+ A LL I+IN+ GIV E+IY+ IFL++A  K R   +K L L  + GF  + L 
Sbjct  61   YAFVKREAALLLITINTFGIVVESIYLAIFLLYAPRKPRLTTIKLLLLLNVFGFGAMLLS  120

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            + +   G  R++++GWIC+ F+I+VFA+PL I+ +V +T+SVE++PF LS FLT++AVMW
Sbjct  121  TLYLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMW  180

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKNVQE---HIVNVEML  792
            F YGL+++D  +ALPN LGF  G++Q+ +Y +YRNA PV +EE    QE   HI++V  +
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMGMYLMYRNATPVALEEPVKAQELNGHIIDVGKM  240

Query  793  GT  798
            GT
Sbjct  241  GT  242



>ref|XP_004157602.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Cucumis 
sativus]
Length=277

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 167/228 (73%), Gaps = 3/228 (1%)
 Frame = +1

Query  103  HHPWLLVF--GILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            H P LLVF  G+LGNIIS FVYLAP+  F RI++ KST G+H++PY++A+FSS LW+ YA
Sbjct  5    HSPHLLVFTFGLLGNIISFFVYLAPLPTFYRIWQKKSTEGFHALPYLVALFSSALWLCYA  64

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWF  453
            F+K N  LLI+INS G V E +Y ++F+VFA++  R   ++    + +G F +I +   F
Sbjct  65   FLKTNTFLLITINSFGCVIEFLYFIVFIVFAANSVRMLTIRIFAMMNMGLFGLILVAIHF  124

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
              +   R  ++GWICVA S++VFA+PLSI+ QV  TKSVEF+PF LSFFLTLSA+MWF Y
Sbjct  125  IPNPSNRTDVMGWICVAVSVSVFAAPLSILRQVMTTKSVEFMPFTLSFFLTLSAIMWFAY  184

Query  634  GLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIV  777
            GL++ D+ IA+PN++GF LGLLQ+++YAIYR  K V+ E K   E +V
Sbjct  185  GLLLNDICIAIPNVVGFILGLLQMVVYAIYRKRKIVIMEEKKQPEQVV  232



>ref|XP_004140547.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Cucumis 
sativus]
 gb|KGN46429.1| hypothetical protein Csa_6G092510 [Cucumis sativus]
Length=277

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 167/228 (73%), Gaps = 3/228 (1%)
 Frame = +1

Query  103  HHPWLLVF--GILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYA  276
            H P LLVF  G+LGNIIS FVYLAP+  F RI++ KST G+H++PY++A+FSS LW+ YA
Sbjct  5    HSPHLLVFTFGLLGNIISFFVYLAPLPTFYRIWQKKSTEGFHALPYLVALFSSALWLCYA  64

Query  277  FIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWF  453
            F+K N  LLI+INS G V E +Y ++F+VFA++  R   ++    + +G F +I +   F
Sbjct  65   FLKTNTFLLITINSFGCVIEFLYFIVFIVFAANSVRMLTIRIFAMMNMGLFGLILVAIHF  124

Query  454  PFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGY  633
              +   R  ++GWICVA S++VFA+PLSI+ QV  TKSVEF+PF LSFFLTLSA+MWF Y
Sbjct  125  IPNPSNRTDVMGWICVAVSVSVFAAPLSILRQVMTTKSVEFMPFTLSFFLTLSAIMWFAY  184

Query  634  GLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIV  777
            GL++ D+ IA+PN++GF LGLLQ+++YAIYR  K V+ E K   E +V
Sbjct  185  GLLLNDICIAIPNVVGFILGLLQMVVYAIYRKRKIVIMEEKKQPEQVV  232



>ref|XP_009802608.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
 ref|XP_009792803.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=293

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 169/253 (67%), Gaps = 12/253 (5%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W   FG+LGNI+S  V+L+P+  F +IY+ KST GY S+PYVIA+FSSMLW+YYAF+K N
Sbjct  7    WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTN  66

Query  292  ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGE  468
             TLLI+INS G+  ETIY+  +L +A  KAR   +K LFL  +GGF  I L++ F F G 
Sbjct  67   TTLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKGV  126

Query  469  IRISLVGWICVAFSIAVFASPLSIVL-----------QVFRTKSVEFLPFYLSFFLTLSA  615
             R  +VGW+C+ FS+ VF +PL IV            +V +TKSVE++P  LS FLTLSA
Sbjct  127  ARGQVVGWVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLSVFLTLSA  186

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLG  795
            VMWF YGL++KD+ IA PNILGF  G+LQI+LY IY   +  + + +N+ E   +V +L 
Sbjct  187  VMWFFYGLLLKDINIAAPNILGFIFGILQIVLYVIYNKKEKHILKEQNLPELQNHVIILD  246

Query  796  TSNQLVHPVDSGR  834
             + +L    +  +
Sbjct  247  DNKKLPELTEEQK  259



>sp|P93332.1|NOD3_MEDTR RecName: Full=Bidirectional sugar transporter N3; AltName: Full=Nodulin 
3; Short=MtN3; Short=N-3 [Medicago truncatula]
 emb|CAA69976.1| MtN3 [Medicago truncatula]
Length=268

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+     FG+LGN+IS  V+LAP+S F RIY+ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWFPF  459
            KK+A LLI+INS G V ETIYI++++++A   AR    K L  + +G F++I +V+ +  
Sbjct  65   KKDAFLLITINSFGCVVETIYIILYIIYAPRDARNLTFKLLSAMNVGSFALILIVTNYAV  124

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
             G +R+ ++GW+CV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA MWFGYG 
Sbjct  125  HGPLRVQVLGWVCVSLSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWFGYGF  184

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNA  732
             +KD+ I LPN+LG  LGLLQ+LLYAIYRN 
Sbjct  185  FLKDICIXLPNVLGXVLGLLQMLLYAIYRNG  215



>ref|XP_007139099.1| hypothetical protein PHAVU_008G001100g [Phaseolus vulgaris]
 gb|ESW11093.1| hypothetical protein PHAVU_008G001100g [Phaseolus vulgaris]
Length=270

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 184/266 (69%), Gaps = 9/266 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            HH     FG+LGN+IS  V+LAPV  F RIY+ KST  + S+PY++A+FSSMLW+YYA++
Sbjct  5    HHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYAWL  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLVSWFP  456
            KK+A LLI+IN  G V E IYI++++++A+  AR   +K LF  + +G F++I +V+ F 
Sbjct  65   KKDAVLLITINLFGCVIEIIYIILYIIYATRDARNLTIK-LFSAMNLGSFALILVVTNFI  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G +R+ ++GWICV+ S++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA+MWFGYG
Sbjct  124  VHGPLRVQVLGWICVSVSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNA-KPVVEENKNVQEHIVNV---EMLGTSN  804
            L +KD+ IALPN+LGF LGLLQ+LLY IYR   K      KN QE + N+     +GT  
Sbjct  184  LFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKGNTMEKNPQEPLKNIVVASPMGTGE  243

Query  805  QLVHPVDSGRNISDGVTEINMENNDQ  882
              V PV+          E   + +++
Sbjct  244  --VFPVEEDEEAKKSQVEREEKKSEE  267



>ref|XP_010442555.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X1 [Camelina sativa]
 ref|XP_010442556.1| PREDICTED: bidirectional sugar transporter SWEET10-like isoform 
X2 [Camelina sativa]
Length=288

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 187/267 (70%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFGILGNIIS FV LAP+  FIRIY+ KS+ GY SVPYVI++FS+MLW+YYA IKK+A +
Sbjct  11   VFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAMM  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS   V + +YI ++  +A  K +   +K  LF+ +  F +IFL+++F   G  R+
Sbjct  71   LITINSFAFVVQIVYISLYFFYAPKKEKILTVKCVLFVDVFAFGLIFLLTYFLTHGNKRV  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ FS++VF +PL I+ +V +TKS EF+PF LSFFLTLSA+MWF YGL++KD  
Sbjct  131  QVLGYICMVFSLSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLKDKN  190

Query  658  IALPNilgfflgllqillYAIYRNA-----KPVVEENKNVQEHIVNVEMLGT---SNQL-  810
            IALPN+LGF  G+LQ++L+ IY+       +P V + +++ EH+V+V  L +   ++Q+ 
Sbjct  191  IALPNVLGFIFGVLQMILFVIYKKPGTKVLEPSVIKLQDISEHVVDVVRLSSMVCNSQMR  250

Query  811  -VHPVDSGRNISDGVTEINMENNDQGE  888
             + P DS    +D    I+++   +G+
Sbjct  251  TLVPQDS----ADMEDTIDLDEKIKGD  273



>gb|KFK25541.1| hypothetical protein AALP_AA8G128400 [Arabis alpina]
Length=299

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/280 (47%), Positives = 188/280 (67%), Gaps = 18/280 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M I+  HH    +FGILGN IS  V+LAPV  F RI++ KST  + S+PY +++FS MLW
Sbjct  1    MGIMIDHHLLANIFGILGNFISFCVFLAPVPTFYRIFKKKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA +KK A LLI+IN  G V ETIYI +FL +A+   + +A+K LF+   +  FS I 
Sbjct  61   LYYALLKKGAFLLITINCFGCVVETIYIAMFLTYATKDKKTSAMK-LFMAMNVAFFSSIL  119

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L++ F     +++S++GWICVA S++VFA+PL +V +V +TKSVEF+PF LSFFLT+SAV
Sbjct  120  LMTHFFVKSPLKVSVLGWICVAISVSVFAAPLMVVARVIKTKSVEFMPFSLSFFLTISAV  179

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEEN-KNVQ---------E  768
            MW  YGL + D+ IA+PN++GF LG++Q++LY IY+N+K   E N K V          +
Sbjct  180  MWGAYGLFLHDICIAIPNVVGFLLGMVQMVLYGIYKNSKGEFEINEKKVNSSTSSEQQLK  239

Query  769  HIVNVEMLGTSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
             +V +  LG S   VHPVD    +++ V E+ + ++D  E
Sbjct  240  SVVVMSPLGVSE--VHPVD--VTVTETV-EVPLSDHDHEE  274



>gb|AFK39311.1| unknown [Lotus japonicus]
Length=260

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 169/221 (76%), Gaps = 6/221 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+     FG+LGN+IS  V+LAP++ F RIY+ KST G+ S+PY++A+FSSMLW+YYA +
Sbjct  5    HNTLAFTFGMLGNVISFMVFLAPIATFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAMV  64

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSIIFLVSWFP  456
            KK+A LLI+INS G V E IYI++++++A   AR   LK LF  + +G F++I LV+ F 
Sbjct  65   KKDAFLLITINSFGCVIEIIYIILYMIYAPRDARNLTLK-LFTAMNVGSFALILLVTHFA  123

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G +R+ ++GWICV+ +++VFA+PLSIV QV RTKSVEF+PF LSF LTLSA MWFGYG
Sbjct  124  VHGPLRVQVLGWICVSIAVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWFGYG  183

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN  759
            L +KD+ IALPNILGF LGL+Q++LYAIYRN     E+ K 
Sbjct  184  LFLKDICIALPNILGFGLGLIQMVLYAIYRNGN---EKGKK  221



>ref|XP_009802195.1| PREDICTED: bidirectional sugar transporter SWEET9-like isoform 
X2 [Nicotiana sylvestris]
Length=297

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 176/258 (68%), Gaps = 13/258 (5%)
 Frame = +1

Query  118  LVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNAT  297
            L F   GNI+S FV+L+P+  F +IY+ KST  Y S+PYV+A+FS+M W+YYAF+K N T
Sbjct  9    LGFPFAGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKSNTT  68

Query  298  LLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCI-GGFSIIFLVSWFPFSGEIR  474
            LLI+INS G   ETIY+  +L +A  KAR   +K L L + GGF  I LV+   F G +R
Sbjct  69   LLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKGVVR  128

Query  475  ISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDL  654
            + +VGWIC+ FS+ VF SPL I+ QV +TKSVE++PF++S FLTLSAV WF YGL++KD 
Sbjct  129  VQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGLLLKDF  188

Query  655  RIALPNilgfflgllqillYAI-YRNAKPVVEENK--NVQEHIV------NVEMLGTSNQ  807
             IA+PN+LGF +G+LQ++ Y I Y+  + +V+E+K   +Q H++      N+  L T  Q
Sbjct  189  NIAIPNVLGFIVGILQMVFYVIYYKKEEVIVKEHKFPEIQNHVIILHNDKNLPEL-TEEQ  247

Query  808  LVHPVDSGRNISDGVTEI  861
            ++  V  G  IS   TEI
Sbjct  248  IIDIVKLGSLIS--CTEI  263



>ref|XP_003532478.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN16865.1| Bidirectional sugar transporter SWEET13 [Glycine soja]
Length=254

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 177/242 (73%), Gaps = 7/242 (3%)
 Frame = +1

Query  94   LDLHHP-WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMY  270
            + +H   W  VFG++GNIIS  V+LAP+  F +IY+ KST G+ S+PYV+A+FS+MLW+Y
Sbjct  1    MTMHRESWAFVFGVMGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIY  60

Query  271  YAFIKKN-ATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLV  444
            YAF+K+  A LLI+IN+ GIV E+IY+ IFL++A  K R   +K L L  + GF  + L 
Sbjct  61   YAFVKRETALLLITINTFGIVVESIYLSIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLS  120

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            + +   G  R++++GWIC+ F+I+VFA+PL I+ +V +T+SVE++PF LS FLT++AVMW
Sbjct  121  TLYLSKGAKRLAIIGWICLVFNISVFAAPLFIIRRVIKTRSVEYMPFTLSMFLTINAVMW  180

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKNVQE---HIVNVEML  792
            F YGL+++D  +ALPN LGF  G++Q+++Y +YRNA PV +EE    QE   HI++V  +
Sbjct  181  FFYGLLLRDYYVALPNTLGFVFGIIQMVMYLMYRNATPVALEEPVKAQELNGHIIDVVKI  240

Query  793  GT  798
            GT
Sbjct  241  GT  242



>ref|XP_006288378.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
 gb|EOA21276.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
Length=287

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 179/272 (66%), Gaps = 11/272 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D H+ W  VFG+LGN+IS  V+L+PV  F RI + K+T G+ S+PYV+A+FS+MLW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA  KK+  LL++INS G   ETIYI IFL FA+  AR   +K L L  +GGF  I L
Sbjct  61   LYYATQKKDVFLLVTINSFGCFIETIYISIFLAFATKNARMLTVKLLLLMNVGGFCAILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +  F   G  R  ++G ICV FS+ VFA+PLSI+  V +TKSVE++PF LS  LT+SAV+
Sbjct  121  LCQFLAKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP----VVEENKNVQEHIVNVEM  789
            W  YGL +KD+ +A PN++GF LG LQ++LY +Y+  K     V +E +N +   V+++M
Sbjct  181  WLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTSSDLVEKELENAKLPEVSIDM  240

Query  790  LGTSNQLVHPVDSGRNISDGVTEINMEN-NDQ  882
            L    +L    +    I+  V  +NM N ND+
Sbjct  241  L----KLGGAAEPACGITV-VRSVNMCNCNDR  267



>ref|XP_002443167.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
 gb|EES17005.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
Length=302

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 166/227 (73%), Gaps = 2/227 (1%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   +LAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPWAFAFGLLGNLISFLTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA IK N T LI+IN+ G V ETIYI+++ V+A  KA+    K  L L +G F +I L
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            V+   F G+ R+ ++GWICV FS++VF +PLSI+ +V +TKS+E++PF LS  LTLSAV+
Sbjct  121  VTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSMEYMPFSLSLSLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKN  759
            WF YGL++KD  +ALPNILGF  G++Q++LY +Y N  PV V E K+
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGMVQMVLYVLYMNKTPVAVAEGKD  227



>emb|CAC44123.1| N3 like protein [Medicago truncatula]
Length=255

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 176/241 (73%), Gaps = 6/241 (2%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
               W  VFGI+GNIIS  V+L+P+  F  I++ KS  G+ ++PYV+A+FS+MLW+YYAF+
Sbjct  5    RESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFV  64

Query  283  KK-NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            K+ +A LLI+IN+ GIV E+ YI++FL++A  K R + +K L L  + GF  + L + + 
Sbjct  65   KRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R++++GWIC+ F+I+VFA+PL ++ +V R++SVE++PF+LSFFLT++AVMWF YG
Sbjct  125  SKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE----HIVNVEMLGTSN  804
            L+++D  +ALPN LGF  G++Q+++Y IYRNA PVVE     QE    HI++V  +GT +
Sbjct  185  LLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVEAPMKGQELSGGHIIDVVKIGTDS  244

Query  805  Q  807
             
Sbjct  245  N  245



>ref|XP_007159993.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
 gb|ESW31987.1| hypothetical protein PHAVU_002G283900g [Phaseolus vulgaris]
Length=258

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 176/254 (69%), Gaps = 10/254 (4%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
               W  VFG+LGNIIS  V+LAP+  F +IY+ KST G+ S+PYV+A+FS+MLW+YYAF+
Sbjct  5    RESWAFVFGLLGNIISFGVFLAPLPTFYQIYKKKSTEGFQSLPYVVALFSAMLWIYYAFV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            K+ A LL I+IN+ GIV E+IY+ IFL++A  K R   +K L L  + GF  + L + + 
Sbjct  65   KREAALLLITINTFGIVVESIYLTIFLIYAPRKPRLTTIKLLLLLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R++++GWIC+ F+I+VFA+PL I+ +V +T+SVE++PF LS FLT++AVMWF YG
Sbjct  125  TKGAKRLAIIGWICLVFNISVFAAPLFIISRVIKTRSVEYMPFTLSMFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKNVQE---HIVNVEMLGTSN  804
            L+++D  +ALPN LGF  G++Q+ +Y +YRNA PV +EE    QE   HIV    +GT  
Sbjct  185  LLLRDYYVALPNTLGFVFGIIQMGMYLMYRNATPVALEEPVKGQESNGHIVGAVKMGT--  242

Query  805  QLVHPVDSGRNISD  846
              + P  +G  +  
Sbjct  243  --IEPNHAGAGLGG  254



>ref|XP_006366913.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=357

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 174/261 (67%), Gaps = 8/261 (3%)
 Frame = +1

Query  106  HPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIK  285
            HP +  FGILGN++S  V++APV  F RI + KS+ G+HS+PYV+ +FS+MLW+YYA +K
Sbjct  8    HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  286  KNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFS  462
             N TLLI+INS G + ETIY+ I+  +A+ KAR   L   L L  G F +I  ++     
Sbjct  68   TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  463  GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLI  642
            G  R  ++GWIC+AFSI+VF +PLSI+ +V RTKSVEF+PF LS  LT+SAVMWF YGL+
Sbjct  128  GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  643  MKDLRIALPNilgfflgllqillYAIYRNAKP--VVEENKNVQEHIVNVEMLGTSNQLVH  816
            +KD  +A+PNI G  LG+LQ++LY IYRN+K   V  E +      V+ E+    N  V+
Sbjct  188  LKDFYVAVPNISGMILGVLQMILYGIYRNSKSNNVATEKELPTVVKVDQELPPKVNCEVY  247

Query  817  PVDSGRNISDGVTEINMENND  879
            PV    NIS   +E N E  D
Sbjct  248  PV----NISSLDSE-NGEGKD  263



>gb|EMS46194.1| Bidirectional sugar transporter SWEET15 [Triticum urartu]
Length=345

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 159/223 (71%), Gaps = 4/223 (2%)
 Frame = +1

Query  85   MAILDL-HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MA L++  H W   FGILGNIIS+ V+L+P+  F R+YR KST G+ S PY++ +FS +L
Sbjct  1    MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYLVTLFSCLL  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF--LCIGGFSII  435
            WMYYAF+K  + LL++IN++G V E++YI ++LV+A   AR    K LF  L +G F +I
Sbjct  61   WMYYAFLKSGSELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAK-LFIGLDVGLFGLI  119

Query  436  FLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
             LV+     G +R+ +VGWICVA ++ VFA+PLSI+  V RTKSVEF+PF LSFFL LSA
Sbjct  120  ALVTMLASHGPLRVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV  744
            V+WF YG + KD+ +A+PN+LGF  G+ Q+ LY  YRN KP  
Sbjct  180  VIWFAYGALKKDIFVAMPNVLGFLFGVAQMALYMAYRNKKPAT  222



>ref|XP_010482380.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Camelina 
sativa]
Length=288

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 187/267 (70%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFGILGNIIS FV LAP+  FIRIY+ KS+ GY SVPYVI++FS+MLW+YYA IKK+A +
Sbjct  11   VFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAMM  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS   V + +YI ++  +A  K +   +K  LF+ +  F +IFL+++F   G  R 
Sbjct  71   LITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFLTHGNKRG  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ F+++VF +PL I+ +V +TKS EF+PF LSFFLTLSA+MWF YGL++KD+ 
Sbjct  131  QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLKDMN  190

Query  658  IALPNilgfflgllqillYAIYRNA-----KPVVEENKNVQEHIVNVEMLGT---SNQL-  810
            IALPNILGF  G+LQ++L+ IY+       +P V + +++ EH+V+V  L +   ++Q+ 
Sbjct  191  IALPNILGFIFGVLQMILFVIYKKPGTKVLEPSVIKLQDISEHVVDVVRLSSMVCNSQMR  250

Query  811  -VHPVDSGRNISDGVTEINMENNDQGE  888
             + P DS    +D    I+++   +G+
Sbjct  251  TLVPQDS----ADMADTIDLDEKIKGD  273



>ref|XP_010025272.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=288

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 177/280 (63%), Gaps = 22/280 (8%)
 Frame = +1

Query  115  LLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNA  294
            + +FGILGNI+S+FV+ APV  F RIY+ KST G+ S+PY++A+FSSMLW+YYAF+K ++
Sbjct  5    IFIFGILGNIVSLFVFFAPVPTFYRIYKEKSTEGFQSIPYLVALFSSMLWLYYAFLKGHS  64

Query  295  TLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGEI  471
             LLI+INS G V E +YI I++ +A   A+ + +K   L  +G FS++ L+  F  + + 
Sbjct  65   FLLITINSFGCVIEMVYIAIYIAYALRAAKSSTIKLFALMNVGLFSLLILIMHFIPNDDA  124

Query  472  RISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKD  651
            R ++ GWIC   S++VFA+PL IV +V RTKSVEF+PF LSFFLTLSAVMWFGYG   KD
Sbjct  125  RTTVFGWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAVMWFGYGFFQKD  184

Query  652  LRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVN--VEMLGTSNQLVHPVD  825
              I +PNI+GF LGL Q++LY  YRN   ++ +++ + E +    V        +VHPV 
Sbjct  185  WCIMIPNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEKLPQHVVHPPSGRASVVHPVT  244

Query  826  SG-------------------RNISDGVTEINMENNDQGE  888
             G                     + +G  E+ +  ND G 
Sbjct  245  VGIPPPINGGEARADEQQPQPSQLPEGAVEVVVSGNDPGS  284



>ref|XP_008464392.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=297

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/263 (46%), Positives = 172/263 (65%), Gaps = 3/263 (1%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+PW+  FG+LGNI S  V+LAPV  FIR+ R KST G+ S+PYV+A+FS++L +YY+ +
Sbjct  8    HNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYSTL  67

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPF  459
              +   L++INS+G   ET+YI +++ +A  KAR   ++  L L + GF  I +V+ F  
Sbjct  68   NADEFFLMTINSVGCFIETVYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQFLV  127

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
                R  ++G+IC   S++VFA+PLSI+ +V RT+SVE++PF LSFFLTLSAVMW  YGL
Sbjct  128  KRAYRARVIGFICGGLSVSVFAAPLSIMKKVIRTRSVEYMPFSLSFFLTLSAVMWLCYGL  187

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHP  819
             +KDL +ALPN LGF  G+ Q++LYAIYRNAKP+  E K + +H  ++E         +P
Sbjct  188  FLKDLYVALPNTLGFTFGMAQMILYAIYRNAKPLPNEEK-LPQHKADIETQIVITTTTNP  246

Query  820  VDSGRNISDGVTEINMENNDQGE  888
             D G    +    IN+    Q  
Sbjct  247  -DQGDEHQNQDQVINVPPPPQSN  268



>emb|CDX91144.1| BnaC02g04530D [Brassica napus]
Length=297

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 179/256 (70%), Gaps = 12/256 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   ++FGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMVNHHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA  K++A LLI+INS G V ETIYI +F  +A+ + +  A+K LFL   +  FS+I 
Sbjct  61   LYYALTKQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIK-LFLTMNVAFFSLII  119

Query  439  LVSWFPF-SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F   S  +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFAVKSPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNA--KPVVEENKNVQEH----IV  777
            VMWF YG  + D+ IA+PN++GF LGL+Q++LY +YRN+  K  + + KN        IV
Sbjct  180  VMWFAYGAFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGDKLDIGKKKNSSSEQLKTIV  239

Query  778  NVEMLGTSNQLVHPVD  825
             +  LG S   +HPVD
Sbjct  240  VMSPLGLSE--MHPVD  253



>gb|AFK35161.1| unknown [Medicago truncatula]
Length=255

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 175/239 (73%), Gaps = 6/239 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
               W  VFGI+GNIIS  V+L+P+  F  I++ KS  G+ ++PYV+A+FS+MLW+YYAF+
Sbjct  5    RESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFV  64

Query  283  KK-NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            K+ +A LLI+IN+ GIV E+ YI++FL++A  K R + +K L L  + GF  + L + + 
Sbjct  65   KRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R++++GWIC+ F+I+VFA+PL ++ +V R++SVE++PF+LSFFLT++AVMWF YG
Sbjct  125  SKGAKRLAIIGWICLVFNISVFATPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE----HIVNVEMLGTS  801
            L+++D  +ALPN LGF  G++Q+++Y IYRNA PVVE     QE    HI++V  +GT 
Sbjct  185  LLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVEAPMKGQELSGGHIIDVVKIGTD  243



>ref|XP_002865823.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42082.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 185/267 (69%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFGILGNIIS FV LAP+  F+RIY+ KS+ GY S+PYVI++FS+MLWMYYA IKK+A +
Sbjct  11   VFGILGNIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVISLFSAMLWMYYAMIKKDAMM  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS   V + +YI ++  +A  K +   +K  LF+ + GF  IF++++F      R+
Sbjct  71   LITINSFAFVIQIVYISLYFFYAPKKEKTLTVKFVLFVDVFGFGAIFVLTYFLIHANKRV  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ F+++VF +PL I+ +V +TKS EF+PF LSFFLTLSAVMWF YGL++KD+ 
Sbjct  131  HVLGYICMVFALSVFLAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  658  IALPNilgfflgllqillYAIYRNAKPVVEEN-----KNVQEHIVNVEMLGT---SNQL-  810
            IALPN+LGF  G+LQ++L+ IY+     V E      +++ EH+V+V  L T   ++Q+ 
Sbjct  191  IALPNVLGFIFGVLQMILFLIYKKPGTKVLEPPGIKLQDISEHVVDVVRLSTMVCNSQMR  250

Query  811  -VHPVDSGRNISDGVTEINMENNDQGE  888
             + P DS    +D    I+++   +G+
Sbjct  251  TLVPQDS----ADMEATIDIDEKIKGD  273



>gb|KDO64483.1| hypothetical protein CISIN_1g020739mg [Citrus sinensis]
Length=285

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 189/272 (69%), Gaps = 5/272 (2%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M +   H P +  FG+LGNI+S  V+LAP+  F R+ + KST G+ S+PYV+A+FS+MLW
Sbjct  1    MTMFSTHDPSVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA +KK+A LLI+IN+ G V ETIY+ +++ FA  +AR   L+ L L   GGF  I L
Sbjct  61   IYYAMMKKDAFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILL  120

Query  442  VSWFPFSGE-IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            +S F   G   R+ L+GW+CV FS++VFA+PLSI+  V RTKSVEF+PFYLS FLTL+AV
Sbjct  121  LSHFLAKGSAARLRLLGWVCVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN-VQEHIVNVEMLG  795
            MWF YGL +KD+ +A+PN+LGF  G++Q++LYAIYRN + VV E+ N V EH V+V  L 
Sbjct  181  MWFFYGLFLKDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNKVPEHTVDVVKLS  240

Query  796  TSNQLVHPVDSG-RNISDGVTEINMENNDQGE  888
            T+N       +  RN  D   E + + NDQ E
Sbjct  241  TNNMTASEEQTNSRNNFDDKNE-HEQANDQHE  271



>gb|KEH20983.1| bidirectional sugar transporter [Medicago truncatula]
Length=255

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 175/239 (73%), Gaps = 6/239 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
               W  VFGI+GNIIS  V+L+P+  F  I++ KS  G+ ++PYV+A+FS+MLW+YYAF+
Sbjct  5    RESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFV  64

Query  283  KK-NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            K+ +A LLI+IN+ GIV E+ YI++FL++A  K R + +K L L  + GF  + L + + 
Sbjct  65   KRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R++++GWIC+ F+I+VFA+PL ++ +V R++SVE++PF+LSFFLT++AVMWF YG
Sbjct  125  SKGAKRLAIIGWICLVFNISVFAAPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQE----HIVNVEMLGTS  801
            L+++D  +ALPN LGF  G++Q+++Y IYRNA PVVE     QE    HI++V  +GT 
Sbjct  185  LLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVEAPMKGQELSGGHIIDVVKIGTD  243



>gb|AHL43546.1| nodule-specific sucrose transporter [Medicago truncatula]
Length=270

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 180/269 (67%), Gaps = 17/269 (6%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W  VFG++GN+IS   +LAP+  F RIY+ KST G+ SVPYV A+FS+MLW+YYA +K  
Sbjct  9    WAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALFSAMLWIYYAHVKNK  68

Query  292  ATLLI-SINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGGFSIIFLVSWFPFSGE  468
            ATLL+ +IN  G   E IYI+IFL++AS+KAR + +K LFL + G+  + +++ +   G 
Sbjct  69   ATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIKLLFLTVCGYGTMVILTTYLTKGS  128

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
             R+S++GWIC+ F+I VFASPL I+ QV +TKSV F+P  LSFFLTL+A++WF YGL++ 
Sbjct  129  KRLSIIGWICMVFNICVFASPLFILKQVIKTKSVAFMPLNLSFFLTLNAIVWFFYGLLID  188

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEENK---------NVQEHIVNVEMLGTS  801
            D  IA+PN LGF  G++Q+++Y IY++A P +E  K         N+ E + N  +    
Sbjct  189  DFYIAIPNTLGFVFGIVQMVIYLIYKDAIP-LESTKLQKPNDHVLNICEDVPNGALQPGP  247

Query  802  NQLVHPVDSGRNISDGVTEINMENNDQGE  888
            NQ+V      ++ +  V  I  E+ + G+
Sbjct  248  NQVV------KSGAPAVAVIGGEDPNNGK  270



>ref|XP_011085139.1| PREDICTED: bidirectional sugar transporter NEC1-like [Sesamum 
indicum]
Length=262

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 179/268 (67%), Gaps = 18/268 (7%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+L + H  +L FG+LGN++S  V+LAP+  F  I++ KS+ G+ S+PY +A  S+ L 
Sbjct  1    MALLSVEHLAVL-FGLLGNLVSFLVFLAPMPTFYTIWKKKSSEGFQSIPYSVAFLSASLL  59

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFL  441
            +YYAF+K NA +++SIN IG V E IY+LI++ +A  KAR   +K + L   GG  ++ L
Sbjct  60   LYYAFLKTNAYMIVSINGIGCVIEMIYLLIYITYAPKKARMFTIKLVVLFNFGGMGLVML  119

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            VS   + G  R+SLVGW C  F++AVFA+PLSI+ +V RTKSVEF+PF LSFFLTL A M
Sbjct  120  VSLLAYKGSKRVSLVGWACAIFNLAVFAAPLSIMRRVIRTKSVEFMPFTLSFFLTLCATM  179

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTS  801
            WF YG  +KD  IALPN+LGF  G+ Q++LY IY+NAK  V E+KNV+        L TS
Sbjct  180  WFFYGFFVKDYYIALPNVLGFLFGIAQMILYFIYKNAKKEV-ESKNVE--------LETS  230

Query  802  NQLVHPVDSGRNISDGVTEINMENNDQG  885
              +   +++ +++     E N+E  DQ 
Sbjct  231  KDV--ELETSKDV-----EKNLELKDQA  251



>ref|NP_197755.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
 sp|O82587.1|SWT12_ARATH RecName: Full=Bidirectional sugar transporter SWEET12; Short=AtSWEET12; 
AltName: Full=MtN3-like protein [Arabidopsis thaliana]
 gb|AAC64192.1| MTN3 homolog [Arabidopsis thaliana]
 dbj|BAA97235.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL09814.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAL15214.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAM47150.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AED93195.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
Length=285

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 131/281 (47%), Positives = 180/281 (64%), Gaps = 18/281 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D H+ W  VFG+LGN+IS  V+L+PV  F RI + K+T G+ S+PYV+A+FS+MLW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA  KK+  LL++INS G   ETIYI IF+ FAS KAR   +K L L   GGF +I L
Sbjct  61   LYYATQKKDVFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +  F   G  R  ++G ICV FS+ VFA+PLSI+  V +TKSVE++PF LS  LT+SAV+
Sbjct  121  LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAK---PVVE---ENKNVQEHIVNV  783
            W  YGL +KD+ +A PN++GF LG LQ++LY +Y+  K    +VE   E   + E  +++
Sbjct  181  WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  784  EMLGTSNQ-------LVHPVDSGRNISDGVTEINMENNDQG  885
              LGT          +V  V++  N +D   EI    N QG
Sbjct  241  VKLGTLTSPEPVAITVVRSVNTC-NCNDRNAEI---ENGQG  277



>ref|XP_006347347.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
tuberosum]
Length=289

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/236 (52%), Positives = 168/236 (71%), Gaps = 7/236 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA   +H  W+  FG+LGNI+S FV+L+P+  F ++Y+  ST GY S+PYV+A+FS+MLW
Sbjct  1    MADFSVH--WVFAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLW  58

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFL  441
            +YYAF+K N TLLI+IN+ G   E IY+  +L +AS +AR   +K L L + G F  I L
Sbjct  59   IYYAFLKTNTTLLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVL  118

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            VS F F G +R+ +VGWIC+  S+ VF +PL IV QV +TKSVE++PF LS FLTLSAVM
Sbjct  119  VSQFLFEGAVRVQVVGWICLVCSLCVFVAPLCIVKQVIKTKSVEYMPFLLSVFLTLSAVM  178

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP---VVEEN-KNVQEHIV  777
            WF YGL++KD  IA+PN+LGF  G+LQ++LY +Y N K    V E+N   ++ H++
Sbjct  179  WFFYGLLLKDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEQNLPELKNHVI  234



>ref|XP_004503778.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Cicer 
arietinum]
Length=255

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 175/240 (73%), Gaps = 7/240 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
               W  VFG+LGNIIS  V+L+P+  F  I++ KST G+ S+PYV+A+FS+MLW+YYAF+
Sbjct  5    RESWAFVFGLLGNIISFAVFLSPLPTFYLIFKKKSTEGFQSLPYVVALFSAMLWIYYAFV  64

Query  283  KKNATLL-ISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            K+ A LL I+IN+ GIV E+ Y+++FL++A+ K+R + +K L L  + GF  + L + + 
Sbjct  65   KREAALLLITINTFGIVVESCYLIVFLIYATKKSRLSTIKLLLLLNVFGFGAMLLSTLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R++++GWIC+ F+I VFA+PL I+ +V RT+SVE++PF+LSFFLT++AVMWF YG
Sbjct  125  AKGAKRLAIIGWICLVFNITVFAAPLFIISRVIRTRSVEYMPFFLSFFLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPV-----VEENKNVQEHIVNVEMLGTS  801
            L++KD  +ALPN LGF  G++Q+++Y IYRNA PV     V+  +    HIV+V  +G+ 
Sbjct  185  LLLKDYYVALPNTLGFVFGIIQMVMYLIYRNATPVPLDGPVKGQELSGGHIVDVVKIGSD  244



>ref|XP_010442345.1| PREDICTED: bidirectional sugar transporter SWEET10 [Camelina 
sativa]
Length=289

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 186/267 (70%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFGILGNIIS FV LAP+  FIRIY+ KS+ GY SVPYVI++FS+MLW+YYA IKK+A +
Sbjct  11   VFGILGNIISFFVCLAPIPTFIRIYKRKSSEGYQSVPYVISLFSAMLWLYYAMIKKDAMM  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            LI+INS   V + +YI ++  +A  K +   +K  LF+ +  F +IFL+++F   G  R+
Sbjct  71   LITINSFAFVVQIVYISLYFFYAPKKEKILTVKFVLFVDVFAFGLIFLLTYFLTHGNKRV  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ F+++VF +PL I+ +V +TKS EF+PF LSFFLTLSA+MWF YGL++KD  
Sbjct  131  QVLGYICMVFALSVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAIMWFFYGLLLKDKN  190

Query  658  IALPNilgfflgllqillYAIYRNA-----KPVVEENKNVQEHIVNVEMLGT---SNQL-  810
            IALPN+LGF  G+LQ++L+ IY+       +P V + +++ EH+V+V  L +   ++Q+ 
Sbjct  191  IALPNVLGFIFGVLQMILFVIYKKPGTKVLEPSVIKLQDISEHVVDVVRLSSMVCNSQMR  250

Query  811  -VHPVDSGRNISDGVTEINMENNDQGE  888
             + P DS    +D    I+ +   +G+
Sbjct  251  TLVPQDS----ADMEDTIDRDEKIKGD  273



>ref|XP_002322281.2| N3 like family protein [Populus trichocarpa]
 gb|EEF06408.2| N3 like family protein [Populus trichocarpa]
Length=283

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 183/276 (66%), Gaps = 10/276 (4%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + LH  W+  FG+LGN IS  V LAP+  F RI + K++ G+HS+PYVIA+FS+MLW++Y
Sbjct  1    MALHLTWVFGFGLLGNFISCLVCLAPLPTFYRICKKKTSQGFHSIPYVIALFSAMLWLFY  60

Query  274  AFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFLVSW  450
            A  K++A LLI+INS     E  YI ++L++A+ K +    K L L  + GF +I +++ 
Sbjct  61   ALFKEDALLLITINSFTFFMEIGYIFMYLLYATKKDKILTFKLLLLFNVFGFGLICVLTR  120

Query  451  FPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFG  630
            F    + R+ ++GWIC+ FS+ VF +PL IV +V RTKSVEF+PF LSFFLTLSAVMWF 
Sbjct  121  FLTQRQKRVQVLGWICMTFSLCVFVAPLFIVRKVIRTKSVEFMPFSLSFFLTLSAVMWFF  180

Query  631  YGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVV----EENKNVQEHIVNVEMLGT  798
            YG + KD  +A+PNILG   G+LQ++LY IYRN+K VV    +   ++ EH+V++E LG 
Sbjct  181  YGFLKKDQFVAVPNILGLLFGILQMVLYMIYRNSKKVVVVEPKLKLDISEHVVDLEKLGA  240

Query  799  S--NQLVHPVDSGRNISDGVTEINMENNDQGE*KMI  900
            +  +++   +    +  DG+ E   + N + + K I
Sbjct  241  AICSEIAIGIPKLNDGGDGIIE---DQNAKEQTKKI  273



>ref|XP_010421173.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 177/273 (65%), Gaps = 10/273 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D H+ W  VFG+LGN+IS  V+L+PV  F RI + K+T G+ S+PYV+A+FS+ LW
Sbjct  1    MALFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA  KK+  LL++IN  G   ETIYI IF+ FA+ KAR   +K L L  +GGF  I L
Sbjct  61   LYYATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +  F   G  R  ++G ICV FS+ VFA+PLSI+  V +TKSVE++PF LS  LT+SAV+
Sbjct  121  LCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP----VVEENKNVQEHI-VNVE  786
            W  YGL +KD+ +A PN++GF LG LQ++LY +Y+  K     V +E +  + H  V+++
Sbjct  181  WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLHDEVSID  240

Query  787  MLGTSNQLVHPVDSGRNISDGVTEINMEN-NDQ  882
            ML     +  P  +   +   V  +NM N ND+
Sbjct  241  MLKLGTLIASPEPAAITV---VRPVNMCNCNDR  270



>ref|XP_009125890.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Brassica 
rapa]
Length=297

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 179/256 (70%), Gaps = 12/256 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   ++FGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMVNHHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA  K++A LLI+INS G V ETIYI +F  +A+ + +  A+K LFL   +  FS+I 
Sbjct  61   LYYALTKQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIK-LFLTMNVAFFSLII  119

Query  439  LVSWFPFS-GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F      +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFAVKRPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVE---ENKNVQEH---IV  777
            VMWF YG  + D+ IA+PN++GF LGL+Q++LY +YRN+   ++   +N +  E    IV
Sbjct  180  VMWFAYGAFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGEKLDIGKKNNSSSEQLKTIV  239

Query  778  NVEMLGTSNQLVHPVD  825
             +  LG S   +HPVD
Sbjct  240  VMSPLGLSE--MHPVD  253



>gb|EMT20483.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=310

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 172/263 (65%), Gaps = 24/263 (9%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILG----------------NIISIFVYLAPVSIFIRIYRAKSTMG  216
            M  L L HPW   FG+LG                N+IS   YLAP+  F +IYR+KST G
Sbjct  1    MGGLSLQHPWAFAFGLLGVSLFSLANCRMLLRAGNVISFMTYLAPLPTFYQIYRSKSTQG  60

Query  217  YHSVPYVIAIFSSMLWMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNAL  396
            + SVPYV+A+FS+MLW+YYA +K +  LLI+INS G V ETIYI+I+L +A  +A+    
Sbjct  61   FQSVPYVVALFSAMLWIYYALLKSDECLLITINSAGCVIETIYIIIYLTYAPKQAKLFTA  120

Query  397  KELFLC-IGGFSIIFLVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVE  573
            K L L  +G F +I L++     GE R+ ++GW+CV FS++VF +PLS++  V RT+SVE
Sbjct  121  KILLLLNVGVFGLILLLTLLLSEGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVE  180

Query  574  FLPFYLSFFLTLSAVMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEEN  753
            F+PF LS  LT+SAV+WF YGL++KD  +ALPNILGF  G++Q+ LYA+YRNA P     
Sbjct  181  FMPFSLSLSLTVSAVVWFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNAMPSPAPK  240

Query  754  K-------NVQEHIVNVEMLGTS  801
            +        V EH++++  LG +
Sbjct  241  QVDDADAIKVPEHVIHIAKLGPA  263



>ref|XP_004957300.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Setaria 
italica]
Length=283

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 155/218 (71%), Gaps = 1/218 (0%)
 Frame = +1

Query  88   AILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWM  267
             +  + HPW   FGILGNI+S  V+LAP   F+R+YR KST G+  VPYV+A+FS MLW+
Sbjct  4    GLFSMEHPWASAFGILGNIVSFLVFLAPTPTFLRVYRKKSTEGFSCVPYVVALFSCMLWI  63

Query  268  YYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKE-LFLCIGGFSIIFLV  444
            +YA +K N++ L++IN+ G V E++YIL++L++A   AR  AL   L L +  FS+I +V
Sbjct  64   FYALVKTNSSPLLTINAFGCVVESVYILLYLLYAPRAARIRALASFLLLDVAAFSLIAVV  123

Query  445  SWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMW  624
            +    +G  R+ ++G IC+AFS+AVF +P+S++  V RTKS EF+PF LSFFLTLSAV W
Sbjct  124  TLELVAGPHRVKVLGSICLAFSMAVFVAPMSVIFVVIRTKSAEFMPFSLSFFLTLSAVAW  183

Query  625  FGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP  738
            F YGL  KDL + LPN+ GFF G +Q++LY  YR  KP
Sbjct  184  FFYGLFTKDLYVTLPNVGGFFFGCVQMVLYCCYRKPKP  221



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 173/261 (66%), Gaps = 9/261 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+PW+  FG+LGNI S  V+LAPV  FIR+ R KST G+ S+PYV+A+FS++L +YY+ +
Sbjct  8    HNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALLLIYYSTL  67

Query  283  KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPF  459
              +   L++INS+G   ETIYI +++ +A  KAR   ++  L L + GF  I +V+ F  
Sbjct  68   NADEFFLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSILVVTQFLV  127

Query  460  SGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGL  639
                R  ++G+IC   S++VFA+PLSI+ +V RT+SVE++PF LSFFLTLSAVMW  YGL
Sbjct  128  KRAYRARVIGFICGGLSVSVFAAPLSIMKRVIRTRSVEYMPFSLSFFLTLSAVMWLCYGL  187

Query  640  IMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEHIVNVEMLGTSNQLVHP  819
             +KDL +ALPN LGF  G+ Q++LYAIYRNAKP+  E K + +H  ++E      Q+V  
Sbjct  188  FLKDLYVALPNTLGFTFGMAQMILYAIYRNAKPLPSEEK-LPQHKADIE-----TQIV--  239

Query  820  VDSGRNISDGVTEINMENNDQ  882
            + +     D       +N DQ
Sbjct  240  ITATPTNPDDHQGDEHQNQDQ  260



>ref|XP_003602780.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=270

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 178/264 (67%), Gaps = 7/264 (3%)
 Frame = +1

Query  112  WLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKN  291
            W  VFG++GN+IS   +LAP+  F RIY+ KST G+ SVPYV A+ S+MLW+YYA +K  
Sbjct  9    WAFVFGVIGNVISCMTFLAPLPTFYRIYKKKSTEGFQSVPYVTALLSAMLWIYYAHVKNK  68

Query  292  ATLLI-SINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGGFSIIFLVSWFPFSGE  468
            ATLL+ +IN  G   E IYI+IFL++AS+KAR + +K LFL + G+  + +++ +   G 
Sbjct  69   ATLLLLTINIYGFGIEAIYIIIFLLYASNKARLSTIKLLFLTVCGYGTMVILTTYLTKGS  128

Query  469  IRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMK  648
             R+S++GWIC+ F+I VFASPL I+ QV +TKSV F+P  LSFFLTL+A++WF YGL++ 
Sbjct  129  KRLSIIGWICMVFNICVFASPLFILKQVIKTKSVAFMPLNLSFFLTLNAIVWFFYGLLID  188

Query  649  DLRIALPNilgfflgllqillYAIYRNAKPVVEEN-KNVQEHIVNVEMLGTSNQLVHPVD  825
            D  IA+PN LGF  G++Q+++Y IY++A P+     +   +H++N+      N  + P D
Sbjct  189  DFYIAIPNTLGFVFGIVQMVIYLIYKDAIPLESTKLQKPNDHVLNI-CEDVPNGALQP-D  246

Query  826  SGRNISDG---VTEINMENNDQGE  888
              + +  G   V  I  E+ + G+
Sbjct  247  PNQVVKSGAPAVAVIGDEDPNNGK  270



>ref|XP_010027260.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=285

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 175/253 (69%), Gaps = 10/253 (4%)
 Frame = +1

Query  115  LLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNA  294
            + +FGILGNI+S FV+LAP+  F RIYR KST  + S+PY++A+FSSMLW+YYAF+K ++
Sbjct  5    IFIFGILGNIVSFFVFLAPMPTFYRIYRNKSTEEFQSIPYLVALFSSMLWLYYAFLKGHS  64

Query  295  TLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFPFSGEI  471
             LLI+INS G V E +YI I++ +A + AR + +K   L  +G FS++ L++ F  + + 
Sbjct  65   FLLITINSFGCVIEMVYIAIYIAYALTAARNSTIKLFALMNMGLFSLLILITHFIPNDDA  124

Query  472  RISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKD  651
            R  + GWIC   S++VFA+PLSIV +V RTKSVEF+PF LSFFLTLSA+MWFGYG   KD
Sbjct  125  RAMVFGWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKD  184

Query  652  LRIALPNilgfflgllqillYAIYRNAKPVVEEN--KNVQEHIVNVEMLGTS------NQ  807
              I +PN +GF LGL Q+++Y  YRN + V++E   ++V   +V   + G S      ++
Sbjct  185  WCIMIPNTVGFVLGLSQMVVYGYYRNNE-VMDEKLPQHVAITVVRPPLGGVSEVRPVTDE  243

Query  808  LVHPVDSGRNISD  846
            +  P+D G   +D
Sbjct  244  ISPPIDRGEARAD  256



>emb|CDX85668.1| BnaA02g01450D [Brassica napus]
Length=297

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 178/256 (70%), Gaps = 12/256 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   ++FGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MGVMVNHHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC--IGGFSIIF  438
            +YYA  K++A LLI+INS G V ETIYI +F  +A+ + +  A+K LFL   +  FS+I 
Sbjct  61   LYYALTKQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIK-LFLTMNVAFFSLII  119

Query  439  LVSWFPFS-GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F      +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFAVKRPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVE---ENKNVQEH---IV  777
            VMWF YG  + D+ IA+PN++GF LGL+Q++LY +YRN+   ++    N +  E    IV
Sbjct  180  VMWFAYGAFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGEKLDIGKRNNSSSEQLKTIV  239

Query  778  NVEMLGTSNQLVHPVD  825
             +  LG S   +HPVD
Sbjct  240  VMSPLGLSE--MHPVD  253



>ref|XP_004962650.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Setaria 
italica]
Length=269

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 165/243 (68%), Gaps = 9/243 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA   L HPW   FG+LGNIIS   +LAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGFSLQHPWAFTFGLLGNIISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA IK N  LLI+IN  G V E+IY++++ V+A  KAR    K  L L +G F  I L
Sbjct  61   IFYALIKTNEILLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
             +   F G+ RI  +GWICV FS+ VF +PLSI+ +V +T+SVE++PF LS  LTLSAV+
Sbjct  121  FTLLVFKGDKRIVTLGWICVGFSVGVFVAPLSIIRRVIKTRSVEYMPFSLSLSLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNV--------QEHIV  777
            WF YGL++KD  +ALPN+LGF  G++Q+ LY  Y N  P+V E K          +EH+V
Sbjct  181  WFLYGLLIKDKYVALPNVLGFAFGIVQMGLYMFYMNKTPLVPEGKVAAGKLPAAGEEHVV  240

Query  778  NVE  786
            NV 
Sbjct  241  NVH  243



>ref|XP_009121791.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
SWEET15 [Brassica rapa]
Length=298

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/256 (50%), Positives = 176/256 (69%), Gaps = 12/256 (5%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M ++  HH   +VFGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS M+ 
Sbjct  1    MGVMINHHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMIX  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG--FSIIF  438
            +YYA  K++A LLI+INS G V ETIYI +F  +A+   R  A+K LFL I    FS+I 
Sbjct  61   LYYALTKQHAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMK-LFLTINVAFFSLIL  119

Query  439  LVSWFPFS-GEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F      +++S++GWICVA S++VFA+PL IV +V +TKSVEF+PF LSFFLT+SA
Sbjct  120  MVTHFAVKRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQ------EHIV  777
            VMWF YGL + D+ IA+PN++GF LG++Q+LLY IYRN    ++  K +       + +V
Sbjct  180  VMWFAYGLFLHDICIAIPNVVGFILGMVQMLLYGIYRNPGEKLDTEKKMNPSDQQLKSVV  239

Query  778  NVEMLGTSNQLVHPVD  825
             +  LG S   VHP+D
Sbjct  240  VMSPLGVSE--VHPID  253



>ref|XP_002453892.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
 gb|EES06868.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
Length=336

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 171/265 (65%), Gaps = 18/265 (7%)
 Frame = +1

Query  85   MAILDL-HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSML  261
            MA L++    W   FGILGNIIS+ V+L+P+  F R+YR KST G+ S PYV+ +FS ML
Sbjct  1    MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  262  WMYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIF  438
            W++YA +K  A LL++IN +G V ET+Y+ ++L++A   AR    K L  L +G F ++ 
Sbjct  61   WIFYALLKSGAELLVTINGVGCVIETVYLGMYLLYAPKAARVLTAKMLLGLNVGVFGLVA  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            LV+    +G +R+ ++GWICV+ +++VFA+PLSI+ QV RTKSVEF+P  LSFFL LSAV
Sbjct  121  LVTMVLSNGGLRVKVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKP------VVEENKNVQEHIVN  780
            +WF YG + KD+ +A PN+LGF  GL Q+ LY  YRN KP      +VEE K   E   +
Sbjct  181  IWFAYGALKKDVFVAAPNVLGFVFGLAQMALYMAYRNKKPAAAAVIMVEEVKLPAEQYAS  240

Query  781  VEML----------GTSNQLVHPVD  825
             E+            +    VHP+D
Sbjct  241  KEVAPPAAAHEGSRASCGAEVHPID  265



>ref|XP_010454652.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 175/274 (64%), Gaps = 12/274 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D H+ W  VFG+LGN+IS  V+L+PV  F RI + K+T G+ S+PYV+A+FS+ LW
Sbjct  1    MALFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA  KK+  LL++IN  G   ETIYI IF+ FA+ KAR   +K L L  +GGF  I L
Sbjct  61   LYYATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +  F   G  R  ++G ICV FS+ VFA+PLSI+  V +TKSVE++PF LS  LT+SAV+
Sbjct  121  LCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVE------ENKNVQEHIVNV  783
            W  YGL +KD+ +A PN++GF LG LQ++LY +Y+  K   E      E   + +  V++
Sbjct  181  WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLPDE-VSI  239

Query  784  EMLGTSNQLVHPVDSGRNISDGVTEINMEN-NDQ  882
            +ML     +  P  +   +   V  +NM N ND+
Sbjct  240  DMLKLGTLIASPEPAAITV---VRPVNMCNCNDR  270



>gb|KHG27148.1| Bidirectional sugar transporter SWEET10 -like protein [Gossypium 
arboreum]
Length=278

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 187/273 (68%), Gaps = 8/273 (3%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + LH  W  VFGILGN++S  V LAP+  F +IY+ +++ GY S+PYV+++FS+MLW+YY
Sbjct  1    MALHVSWAFVFGILGNVVSFLVSLAPLPTFYQIYKKRTSEGYQSIPYVVSLFSAMLWIYY  60

Query  274  AFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFLVSW  450
            A +KK+A LLI+IN+  +  +T YI+++  +   K +   LK + L  + GF +IF  ++
Sbjct  61   ALLKKDAMLLITINTFCVFIQTFYIVVYFYYGPKKEKLVTLKLILLFNVFGFGVIFFSTF  120

Query  451  FPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFG  630
            F  +  IR+ ++G+IC+ F++ VF +PL I+ +V +TKSVE++PF LS FLTL AVMWF 
Sbjct  121  FLKNPLIRLQILGYICMGFALCVFVAPLGILRKVIKTKSVEYMPFTLSVFLTLGAVMWFF  180

Query  631  YGLIMKDLRIALPNilgfflgllqillYAIYRN-AKPVVEENK---NVQEHIVNVEMLG-  795
            YGL++KD+ IA+PN+LGF  G+LQ++LYAIY+N  K +VE+ K   + Q+ +V+V  LG 
Sbjct  181  YGLLLKDMNIAVPNVLGFIFGILQMILYAIYKNYPKKMVEDPKLQLSAQQVVVDVVKLGS  240

Query  796  -TSNQLVHPVDSGRNISDGVTEI-NMENNDQGE  888
             T +  V+ V    N  DG  E  N++ N+  +
Sbjct  241  TTVSLEVNAVGPNPNNGDGTGEAQNIKTNNTAD  273



>ref|XP_010556111.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=307

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 178/252 (71%), Gaps = 11/252 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA++   H   + FGILGN IS  V+LAPV  F RIY+ KST  + S+PY +++FS MLW
Sbjct  1    MAVMINQHLLAVTFGILGNAISFLVFLAPVPTFYRIYKKKSTESFRSLPYQVSLFSCMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG--FSIIF  438
            +YYA +K+NA LLI+INS G V ET YI +F+ +A+   R +A+K LF+ +    FS+I 
Sbjct  61   LYYALLKQNAFLLITINSFGCVVETFYIAMFIAYAAKDKRISAMK-LFMAMNVTFFSLIL  119

Query  439  LVSWFPFSGEI-RISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSA  615
            +V+ F       +I ++GWICVA S++VFA+PLS+V +V RTKSVEF+PF LSFFLT+SA
Sbjct  120  IVTHFLVKNSSHQIVILGWICVAISVSVFAAPLSVVARVIRTKSVEFMPFTLSFFLTISA  179

Query  616  VMWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNVQEH----IVNV  783
            VMWF YGL + D+ IA+PN+LGF LG++Q++LY IYRN++    E K +Q+H    IV +
Sbjct  180  VMWFAYGLFLHDICIAIPNVLGFALGMVQMILYGIYRNSEKSNLE-KKIQDHQLKTIVVL  238

Query  784  EMLGTSNQLVHP  819
              LG S   V+P
Sbjct  239  SPLGVSE--VYP  248



>ref|NP_001149087.1| MTN3 [Zea mays]
 gb|ACF85462.1| unknown [Zea mays]
 gb|ACG34136.1| MTN3 [Zea mays]
 gb|AFW56330.1| MTN3 [Zea mays]
Length=302

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 178/263 (68%), Gaps = 15/263 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA + L HPW   FG+LGN+IS   +LAP+  F RIY++KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGMSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGG-FSIIFL  441
            ++YA IK N T LI+IN+ G V ETIY++++ V+A  KA+    K + L  GG F +I L
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYVVMYFVYAPKKAKLFTAKIMVLLNGGVFGVILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++   F G  R+ L+GWICV FS++VF +PLSI+ +V +TKSVE++PF LS  LTLSAV+
Sbjct  121  LTLLLFKGSKRVVLLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV--VEENKN-------VQEHI  774
            WF YGL++KD  +ALPNILGF  G++Q++LY +Y N  PV    E K+         EH+
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAATAEGKDAGKLSSAADEHV  240

Query  775  -VNVEMLGTS----NQLVHPVDS  828
             VN+  L  +    +  VHPV  
Sbjct  241  LVNIAKLSPALPERSSGVHPVTQ  263



>ref|XP_002443163.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
 gb|EES17001.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
Length=304

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 178/261 (68%), Gaps = 15/261 (6%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA L L HPW   FG+LGN+IS   +LAP+  F RIY+ KST G+ SVPYV+A+FS+MLW
Sbjct  1    MAGLSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFL  441
            ++YA IK N T LI+IN+ G V ETIYI+++ V+A  K +    K  L L +G F +I L
Sbjct  61   IFYALIKSNETFLITINAAGCVIETIYIIMYFVYAPKKGKMFTAKIMLLLNVGIFGVILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            ++   F G+ R+ ++GWICV FS++VF +PLSI+ +V +TKSVE++PF LS  LTLSAV+
Sbjct  121  LTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMKRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPV-VEENKN--------VQEHI  774
            WF YGL++KD  +ALPNILGF  G++Q++LY +Y N  PV V E K+          EH+
Sbjct  181  WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAVAEGKDAGGKLPSAADEHV  240

Query  775  -VNVEMLGTS----NQLVHPV  822
             VN+  L  +    +  VHPV
Sbjct  241  LVNIAKLSPALPERSSGVHPV  261



>ref|XP_002877428.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53687.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 176/275 (64%), Gaps = 11/275 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D H+ W  VFG+LGN+IS  V+L+PV  F RI + K+T G+ S+PYV+A+FS+MLW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA  KK+  LL++INS G   E IYI IF+ FAS KAR   +K L L   GGF +I L
Sbjct  61   LYYATQKKDVFLLVTINSFGCFIEIIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +  F   G  R  ++G ICV FS+ VFA+PLSI+  V +TKSVE++PF LS  LT+SAV+
Sbjct  121  LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAK---PVVE---ENKNVQEHIVNV  783
            W  YGL +KD+ +A PN++GF LG LQ++LY +Y+  K    +VE   E   + E  +++
Sbjct  181  WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  784  EMLGTSNQLVHPVDSGRNISDGVTEINMENNDQGE  888
              LGT   L  P  +   +   V   N  N+ + E
Sbjct  241  LKLGT---LTSPEPAAITVVRSVNTCNC-NDRKAE  271



>ref|XP_004301046.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
N3-like [Fragaria vesca subsp. vesca]
Length=291

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 181/274 (66%), Gaps = 8/274 (3%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            M++ +  H    +F ++G++IS  VYLAPV  F RIY+ K+T G+ S+PY++A+F S LW
Sbjct  1    MSMYNSQHHLAFIFVVIGDVISFMVYLAPVPTFYRIYKKKTTEGFQSLPYLVALFGSTLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFL  441
            +YY  +K+N  LLI+IN+ G V ET+YI +++V+A++ +R+  +K   F+ +G FS+I +
Sbjct  61   LYYGIVKQNMVLLITINTFGSVMETLYIAMYIVYATNASRKLTIKLFGFMNLGLFSLIVV  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
               +    E R  ++G I VA +I   A+PLSIV QV RT SVEF+PF LSFFLTLS V+
Sbjct  121  CISYAVHSEYRALVLGXINVAVTICASAAPLSIVAQVIRTGSVEFMPFTLSFFLTLSGVL  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKN---VQEHIVNVEML  792
            WF YG+++KD+ IALPN LGF LGLLQ+L YAIYRN K V  + +N     EH+ +  +L
Sbjct  181  WFSYGMLLKDIFIALPNGLGFVLGLLQMLFYAIYRNRKQVTVDQRNKLPAPEHVTDTVIL  240

Query  793  GTSNQLVHPVDSGR----NISDGVTEINMENNDQ  882
              +   V  VD+ +    +  DG  E + + +++
Sbjct  241  SIATSEVQSVDAKQCYDYDGKDGSKESDGDEHEK  274



>ref|XP_007038075.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22576.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
Length=280

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 187/270 (69%), Gaps = 9/270 (3%)
 Frame = +1

Query  94   LDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYY  273
            + LH  W  VFG+LGN++S  V LAP+  F +IY+ +++ G+ S+PYV+++FS+MLW+YY
Sbjct  1    MALHLSWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYY  60

Query  274  AFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFL-CIGGFSIIFLVSW  450
            A +KK+A LLI+IN+     +T YI+ +  +A  K +   +K + L  I GF +IFL ++
Sbjct  61   ALLKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTF  120

Query  451  FPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFG  630
            F  +   R+ ++G+IC+AF+++VFA+PL I+ +V +TKSVE++PF LS FLTL AVMWF 
Sbjct  121  FLQNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFF  180

Query  631  YGLIMKDLRIALPNilgfflgllqillYAIYRNA-KPVVEENK--NVQEHIVNVEMLGT-  798
            YGL++KD+ IA+PN++GF  G+LQ++LYAIY+N  K +VE+ K   + EHIV+V  LGT 
Sbjct  181  YGLLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLSEHIVDVVKLGTM  240

Query  799  ---SNQLVHPVDSGRNISDGVTEI-NMENN  876
                   V P  +  N + GV +  N++ N
Sbjct  241  VCSEVNAVAPQPNETNNNGGVVQAQNIKGN  270



>ref|XP_010493487.1| PREDICTED: bidirectional sugar transporter SWEET12 [Camelina 
sativa]
Length=289

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 175/274 (64%), Gaps = 12/274 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MA+ D H+ W  VFG+LGN+IS  V+L+PV  F RI + K+T G+ S+PYV+A+FS+ LW
Sbjct  1    MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  265  MYYAFIKKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFL  441
            +YYA  KK+  LL++IN  G   ETIYI IF+ FA+ KAR   +K L L  +GGF  I L
Sbjct  61   LYYATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILL  120

Query  442  VSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVM  621
            +  F   G  R  ++G ICV FS+ VFA+PLSI+  V +TKSVE++PF LS  LT+SAV+
Sbjct  121  LCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  622  WFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVE------ENKNVQEHIVNV  783
            W  YGL +KD+ +A PN++GF LG LQ++LY +Y+  K   E      E   + +  V++
Sbjct  181  WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLPDE-VSI  239

Query  784  EMLGTSNQLVHPVDSGRNISDGVTEINMEN-NDQ  882
            +ML     +  P  +   +   V  +NM N ND+
Sbjct  240  DMLKLGTLIASPEPAAITV---VRPVNMCNCNDR  270



>ref|XP_010442559.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Camelina 
sativa]
Length=295

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 182/278 (65%), Gaps = 16/278 (6%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+ W  VFGI+GNIIS  V+LAPV  FIRI + KST G+ S+PY+ AIFS+MLW+YYA  
Sbjct  5    HNVWAFVFGIMGNIISFIVFLAPVPTFIRIVKKKSTEGFQSLPYLSAIFSAMLWIYYAMQ  64

Query  283  KKNAT-LLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWFP  456
            K  +  LLI+IN++G V ETIYI++F+ +A+ K R + LK L  L   GF++I LV    
Sbjct  65   KDGSGFLLITINAVGCVIETIYIVLFVTYANKKTRISTLKVLGLLNFLGFAVIVLVCELL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R  ++G ICV FS++VFA+PLSI+  V RT+SVEF+PF LS FLTLSAV W  YG
Sbjct  125  TKGSTREKVLGGICVGFSVSVFAAPLSIMRVVVRTRSVEFMPFSLSLFLTLSAVTWLFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAK-PVVEENKNVQ----EHIVNVEMLGT-  798
            L +KD  +ALPN+LG FLG +Q++LY I++  K PV ++    +    E+ +++  L T 
Sbjct  185  LAIKDFYVALPNVLGAFLGAVQMILYIIFKYYKTPVAQKTDKSKAVASEYSIDIAKLTTI  244

Query  799  -----SNQLVHPVDSGRNISDG---VTEINMENNDQGE  888
                 S+  VH   +  N+ +    VTE+  +N + GE
Sbjct  245  TPGPISDSTVHQAPAVHNVLETQIQVTEVKSQNMNDGE  282



>gb|AFK48645.1| unknown [Lotus japonicus]
Length=247

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 175/243 (72%), Gaps = 7/243 (3%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
               W  VFG++GN+IS  V+LAP+  F +IY+ K+  G+ ++PYV+A+FS+MLW+YYAF+
Sbjct  5    RESWAFVFGLMGNVISFMVFLAPLPTFYQIYKKKTAEGFQALPYVVALFSAMLWIYYAFV  64

Query  283  KK-NATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLC-IGGFSIIFLVSWFP  456
            K+ +A LLI+IN+ GIV E+IYI  FL +A  K+R + +K L L  + GF  + L + + 
Sbjct  65   KRESALLLITINTFGIVVESIYIAFFLFYAPKKSRLSTIKLLLLLNVFGFGAMLLATLYL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R+ ++GWIC+ F+I+VFA+PL I+ +V RT+SVE++PF+LSF LT++AVMWF YG
Sbjct  125  SKGAKRLQIIGWICLVFNISVFAAPLFIISKVIRTRSVEYMPFFLSFSLTINAVMWFFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAKPVV-EENKNVQE----HIVNVEMLGTS  801
            ++++D  +ALPN LGF  G++Q+++Y IYRNA PVV EE    QE    HI++V   G  
Sbjct  185  MLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVIEEKVKGQEMSGDHIIDVAKGGAV  244

Query  802  NQL  810
            +++
Sbjct  245  SKV  247



>gb|KFK26707.1| hypothetical protein AALP_AA8G282900 [Arabis alpina]
Length=281

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 184/267 (69%), Gaps = 15/267 (6%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFG+LG+IIS FV LAP+  F+RIY+ KS+ GY S+PYVIA+FS+MLW+YYA ++K+A L
Sbjct  11   VFGLLGDIISFFVCLAPIPTFVRIYKRKSSEGYQSIPYVIALFSAMLWIYYALVRKHAVL  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            LI+IN+   V +  YI  +L +A  K +   +K  LF+ +  F +IFL+++F   G  R+
Sbjct  71   LITINTFCCVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGLIFLLTYFLTHGIKRV  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ F++ VF +PL I+ +V +TKS EF+PF LSFFLTLSAVMWF YGL++KD+ 
Sbjct  131  QVLGYICMVFALCVFVAPLGIIRKVIKTKSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  658  IALPNilgfflgllqillYAIYRNAKPVVEEN-----KNVQEHIVNVEMLGT---SNQL-  810
            +ALPN+LGF  G+LQ++LY IY+     V E      +++ EH+V+V  L +   S+Q+ 
Sbjct  191  VALPNVLGFIFGVLQMILYMIYKKPGTKVLEPSGIKLQDISEHVVDVVRLSSMVCSSQMR  250

Query  811  -VHPVDSGRNISDGVTEINMENNDQGE  888
             + P DS    +D    I+++   +G+
Sbjct  251  ALVPQDS----ADMEATIDIDEKIKGD  273



>ref|XP_010039121.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
 gb|KCW49070.1| hypothetical protein EUGRSUZ_K02670 [Eucalyptus grandis]
Length=284

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 174/276 (63%), Gaps = 10/276 (4%)
 Frame = +1

Query  85   MAILDLHHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLW  264
            MAI    +PW   FG+LGN+IS  V+LAPV  F  + + KST G+ SVPYV+++ S+MLW
Sbjct  1    MAIFSTDNPWAFAFGLLGNLISFMVFLAPVPTFYGVCKRKSTEGFQSVPYVVSLLSAMLW  60

Query  265  MYYAFI--KKNATLLISINSIGIVFETIYILIFLVFASSKARRNALKELFLCIGGFSIIF  438
            +YYA I  + N  LL+++NS+G V ETIY+ ++L +A  KA+    K + +  GGF    
Sbjct  61   LYYASINSESNDFLLVTVNSVGCVIETIYVALYLAYAPKKAKIFTAKLMVMGFGGFCSFI  120

Query  439  LVSWFPFSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAV  618
            L+S F   G  R+ L+GW+CV FS+ VFA+PLS++  V RTKSVEF+PF LSFFLTLSAV
Sbjct  121  LLSRFLTEGSTRVQLLGWLCVGFSVIVFAAPLSVMRMVIRTKSVEFMPFSLSFFLTLSAV  180

Query  619  MWFGYGLIMKDLRIALPNilgfflgllqillYAIYRNAKPVVEENKNV---QEHIVNVEM  789
             W  YG+ +KD+ IA+PN+LGF LG+LQ+ LY IYR    +V E  +     + I N + 
Sbjct  181  TWLLYGIFLKDIHIAVPNVLGFILGVLQMGLYLIYRKRNIMVLEKPDYLGGAKPIANTQS  240

Query  790  LG-TSNQLVHPVDS----GRNISDGVTEINMENNDQ  882
                SN  V  VD       ++ +G       +N+Q
Sbjct  241  CSIASNDNVIHVDEVKERKEDVHEGEKSSEASDNEQ  276



>ref|XP_009132693.1| PREDICTED: bidirectional sugar transporter SWEET10 [Brassica 
rapa]
Length=289

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 178/256 (70%), Gaps = 12/256 (5%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFGILGNIIS  V LAP+  FIRIY+ KS+ GY S+PYVIA+FS+MLW+YYA IK N  +
Sbjct  11   VFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIYYAMIKTNVVI  70

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALK-ELFLCIGGFSIIFLVSWFPFSGEIRI  477
            +I+IN++ +V +  YI  +L +A  K +   +K  LF+ +  F  IF +++F   G+ R+
Sbjct  71   MITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLTYFLLHGQKRV  130

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
             ++G+IC+ FS+ VF +PL I+ +V +T+S EF+PF LSFFLTLSAVMWF YGL++KD+ 
Sbjct  131  QILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWFFYGLLLKDMN  190

Query  658  IALPNilgfflgllqillYAIYRNA-----KPVVEENKNVQEHIVNVEMLGT---SNQL-  810
            IALPN+LGF  G+LQ++LY IY+       +P V   + + +H+V+V  L +   S+Q+ 
Sbjct  191  IALPNVLGFIFGVLQMILYMIYKKPGTKVLEPPVINLQEISDHVVDVVRLSSMVCSSQMR  250

Query  811  -VHPVDSGRNISDGVT  855
             + P DS  ++ D +T
Sbjct  251  TLVPQDSA-DMEDTIT  265



>gb|EPS64389.1| hypothetical protein M569_10392, partial [Genlisea aurea]
Length=248

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 161/232 (69%), Gaps = 5/232 (2%)
 Frame = +1

Query  121  VFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFIKKNATL  300
            VFG+LGN IS  V+LAP+  F +IY+ KST G+  VPY++ +FS+MLW+YYAF+K + TL
Sbjct  6    VFGLLGNAISFMVFLAPIPTFYKIYKKKSTEGFQCVPYIVGLFSAMLWIYYAFLKPDTTL  65

Query  301  LISINSIGIVFETIYILIFLVFASSKARRNALKELF-LCIGGFSIIFLVSWFPFSGEIRI  477
            L++INS+G  F++IYI  +L F+S K R    K+LF L +  F +I  V+ F  S   + 
Sbjct  66   LVTINSVGCFFQSIYIGFYLYFSSKKTRVVTTKQLFVLNVASFGVIIAVTRFVVSPSQQA  125

Query  478  SLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYGLIMKDLR  657
            S+VGWIC+ FS+ VF +PL +V QV RTKSVE +PF LSFFLTLSAVMWF YGL+ KD  
Sbjct  126  SVVGWICLVFSLCVFVAPLCVVRQVIRTKSVECMPFLLSFFLTLSAVMWFFYGLLRKDYN  185

Query  658  IALPNilgfflgllqillYAIYRNAKPVVEENK----NVQEHIVNVEMLGTS  801
            IALPN+LGF  G+LQ+LLY +YR       + K     +Q+ I++   L ++
Sbjct  186  IALPNVLGFIFGVLQMLLYMMYRKVDEDSAKKKLPLPELQDQILDAVKLNSA  237



>ref|XP_010482381.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Camelina 
sativa]
Length=295

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 182/278 (65%), Gaps = 16/278 (6%)
 Frame = +1

Query  103  HHPWLLVFGILGNIISIFVYLAPVSIFIRIYRAKSTMGYHSVPYVIAIFSSMLWMYYAFI  282
            H+ W  VFGI+GNIIS  V+LAPV  FIRI + KST G+ S+PY+ AIFS+MLW+YYA  
Sbjct  5    HNVWAFVFGIMGNIISFVVFLAPVPTFIRIVKKKSTEGFQSLPYLSAIFSAMLWIYYAMQ  64

Query  283  KKNAT-LLISINSIGIVFETIYILIFLVFASSKARRNALKEL-FLCIGGFSIIFLVSWFP  456
            K  +  LLI+IN++G V ETIYI++F+ +A+ K R + LK L  L   GF++I LV    
Sbjct  65   KDGSGFLLITINAVGCVIETIYIVLFVTYANKKTRISTLKVLGLLNFLGFAVIVLVCELL  124

Query  457  FSGEIRISLVGWICVAFSIAVFASPLSIVLQVFRTKSVEFLPFYLSFFLTLSAVMWFGYG  636
              G  R  ++G ICV FS++VFA+PLSI+  V RT+SVEF+PF LS FLTLSAV W  YG
Sbjct  125  TKGSTREKVLGGICVGFSVSVFAAPLSIMRVVVRTRSVEFMPFSLSLFLTLSAVTWLFYG  184

Query  637  LIMKDLRIALPNilgfflgllqillYAIYRNAK-PVVEENKNVQ----EHIVNVEMLGT-  798
            L +KD  +ALPN+LG FLG +Q++LY I++  K PV ++    +    E+ +++  L T 
Sbjct  185  LAIKDFYVALPNVLGAFLGAVQMILYIIFKYYKTPVAQKTDKSKAVASEYSIDIAKLTTI  244

Query  799  -----SNQLVHPVDSGRNISDG---VTEINMENNDQGE  888
                 S+  VH   +  N+ +    VTE+  +N + GE
Sbjct  245  TPGPISDSTVHQAPAVHNVLETQIQVTEVKSQNMNDGE  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2989120234566