BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77515_g1_i1 len=1634 path=[1:0-1633]

Length=1634
                                                                      Score     E

ref|XP_004235795.1|  PREDICTED: peroxisome biogenesis protein 3-2       551   0.0      
ref|XP_009776113.1|  PREDICTED: peroxisome biogenesis protein 3-2...    548   0.0      
ref|XP_009624188.1|  PREDICTED: peroxisome biogenesis protein 3-2...    545   0.0      
ref|XP_009791935.1|  PREDICTED: peroxisome biogenesis protein 3-2...    539   0.0      
ref|XP_006341556.1|  PREDICTED: peroxisome biogenesis protein 3-2...    533   0.0      
ref|XP_006353815.1|  PREDICTED: peroxisome biogenesis protein 3-2...    531   0.0      
ref|XP_009600163.1|  PREDICTED: peroxisome biogenesis protein 3-2       531   0.0      
ref|XP_004252269.1|  PREDICTED: peroxisome biogenesis protein 3-2...    530   0.0      
emb|CDO98382.1|  unnamed protein product                                527   0.0      
ref|XP_011084479.1|  PREDICTED: peroxisome biogenesis protein 3-2       511   3e-175   
gb|KHG12837.1|  Peroxisome biogenesis 3-2 -like protein                 497   1e-169   
ref|XP_002281306.1|  PREDICTED: peroxisome biogenesis protein 3-2       497   2e-169   Vitis vinifera
ref|XP_007036704.1|  Peroxin 3 isoform 1                                487   2e-165   
ref|XP_007036706.1|  Peroxin 3, putative isoform 3                      487   2e-165   
ref|XP_011000480.1|  PREDICTED: peroxisome biogenesis protein 3-2       471   3e-159   
ref|XP_008364649.1|  PREDICTED: peroxisome biogenesis protein 3-2...    469   1e-158   
ref|XP_002317886.1|  phosphatase 2C family protein                      469   2e-158   Populus trichocarpa [western balsam poplar]
ref|XP_002322084.2|  phosphatase 2C family protein                      467   8e-158   Populus trichocarpa [western balsam poplar]
ref|XP_010032548.1|  PREDICTED: peroxisome biogenesis protein 3-2       467   1e-157   
ref|XP_006451673.1|  hypothetical protein CICLE_v10008707mg             464   9e-157   
ref|XP_006490732.1|  PREDICTED: peroxisome biogenesis protein 3-2...    464   9e-157   
ref|XP_009347780.1|  PREDICTED: peroxisome biogenesis protein 3-2...    462   9e-156   
ref|XP_008240185.1|  PREDICTED: peroxisome biogenesis protein 3-1       460   3e-155   
ref|XP_011039100.1|  PREDICTED: peroxisome biogenesis protein 3-2...    461   4e-155   
gb|KDO62865.1|  hypothetical protein CISIN_1g017709mg                   459   1e-154   
gb|KDP37907.1|  hypothetical protein JCGZ_05346                         458   2e-154   
ref|XP_002529562.1|  amino acid transporter, putative                   458   3e-154   Ricinus communis
ref|XP_009360101.1|  PREDICTED: peroxisome biogenesis protein 3-2       453   2e-152   
ref|XP_010255760.1|  PREDICTED: peroxisome biogenesis protein 3-2...    449   2e-150   
ref|XP_008393403.1|  PREDICTED: peroxisome biogenesis protein 3-2...    447   7e-150   
ref|XP_010243784.1|  PREDICTED: peroxisome biogenesis protein 3-2...    446   1e-149   
ref|XP_008453453.1|  PREDICTED: peroxisome biogenesis protein 3-2       442   5e-148   
gb|KHN21657.1|  Peroxisome biogenesis protein 3-2                       437   5e-146   
ref|XP_003525200.1|  PREDICTED: peroxisome biogenesis protein 3-2...    437   5e-146   
ref|XP_007160505.1|  hypothetical protein PHAVU_002G327400g             435   2e-145   
ref|XP_004160430.1|  PREDICTED: peroxisome biogenesis protein 3-2...    432   4e-144   
ref|XP_004299549.1|  PREDICTED: peroxisome biogenesis protein 3-2...    431   6e-144   
ref|XP_004299550.1|  PREDICTED: peroxisome biogenesis protein 3-2...    431   7e-144   
ref|XP_004137328.1|  PREDICTED: peroxisome biogenesis protein 3-2...    431   2e-143   
ref|XP_010549092.1|  PREDICTED: peroxisome biogenesis protein 3-2       428   2e-142   
ref|XP_010551146.1|  PREDICTED: peroxisome biogenesis protein 3-2...    424   5e-141   
gb|KHN00176.1|  Peroxisome biogenesis protein 3-2                       424   7e-141   
ref|NP_683410.1|  peroxin 3                                             423   8e-141   Arabidopsis thaliana [mouse-ear cress]
gb|ACU20085.1|  unknown                                                 423   1e-140   Glycine max [soybeans]
ref|XP_003530946.1|  PREDICTED: peroxisome biogenesis protein 3-2       423   2e-140   
ref|XP_010687023.1|  PREDICTED: peroxisome biogenesis protein 3-2       419   4e-139   
gb|KFK36073.1|  hypothetical protein AALP_AA4G073900                    419   5e-139   
ref|XP_006305970.1|  hypothetical protein CARUB_v10011233mg             418   9e-139   
ref|XP_004503305.1|  PREDICTED: peroxisome biogenesis protein 3-2...    417   2e-138   
ref|XP_006406642.1|  hypothetical protein EUTSA_v10020989mg             415   2e-137   
ref|XP_010479289.1|  PREDICTED: peroxisome biogenesis protein 3-2       412   1e-136   
ref|XP_010923819.1|  PREDICTED: peroxisome biogenesis protein 3-1...    412   3e-136   
ref|XP_010923811.1|  PREDICTED: peroxisome biogenesis protein 3-1...    412   3e-136   
ref|XP_010461693.1|  PREDICTED: peroxisome biogenesis protein 3-2...    411   3e-136   
ref|XP_011039101.1|  PREDICTED: peroxisome biogenesis protein 3-2...    410   5e-136   
ref|XP_008803262.1|  PREDICTED: peroxisome biogenesis protein 3-2...    410   2e-135   
ref|XP_002883113.1|  peroxin-3 family protein                           409   3e-135   
ref|XP_010465898.1|  PREDICTED: peroxisome biogenesis protein 3-1       408   6e-135   
ref|XP_008812617.1|  PREDICTED: peroxisome biogenesis protein 3-1...    409   6e-135   
ref|XP_008812616.1|  PREDICTED: peroxisome biogenesis protein 3-1...    409   6e-135   
ref|XP_010500402.1|  PREDICTED: peroxisome biogenesis protein 3-2...    407   2e-134   
ref|XP_010506481.1|  PREDICTED: peroxisome biogenesis protein 3-1...    407   2e-134   
gb|KDO62868.1|  hypothetical protein CISIN_1g017709mg                   404   3e-134   
ref|XP_010487727.1|  PREDICTED: peroxisome biogenesis protein 3-1...    406   4e-134   
ref|NP_001154410.1|  peroxin 3                                          407   9e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924142.1|  PREDICTED: peroxisome biogenesis protein 3-2...    404   5e-133   
ref|XP_006393377.1|  hypothetical protein EUTSA_v10011573mg             402   4e-132   
gb|AAM63222.1|  unknown                                                 400   5e-132   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566598.1|  peroxin 3-1                                           400   6e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AET05546.2|  peroxisome biogenesis protein                           400   7e-132   
ref|XP_007209400.1|  hypothetical protein PRUPE_ppa009207mg             398   7e-132   
gb|KEH21416.1|  peroxisome biogenesis protein                           400   2e-131   
ref|XP_009147951.1|  PREDICTED: peroxisome biogenesis protein 3-2       399   2e-131   
ref|XP_009135568.1|  PREDICTED: peroxisome biogenesis protein 3-1...    397   1e-130   
ref|XP_007036708.1|  Peroxin 3 isoform 5                                395   1e-130   
ref|XP_006298003.1|  hypothetical protein CARUB_v10014048mg             397   1e-130   
ref|XP_007036709.1|  Peroxin 3 isoform 6                                394   7e-130   
emb|CDX75959.1|  BnaC03g40420D                                          395   1e-129   
ref|XP_009419367.1|  PREDICTED: peroxisome biogenesis protein 3-1...    394   4e-129   
ref|NP_001154622.1|  peroxin 3-1                                        394   6e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51933.1|  BnaAnng11100D                                          389   2e-127   
ref|XP_009113491.1|  PREDICTED: peroxisome biogenesis protein 3-1...    387   1e-126   
ref|XP_009403556.1|  PREDICTED: peroxisome biogenesis protein 3-1...    386   6e-126   
emb|CDX95552.1|  BnaC01g34440D                                          385   1e-125   
emb|CDY69671.1|  BnaCnng64690D                                          377   3e-122   
ref|XP_009113500.1|  PREDICTED: peroxisome biogenesis protein 3-1...    374   9e-122   
ref|XP_006451672.1|  hypothetical protein CICLE_v10008707mg             370   5e-121   
gb|KDO62871.1|  hypothetical protein CISIN_1g017709mg                   370   6e-121   
ref|XP_009135569.1|  PREDICTED: peroxisome biogenesis protein 3-1...    367   7e-119   
gb|AAG50845.1|AC074308_1  hypothetical protein, 3' partial              369   2e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AAG60126.1|AC073555_10  lysine and histidine specific transpor...    379   4e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18500.1|  BnaA01g26950D                                          370   5e-117   
ref|XP_003558994.1|  PREDICTED: peroxisome biogenesis protein 3-1...    362   9e-117   
ref|NP_001062839.1|  Os09g0314300                                       347   7e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661110.1|  PREDICTED: peroxisome biogenesis protein 3-2...    347   7e-111   
dbj|BAK07109.1|  predicted protein                                      340   3e-108   
ref|NP_974332.1|  peroxin 3-1                                           335   3e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KEH21417.1|  peroxisome biogenesis protein                           334   2e-106   
ref|XP_010924144.1|  PREDICTED: peroxisome biogenesis protein 3-2...    328   8e-104   
ref|XP_004956552.1|  PREDICTED: peroxisome biogenesis protein 3-2...    327   5e-103   
ref|XP_002891447.1|  hypothetical protein ARALYDRAFT_336986             332   1e-101   
ref|XP_010924145.1|  PREDICTED: peroxisome biogenesis protein 3-2...    320   3e-101   
ref|XP_002460028.1|  hypothetical protein SORBIDRAFT_02g021030          320   2e-100   Sorghum bicolor [broomcorn]
gb|ACG41301.1|  lysine and histidine specific transporter               317   4e-99    Zea mays [maize]
ref|NP_001141850.1|  lysine and histidine specific transporter          312   2e-97    Zea mays [maize]
ref|XP_011039102.1|  PREDICTED: peroxisome biogenesis protein 3-2...    292   9e-91    
emb|CDX93687.1|  BnaA06g03610D                                          290   3e-90    
gb|EMT02612.1|  Peroxisomal biogenesis factor 3                         292   4e-88    
ref|XP_006490735.1|  PREDICTED: peroxisome biogenesis protein 3-2...    282   6e-87    
ref|XP_008667564.1|  PREDICTED: lysine and histidine specific tra...    269   1e-81    
gb|EMS62415.1|  Peroxisome biogenesis protein 3-2                       266   1e-79    
gb|ABR17606.1|  unknown                                                 259   4e-77    Picea sitchensis
ref|XP_010097593.1|  Peroxisome biogenesis protein 3-2                  238   3e-71    
gb|EMS51732.1|  Peroxisome biogenesis protein 3-1                       233   6e-68    
dbj|BAG92761.1|  unnamed protein product                                231   1e-67    Oryza sativa Japonica Group [Japonica rice]
gb|EYU40233.1|  hypothetical protein MIMGU_mgv1a0090641mg               227   4e-67    
ref|XP_001769437.1|  predicted protein                                  218   2e-61    
gb|EYU40232.1|  hypothetical protein MIMGU_mgv1a0090642mg               207   5e-60    
ref|XP_003631070.1|  Peroxisomal biogenesis factor                      218   7e-60    
gb|EPS67028.1|  hypothetical protein M569_07748                         205   4e-59    
ref|XP_001755103.1|  predicted protein                                  207   3e-57    
ref|XP_001753372.1|  predicted protein                                  206   1e-56    
ref|XP_002960244.1|  hypothetical protein SELMODRAFT_74269              199   2e-54    
emb|CBI15533.3|  unnamed protein product                                190   1e-53    
ref|XP_010663658.1|  PREDICTED: peroxisome biogenesis protein 3-2...    189   2e-53    
dbj|BAB02028.1|  unnamed protein product                                191   3e-53    Arabidopsis thaliana [mouse-ear cress]
gb|ACU17567.1|  unknown                                                 182   1e-50    Glycine max [soybeans]
ref|XP_008653862.1|  PREDICTED: peroxisome biogenesis protein 3-2...    166   7e-44    
gb|ACU17566.1|  unknown                                                 152   3e-40    Glycine max [soybeans]
ref|XP_006837203.1|  hypothetical protein AMTR_s00105p00087820          148   4e-38    
ref|XP_010097594.1|  Peroxisome biogenesis protein 3-2                  137   4e-32    
gb|AFK37561.1|  unknown                                                 129   1e-31    
ref|XP_005846323.1|  hypothetical protein CHLNCDRAFT_135719             126   2e-28    
ref|XP_002609626.1|  hypothetical protein BRAFLDRAFT_125038             113   4e-24    Branchiostoma floridae
ref|XP_007245524.1|  PREDICTED: peroxisomal biogenesis factor 3         107   5e-22    
ref|XP_006821234.1|  PREDICTED: peroxisomal biogenesis factor 3-like    106   8e-22    
ref|XP_007171382.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    105   2e-21    
ref|XP_005815437.1|  PREDICTED: peroxisomal biogenesis factor 3-l...    104   5e-21    
ref|XP_008577085.1|  PREDICTED: peroxisomal biogenesis factor 3         104   6e-21    
ref|XP_010360989.1|  PREDICTED: peroxisomal biogenesis factor 3         103   8e-21    
ref|XP_002113974.1|  hypothetical protein TRIADDRAFT_57948              103   9e-21    Trichoplax adhaerens
gb|ELU04467.1|  hypothetical protein CAPTEDRAFT_227264                  103   1e-20    
ref|XP_007574808.1|  PREDICTED: peroxisomal biogenesis factor 3         103   1e-20    
ref|XP_003215753.1|  PREDICTED: peroxisomal biogenesis factor 3         103   1e-20    
tpg|DAA60994.1|  TPA: hypothetical protein ZEAMMB73_962101            97.1    2e-20    
ref|XP_006161971.1|  PREDICTED: peroxisomal biogenesis factor 3         102   2e-20    
ref|XP_004895703.1|  PREDICTED: peroxisomal biogenesis factor 3         102   2e-20    
ref|XP_006793578.1|  PREDICTED: peroxisomal biogenesis factor 3-like    102   2e-20    
ref|NP_001244856.1|  peroxisomal biogenesis factor 3                    102   2e-20    
emb|CDQ67741.1|  unnamed protein product                                102   3e-20    
ref|XP_005654424.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    102   3e-20    
ref|XP_005334908.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|XP_006643036.1|  PREDICTED: peroxisomal biogenesis factor 3-like    102   3e-20    
ref|XP_008070276.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|XP_004651209.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|XP_002747142.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    Callithrix jacchus [common marmoset]
ref|XP_005280460.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|XP_518776.1|  PREDICTED: peroxisomal biogenesis factor 3            102   3e-20    Pan troglodytes
ref|XP_004011437.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|XP_006188573.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|NP_001231114.1|  peroxisomal biogenesis factor 3                    102   3e-20    
ref|XP_006075251.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|XP_005211059.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    102   3e-20    
ref|XP_005889151.1|  PREDICTED: peroxisomal biogenesis factor 3         102   3e-20    
ref|XP_003403999.1|  PREDICTED: peroxisomal biogenesis factor 3         102   4e-20    
ref|XP_006197822.1|  PREDICTED: peroxisomal biogenesis factor 3         102   4e-20    
ref|XP_003926909.1|  PREDICTED: peroxisomal biogenesis factor 3         102   4e-20    
ref|NP_001092457.1|  peroxisomal biogenesis factor 3                    102   4e-20    Bos taurus [bovine]
ref|XP_004368919.1|  PREDICTED: peroxisomal biogenesis factor 3         101   5e-20    
ref|XP_007904528.1|  PREDICTED: peroxisomal biogenesis factor 3         101   5e-20    
ref|XP_007114376.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    101   5e-20    
ref|NP_003621.1|  peroxisomal biogenesis factor 3                       101   5e-20    Homo sapiens [man]
ref|XP_780894.3|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal bio...    100   5e-20    Strongylocentrotus purpuratus [purple urchin]
gb|AAX37078.1|  peroxisomal biogenesis factor 3                         101   5e-20    
ref|XP_003986666.1|  PREDICTED: peroxisomal biogenesis factor 3         101   6e-20    
ref|XP_007450373.1|  PREDICTED: peroxisomal biogenesis factor 3         101   6e-20    
ref|XP_005654423.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    101   6e-20    
ref|XP_005974994.1|  PREDICTED: peroxisomal biogenesis factor 3         101   6e-20    
ref|XP_004263803.1|  PREDICTED: peroxisomal biogenesis factor 3         101   7e-20    
ref|XP_005389308.1|  PREDICTED: peroxisomal biogenesis factor 3         101   7e-20    
ref|XP_006976733.1|  PREDICTED: peroxisomal biogenesis factor 3         100   8e-20    
ref|XP_004568496.1|  PREDICTED: peroxisomal biogenesis factor 3-like    100   9e-20    
ref|XP_010624910.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    100   9e-20    
ref|XP_004628607.1|  PREDICTED: peroxisomal biogenesis factor 3         100   9e-20    
ref|XP_007171383.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    100   9e-20    
ref|XP_004673964.1|  PREDICTED: peroxisomal biogenesis factor 3         100   1e-19    
ref|XP_003769558.1|  PREDICTED: peroxisomal biogenesis factor 3         100   1e-19    
ref|XP_004935736.1|  PREDICTED: peroxisomal biogenesis factor 3 i...    100   1e-19    
ref|XP_419708.1|  PREDICTED: peroxisomal biogenesis factor 3 isof...    100   1e-19    Gallus gallus [bantam]
ref|XP_004935737.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  99.4    2e-19    
ref|NP_001039031.1|  peroxisomal biogenesis factor 3                    100   2e-19    Xenopus tropicalis [western clawed frog]
ref|XP_007946997.1|  PREDICTED: peroxisomal biogenesis factor 3       99.8    2e-19    
ref|XP_002714902.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  99.8    2e-19    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006084465.1|  PREDICTED: peroxisomal biogenesis factor 3       99.8    2e-19    
ref|NP_112640.1|  peroxisomal biogenesis factor 3                     99.8    2e-19    Rattus norvegicus [brown rat]
ref|XP_005859142.1|  PREDICTED: peroxisomal biogenesis factor 3       99.4    3e-19    
ref|XP_003499990.1|  PREDICTED: peroxisomal biogenesis factor 3       99.4    3e-19    
ref|XP_010624911.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  98.6    3e-19    
ref|XP_003800102.1|  PREDICTED: peroxisomal biogenesis factor 3-like  99.4    3e-19    
ref|XP_005361054.1|  PREDICTED: peroxisomal biogenesis factor 3       98.6    5e-19    
ref|NP_001157667.1|  peroxisomal biogenesis factor 3 isoform 2        98.2    5e-19    Mus musculus [mouse]
ref|XP_003465693.1|  PREDICTED: peroxisomal biogenesis factor 3       98.2    6e-19    
ref|XP_006035374.1|  PREDICTED: peroxisomal biogenesis factor 3       98.2    7e-19    
gb|EDL03500.1|  peroxisomal biogenesis factor 3, isoform CRA_b        98.2    7e-19    
ref|XP_006891726.1|  PREDICTED: peroxisomal biogenesis factor 3       98.2    8e-19    
ref|XP_007096424.1|  PREDICTED: peroxisomal biogenesis factor 3       98.2    8e-19    
dbj|BAC35986.1|  unnamed protein product                              97.8    8e-19    Mus musculus [mouse]
ref|XP_001370565.1|  PREDICTED: peroxisomal biogenesis factor 3       97.8    9e-19    Monodelphis domestica
ref|NP_064345.1|  peroxisomal biogenesis factor 3 isoform 1           97.8    9e-19    Mus musculus [mouse]
ref|XP_004084984.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  97.4    1e-18    
ref|XP_006915420.1|  PREDICTED: peroxisomal biogenesis factor 3       97.8    1e-18    
ref|XP_010963962.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  97.1    1e-18    
ref|XP_003971450.1|  PREDICTED: peroxisomal biogenesis factor 3-like  97.4    1e-18    
ref|XP_004752801.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  96.7    1e-18    
ref|XP_004441027.1|  PREDICTED: peroxisomal biogenesis factor 3       97.4    1e-18    
ref|XP_007636710.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  97.8    1e-18    
ref|XP_007114377.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  97.1    1e-18    
ref|XP_006265794.1|  PREDICTED: peroxisomal biogenesis factor 3       97.1    2e-18    
ref|XP_005065917.1|  PREDICTED: peroxisomal biogenesis factor 3       97.1    2e-18    
ref|NP_956522.1|  peroxisomal biogenesis factor 3                     97.1    2e-18    Danio rerio [leopard danio]
ref|XP_003790322.1|  PREDICTED: peroxisomal biogenesis factor 3       97.1    2e-18    
ref|XP_008395275.1|  PREDICTED: peroxisomal biogenesis factor 3       96.7    2e-18    
ref|XP_004752800.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  96.7    2e-18    
ref|XP_008693264.1|  PREDICTED: peroxisomal biogenesis factor 3       96.7    2e-18    
ref|XP_008828040.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  96.7    2e-18    
ref|XP_006834673.1|  PREDICTED: peroxisomal biogenesis factor 3       96.3    3e-18    
ref|XP_007648428.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  97.4    3e-18    
gb|ETE64214.1|  Peroxisomal biogenesis factor 3                       96.3    3e-18    
ref|XP_004702025.1|  PREDICTED: peroxisomal biogenesis factor 3       96.3    4e-18    
ref|XP_007422975.1|  PREDICTED: peroxisomal biogenesis factor 3       95.9    4e-18    
ref|XP_541132.3|  PREDICTED: peroxisomal biogenesis factor 3 isof...  95.9    5e-18    Canis lupus familiaris [dogs]
ref|XP_005518498.1|  PREDICTED: peroxisomal biogenesis factor 3       95.5    5e-18    
ref|XP_004345008.1|  hypothetical protein CAOG_06259                  97.1    5e-18    
ref|XP_010572891.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  95.5    5e-18    
ref|XP_004397084.1|  PREDICTED: peroxisomal biogenesis factor 3       95.5    6e-18    
ref|NP_001188055.1|  peroxisomal biogenesis factor 3                  95.1    6e-18    
ref|XP_010572892.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  94.7    8e-18    
ref|XP_001635320.1|  predicted protein                                95.1    9e-18    Nematostella vectensis
ref|NP_001085641.1|  peroxisomal biogenesis factor 3                  94.0    2e-17    Xenopus laevis [clawed frog]
ref|XP_002912676.1|  PREDICTED: peroxisomal biogenesis factor 3-like  93.6    2e-17    
ref|XP_010880897.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  93.2    3e-17    
ref|XP_005815436.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  93.2    3e-17    
ref|XP_009899674.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  92.8    4e-17    
ref|XP_004084985.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  92.8    5e-17    
ref|XP_009093585.1|  PREDICTED: peroxisomal biogenesis factor 3       92.0    6e-17    
ref|XP_005150108.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  92.0    8e-17    
ref|XP_005552064.1|  PREDICTED: uncharacterized LOC101865844 isof...  91.3    9e-17    
ref|XP_006731037.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  91.7    1e-16    
ref|XP_010754546.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  91.3    1e-16    
ref|XP_010221750.1|  PREDICTED: peroxisomal biogenesis factor 3       91.3    2e-16    
ref|XP_006731036.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  90.9    2e-16    
ref|XP_004587341.1|  PREDICTED: peroxisomal biogenesis factor 3       90.5    2e-16    
ref|XP_008311852.1|  PREDICTED: peroxisomal biogenesis factor 3       90.5    2e-16    
ref|XP_001507262.2|  PREDICTED: peroxisomal biogenesis factor 3       90.1    3e-16    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_008300030.1|  PREDICTED: peroxisomal biogenesis factor 3       89.0    7e-16    
ref|XP_006128851.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  89.0    7e-16    
ref|XP_005645716.1|  hypothetical protein COCSUDRAFT_57086            89.4    7e-16    
ref|XP_006745252.1|  PREDICTED: peroxisomal biogenesis factor 3       88.6    1e-15    
gb|KGL83312.1|  Peroxisomal biogenesis factor 3                       88.2    1e-15    
ref|XP_005452456.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  89.4    2e-15    
gb|KFO32260.1|  Peroxisomal biogenesis factor 3                       87.4    2e-15    
pdb|3AJB|A  Chain A, Crystal Structure Of Human Pex3p In Complex ...  86.7    3e-15    
ref|XP_009048700.1|  hypothetical protein LOTGIDRAFT_157859           86.7    4e-15    
dbj|BAG62543.1|  unnamed protein product                              85.5    4e-15    Homo sapiens [man]
pdb|3MK4|A  Chain A, X-ray Structure Of Human Pex3 In Complex Wit...  86.3    4e-15    
gb|KFV80578.1|  Peroxisomal biogenesis factor 3                       85.5    9e-15    
ref|XP_004327629.1|  PREDICTED: peroxisomal biogenesis factor 3       84.3    9e-15    
ref|XP_009671878.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  85.5    1e-14    
gb|EDL03499.1|  peroxisomal biogenesis factor 3, isoform CRA_a        85.5    1e-14    
ref|XP_008529945.1|  PREDICTED: peroxisomal biogenesis factor 3       85.9    2e-14    
gb|ACN31079.1|  unknown                                               79.7    2e-14    Zea mays [maize]
ref|XP_005608285.1|  PREDICTED: peroxisomal biogenesis factor 3       85.9    2e-14    
ref|XP_010880898.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  84.0    3e-14    
ref|XP_004609052.1|  PREDICTED: peroxisomal biogenesis factor 3       83.6    3e-14    
ref|XP_010705608.1|  PREDICTED: peroxisomal biogenesis factor 3       83.6    3e-14    
ref|XP_007538464.1|  PREDICTED: peroxisomal biogenesis factor 3       84.3    3e-14    
ref|XP_005043945.1|  PREDICTED: peroxisomal biogenesis factor 3       83.6    5e-14    
gb|KFO60907.1|  Peroxisomal biogenesis factor 3                       83.6    5e-14    
ref|XP_006128850.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  83.6    6e-14    
gb|EMP39110.1|  Peroxisomal biogenesis factor 3                       83.2    6e-14    
ref|XP_009569395.1|  PREDICTED: peroxisomal biogenesis factor 3       83.2    7e-14    
ref|XP_008634229.1|  PREDICTED: peroxisomal biogenesis factor 3       83.2    7e-14    
ref|XP_005507780.1|  PREDICTED: peroxisomal biogenesis factor 3       82.8    1e-13    
gb|EOA95776.1|  Peroxisomal biogenesis factor 3                       82.0    1e-13    
dbj|BAE91223.1|  unnamed protein product                              80.1    1e-13    
gb|KFV68033.1|  Peroxisomal biogenesis factor 3                       82.0    1e-13    
ref|XP_005027501.1|  PREDICTED: peroxisomal biogenesis factor 3       82.0    1e-13    
ref|XP_005438251.1|  PREDICTED: peroxisomal biogenesis factor 3       82.0    2e-13    
gb|KFW74011.1|  Peroxisomal biogenesis factor 3                       81.6    2e-13    
ref|XP_009499740.1|  PREDICTED: peroxisomal biogenesis factor 3       81.3    2e-13    
ref|XP_009981480.1|  PREDICTED: peroxisomal biogenesis factor 3       81.3    2e-13    
gb|KFQ02011.1|  Peroxisomal biogenesis factor 3                       81.3    2e-13    
gb|KFV04823.1|  Peroxisomal biogenesis factor 3                       81.3    2e-13    
ref|XP_009914884.1|  PREDICTED: peroxisomal biogenesis factor 3       81.3    3e-13    
gb|EMC85914.1|  Peroxisomal biogenesis factor 3                       81.3    3e-13    
gb|KFW06411.1|  Peroxisomal biogenesis factor 3                       81.3    3e-13    
ref|XP_005420196.1|  PREDICTED: peroxisomal biogenesis factor 3       81.3    3e-13    
ref|XP_009577804.1|  PREDICTED: peroxisomal biogenesis factor 3       80.9    3e-13    
gb|KFP46224.1|  Peroxisomal biogenesis factor 3                       80.9    3e-13    
gb|ELK36468.1|  Peroxisomal biogenesis factor 3                       80.1    4e-13    
gb|KFU90295.1|  Peroxisomal biogenesis factor 3                       80.5    4e-13    
ref|XP_009671879.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  79.7    4e-13    
ref|XP_006755447.1|  PREDICTED: peroxisomal biogenesis factor 3       80.1    4e-13    
gb|KFQ35131.1|  Peroxisomal biogenesis factor 3                       80.1    5e-13    
ref|XP_008138512.1|  PREDICTED: peroxisomal biogenesis factor 3       80.1    5e-13    
ref|XP_010182210.1|  PREDICTED: peroxisomal biogenesis factor 3       80.1    5e-13    
ref|XP_009996850.1|  PREDICTED: peroxisomal biogenesis factor 3       80.1    5e-13    
ref|XP_002195948.2|  PREDICTED: peroxisomal biogenesis factor 3       80.1    5e-13    
gb|KFQ43416.1|  Peroxisomal biogenesis factor 3                       80.1    6e-13    
ref|XP_005490317.1|  PREDICTED: peroxisomal biogenesis factor 3       80.1    6e-13    
gb|KFW63695.1|  Peroxisomal biogenesis factor 3                       79.7    6e-13    
ref|XP_006512870.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  79.3    7e-13    
gb|KFQ93619.1|  Peroxisomal biogenesis factor 3                       79.7    7e-13    
gb|KFM08992.1|  Peroxisomal biogenesis factor 3                       79.7    7e-13    
gb|KFW88399.1|  Peroxisomal biogenesis factor 3                       79.7    7e-13    
gb|KFP01047.1|  Peroxisomal biogenesis factor 3                       79.7    7e-13    
ref|XP_008930623.1|  PREDICTED: peroxisomal biogenesis factor 3       80.1    7e-13    
ref|XP_009317427.1|  PREDICTED: peroxisomal biogenesis factor 3       80.1    8e-13    
gb|KFP20503.1|  Peroxisomal biogenesis factor 3                       79.7    8e-13    
gb|KFV57655.1|  Peroxisomal biogenesis factor 3                       79.7    8e-13    
ref|XP_008261804.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  79.0    8e-13    
ref|XP_009279842.1|  PREDICTED: peroxisomal biogenesis factor 3       79.7    9e-13    
ref|XP_009970315.1|  PREDICTED: peroxisomal biogenesis factor 3       79.7    9e-13    
gb|KGL91089.1|  Peroxisomal biogenesis factor 3                       79.3    1e-12    
gb|KFR11870.1|  Peroxisomal biogenesis factor 3                       79.3    1e-12    
ref|XP_010197335.1|  PREDICTED: peroxisomal biogenesis factor 3       79.3    1e-12    
ref|XP_009934378.1|  PREDICTED: peroxisomal biogenesis factor 3       79.7    1e-12    
ref|XP_009880611.1|  PREDICTED: peroxisomal biogenesis factor 3       79.3    1e-12    
ref|XP_009642549.1|  PREDICTED: peroxisomal biogenesis factor 3       79.3    1e-12    
ref|XP_009459083.1|  PREDICTED: peroxisomal biogenesis factor 3       79.7    1e-12    
gb|KFZ67784.1|  Peroxisomal biogenesis factor 3                       79.0    1e-12    
gb|KFV04344.1|  Peroxisomal biogenesis factor 3                       79.0    1e-12    
ref|XP_009956858.1|  PREDICTED: peroxisomal biogenesis factor 3       79.0    1e-12    
gb|EKC30200.1|  Serine/threonine-protein kinase RIO1                  80.5    2e-12    
ref|XP_005230300.1|  PREDICTED: peroxisomal biogenesis factor 3       79.0    2e-12    
ref|XP_009702581.1|  PREDICTED: peroxisomal biogenesis factor 3       79.3    2e-12    
ref|XP_005097122.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  79.0    2e-12    
ref|XP_010084680.1|  PREDICTED: peroxisomal biogenesis factor 3       79.0    2e-12    
gb|KFP59618.1|  Peroxisomal biogenesis factor 3                       78.6    2e-12    
gb|KFO71304.1|  Peroxisomal biogenesis factor 3                       78.2    2e-12    
ref|XP_009082128.1|  PREDICTED: peroxisomal biogenesis factor 3       78.6    2e-12    
gb|KFP73261.1|  Peroxisomal biogenesis factor 3                       78.2    2e-12    
gb|ERE63886.1|  peroxisomal biogeneis factor 3-like isoform 1         77.8    3e-12    
gb|KFZ57978.1|  Peroxisomal biogenesis factor 3                       77.8    3e-12    
ref|XP_008828042.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  77.4    3e-12    
gb|KFQ15807.1|  Peroxisomal biogenesis factor 3                       77.4    4e-12    
ref|XP_010165981.1|  PREDICTED: peroxisomal biogenesis factor 3       77.4    4e-12    
ref|XP_009018260.1|  hypothetical protein HELRODRAFT_157080           76.6    4e-12    
ref|XP_001661904.1|  perixosomal biogenesis factor                    77.0    8e-12    
ref|XP_010572893.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  76.3    9e-12    
gb|KFP27768.1|  Peroxisomal biogenesis factor 3                       76.6    1e-11    
ref|XP_010135952.1|  PREDICTED: peroxisomal biogenesis factor 3       76.3    1e-11    
gb|KFO90663.1|  Peroxisomal biogenesis factor 3                       76.3    1e-11    
ref|XP_010775627.1|  PREDICTED: peroxisomal biogenesis factor 3       73.9    1e-11    
ref|XP_010151604.1|  PREDICTED: peroxisomal biogenesis factor 3       74.3    2e-11    
gb|KFV93845.1|  Peroxisomal biogenesis factor 3                       74.3    2e-11    
gb|KFO12179.1|  Peroxisomal biogenesis factor 3                       74.7    2e-11    
gb|KFQ76608.1|  Peroxisomal biogenesis factor 3                       74.3    2e-11    
gb|KFQ67735.1|  Peroxisomal biogenesis factor 3                       74.3    2e-11    
ref|XP_010303456.1|  PREDICTED: peroxisomal biogenesis factor 3       74.7    2e-11    
ref|XP_010287657.1|  PREDICTED: peroxisomal biogenesis factor 3       74.3    2e-11    
ref|XP_010018624.1|  PREDICTED: peroxisomal biogenesis factor 3       74.7    2e-11    
gb|EFX72227.1|  hypothetical protein DAPPUDRAFT_59197                 75.1    2e-11    
gb|EHJ68637.1|  peroxisomal biogenesis factor 3                       75.5    3e-11    
gb|AFW68583.1|  hypothetical protein ZEAMMB73_371421                  74.7    3e-11    
gb|KFQ21433.1|  Peroxisomal biogenesis factor 3                       73.6    3e-11    
ref|XP_007056335.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  75.1    4e-11    
ref|XP_008946453.1|  PREDICTED: peroxisomal biogenesis factor 3       73.6    4e-11    
gb|KFM24650.1|  Peroxisome biogenesis protein 3-1                     72.4    8e-11    
gb|EXX55451.1|  hypothetical protein RirG_225330                      74.3    9e-11    
gb|AAI58162.1|  Unknown (protein for MGC:135489)                      71.2    1e-10    
ref|XP_010123480.1|  PREDICTED: peroxisomal biogenesis factor 3       71.6    1e-10    
ref|XP_006731038.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  72.4    1e-10    
gb|KFV43915.1|  Peroxisomal biogenesis factor 3                       71.6    1e-10    
ref|XP_001863328.1|  peroxisomal biogenesis factor 3                  72.4    3e-10    
ref|XP_009812888.1|  PREDICTED: peroxisomal biogenesis factor 3-like  71.6    3e-10    
gb|EMT04183.1|  hypothetical protein F775_00519                       68.6    6e-10    
ref|XP_002676488.1|  peroxin-3                                        71.2    7e-10    
ref|XP_002415303.1|  perixosomal biogenesis factor, putative          70.5    9e-10    
ref|XP_505754.1|  YALI0F22539p                                        70.9    1e-09    
gb|KHJ34252.1|  putative peroxin-3 family protein                     70.9    1e-09    
gb|KFP44251.1|  Peroxisomal biogenesis factor 3                       68.6    1e-09    
ref|XP_005097121.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  70.1    2e-09    
gb|KFB35048.1|  AGAP002507-PA-like protein                            69.3    3e-09    
ref|NP_001040264.1|  peroxisomal biogenesis factor 3                  67.4    9e-09    
ref|XP_312432.3|  AGAP002507-PA                                       67.4    1e-08    
dbj|GAM35987.1|  hypothetical protein TCE0_018f04733                  68.2    1e-08    
ref|XP_004340871.1|  Peroxin-3 protein                                67.0    2e-08    
ref|XP_005186870.1|  PREDICTED: peroxisomal biogenesis factor 3-like  66.6    2e-08    
gb|EPT01939.1|  hypothetical protein FOMPIDRAFT_1036019               66.6    3e-08    
gb|AFW85710.1|  hypothetical protein ZEAMMB73_633021                  65.9    3e-08    
ref|XP_002147989.1|  peroxisomal membrane protein (Pex3), putative    65.9    5e-08    
ref|XP_005709198.1|  peroxin-3 family protein                         65.5    5e-08    
ref|XP_001218024.1|  conserved hypothetical protein                   65.9    5e-08    
gb|EPB83248.1|  hypothetical protein HMPREF1544_09992                 65.5    5e-08    
gb|EFN87948.1|  Peroxisomal biogenesis factor 3                       65.1    6e-08    
ref|XP_002427139.1|  Peroxisomal biogenesis factor, putative          64.7    8e-08    
emb|CCG81165.1|  putative Peroxisomal membrane protein                64.3    1e-07    
ref|XP_004522342.1|  PREDICTED: peroxisomal biogenesis factor 3-l...  63.9    2e-07    
gb|KFA70810.1|  hypothetical protein S40288_09655                     64.3    2e-07    
ref|XP_008045095.1|  hypothetical protein TRAVEDRAFT_175684           63.9    2e-07    
gb|KFH70598.1|  hypothetical protein MVEG_03448                       63.5    3e-07    
gb|KFA55480.1|  hypothetical protein S40293_02082                     63.2    3e-07    
gb|KEY74140.1|  hypothetical protein S7711_00300                      63.2    3e-07    
ref|XP_002482219.1|  peroxisomal membrane protein (Pex3), putative    62.4    5e-07    
ref|XP_001385728.2|  Peroxisomal biogenesis factor 3 (Peroxin-3)      62.0    7e-07    
emb|CCL99374.1|  predicted protein                                    62.0    8e-07    
ref|XP_006675591.1|  hypothetical protein BATDEDRAFT_22540            61.6    8e-07    
gb|KFA63456.1|  hypothetical protein S40285_00311                     61.6    9e-07    
ref|XP_006667863.1|  peroxisomal membrane protein Pex3, putative      61.6    1e-06    
ref|XP_003424038.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  60.8    1e-06    
gb|EYE93433.1|  putative peroxisomal membrane protein                 61.6    1e-06    
gb|EMR84525.1|  putative peroxin-3 family protein                     60.8    2e-06    
gb|EWC45066.1|  hypothetical protein DRE_06205                        60.8    2e-06    
ref|XP_008216529.1|  PREDICTED: peroxisomal biogenesis factor 3 i...  60.1    2e-06    
ref|XP_011128114.1|  hypothetical protein AOL_s00215g610              60.5    2e-06    
ref|XP_659885.1|  hypothetical protein AN2281.2                       60.5    3e-06    
ref|XP_001555052.1|  hypothetical protein BC1G_06575                  60.1    3e-06    
dbj|GAM24519.1|  hypothetical protein SAMD00019534_076940             59.7    3e-06    
ref|XP_007727655.1|  hypothetical protein A1O1_08606                  60.1    3e-06    
ref|XP_008556324.1|  PREDICTED: peroxisomal biogenesis factor 3       59.3    3e-06    
gb|KFM81143.1|  Peroxisomal biogenesis factor 3                       57.8    5e-06    
ref|XP_008492319.1|  PREDICTED: peroxisomal biogenesis factor 3       58.2    5e-06    
gb|ERG81975.1|  peroxisomal biogenesis factor 3                       58.9    5e-06    
ref|XP_762347.1|  hypothetical protein UM06200.1                      59.3    6e-06    
ref|XP_003691107.1|  PREDICTED: peroxisomal biogenesis factor 3-like  58.5    7e-06    
gb|KDR15659.1|  Peroxisomal biogenesis factor 3                       58.5    8e-06    
gb|EUC61530.1|  peroxin-3 protein                                     58.9    8e-06    
gb|EPS34788.1|  hypothetical protein PDE_09752                        58.9    8e-06    
emb|CEI89186.1|  hypothetical protein RMCBS344292_03553               58.5    8e-06    
ref|XP_007372609.1|  hypothetical protein SPAPADRAFT_58391            58.5    9e-06    
gb|KHC68029.1|  peroxin-3                                             58.5    9e-06    
ref|XP_003717143.1|  peroxisomal biogenesis factor 3                  58.5    9e-06    
gb|EMF11828.1|  Peroxin-3-domain-containing protein                   58.5    9e-06    
ref|XP_003249441.1|  PREDICTED: peroxisomal biogenesis factor 3-like  58.2    9e-06    
emb|CEG67527.1|  Putative Likely peroxisomal integral membrane pr...  58.2    1e-05    
emb|CEG79413.1|  hypothetical protein RMATCC62417_13887               58.2    1e-05    
ref|XP_003402242.1|  PREDICTED: peroxisomal biogenesis factor 3-like  57.8    1e-05    
emb|CEJ89276.1|  Putative Peroxin-3 protein                           58.2    1e-05    
gb|KDQ56756.1|  hypothetical protein JAAARDRAFT_36244                 58.2    1e-05    
ref|XP_003485479.1|  PREDICTED: peroxisomal biogenesis factor 3-like  57.4    1e-05    
ref|XP_001985390.1|  GH14525                                          57.4    2e-05    
ref|XP_501103.1|  YALI0B19624p                                        57.4    2e-05    
emb|CEG67528.1|  hypothetical protein RMATCC62417_03941               57.0    2e-05    
ref|XP_001958090.1|  GF23687                                          57.4    2e-05    
ref|XP_002095134.1|  GE22224                                          57.0    2e-05    
gb|KFX41840.1|  Peroxisomal biogenesis factor 3                       57.4    2e-05    
gb|ESZ95011.1|  hypothetical protein SBOR_4631                        57.4    2e-05    
ref|XP_640890.1|  transmembrane protein                               57.0    2e-05    
ref|XP_006621808.1|  PREDICTED: peroxisomal biogenesis factor 3-like  57.0    2e-05    
ref|XP_002030567.1|  GM25512                                          57.0    2e-05    
ref|XP_970039.1|  PREDICTED: peroxisomal biogenesis factor 3          56.6    2e-05    
ref|XP_002068473.1|  GK20400                                          57.0    2e-05    
ref|XP_713871.1|  likely peroxisomal integral membrane protein Pex3   57.0    3e-05    
gb|KFQ48822.1|  Peroxisomal biogenesis factor 3                       55.8    3e-05    
gb|KHC57682.1|  peroxin-3                                             57.0    3e-05    
gb|KGQ12843.1|  Peroxisomal biogenesis factor 3                       57.0    3e-05    
ref|XP_002084934.1|  GD14527                                          56.6    3e-05    
ref|NP_648753.1|  peroxin 3, isoform A                                56.6    3e-05    
ref|XP_009157066.1|  hypothetical protein HMPREF1120_04681            57.0    3e-05    
ref|XP_714071.1|  likely peroxisomal integral membrane protein Pex3   56.6    3e-05    
gb|KGQ91348.1|  peroxin-3                                             56.6    3e-05    
gb|EEQ42465.1|  conserved hypothetical protein                        56.6    3e-05    
gb|KHC43552.1|  peroxin-3                                             56.6    3e-05    
ref|XP_007736314.1|  hypothetical protein A1O3_08023                  57.0    3e-05    
emb|CEI89187.1|  hypothetical protein RMCBS344292_03553               56.2    4e-05    
ref|XP_001973058.1|  GG15881                                          56.2    4e-05    
emb|CDJ88368.1|  Peroxin-3 domain containing protein                  56.2    4e-05    
gb|KHN87912.1|  Peroxisomal biogenesis factor 3                       55.8    6e-05    
ref|XP_005856109.1|  peroxin-3                                        53.9    6e-05    
ref|XP_002048218.1|  GJ13845                                          55.5    6e-05    
emb|CAC09577.1|  protein phosphatase 2C (PP2C)                        52.0    6e-05    
ref|XP_007834876.1|  hypothetical protein PFICI_08104                 55.8    7e-05    
ref|XP_001273964.1|  peroxisomal membrane protein (Pex3), putative    55.8    7e-05    
ref|XP_006957095.1|  hypothetical protein WALSEDRAFT_56687            55.5    7e-05    
ref|XP_008597433.1|  peroxin-3 protein                                55.5    8e-05    
ref|XP_001598504.1|  hypothetical protein SS1G_00593                  55.5    8e-05    
ref|XP_007870706.1|  Peroxin-3                                        55.5    1e-04    
ref|XP_002007710.1|  GI13098                                          55.1    1e-04    
gb|KHN95105.1|  Peroxin-3 family protein                              55.5    1e-04    
ref|XP_001353169.1|  GA19910                                          55.1    1e-04    
ref|XP_002022221.1|  GL24760                                          54.7    1e-04    
ref|XP_001730507.1|  hypothetical protein MGL_2303                    55.1    1e-04    
sp|Q92262.1|PEX3_PICPA  RecName: Full=Peroxisomal biogenesis fact...  54.7    2e-04    
ref|XP_002493315.1|  Peroxisomal membrane protein (PMP)               54.3    2e-04    
ref|XP_002417350.1|  peroxisomal biogenesis factor 3, putative        54.3    2e-04    
dbj|GAK67584.1|  peroxin-3                                            54.3    2e-04    
gb|EIE83189.1|  hypothetical protein RO3G_07894                       53.9    2e-04    
gb|EWM25801.1|  peroxisomal biogenesis factor 3                       53.9    2e-04    
emb|CDO77446.1|  hypothetical protein BN946_scf184857.g53             53.9    2e-04    
gb|EHK47900.1|  peroxin-3 protein                                     53.9    3e-04    
ref|XP_001266008.1|  peroxisomal membrane protein (Pex3), putative    53.9    3e-04    
dbj|GAC95071.1|  likely peroxisomal integral membrane protein         53.9    3e-04    
ref|XP_006692785.1|  peroxisomal biogenesis factor 3-like protein     53.5    4e-04    
ref|XP_007291510.1|  Peroxin-3 family protein                         53.5    4e-04    
gb|EMG45578.1|  hypothetical protein G210_4236                        53.5    4e-04    
gb|EPZ37056.1|  Peroxin-3 domain-containing protein                   53.1    4e-04    
ref|XP_007912459.1|  putative peroxisomal biogenesis factor 3 pro...  53.5    4e-04    
gb|KEI42393.1|  hypothetical protein L969DRAFT_91840                  53.9    4e-04    
dbj|GAA99015.1|  hypothetical protein E5Q_05704                       53.5    5e-04    



>ref|XP_004235795.1| PREDICTED: peroxisome biogenesis protein 3-2 [Solanum lycopersicum]
 ref|XP_010318635.1| PREDICTED: peroxisome biogenesis protein 3-2 [Solanum lycopersicum]
Length=369

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/366 (71%), Positives = 315/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FWRRHK+KVYVT GVLGSG+LLYKLY+GH+RR+ +LE+EL  + +NDELI++Q+KEHF 
Sbjct  3     EFWRRHKRKVYVTFGVLGSGYLLYKLYEGHKRRLSDLERELADEKRNDELIRSQIKEHFG  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
              IQ IADSTTLPHVM++LSSRI E+LDL  L E+LMKGKD+PN+LTAAEKLELWDRLKI 
Sbjct  63    KIQTIADSTTLPHVMRHLSSRIEEDLDLTHLMERLMKGKDEPNSLTAAEKLELWDRLKIS  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             +FTR+VLSLW+ T L+LYIRVQVNILGRHLYIDTAR LGSS Q +EAD+I RDD+Q FLA
Sbjct  123   NFTRIVLSLWATTMLSLYIRVQVNILGRHLYIDTARGLGSSIQLDEADLIDRDDEQQFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL N GL  L S FE ATSEVLKGKQLKD F+TT+LHDT++QIL  F+SMGSPHHW+
Sbjct  183   SADYLTNVGLPALTSCFETATSEVLKGKQLKDFFNTTVLHDTILQILAAFLSMGSPHHWM  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              +LMPE  K+Y+ AA SSSD T+   AS FEQLM E +AVLSS+EF N++D+SLKTVVD 
Sbjct  243   GFLMPEHSKLYNSAATSSSDRTEPSPASKFEQLMLEAQAVLSSSEFENILDMSLKTVVDV  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             M+EDI+V CGETNL +G+PLAKL+PRLAH+ + LLEE NR+RYIQ++QN+PEVE+ FTLL
Sbjct  303   MMEDIKVLCGETNLKLGIPLAKLIPRLAHMSRILLEESNRDRYIQIVQNMPEVEMFFTLL  362

Query  1354  YSSTPV  1371
             Y+STP 
Sbjct  363   YASTPA  368



>ref|XP_009776113.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Nicotiana 
sylvestris]
Length=369

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/366 (72%), Positives = 314/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FWRRHK+KVYVTLGV+GSG+LL+KLYDGHRRR+ +LE+EL  + +N+ELI++Q+K HFE
Sbjct  3     EFWRRHKRKVYVTLGVIGSGYLLFKLYDGHRRRLSDLERELADERRNEELIRSQVKAHFE  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IADSTTLPHVM+ L SRI EELDL  LTE+LMKGKDQPN+LTAAEKLELW+RLKIL
Sbjct  63    NIQGIADSTTLPHVMRNLRSRIEEELDLALLTERLMKGKDQPNSLTAAEKLELWERLKIL  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             +FTR+VLSLW+ T L+LYIRVQVNILGRHLYIDTAR LG+S Q +EAD+I RDD+Q FLA
Sbjct  123   TFTRIVLSLWATTVLSLYIRVQVNILGRHLYIDTARGLGTSCQLDEADLIDRDDEQQFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL N GL  LIS FE A SEVLKGKQLKD F+TT+LHDTV++ILD FMS+GSPHHWL
Sbjct  183   SADYLTNVGLPALISSFETAASEVLKGKQLKDFFNTTLLHDTVLRILDTFMSLGSPHHWL  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              +LMPE  K+Y+ AA SSS NT+   +S FEQLM E R VLSS+EF N++D+SLKT VD 
Sbjct  243   GFLMPEHFKLYNSAATSSSGNTEPSPSSKFEQLMLEARTVLSSSEFENILDLSLKTAVDV  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             M+ED+ V CGETNL +G+PLAKLLPRLAH+ + LLEE NRNRYIQV+Q++P VE+ FTLL
Sbjct  303   MMEDVTVLCGETNLKLGIPLAKLLPRLAHMSRILLEESNRNRYIQVVQDMPVVEMFFTLL  362

Query  1354  YSSTPV  1371
             Y+STP 
Sbjct  363   YASTPT  368



>ref|XP_009624188.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Nicotiana 
tomentosiformis]
Length=369

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/365 (72%), Positives = 309/365 (85%), Gaps = 0/365 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FWRRHK+KVYVT+GVLGSG+ LYKLY+ HRR++ +LE+EL    +++ELIK+Q+K HFE
Sbjct  3     EFWRRHKRKVYVTVGVLGSGYFLYKLYNAHRRKLSDLERELADQRRSEELIKSQVKSHFE  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IADSTTLPHVM+ LSS+I EELDL  LTE+LMKGKD PN+LTAAEKLELW+RLKIL
Sbjct  63    NIQRIADSTTLPHVMRCLSSQIEEELDLAHLTERLMKGKDLPNSLTAAEKLELWERLKIL  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW  T L+LYIRVQVNILGRHLYIDTAR +GSS Q +EAD+I R+DQQ FLA
Sbjct  123   SFTRMVLSLWVTTLLSLYIRVQVNILGRHLYIDTARGIGSSGQLDEADLIDRNDQQRFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL  +GL TLIS FEAATSEVLKGKQLKD F+TT+LHDT++QIL+ FMS  SPH WL
Sbjct  183   SADYLTTFGLPTLISSFEAATSEVLKGKQLKDFFNTTVLHDTIIQILNTFMSTASPHQWL  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              + MPED K  S+    S+ +TDL  AS FEQLMQET+AVLSSAEF N+V++SLK  VD 
Sbjct  243   GFFMPEDSKQNSVDVSFSTGSTDLSNASKFEQLMQETQAVLSSAEFCNIVEISLKAAVDV  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++EDIRV CGE NL  GMPLAKLLPR+AH+ Q LLEE NRNRYIQVIQ++PEVE+ FTLL
Sbjct  303   LMEDIRVLCGEANLTSGMPLAKLLPRIAHMDQILLEESNRNRYIQVIQDIPEVEIFFTLL  362

Query  1354  YSSTP  1368
             Y+S+P
Sbjct  363   YASSP  367



>ref|XP_009791935.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Nicotiana 
sylvestris]
Length=369

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/365 (71%), Positives = 307/365 (84%), Gaps = 0/365 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FW RHK+KVYVTLGVLGSG+ LYKLYD HRR++F+LE+EL    +++ELIK+Q+K HFE
Sbjct  3     EFWGRHKRKVYVTLGVLGSGYFLYKLYDAHRRKLFDLERELADQRRSEELIKSQVKSHFE  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IADSTTLPHVM+ LSS+I EELDL  LTE+LMKGKD PN+LTAAEKLELWDRLKIL
Sbjct  63    NIQRIADSTTLPHVMRCLSSQIEEELDLTHLTERLMKGKDLPNSLTAAEKLELWDRLKIL  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRM LSLW+ T L+LYIRVQVNILGRHLYIDTAR +GSS Q +E D+I R+DQ+ FLA
Sbjct  123   SFTRMGLSLWATTLLSLYIRVQVNILGRHLYIDTARGIGSSGQFDEVDLIDRNDQRRFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL  +GL TLIS FEAA SEVLK KQLKD F+TT+LHDT++QIL+ FMS  SPH WL
Sbjct  183   SADYLTTFGLPTLISSFEAANSEVLKRKQLKDFFNTTVLHDTIIQILNTFMSTASPHQWL  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              + MPED K  ++   SS+ +TDL  AS FEQLM ET+AVLSSAEFGN+V++SLK  VD 
Sbjct  243   GFFMPEDSKQNNVDVSSSTGSTDLSNASKFEQLMLETQAVLSSAEFGNIVNISLKAAVDV  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++EDIRV CGE NL  GMPLAKLLPR+AH+ Q LLEEPNRNRYIQVIQ++ +VE+ FTLL
Sbjct  303   LMEDIRVLCGEANLTSGMPLAKLLPRIAHMDQILLEEPNRNRYIQVIQDIQDVEIFFTLL  362

Query  1354  YSSTP  1368
             Y+S+P
Sbjct  363   YASSP  367



>ref|XP_006341556.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Solanum tuberosum]
Length=369

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/366 (71%), Positives = 316/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FWRRHK+KVYVT GVLGSG+LLYKLY+GH+RR+ +LE+EL  + +N+ELI++Q+KEHF 
Sbjct  3     EFWRRHKRKVYVTFGVLGSGYLLYKLYEGHKRRLSDLERELADERRNEELIRSQIKEHFG  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
              IQ IADSTTLPHVM++LSSRI  +LDL  L E+LMKGKD+PN+LTAAEKLELWDRLKIL
Sbjct  63    KIQTIADSTTLPHVMRHLSSRIEGDLDLTHLMERLMKGKDEPNSLTAAEKLELWDRLKIL  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             +FTR+VLSLW+ T ++LYIRVQVNILGRHLYIDTAR LGSS Q +EAD+I RDD+Q FLA
Sbjct  123   NFTRIVLSLWATTMVSLYIRVQVNILGRHLYIDTARGLGSSIQLDEADLIDRDDEQQFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL N GL  LIS FE ATSEVLKGKQLKD F+TT+LHDT++QIL  F+SMGSPHHW+
Sbjct  183   SADYLTNVGLPALISCFETATSEVLKGKQLKDFFNTTVLHDTILQILATFLSMGSPHHWM  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              +LMPE  K+Y+ AA SSSD+T+   AS FEQLM E +AVLSS+EF N++D+SLKT VD 
Sbjct  243   GFLMPEPSKLYNSAATSSSDSTEPSPASKFEQLMLEAQAVLSSSEFENILDMSLKTAVDV  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             M+EDI+V CGETNL +G+PLAKLLPRLAH+   LLEEPNR+RYIQ++Q++PEVE+ FTLL
Sbjct  303   MMEDIKVLCGETNLKLGIPLAKLLPRLAHMSHILLEEPNRDRYIQIVQSMPEVEMFFTLL  362

Query  1354  YSSTPV  1371
             Y+STP 
Sbjct  363   YASTPA  368



>ref|XP_006353815.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Solanum tuberosum]
Length=369

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/364 (70%), Positives = 304/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FW R+++K YVTLGVLGSG+  YKLYD HRR++ +L  ELE + ++DELIK Q+K HFE
Sbjct  3     EFWIRYRRKAYVTLGVLGSGYFFYKLYDTHRRKLSDLHTELEQERRSDELIKFQVKAHFE  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             N+Q IADSTTLPHV++ L S+I +ELDL  LTE+LMKGKD PN+LTAA+KLELWDRLKI+
Sbjct  63    NVQRIADSTTLPHVVRCLRSQIEKELDLTHLTERLMKGKDLPNSLTAAQKLELWDRLKII  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW+ T L+LYIRVQVNILGRHLYIDTAR +G S Q +E D+I R+DQQ FLA
Sbjct  123   SFTRMVLSLWAATLLSLYIRVQVNILGRHLYIDTARGIGGSGQFDEIDLIDRNDQQQFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL ++GL TLIS FE ATSEVLKGKQLKD F++T+LHDTV+QIL+ FMS GSPHHWL
Sbjct  183   SADYLTSFGLPTLISSFEGATSEVLKGKQLKDFFNSTVLHDTVIQILNTFMSTGSPHHWL  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              +LMPED K  +L   SS+ +TDL  AS FEQLM ETRAVLSS EF N+VD+ LK  VDA
Sbjct  243   SFLMPEDSKRNNLGVSSSTGSTDLSNASKFEQLMLETRAVLSSTEFRNIVDILLKAAVDA  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++EDI V CG+ NL  GMPLAKLLPR+AH+ Q LLEEPNRNRYIQVIQ++PE+E+ FTLL
Sbjct  303   LMEDISVLCGDANLTSGMPLAKLLPRIAHMDQILLEEPNRNRYIQVIQDIPEIEIFFTLL  362

Query  1354  YSST  1365
             Y+ST
Sbjct  363   YAST  366



>ref|XP_009600163.1| PREDICTED: peroxisome biogenesis protein 3-2 [Nicotiana tomentosiformis]
Length=369

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/366 (72%), Positives = 314/366 (86%), Gaps = 0/366 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FWRRHK+KVYVTLGV+GSG+LLYKLYDGHRRR+ +LE+EL  + +N+ELI++Q+K HFE
Sbjct  3     EFWRRHKRKVYVTLGVVGSGYLLYKLYDGHRRRLSDLERELADERRNEELIRSQVKAHFE  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IA+STTLPHVM+ L SRI EELDL  LTE+LMKGK QPNTLTAAEKLELW+RLKIL
Sbjct  63    NIQGIANSTTLPHVMRNLRSRIEEELDLALLTERLMKGKYQPNTLTAAEKLELWERLKIL  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             +FTR+VLSLW+ T L+LYIRVQVNILGRHLYIDTA  LG+S Q +EAD+I RDD+Q FLA
Sbjct  123   TFTRIVLSLWATTVLSLYIRVQVNILGRHLYIDTAHGLGTSCQLDEADLIDRDDEQQFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL N GL  LIS FE A SEVLKGKQLKD F+TT+LHDTV++ILD FMSMGSPHHWL
Sbjct  183   SADYLINVGLPALISSFETAASEVLKGKQLKDFFNTTLLHDTVLRILDTFMSMGSPHHWL  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              +LMPE  K+Y+ AA SSS NT+   +S FEQLM E +AVLSS+EF N++D+SLKT VD 
Sbjct  243   GFLMPEHFKLYNSAATSSSSNTEPSPSSKFEQLMLEAQAVLSSSEFENILDLSLKTAVDV  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             M+ED+ V CGETNL +G+PLAKLLPRLAH+ + LLEE NRNRYIQV+Q++PEVE+ FTLL
Sbjct  303   MMEDVTVLCGETNLKLGIPLAKLLPRLAHMSRILLEESNRNRYIQVVQDMPEVEMFFTLL  362

Query  1354  YSSTPV  1371
             Y+STP 
Sbjct  363   YASTPA  368



>ref|XP_004252269.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Solanum lycopersicum]
Length=369

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/364 (69%), Positives = 304/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FWRR+++K YVTLGVLGSG+ LYKLYD HRR++ +L  ELE + ++DELIK  +K HFE
Sbjct  3     EFWRRYRRKAYVTLGVLGSGYFLYKLYDRHRRKLSDLHTELEQERRSDELIKFLVKAHFE  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             N+Q IADSTTLPHV++ L S+I  +LDL  LTE+LMKGKD PN+LTAA+KLELWDRLKIL
Sbjct  63    NVQRIADSTTLPHVVRCLRSQIETKLDLTHLTERLMKGKDLPNSLTAAQKLELWDRLKIL  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW+ T L+LYIRVQVNILGRH+YIDTAR +G   Q +E D+I R+DQQ FLA
Sbjct  123   SFTRMVLSLWAATLLSLYIRVQVNILGRHIYIDTARGIGGYGQFDEVDLIDRNDQQQFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             SADYL+++GL TLIS FE ATSEVL+GKQLKD F+TT+LHD+V+QIL+ FMSMGSPHHWL
Sbjct  183   SADYLSSFGLPTLISSFEGATSEVLEGKQLKDFFNTTVLHDSVIQILNTFMSMGSPHHWL  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              +LMPED K  +L   SS+ +TDLC AS FEQLM ETRAV SS EF N+VD+ LK  VD 
Sbjct  243   SFLMPEDSKPNNLGVTSSTGSTDLCNASKFEQLMLETRAVFSSTEFRNIVDILLKAAVDV  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++EDI V CG+ NL  GMPLAKLLPR+AH+ Q LLEEPNRNRYIQVIQ++PE+E+ FTLL
Sbjct  303   LMEDISVLCGDANLTSGMPLAKLLPRIAHMDQILLEEPNRNRYIQVIQDIPEIEIFFTLL  362

Query  1354  YSST  1365
             Y+ST
Sbjct  363   YAST  366



>emb|CDO98382.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/364 (70%), Positives = 304/364 (84%), Gaps = 7/364 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRHK+KVY+TLGVLGSG+ LYKLYD H RRI +LE+EL  + +NDEL+KAQM+EHFEN
Sbjct  12    FWRRHKRKVYITLGVLGSGYFLYKLYDAHSRRISDLERELATERENDELVKAQMQEHFEN  71

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q IADSTTLPHVMQYLS+R++EELDL  LTE+LM+GK QPNTLTAAEKLELWDRLKILS
Sbjct  72    VQRIADSTTLPHVMQYLSTRVAEELDLAPLTERLMRGKGQPNTLTAAEKLELWDRLKILS  131

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMVLS+W+MTTLNL+IRVQVNILGRHLYI+TAR LG+S+  +EAD+I RDD+Q FLA 
Sbjct  132   FTRMVLSVWAMTTLNLFIRVQVNILGRHLYINTARGLGNSHLLDEADLIDRDDEQQFLAI  191

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L+NY + TLI+  EAATSEVLKGKQLKD F++++L +T+V+ILD FMS G+P  WL 
Sbjct  192   ADFLSNYEIPTLIASIEAATSEVLKGKQLKDYFNSSVLRETIVRILDTFMSKGNPRQWLG  251

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             YL+PED +IY L  PS S N     AS FEQL +ETRAVLSSAEFGN++D+SLK  VDA+
Sbjct  252   YLIPEDNRIYKLVEPSGSGNEVHSHASKFEQLTEETRAVLSSAEFGNILDISLKVAVDAI  311

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
              E+I +Q         +PLAKLLPR+A +GQ LLEEPNR RYIQ+I+N PEVEL FT+LY
Sbjct  312   AEEIDMQS-------AIPLAKLLPRIAQMGQILLEEPNRQRYIQIIRNTPEVELFFTVLY  364

Query  1357  SSTP  1368
             SS P
Sbjct  365   SSMP  368



>ref|XP_011084479.1| PREDICTED: peroxisome biogenesis protein 3-2 [Sesamum indicum]
Length=369

 Score =   511 bits (1317),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 244/366 (67%), Positives = 301/366 (82%), Gaps = 0/366 (0%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FWRRHK+KVYVTLGV GSG+LLYKLYD  RRR+ +L+K+L  + +N+ELIKAQ++ HFE
Sbjct  3     EFWRRHKRKVYVTLGVFGSGYLLYKLYDARRRRLSDLKKQLADERQNEELIKAQIQAHFE  62

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             ++Q IADSTTLPHVM +L SR++E LDL  LTE+L++GK QPNTLT AEKLELWDRLKIL
Sbjct  63    SVQRIADSTTLPHVMHFLESRLAENLDLTHLTERLVQGKGQPNTLTMAEKLELWDRLKIL  122

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFT+MV SLW+M  L+LYIRVQVNILGRHLYIDTAR LGSS+  +EA++I ++D+Q FLA
Sbjct  123   SFTKMVSSLWAMNMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDEAELIDKNDEQQFLA  182

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
              ADYL+NYGL  LI++ EAAT EVLKGKQLKD F+  +LHDT++ IL+  M MGSPHHW+
Sbjct  183   CADYLSNYGLLALINNTEAATMEVLKGKQLKDFFNVAVLHDTIINILENLMIMGSPHHWV  242

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLMPED  +Y   A SSS  +DL  A+ FE LM ETRAVLSSAEF N+VD+SL+ +V+ 
Sbjct  243   GYLMPEDAGVYKFVAASSSSGSDLSNATKFELLMGETRAVLSSAEFSNIVDISLRRLVNG  302

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++ED+ + CGE NL  GMPLA+LLPR+AH+GQ LL E NRNRYIQ+I+ +PEVEL FTLL
Sbjct  303   VLEDLSIHCGENNLATGMPLARLLPRIAHMGQLLLTESNRNRYIQIIRGMPEVELFFTLL  362

Query  1354  YSSTPV  1371
             YSS P 
Sbjct  363   YSSMPA  368



>gb|KHG12837.1| Peroxisome biogenesis 3-2 -like protein [Gossypium arboreum]
Length=371

 Score =   497 bits (1280),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 238/362 (66%), Positives = 298/362 (82%), Gaps = 1/362 (0%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
              WRRH++KV VT GVLGSG+LLYKLYD H+RR+ +LE++L  + +NDE IKAQM+ HFEN
Sbjct  7     LWRRHRRKVLVTAGVLGSGYLLYKLYDAHKRRLIDLERQLANERENDEFIKAQMQLHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IAD+TTLPH M YLS RI+E+L+L  L E+L+KGKDQPN+L+++EKLELWDRLKILS
Sbjct  67    IQRIADTTTLPHAMPYLSCRIAEDLNLSHLMERLVKGKDQPNSLSSSEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMV+S+W++T L+LYIRVQVNILGRHLYIDTAR LGSSY  EEAD+I RDDQQ FLAS
Sbjct  127   FTRMVVSIWAVTILSLYIRVQVNILGRHLYIDTARGLGSSYLLEEADLIDRDDQQKFLAS  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LAN+GL  LIS  + A +EVLK KQL+D F+T ILH+T++QILD F+SMGSPHHW+ 
Sbjct  187   ADFLANHGLPKLISSMQTAATEVLKAKQLRDFFNTAILHETIMQILDVFLSMGSPHHWVD  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
              LMPEDP++Y LA  +SSD T+    + F+QLM ETR VLSSAEF NVV++SLK V  A+
Sbjct  247   CLMPEDPRLYKLAK-TSSDETNPPEFTKFDQLMVETREVLSSAEFSNVVELSLKAVAKAL  305

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             VE+   Q G  NL  GMPLA+LLPR+A +   L+EEP++N++IQ+IQ++PEV L FTLLY
Sbjct  306   VEEKGFQSGGGNLTNGMPLARLLPRIAQICPTLVEEPSKNQFIQIIQSVPEVGLFFTLLY  365

Query  1357  SS  1362
             S+
Sbjct  366   SN  367



>ref|XP_002281306.1| PREDICTED: peroxisome biogenesis protein 3-2 [Vitis vinifera]
 emb|CBI15539.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 242/370 (65%), Positives = 299/370 (81%), Gaps = 1/370 (0%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWRRH++K++V++GV GSG+LLYKLYD HRRR+ +LE+EL    +N+ELIKAQM+ H
Sbjct  4     VRDFWRRHRRKIFVSVGVFGSGYLLYKLYDAHRRRLDDLERELAVQRENEELIKAQMQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+IQ IAD+TTLPH M YLS RI+EELDL  LTE+LMKGK QPNTLT +EKLELWDRLK
Sbjct  64    FESIQRIADTTTLPHSMLYLSGRIAEELDLSHLTERLMKGKGQPNTLTPSEKLELWDRLK  123

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR  GSS+  EEAD I R DQQ F
Sbjct  124   ILSFTRMVLSLWAMTMLSLYIRVQVNILGRHLYIDTARGGGSSHLLEEADPIDRHDQQKF  183

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             LASAD+L+NY +  LIS+  AA +EVLKGKQL+DVF++ +LH T++QILD F+S G PH+
Sbjct  184   LASADFLSNYSIPALISNMHAAAAEVLKGKQLRDVFNSMVLHGTIMQILDLFISTGKPHN  243

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
              + YLMP+D K Y  A+PS+ D++     + F+QLM ETRAVLSSAEF NV+DVSL+TVV
Sbjct  244   LVDYLMPDDTKSYKPASPSNGDSSTPADVTKFDQLMVETRAVLSSAEFINVIDVSLRTVV  303

Query  1168  DAMVED-IRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             DA+VED + VQ G  +   GM LAKLLPR+A +G  LLEEP++NR+IQ+IQ  PEVE  F
Sbjct  304   DAVVEDMMGVQLGGGSPSSGMVLAKLLPRVAQMGPLLLEEPSKNRFIQIIQKAPEVEFFF  363

Query  1345  TLLYSSTPVV  1374
             TLLY++ P +
Sbjct  364   TLLYANMPTL  373



>ref|XP_007036704.1| Peroxin 3 isoform 1 [Theobroma cacao]
 ref|XP_007036705.1| Peroxin 3 isoform 1 [Theobroma cacao]
 gb|EOY21205.1| Peroxin 3 isoform 1 [Theobroma cacao]
 gb|EOY21206.1| Peroxin 3 isoform 1 [Theobroma cacao]
Length=372

 Score =   487 bits (1253),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/362 (64%), Positives = 295/362 (81%), Gaps = 0/362 (0%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
              WRRHK+KV VT GVLGSG+ LYKLYD HR R+ +LE++L ++ +NDE IKAQM+ HFEN
Sbjct  7     LWRRHKRKVLVTAGVLGSGYFLYKLYDAHRHRLADLERQLASERENDEFIKAQMQVHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IAD+TTLPH M YLS RI+E+LDL  LT +LM+GK QPNTL+++EKL+LWDRLKILS
Sbjct  67    IQRIADTTTLPHAMHYLSCRIAEDLDLSHLTNRLMRGKGQPNTLSSSEKLQLWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMV+S+W++T L+LYIRVQVNILGRHLYI TAR LGSS   E+A++I RDDQQ FLA+
Sbjct  127   FTRMVVSIWAVTLLSLYIRVQVNILGRHLYIATARGLGSSNLLEDAELIDRDDQQKFLAN  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LAN+GL+TLIS  + A +EVLK KQL+D F TT+L   ++QILD FMSMGSPHHW+ 
Sbjct  187   ADFLANHGLSTLISHMQTAATEVLKAKQLRDFFDTTVLQQIIMQILDMFMSMGSPHHWVD  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
              LMPEDP++Y  A  SSSD T+    + F QLM ETR VLSSAEF +VV++SLK VV+A+
Sbjct  247   CLMPEDPRLYKFAMASSSDKTNPPDFTQFNQLMVETREVLSSAEFTSVVEISLKAVVNAL  306

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             VE+   Q G ++L +GMPLA+LLPR++ +   LL+EP++N++IQ+IQ++PEV L FTLLY
Sbjct  307   VEEKGFQSGGSSLTLGMPLARLLPRISQICPSLLDEPSKNQFIQIIQSVPEVGLFFTLLY  366

Query  1357  SS  1362
             ++
Sbjct  367   AN  368



>ref|XP_007036706.1| Peroxin 3, putative isoform 3, partial [Theobroma cacao]
 ref|XP_007036707.1| Peroxin 3, putative isoform 3, partial [Theobroma cacao]
 gb|EOY21207.1| Peroxin 3, putative isoform 3, partial [Theobroma cacao]
 gb|EOY21208.1| Peroxin 3, putative isoform 3, partial [Theobroma cacao]
Length=388

 Score =   487 bits (1254),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/361 (64%), Positives = 295/361 (82%), Gaps = 0/361 (0%)
 Frame = +1

Query  280   WRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFENI  459
             WRRHK+KV VT GVLGSG+ LYKLYD HR R+ +LE++L ++ +NDE IKAQM+ HFENI
Sbjct  24    WRRHKRKVLVTAGVLGSGYFLYKLYDAHRHRLADLERQLASERENDEFIKAQMQVHFENI  83

Query  460   QIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILSF  639
             Q IAD+TTLPH M YLS RI+E+LDL  LT +LM+GK QPNTL+++EKL+LWDRLKILSF
Sbjct  84    QRIADTTTLPHAMHYLSCRIAEDLDLSHLTNRLMRGKGQPNTLSSSEKLQLWDRLKILSF  143

Query  640   TRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLASA  819
             TRMV+S+W++T L+LYIRVQVNILGRHLYI TAR LGSS   E+A++I RDDQQ FLA+A
Sbjct  144   TRMVVSIWAVTLLSLYIRVQVNILGRHLYIATARGLGSSNLLEDAELIDRDDQQKFLANA  203

Query  820   DYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRY  999
             D+LAN+GL+TLIS  + A +EVLK KQL+D F TT+L   ++QILD FMSMGSPHHW+  
Sbjct  204   DFLANHGLSTLISHMQTAATEVLKAKQLRDFFDTTVLQQIIMQILDMFMSMGSPHHWVDC  263

Query  1000  LMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMV  1179
             LMPEDP++Y  A  SSSD T+    + F QLM ETR VLSSAEF +VV++SLK VV+A+V
Sbjct  264   LMPEDPRLYKFAMASSSDKTNPPDFTQFNQLMVETREVLSSAEFTSVVEISLKAVVNALV  323

Query  1180  EDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYS  1359
             E+   Q G ++L +GMPLA+LLPR++ +   LL+EP++N++IQ+IQ++PEV L FTLLY+
Sbjct  324   EEKGFQSGGSSLTLGMPLARLLPRISQICPSLLDEPSKNQFIQIIQSVPEVGLFFTLLYA  383

Query  1360  S  1362
             +
Sbjct  384   N  384



>ref|XP_011000480.1| PREDICTED: peroxisome biogenesis protein 3-2 [Populus euphratica]
Length=374

 Score =   471 bits (1212),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 227/365 (62%), Positives = 292/365 (80%), Gaps = 2/365 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRHK+K+ +T GVLGSG+ L KLY+ H++++ +LE+EL     NDELIKAQ+++HFEN
Sbjct  7     FWRRHKRKILITSGVLGSGYFLCKLYNAHQQKLADLERELARQRANDELIKAQLQDHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q+IAD+TTLPH MQYL +RI+EELDL QLTE+L KGKDQP TLT++EKLELWDRLKILS
Sbjct  67    VQLIADTTTLPHAMQYLRTRIAEELDLSQLTERLQKGKDQPTTLTSSEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT+M++SLW++T L+LYI+VQVNILGRHLYIDTAR LGSS   E  D++ RDDQQ FLAS
Sbjct  127   FTQMLVSLWAVTMLSLYIKVQVNILGRHLYIDTARGLGSSLLLENVDLVDRDDQQNFLAS  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LAN GL  LI + +A  +EVL+GK+L D+F+TT LH+TV+QIL++FMSMGSPH W+ 
Sbjct  187   ADFLANNGLLALIPNIQAVVTEVLEGKKLTDLFNTTSLHETVMQILNKFMSMGSPHQWID  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             YLMPED   Y L   SS D+  L  + NF+QLM E RAVLSSAEFG ++++SLK  VDA+
Sbjct  247   YLMPEDCGHYKLGPSSSIDDMILPDSMNFDQLMVEARAVLSSAEFGKIMEISLKVAVDAL  306

Query  1177  VEDIRVQCGET--NLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTL  1350
             V+D+  Q   T  +L +GMPLAKLL R+  +   LL E ++N+ IQ+I+NLPEVEL FTL
Sbjct  307   VDDMEAQSQSTGASLTLGMPLAKLLSRVLQIIPSLLGEASQNQIIQIIRNLPEVELFFTL  366

Query  1351  LYSST  1365
             LY++ 
Sbjct  367   LYANN  371



>ref|XP_008364649.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Malus domestica]
Length=368

 Score =   469 bits (1207),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/366 (64%), Positives = 289/366 (79%), Gaps = 6/366 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADM-KNDELIKAQMKEHFE  453
             FWRRHK+KV V  GVLGSG+LLYKLY+ HR+R+ +LE ELE +  KNDELIKAQM+ HFE
Sbjct  7     FWRRHKRKVLVATGVLGSGYLLYKLYNAHRQRLXDLETELEHEREKNDELIKAQMQAHFE  66

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IAD+TTLPH M YLSSRI+EELDL  LTE+LM+ K QP   T+ EKLELWDRLKIL
Sbjct  67    NIQRIADTTTLPHAMYYLSSRIAEELDLSHLTERLMQVKGQP---TSQEKLELWDRLKIL  123

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW+MT LNLYIRVQVNILGRHLYIDTAR LGSS   E+AD+I+RDDQQ FLA
Sbjct  124   SFTRMVLSLWAMTILNLYIRVQVNILGRHLYIDTARGLGSSLLIEDADLIHRDDQQKFLA  183

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S+DYLA+  L  LIS+ +AA +EVL GKQLKD F+TT+LH T+++IL++FMS G PHHW+
Sbjct  184   SSDYLASNALPALISNIQAAATEVLNGKQLKDSFNTTVLHATIMEILEKFMSTGDPHHWV  243

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLMPED + + LA   S+DN  L   + F+QLM ETRAV+SSAEF +V D +L+ VVD 
Sbjct  244   NYLMPEDARWHELATAFSNDNIPLPDVTKFDQLMLETRAVISSAEFRSVADTALRAVVDT  303

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++ED+  Q G  +L  G+ LAK+L R+A  G  +LEE   +++IQ+I N+P+VEL FTL+
Sbjct  304   VIEDMNAQPGGGSLKSGIQLAKVLARVAQTGPSVLEES--SKFIQIILNVPQVELFFTLI  361

Query  1354  YSSTPV  1371
             YS+  +
Sbjct  362   YSNMKI  367



>ref|XP_002317886.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE96106.1| phosphatase 2C family protein [Populus trichocarpa]
Length=374

 Score =   469 bits (1206),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 288/367 (78%), Gaps = 2/367 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH+ K+ +T GVLGSG+ LY+LY+ H +R+ +LE+EL     NDELIKAQ++ HFEN
Sbjct  7     FWRRHRSKILITAGVLGSGYFLYRLYNAHEQRLADLERELARQRANDELIKAQLQAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q+IAD+TTLPH MQYL SRI+EELDL QLTE+L KGK +P TLT++EKLELWDRLKILS
Sbjct  67    VQLIADTTTLPHAMQYLRSRIAEELDLSQLTERLQKGKGKPYTLTSSEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT+MV+SLW++T L+LYI+VQVNILGRHLYIDTAR LGSS   E  D+I RDDQQ FLA 
Sbjct  127   FTQMVVSLWAVTILSLYIKVQVNILGRHLYIDTARGLGSSLLLENVDLIDRDDQQNFLAG  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LAN GL  LIS+ +A  +EV++GK+L D+F+TT  H+TV+QILD+FMS+GS H W+ 
Sbjct  187   ADFLANNGLLALISNIQAVVTEVIEGKKLIDLFNTTSFHETVMQILDKFMSVGSLHQWID  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             YLMPED   Y L   SS D+T L  ++NF+QLM E R VLSSAEFG ++ +SLK  VDA+
Sbjct  247   YLMPEDSGHYKLGTSSSIDDTVLPNSTNFDQLMVEARTVLSSAEFGKIMGISLKVAVDAL  306

Query  1177  VEDIRVQCGET--NLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTL  1350
             VED+  QC  T  +L  GMPLAKLL R+  +   LL E ++N++I++I+ +PEVEL FTL
Sbjct  307   VEDMEAQCQSTGASLTSGMPLAKLLSRVMQMVPSLLREASQNQFIKIIRTVPEVELFFTL  366

Query  1351  LYSSTPV  1371
             LY++  V
Sbjct  367   LYANNLV  373



>ref|XP_002322084.2| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEF06211.2| phosphatase 2C family protein [Populus trichocarpa]
Length=374

 Score =   467 bits (1202),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 225/364 (62%), Positives = 291/364 (80%), Gaps = 2/364 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRHK+K+ +T GVLGSG+ L KLY+ H++++ +LE+EL     NDELIKAQ+++HFEN
Sbjct  7     FWRRHKRKILITSGVLGSGYFLCKLYNAHQQKLADLERELARQRANDELIKAQLQDHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q+IAD+TTLPH MQYL +RI+EELDL QLTE+L KGK QP TLT++EKLELWDRLKILS
Sbjct  67    VQLIADTTTLPHAMQYLRTRIAEELDLSQLTERLQKGKGQPTTLTSSEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT+M++SLW++T L+LYI+VQVNILGRHLYIDTAR LGSS   E  D++ RDDQQ FLAS
Sbjct  127   FTQMLVSLWAVTMLSLYIKVQVNILGRHLYIDTARGLGSSLLLENVDLVDRDDQQKFLAS  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LAN GL  LIS+ +A  +EVL+GK+L D+F+TT LH+TV+QIL++FMSMGSPH W+ 
Sbjct  187   ADFLANNGLLALISNIQAVVTEVLEGKKLTDLFNTTSLHETVMQILNKFMSMGSPHQWID  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             YLM ED   Y L   SS D+  L  + NF+QLM E RAVLSSAEFG ++++SLK  VDA+
Sbjct  247   YLMAEDCGHYKLGPSSSIDDMILPDSMNFDQLMVEARAVLSSAEFGKIMEISLKVAVDAL  306

Query  1177  VEDIRVQCGET--NLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTL  1350
             V+D+  Q   T  +L +GMPLAKLL R+  +   LL E ++N+ IQ+I+N+PEVEL FTL
Sbjct  307   VDDMEAQSQSTGASLTLGMPLAKLLSRVLQIVPSLLGEASQNQIIQIIRNVPEVELFFTL  366

Query  1351  LYSS  1362
             LY++
Sbjct  367   LYAN  370



>ref|XP_010032548.1| PREDICTED: peroxisome biogenesis protein 3-2 [Eucalyptus grandis]
 gb|KCW83971.1| hypothetical protein EUGRSUZ_B00855 [Eucalyptus grandis]
Length=370

 Score =   467 bits (1201),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 218/368 (59%), Positives = 293/368 (80%), Gaps = 0/368 (0%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             MI  FWRRH++K+    G+LGSG+LLYKLYDG ++++ +LEK L  + +N+EL+KA M+ 
Sbjct  1     MIRDFWRRHRRKILFGAGILGSGYLLYKLYDGRKKQLLDLEKVLAGERENEELVKAHMQT  60

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HFE+IQ IA++ T+PH M Y+SSRI+EELDL  LTE+LM+GK QPNTLT+AEKLELWD+L
Sbjct  61    HFESIQGIANTATMPHAMHYVSSRIAEELDLTHLTERLMRGKGQPNTLTSAEKLELWDQL  120

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRM++SLW+MT L+LYIRVQVNILGRHLYIDTAR LGS    ++AD+I  +DQQ 
Sbjct  121   KILSFTRMLVSLWAMTLLSLYIRVQVNILGRHLYIDTARGLGSPQLLDDADLIDMEDQQK  180

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FLASAD+L+N+GL  LI + +AA +EVLKGKQL+D F    LH+T++QILD FM MG+P 
Sbjct  181   FLASADFLSNHGLAALIYNMQAAAAEVLKGKQLRDFFDNAALHETILQILDTFMIMGTPL  240

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
              W+ YLMPED +++ ++  S +++T +   + F+QLM E R V+SSAEFG VVDVSLK V
Sbjct  241   QWVGYLMPEDARLHKISNTSGNEDTIVPDFTKFDQLMVEARTVISSAEFGGVVDVSLKMV  300

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             V A+VE+  +Q G ++   G+PLAKL+PR+A +G  LLEE ++NR+IQ+I++ P+VEL F
Sbjct  301   VHALVEEFGLQAGGSSAASGIPLAKLVPRVAQMGPLLLEEASKNRFIQIIRDSPDVELFF  360

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  361   TLLYTNMP  368



>ref|XP_006451673.1| hypothetical protein CICLE_v10008707mg [Citrus clementina]
 gb|ESR64913.1| hypothetical protein CICLE_v10008707mg [Citrus clementina]
Length=367

 Score =   464 bits (1195),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 220/362 (61%), Positives = 292/362 (81%), Gaps = 5/362 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+++T GVLG G+LLYKLYD  +RRI +L+++     ++DEL+KAQM+ H+E 
Sbjct  7     FWRRHRRKIFITTGVLGGGYLLYKLYDS-QRRIADLDRQ---QCEHDELLKAQMQAHYEE  62

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q IAD+TTLPH M YLS RI+EELDL  LT+KL++GK+QP TL+++EKLELWDRLKILS
Sbjct  63    VQRIADATTLPHAMHYLSIRIAEELDLSPLTDKLLRGKEQPYTLSSSEKLELWDRLKILS  122

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT++V++LW++T ++LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I RDDQQ FLAS
Sbjct  123   FTKLVVALWAVTMVSLYIRVQVNILGRHLYIDTARGLGSSDLPEDADLIDRDDQQKFLAS  182

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
              DYLANYG+  +IS+ +AA  E LKGKQL+D+F+T +LH+T +QIL+ FMSMGSPH W+ 
Sbjct  183   VDYLANYGMQAMISNVQAAADEALKGKQLRDIFNTAVLHETFMQILEVFMSMGSPHQWVD  242

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             +LMP+D + Y L   S  D T L  A+ F++LM ETRAVLSSAE+ +VVD+S K  VDA+
Sbjct  243   FLMPQDIRFYKLVTASGHDETTLSGATKFDELMVETRAVLSSAEYTSVVDMSFKAAVDAL  302

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             ++++RVQ G  +L+ GMPLAKL+PR+  +   LL EP+ NR IQVI+ +PEVEL FTLLY
Sbjct  303   IDEMRVQSG-GSLISGMPLAKLVPRVVQMSPSLLAEPSNNRIIQVIRTIPEVELFFTLLY  361

Query  1357  SS  1362
             ++
Sbjct  362   AN  363



>ref|XP_006490732.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X1 
[Citrus sinensis]
 ref|XP_006490733.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X2 
[Citrus sinensis]
 ref|XP_006490734.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X3 
[Citrus sinensis]
 gb|KDO62867.1| hypothetical protein CISIN_1g017709mg [Citrus sinensis]
Length=367

 Score =   464 bits (1195),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 220/362 (61%), Positives = 292/362 (81%), Gaps = 5/362 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+++T GVLG G+LLYKLYD  +RRI +L+++     ++DEL+KAQM+ H+E 
Sbjct  7     FWRRHRRKIFITTGVLGGGYLLYKLYDS-QRRIADLDRQ---QCEHDELLKAQMQAHYEE  62

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q IAD+TTLPH M YLS RI+EELDL  LT+KL++GK+QP TL+++EKLELWDRLKILS
Sbjct  63    VQRIADATTLPHAMHYLSIRIAEELDLSPLTDKLLRGKEQPYTLSSSEKLELWDRLKILS  122

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT++V++LW++T ++LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I RDDQQ FLAS
Sbjct  123   FTKLVVALWAVTMVSLYIRVQVNILGRHLYIDTARGLGSSDLPEDADLIDRDDQQKFLAS  182

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
              DYLANYG+  +IS+ +AA  E LKGKQL+D+F+T +LH+T +QIL+ FMSMGSPH W+ 
Sbjct  183   VDYLANYGMQAMISNVQAAADEALKGKQLRDIFNTVVLHETFMQILEVFMSMGSPHQWVD  242

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             +LMP+D + Y L   S  D T L  A+ F++LM ETRAVLSSAE+ +VVD+S K  VDA+
Sbjct  243   FLMPQDIRFYKLVTASGHDETTLSGATKFDELMVETRAVLSSAEYTSVVDMSFKAAVDAL  302

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             ++++RVQ G  +L+ GMPLAKL+PR+  +   LL EP+ NR IQVI+ +PEVEL FTLLY
Sbjct  303   IDEMRVQSG-GSLISGMPLAKLVPRVVQMSPSLLAEPSNNRIIQVIRTIPEVELFFTLLY  361

Query  1357  SS  1362
             ++
Sbjct  362   AN  363



>ref|XP_009347780.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Pyrus x bretschneideri]
Length=368

 Score =   462 bits (1188),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 229/366 (63%), Positives = 287/366 (78%), Gaps = 6/366 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADM-KNDELIKAQMKEHFE  453
             FWRRH++KV V  GVLGSG+ LYKLY+ HR+R+ +LE ELE    KNDELIKAQM+ HFE
Sbjct  7     FWRRHRRKVLVATGVLGSGYFLYKLYNAHRQRLADLETELEHKREKNDELIKAQMQAHFE  66

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IAD+TTLPH M YLSSRI+EELDL  LTE+LM+ K QP   T+ EKLELWDRLKIL
Sbjct  67    NIQRIADTTTLPHAMYYLSSRIAEELDLSHLTERLMQVKGQP---TSQEKLELWDRLKIL  123

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I+RDDQQ FLA
Sbjct  124   SFTRMVLSLWAMTILSLYIRVQVNILGRHLYIDTARGLGSSLLIEDADLIHRDDQQKFLA  183

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S+DYLA+  L  LIS+ +AA +EVL GKQLKD F+TT+LH T+++IL++FMS G PHHW+
Sbjct  184   SSDYLASNALPALISNIQAAATEVLNGKQLKDSFNTTVLHATIMEILEKFMSTGDPHHWV  243

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLMPED + + LA   S+DN  L   + F+QLM ETRAV+SSAEF +V + +L+ VVD 
Sbjct  244   NYLMPEDARWHELATAFSNDNVPLPDVTKFDQLMLETRAVISSAEFRSVAETALRAVVDT  303

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++ED+  Q G  +L  G+ LAK+L R+A  G  +LEE   +++IQ+I N+P+VEL FTL+
Sbjct  304   VIEDMNAQPGGGSLKSGIQLAKVLARVAQTGPSVLEES--SKFIQIILNVPQVELFFTLI  361

Query  1354  YSSTPV  1371
             YS+  +
Sbjct  362   YSNMKI  367



>ref|XP_008240185.1| PREDICTED: peroxisome biogenesis protein 3-1 [Prunus mume]
Length=358

 Score =   460 bits (1183),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 230/366 (63%), Positives = 290/366 (79%), Gaps = 16/366 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADM-KNDELIKAQMKEHFE  453
             FWRRH++K+YVT GVLGSG+LLYKLY+ HR+R+ +L+ ELE +  +N+ELIKAQM+ HFE
Sbjct  7     FWRRHRRKLYVTAGVLGSGYLLYKLYNAHRQRLADLDTELEHERDRNEELIKAQMQAHFE  66

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IAD+TTLPH + YL+SRI+EELDL  LT+KLM+ K Q    T+AEKLELWDRLKIL
Sbjct  67    NIQRIADTTTLPHAIHYLNSRIAEELDLSHLTDKLMQAKGQS---TSAEKLELWDRLKIL  123

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I+RDDQQ FLA
Sbjct  124   SFTRMVLSLWAMTILSLYIRVQVNILGRHLYIDTARGLGSSLLIEDADLIHRDDQQKFLA  183

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S+DYL+  G+  LIS+ +AA +EVLKGKQL+D F+ T+LH T++QILD+FMS G PHHW+
Sbjct  184   SSDYLSRSGMPALISNIQAAATEVLKGKQLRDSFNATVLHATIMQILDKFMSTGDPHHWV  243

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLMPE      LA   S+DNT L   + FEQLM ETRAV+SSAEFG+V D++L+ VVD 
Sbjct  244   NYLMPE----LELATAFSNDNTLLPDVNKFEQLMAETRAVISSAEFGSVADIALRAVVDT  299

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++ED+ VQ G      G+ LAK+L R+A +G  +LEE   +++IQ+I N+PEVE  FTL+
Sbjct  300   VIEDMGVQPG------GVQLAKVLARVARMGPTVLEES--SKFIQIILNVPEVERFFTLI  351

Query  1354  YSSTPV  1371
             YSS  +
Sbjct  352   YSSMQI  357



>ref|XP_011039100.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X1 
[Populus euphratica]
Length=374

 Score =   461 bits (1185),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 286/367 (78%), Gaps = 2/367 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH+ K+ +T GVLGSG+ LY+LY+ H +R+ ++E+EL     NDE+IKAQ++ H EN
Sbjct  7     FWRRHRSKILITAGVLGSGYFLYRLYNAHEQRLADMERELARQRANDEVIKAQLQAHIEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q+IAD+TTLPH MQYL SRI+EELDL QLTE+L KGK +P TLT++EKLELWDRLKILS
Sbjct  67    VQLIADTTTLPHAMQYLRSRIAEELDLSQLTERLQKGKGKPYTLTSSEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT+MV+SLW++T L+LYI+VQVNILGRH+YIDTAR LGSS   E  D+I RDDQQ FL S
Sbjct  127   FTQMVVSLWAVTILSLYIKVQVNILGRHMYIDTARGLGSSLLLENVDLIDRDDQQKFLVS  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LAN GL  LIS+ +A  +EV++GK+L D+F+TT  H+TV+QILD+FMS+GS   W+ 
Sbjct  187   ADFLANNGLPALISNIQAVVTEVIEGKKLIDLFNTTSFHETVMQILDKFMSVGSLRQWID  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             YLMPED   Y L   SSSD+  L  ++NF+QLM E R VLSSAEFG ++ +SLK  VDA+
Sbjct  247   YLMPEDSGHYKLGTSSSSDDMILPNSTNFDQLMVEARTVLSSAEFGKIMGISLKVAVDAL  306

Query  1177  VEDIRVQCGET--NLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTL  1350
             VED+  +C  T  +L  GMPLAKLL R+  +   LL E ++N++IQ+I+ +PEVEL FTL
Sbjct  307   VEDMEAKCQSTGASLTSGMPLAKLLSRVMQIVPSLLREASQNQFIQIIRTVPEVELFFTL  366

Query  1351  LYSSTPV  1371
             LY++  V
Sbjct  367   LYANNLV  373



>gb|KDO62865.1| hypothetical protein CISIN_1g017709mg [Citrus sinensis]
Length=366

 Score =   459 bits (1180),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 291/362 (80%), Gaps = 6/362 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+++T GVLG G+LLYKLYD  +RRI +L+++     ++DEL+KAQM+ H+E 
Sbjct  7     FWRRHRRKIFITTGVLGGGYLLYKLYDS-QRRIADLDRQ---QCEHDELLKAQMQAHYEE  62

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q IAD+TTLPH M YLS RI+EELDL  LT+KL++GK+QP TL+++EKLELWDRLKILS
Sbjct  63    VQRIADATTLPHAMHYLSIRIAEELDLSPLTDKLLRGKEQPYTLSSSEKLELWDRLKILS  122

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT++V++LW++T ++LYIRVQVNILGRHLYIDTAR LGSS    +AD+I RDDQQ FLAS
Sbjct  123   FTKLVVALWAVTMVSLYIRVQVNILGRHLYIDTARGLGSS-DLPDADLIDRDDQQKFLAS  181

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
              DYLANYG+  +IS+ +AA  E LKGKQL+D+F+T +LH+T +QIL+ FMSMGSPH W+ 
Sbjct  182   VDYLANYGMQAMISNVQAAADEALKGKQLRDIFNTVVLHETFMQILEVFMSMGSPHQWVD  241

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             +LMP+D + Y L   S  D T L  A+ F++LM ETRAVLSSAE+ +VVD+S K  VDA+
Sbjct  242   FLMPQDIRFYKLVTASGHDETTLSGATKFDELMVETRAVLSSAEYTSVVDMSFKAAVDAL  301

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             ++++RVQ G  +L+ GMPLAKL+PR+  +   LL EP+ NR IQVI+ +PEVEL FTLLY
Sbjct  302   IDEMRVQSG-GSLISGMPLAKLVPRVVQMSPSLLAEPSNNRIIQVIRTIPEVELFFTLLY  360

Query  1357  SS  1362
             ++
Sbjct  361   AN  362



>gb|KDP37907.1| hypothetical protein JCGZ_05346 [Jatropha curcas]
Length=369

 Score =   458 bits (1179),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/366 (60%), Positives = 285/366 (78%), Gaps = 5/366 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+ +T GV GSG+ LYKLY+  +R + +LE++L  + ++DE IKAQM+ HFEN
Sbjct  7     FWRRHRRKILITAGVFGSGYYLYKLYNAQKRNLADLERQLADEREHDEHIKAQMQVHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IAD+TTLPH MQYLSSRI+EELDL QLTE+L KGK QPNTLT +EKLELWDRLKILS
Sbjct  67    IQRIADTTTLPHAMQYLSSRIAEELDLSQLTERLKKGKGQPNTLTHSEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSY-QEEEADIIYRDDQQLFLA  813
             FTR  +S+WSMT L+LYIR Q+NILGRHLYIDTAR L SS+  +E+ D+I RDDQ+ FLA
Sbjct  127   FTRTAVSVWSMTMLSLYIRTQLNILGRHLYIDTARGLESSHLLQEDVDLIERDDQKKFLA  186

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S+D+LAN+G+  LISD +AA +EVLKGKQL D+F+T  LH+T++QILD FMS GSPHHW 
Sbjct  187   SSDFLANHGILVLISDIQAAATEVLKGKQLGDIFNTVTLHETIMQILDLFMSRGSPHHWT  246

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLMPED ++Y LA  SSSD+      + FE LM+E R VLSSAEFG V+++SLK +VD 
Sbjct  247   DYLMPEDARLYKLATGSSSDDRITTDTTKFELLMEEARGVLSSAEFGRVLEISLKVIVDT  306

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++     +    +++  MPLA LLPR+A +G  L +E ++NR+IQ+I +L EVE  FTLL
Sbjct  307   LL----AESSGDSIVSEMPLALLLPRVARMGPILFDESSQNRFIQIIGSLSEVEFFFTLL  362

Query  1354  YSSTPV  1371
             Y++ P 
Sbjct  363   YANMPT  368



>ref|XP_002529562.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF32831.1| amino acid transporter, putative [Ricinus communis]
Length=373

 Score =   458 bits (1178),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 280/362 (77%), Gaps = 0/362 (0%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+ +  GVLGSG+ LYKLY+ H+ R+ ELE+EL ++ ++DELI AQ+  HFEN
Sbjct  7     FWRRHRRKIIIASGVLGSGYFLYKLYNAHKCRLAELERELASNREHDELINAQVLAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IAD+TTLPH M YLSSRI+EELDL QLTE+LMKGK QPN LT +EKLELWDRLKILS
Sbjct  67    IQRIADTTTLPHAMHYLSSRIAEELDLSQLTERLMKGKGQPNALTPSEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR+V+SLW+MT L+LYIR QVNILGRHLY+ TAR LGSS   E+ D+I RD QQ FLAS
Sbjct  127   FTRLVVSLWAMTMLSLYIRTQVNILGRHLYLATARVLGSSDLIEDIDLIERDGQQKFLAS  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             +D+ AN G+  L SD + A +EVLKGKQL+D F+T  LH+T++QILD  MS GSPHHW+ 
Sbjct  187   SDFFANSGILALSSDVQLAAAEVLKGKQLRDFFNTATLHETIMQILDLLMSRGSPHHWVE  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             YLMP D +       SSSD+  +   + FEQLM E RAV+SSAEF  VV+ SL+  VDA+
Sbjct  247   YLMPADARFDKRPIDSSSDDIIMTDGTKFEQLMAEARAVISSAEFLGVVEKSLEVSVDAL  306

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             V D+  +    +LM GMPLA+L+PR+A +G  LLEEP+RNR++Q+I ++P+VE  F+ LY
Sbjct  307   VADMGAESSGGSLMAGMPLARLVPRVAQMGPLLLEEPSRNRFLQIIWSIPQVEGFFSALY  366

Query  1357  SS  1362
             ++
Sbjct  367   AN  368



>ref|XP_009360101.1| PREDICTED: peroxisome biogenesis protein 3-2 [Pyrus x bretschneideri]
Length=368

 Score =   453 bits (1166),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 222/366 (61%), Positives = 286/366 (78%), Gaps = 6/366 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADM-KNDELIKAQMKEHFE  453
             FWRRHK+K+ V  GVLGSG+LLYKLY+ HR+R+ ++E ELE +  KNDELIKAQM+ HFE
Sbjct  7     FWRRHKRKIVVATGVLGSGYLLYKLYNAHRQRLADMETELEQEREKNDELIKAQMQAHFE  66

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IAD+TTLPH M YLSSRI+EELDL  LTE+LM+ K QP   T+ EKLELWDRLKIL
Sbjct  67    NIQRIADTTTLPHAMHYLSSRIAEELDLSHLTERLMQVKGQP---TSQEKLELWDRLKIL  123

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMV SLW+MT L+LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I+RDDQQ FLA
Sbjct  124   SFTRMVSSLWTMTILSLYIRVQVNILGRHLYIDTARGLGSSLLIEDADLIHRDDQQKFLA  183

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S+DYL++  L  LIS+ +AA ++VL G QLKD F+TTILH T+++IL++FM+ G P+HW+
Sbjct  184   SSDYLSSNALPALISNIQAAATDVLNGMQLKDSFNTTILHATIIEILEKFMTTGEPYHWV  243

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLM ED + + LA     +NT L   + F+QLM ETRAV+SSAEFG+V + +L+ VVDA
Sbjct  244   NYLMSEDARWHELATAFGDNNTPLSDVTKFDQLMLETRAVISSAEFGSVAETALRAVVDA  303

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++ED+  Q G  +L  G+ LAK+L R+A  G   L+E   +++I++I N+P+VEL FTL+
Sbjct  304   VIEDMSAQPGGGSLKSGIQLAKVLARVAQAGPAFLKES--SKFIRIILNVPQVELFFTLI  361

Query  1354  YSSTPV  1371
             YS+  +
Sbjct  362   YSNMQI  367



>ref|XP_010255760.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Nelumbo nucifera]
Length=373

 Score =   449 bits (1154),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/366 (60%), Positives = 285/366 (78%), Gaps = 3/366 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRHK+KV+ TLG+LGSG+ LYKLYD HR+R+++LE+ELE   + +ELIKAQ++ HFEN
Sbjct  7     FWRRHKRKVFATLGILGSGYALYKLYDAHRQRLYDLERELEGQRETEELIKAQLQAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IADSTTLP+ M +L SRISEELD+  LT +L++GK  PNTLT+ EKLELW+RLK+LS
Sbjct  67    IQKIADSTTLPYAMHFLRSRISEELDISPLTGRLLQGKGHPNTLTSLEKLELWERLKVLS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARR--LGSSYQEEEADIIYRDDQQLFL  810
             FT MVLSLW+MT LNLY+RVQVNILGRHLYIDTAR   LG +Y  EE D   R  QQ FL
Sbjct  127   FTIMVLSLWTMTMLNLYVRVQVNILGRHLYIDTARNQDLGYAYLPEEVDPFNRHGQQEFL  186

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW  990
             AS+DYL++Y L  +I + + A  +VLKGKQL+D F+T +LHDT++QILD FMSM  P+HW
Sbjct  187   ASSDYLSSYRLNKVIVNMQMAAVDVLKGKQLRDPFNTMLLHDTIIQILDMFMSMNGPNHW  246

Query  991   LRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVD  1170
             + YL+PE+   Y+    ++S N  L   +  +QLM ETRAVL S++FGNVV +SL  VVD
Sbjct  247   VTYLVPENAISYN-HQRATSPNDLLPDLTKLDQLMAETRAVLLSSDFGNVVKISLSAVVD  305

Query  1171  AMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTL  1350
             A++E+I V+    +   G+PLAKLLPR+A +G  LLEEP+ NR+IQ+I+ LPEVEL +T+
Sbjct  306   ALMEEIGVESSGGSSPSGIPLAKLLPRVAQMGPLLLEEPSSNRFIQIIRKLPEVELFYTI  365

Query  1351  LYSSTP  1368
             LY++TP
Sbjct  366   LYANTP  371



>ref|XP_008393403.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Malus domestica]
Length=368

 Score =   447 bits (1149),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 221/366 (60%), Positives = 283/366 (77%), Gaps = 6/366 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADM-KNDELIKAQMKEHFE  453
             FWRRHK+K+ V  GVLGSG+LLY LY+ HR+++ ++E ELE +  KNDELIKAQM+ HFE
Sbjct  7     FWRRHKRKIVVATGVLGSGYLLYTLYNAHRQKLADMETELEQEREKNDELIKAQMQAHFE  66

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             NIQ IAD+TTLPH M YL+SRI+EELDL  LTE+LM+ K QP   T+ EKLELWDRLKIL
Sbjct  67    NIQRIADTTTLPHAMHYLNSRIAEELDLSHLTERLMQVKGQP---TSQEKLELWDRLKIL  123

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I+RDDQQ FLA
Sbjct  124   SFTRMVLSLWTMTILSLYIRVQVNILGRHLYIDTARGLGSSLLIEDADLIHRDDQQKFLA  183

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S+DYL +  L  LIS+ +AA +EVL G QLKD F+TTIL  T+++IL++FM+ G P+HW+
Sbjct  184   SSDYLPSNALPALISNIQAAATEVLNGMQLKDSFNTTILRATIIEILEKFMTTGEPYHWV  243

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLM ED + + LA     DNT L   + F+QLM ETRAV+SSAEFG+V + +L+ VVD 
Sbjct  244   NYLMSEDARWHELATAFGDDNTPLPDVTKFDQLMLETRAVISSAEFGSVAETALRAVVDT  303

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++ED+  Q G  +L  G+ LAK+L R+A  G  L EE   +++I++I N+P+VEL FTL+
Sbjct  304   VIEDMSAQPGGGSLKSGIQLAKVLARVAQTGPALXEES--SKFIRIILNVPQVELFFTLI  361

Query  1354  YSSTPV  1371
             YS+  +
Sbjct  362   YSNMQI  367



>ref|XP_010243784.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Nelumbo nucifera]
Length=371

 Score =   446 bits (1148),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 217/364 (60%), Positives = 282/364 (77%), Gaps = 1/364 (0%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRHK+KV+  LGVLGSG++LYKLYD HRRR+ +LE ELE   + +ELIKAQ++ HFEN
Sbjct  7     FWRRHKRKVFAALGVLGSGYVLYKLYDAHRRRLSQLESELEDQRETEELIKAQLQAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IADSTTLP+ M  L +RI+EELDL  LT +L++GK  PNTLT  EKLELW+RLKI S
Sbjct  67    IQRIADSTTLPYAMHCLRNRITEELDLSHLTGRLLQGKGHPNTLTYVEKLELWERLKIQS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT MVLSLW+MT LNLY+RVQVNILGRHLYIDTAR + +S+  EE D   R  QQ FL S
Sbjct  127   FTLMVLSLWAMTMLNLYVRVQVNILGRHLYIDTARGVENSHLMEEVDKFQRHGQQEFLES  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L++Y +TTLI + + A +EVLK +QL+  F++++LH+T++QILD FM+M  P+HW+ 
Sbjct  187   ADFLSSYSITTLIQNMQMAAAEVLKEEQLRHPFNSSLLHETIMQILDMFMNMNGPNHWVT  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             YL+PE+   Y   + +SS N  L   S  +QLM ETRAVL S++FGNVV +SL+ VVD +
Sbjct  247   YLVPENALSYKHQSATSS-NEALPDISKLDQLMTETRAVLLSSDFGNVVKISLRAVVDTL  305

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             +EDI +Q    NL  G+PLAKLLPR+A +G+ LLEEP+ N++IQ I+NLP+VEL +TLLY
Sbjct  306   MEDIMIQFSGGNLPSGIPLAKLLPRVAQMGRPLLEEPSNNKFIQTIRNLPDVELFYTLLY  365

Query  1357  SSTP  1368
             ++ P
Sbjct  366   ANMP  369



>ref|XP_008453453.1| PREDICTED: peroxisome biogenesis protein 3-2 [Cucumis melo]
Length=373

 Score =   442 bits (1137),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 214/369 (58%), Positives = 282/369 (76%), Gaps = 1/369 (0%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             I  FWRRHK+K+ +T GVLGSG+ LY+ YD + RR+ ++++EL+ + + DELIKAQ++ H
Sbjct  4     IRDFWRRHKRKILITAGVLGSGYFLYRQYDYYSRRLHDIQRELDNEREADELIKAQIQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ IAD+TTLPH +Q+L SRI E+LDL  LTE+LM GK QPNTLT AEKL+LW+ LK
Sbjct  64    FENIQRIADTTTLPHAIQHLHSRIEEDLDLSHLTERLMMGKGQPNTLTLAEKLDLWENLK  123

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFT+MV+SLW++T L+LYIRVQVNILGRH+YIDTAR LGSS+  EEAD+I RDDQQ F
Sbjct  124   ILSFTKMVISLWAITVLSLYIRVQVNILGRHMYIDTARGLGSSHLLEEADLIDRDDQQKF  183

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             LA +D+L NYGL  LI   + A  EVLK KQL+DVF+TT+L +T  QI+  FMS GSPHH
Sbjct  184   LAISDFLCNYGLNALIPKLQVAVGEVLKRKQLRDVFNTTVLRETTTQIIKIFMSTGSPHH  243

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             WL YLMP D +       S+ D+      + F+QLM ETRAVL SAEFGN+V+ SL+  V
Sbjct  244   WLDYLMPGDNQSSITDTLSTDDDAVAPNFNKFDQLMMETRAVLLSAEFGNIVEKSLEVGV  303

Query  1168  DAMVEDIRVQ-CGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             D ++E++     G ++   G+PLA+L+PR+A +G  LLE+P ++R+IQ+I+ +PEVE+ F
Sbjct  304   DGLMEEMEASLAGSSSKASGIPLARLVPRVAQMGLLLLEDPIKSRFIQMIRGIPEVEIFF  363

Query  1345  TLLYSSTPV  1371
             TLLY++ P 
Sbjct  364   TLLYANMPA  372



>gb|KHN21657.1| Peroxisome biogenesis protein 3-2 [Glycine soja]
Length=369

 Score =   437 bits (1124),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 281/367 (77%), Gaps = 3/367 (1%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWRRH++KV+VT+GVLGSG+LLYKLY  HR  + ELE+EL    + +EL+KAQM+ H
Sbjct  4     VRDFWRRHRRKVFVTVGVLGSGYLLYKLYGAHRHGVQELERELAVQRETEELMKAQMQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ ++D  TLPH M  LS RI+EELDL  L E+L++GK QPNTLT +EKL+LW RLK
Sbjct  64    FENIQRMSD-VTLPHAMHELSCRITEELDLSHLLERLIQGKGQPNTLTQSEKLDLWSRLK  122

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRM LS+W+ T L+LY +VQVNILGRHLYIDTAR LG S   E  D++ R+DQ+ F
Sbjct  123   ILSFTRMTLSVWATTMLSLYTKVQVNILGRHLYIDTARSLGISDSVESGDVVDREDQKKF  182

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L S D+L+ +G+  LISD EAAT EVLKGKQL   F++T LH+T++QIL+ FMSMG+P+ 
Sbjct  183   LDSVDFLSQHGMPALISDMEAATKEVLKGKQLSTFFNSTTLHETIMQILNTFMSMGTPNS  242

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             W++Y++PED + YS    S SD+      + FEQLM E RAVLSSAEFG++V++SLK VV
Sbjct  243   WIKYMIPEDVRPYS--TTSGSDDPVPFDVTEFEQLMIEARAVLSSAEFGSIVEISLKAVV  300

Query  1168  DAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFT  1347
             D +VE +R +    ++  GMPLA++LP++A +   LL EP++N++IQ+I+N+ EVEL FT
Sbjct  301   DTLVELMRTKFSGGSVAGGMPLARVLPQVAQMCPLLLGEPSKNQFIQIIKNIQEVELFFT  360

Query  1348  LLYSSTP  1368
             LLY++ P
Sbjct  361   LLYANMP  367



>ref|XP_003525200.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Glycine max]
Length=369

 Score =   437 bits (1124),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 281/367 (77%), Gaps = 3/367 (1%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWRRH++KV+VT+GVLGSG+LLYKLY  HR  + ELE+EL    + +EL+KAQM+ H
Sbjct  4     VRDFWRRHRRKVFVTVGVLGSGYLLYKLYGAHRHGVQELERELAVQRETEELMKAQMQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ ++D  TLPH M  LS RI+EELDL  L E+L++GK QPNTLT +EKL+LW RLK
Sbjct  64    FENIQRMSD-VTLPHAMHELSCRITEELDLSHLLERLIQGKGQPNTLTQSEKLDLWSRLK  122

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRM LS+W+ T L+LY +VQVNILGRHLYIDTAR LG S   E  D++ R+DQ+ F
Sbjct  123   ILSFTRMTLSVWATTMLSLYTKVQVNILGRHLYIDTARSLGISDSVESGDVVDREDQKKF  182

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L S D+L+ +G+  LISD EAAT EVLKGKQL   F++T LH+T++QIL+ FMSMG+P+ 
Sbjct  183   LDSVDFLSQHGMPALISDMEAATKEVLKGKQLSTFFNSTTLHETIMQILNTFMSMGTPNS  242

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             W++Y++PED + YS    S SD+      + FEQLM E RAVLSSAEFG++V++SLK VV
Sbjct  243   WIKYMIPEDVRPYS--TTSGSDDPVPFDVTEFEQLMIEARAVLSSAEFGSIVEISLKAVV  300

Query  1168  DAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFT  1347
             D +VE +R +    ++  GMPLA++LP++A +   LL EP++N++IQ+I+N+ EVEL FT
Sbjct  301   DTLVELMRTKFSGGSVAEGMPLARVLPQVAQMCPLLLGEPSKNQFIQIIKNIQEVELFFT  360

Query  1348  LLYSSTP  1368
             LLY++ P
Sbjct  361   LLYANMP  367



>ref|XP_007160505.1| hypothetical protein PHAVU_002G327400g [Phaseolus vulgaris]
 gb|ESW32499.1| hypothetical protein PHAVU_002G327400g [Phaseolus vulgaris]
Length=369

 Score =   435 bits (1119),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 282/367 (77%), Gaps = 3/367 (1%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWRRH++KV+ ++GV GSG+LLYKLY  HR  I ELE+EL A  + +EL+KAQM+ H
Sbjct  4     VRDFWRRHRRKVFFSVGVFGSGYLLYKLYGAHRHGIQELERELAAQRETEELMKAQMQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ I+D  TLPH M  LS RI+EELDL  L E+L++GK QPN+LT +EKL+LW RLK
Sbjct  64    FENIQRISD-VTLPHAMHDLSCRITEELDLSHLLERLIQGKGQPNSLTQSEKLDLWSRLK  122

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRM LS+W+ T L+LY +VQVNILGRHLYIDTAR LG S   E  D++ R+D + F
Sbjct  123   ILSFTRMALSVWATTMLSLYTKVQVNILGRHLYIDTARSLGISDSLESVDVVDREDHKKF  182

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L S D+L+ +G+  LISD EAAT EVLKGKQL   FS+T LH+T +QIL+ FMSMGSP++
Sbjct  183   LDSVDFLSQHGMPALISDMEAATKEVLKGKQLSTFFSSTTLHETFMQILNNFMSMGSPNY  242

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             W++Y++PE  K YS  + SSSD+  L   + +EQLM E +AVLSSAEFG++V+VSL+ VV
Sbjct  243   WIKYMIPEHVKPYS--SNSSSDDRMLSDVTEYEQLMMEAQAVLSSAEFGSIVEVSLQAVV  300

Query  1168  DAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFT  1347
             D +VE + V+    ++  G+PLA++LP++A +   LLEEP++N++IQ+I+N+ EVEL FT
Sbjct  301   DKLVELMGVKFSGGSITAGLPLARVLPQVAQMCPLLLEEPSKNQFIQIIKNIQEVELFFT  360

Query  1348  LLYSSTP  1368
             LLY++ P
Sbjct  361   LLYANMP  367



>ref|XP_004160430.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Cucumis sativus]
Length=373

 Score =   432 bits (1111),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 208/370 (56%), Positives = 281/370 (76%), Gaps = 1/370 (0%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             I  FW+RHK+K+ +T GVLGSG+ LY+ YD + RR+ ++++EL+ + + DELIKAQ++ H
Sbjct  4     IRDFWKRHKRKILITAGVLGSGYFLYRQYDYYSRRLHDIQRELDNEREADELIKAQIQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ IAD+TTLPH +Q+L +RI E+LDL  LTE+LM GK QPNTLT AEKL+LW+ LK
Sbjct  64    FENIQRIADTTTLPHAIQHLHNRIEEDLDLSHLTERLMMGKGQPNTLTLAEKLDLWENLK  123

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFT+MV+SLW++T L+LYIRVQVNILGRH+YIDTAR LGSS+  EEAD+I R+DQQ F
Sbjct  124   ILSFTKMVISLWAITVLSLYIRVQVNILGRHMYIDTARGLGSSHLLEEADLIDREDQQKF  183

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             LA +D+L NYGL  LI   + A  EVLK KQL+DVF+TT+L +T  QI+  FMS  SPHH
Sbjct  184   LAISDFLCNYGLNALIPKLQVAVGEVLKRKQLRDVFNTTVLRETTTQIIKIFMSTASPHH  243

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             WL Y+MP D +       S+ D+      + F+QLM ETRAVL SAEFGN+++ SL+  V
Sbjct  244   WLDYVMPGDNQSSITDTLSTDDDAVAPNFNKFDQLMMETRAVLLSAEFGNIMERSLEVGV  303

Query  1168  DAMVEDIRVQ-CGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             D ++E++     G ++   G+PLA+L+PR+A +G  LLE+P ++R+IQ+I+ +PEVE+ F
Sbjct  304   DGLMEEMEASLAGGSSKASGIPLARLVPRVAQMGLLLLEDPIKSRFIQMIRGIPEVEIFF  363

Query  1345  TLLYSSTPVV  1374
             TLLY++ P  
Sbjct  364   TLLYANMPAA  373



>ref|XP_004299549.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=366

 Score =   431 bits (1109),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 217/366 (59%), Positives = 278/366 (76%), Gaps = 9/366 (2%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKN-DELIKAQMK  441
             +I  FWRRHK+KV VT GVLG G+LLYKLY+ H +R+ +LE EL  + ++ D+L+KA+M+
Sbjct  4     VIRGFWRRHKRKVLVTTGVLGGGYLLYKLYNAHTQRLADLEAELAREQESSDDLLKAKMQ  63

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+IQ IAD+TTLPHVM YLSSRI+EELD   +TE+LM+ K +     + EKLELWDR
Sbjct  64    AHFESIQSIADTTTLPHVMHYLSSRIAEELDTTDITERLMQMKGK-----SPEKLELWDR  118

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQ  801
             LK++SFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR  GSS   E+A++I RDDQQ
Sbjct  119   LKVISFTRMVLSLWAMTMLSLYIRVQVNILGRHLYIDTARGFGSSLIVEDAELIDRDDQQ  178

Query  802   LFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSP  981
              FLAS+DYL+ YG+ +LI   +AA  EVL GKQL D F+T +L DT++QILD+FM  GSP
Sbjct  179   KFLASSDYLSTYGMPSLILHIQAAAIEVLNGKQLTDRFNTAVLRDTIMQILDKFMGTGSP  238

Query  982   HHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKT  1161
             HHW+ YLMPED +   LA   SSD+T L   + FEQL  ETR+V+SS EFGN+ +++L+ 
Sbjct  239   HHWVNYLMPEDARWAELATAFSSDSTVLPDVTKFEQLTLETRSVISSGEFGNIAEMALRA  298

Query  1162  VVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELI  1341
             VVD +V D+  Q G  +L  G PLAK+L R+A +G  LL E ++ R  Q+I N+PEVEL 
Sbjct  299   VVDTVVVDMGAQSG-GDLSSGTPLAKVLARVAQMGPTLLGESSKFR--QIILNVPEVELF  355

Query  1342  FTLLYS  1359
             FTL+YS
Sbjct  356   FTLIYS  361



>ref|XP_004299550.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=365

 Score =   431 bits (1109),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 216/362 (60%), Positives = 276/362 (76%), Gaps = 9/362 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKN-DELIKAQMKEHFE  453
             FWRRHK+KV VT GVLG G+LLYKLY+ H +R+ +LE EL  + ++ D+L+KA+M+ HFE
Sbjct  7     FWRRHKRKVLVTTGVLGGGYLLYKLYNAHTQRLADLEAELAREQESSDDLLKAKMQAHFE  66

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             +IQ IAD+TTLPHVM YLSSRI+EELD   +TE+LM+ K +     + EKLELWDRLK++
Sbjct  67    SIQSIADTTTLPHVMHYLSSRIAEELDTTDITERLMQMKGK-----SPEKLELWDRLKVI  121

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR  GSS   E+A++I RDDQQ FLA
Sbjct  122   SFTRMVLSLWAMTMLSLYIRVQVNILGRHLYIDTARGFGSSLIVEDAELIDRDDQQKFLA  181

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S+DYL+ YG+ +LI   +AA  EVL GKQL D F+T +L DT++QILD+FM  GSPHHW+
Sbjct  182   SSDYLSTYGMPSLILHIQAAAIEVLNGKQLTDRFNTAVLRDTIMQILDKFMGTGSPHHWV  241

Query  994   RYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
              YLMPED +   LA   SSD+T L   + FEQL  ETR+V+SS EFGN+ +++L+ VVD 
Sbjct  242   NYLMPEDARWAELATAFSSDSTVLPDVTKFEQLTLETRSVISSGEFGNIAEMALRAVVDT  301

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +V D+  Q G  +L  G PLAK+L R+A +G  LL E ++ R  Q+I N+PEVEL FTL+
Sbjct  302   VVVDMGAQSG-GDLSSGTPLAKVLARVAQMGPTLLGESSKFR--QIILNVPEVELFFTLI  358

Query  1354  YS  1359
             YS
Sbjct  359   YS  360



>ref|XP_004137328.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Cucumis sativus]
 gb|KGN63852.1| hypothetical protein Csa_1G024840 [Cucumis sativus]
Length=373

 Score =   431 bits (1107),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/370 (56%), Positives = 280/370 (76%), Gaps = 1/370 (0%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             I  FW+RHK+K+ +T GVLGSG+ LY+ YD + RR+ ++++EL+ + + DELIKAQ++ H
Sbjct  4     IRDFWKRHKRKILITAGVLGSGYFLYRQYDYYSRRLHDIQRELDNEREADELIKAQIQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ IAD+TTLPH +Q+L +RI E+LDL  LTE+LM GK QPNTLT AEKL+LW+ LK
Sbjct  64    FENIQRIADTTTLPHAIQHLHNRIEEDLDLSHLTERLMMGKGQPNTLTLAEKLDLWENLK  123

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFT+MV+SLW++T L+LYIRVQVNILGRH+YIDTAR LGSS+  EEAD+I R+DQQ F
Sbjct  124   ILSFTKMVISLWAITVLSLYIRVQVNILGRHMYIDTARGLGSSHLLEEADLIDREDQQKF  183

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             LA +D+L NYGL  LI   + A  EVLK KQL+DVF+TT+L +T  QI+  FMS  SPHH
Sbjct  184   LAISDFLCNYGLNALIPKLQVAVGEVLKRKQLRDVFNTTVLRETTTQIIKIFMSTASPHH  243

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             WL Y+MP D +       S+ D+      + F+QLM ETRAVL S EFGN+++ SL+  V
Sbjct  244   WLDYVMPGDNQSSITDTLSTDDDAVAPNFNKFDQLMMETRAVLLSVEFGNIMERSLEVGV  303

Query  1168  DAMVEDIRVQ-CGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             D ++E++     G ++   G+PLA+L+PR+A +G  LLE+P ++R+IQ+I+ +PEVE+ F
Sbjct  304   DGLMEEMEASLAGGSSKASGIPLARLVPRVAQMGLLLLEDPIKSRFIQMIRGIPEVEIFF  363

Query  1345  TLLYSSTPVV  1374
             TLLY++ P  
Sbjct  364   TLLYANMPAA  373



>ref|XP_010549092.1| PREDICTED: peroxisome biogenesis protein 3-2 [Tarenaya hassleriana]
Length=377

 Score =   428 bits (1100),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/370 (58%), Positives = 282/370 (76%), Gaps = 16/370 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H+++++VT G +GSG+LLYKLY+ H RR+  LE+EL  D +++E+IK QMK HFEN
Sbjct  17    FWRKHRRRIFVTAGCVGSGYLLYKLYNAHTRRLAVLEQELAIDRESEEIIKTQMKAHFEN  76

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+IAD+TTL H MQYLS RI EE+D+  + E L KGK    TL  +EKL+LWD+LKILS
Sbjct  77    IQMIADTTTLSHAMQYLSDRIREEIDVSNVMESLNKGK---GTLPPSEKLQLWDKLKILS  133

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  E+ D+I RDD+Q FLAS
Sbjct  134   FTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLEDLDLIDRDDEQKFLAS  193

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L+  G+  LISD +AA +EVLKGKQL+DV++ ++L +TV+QILD FMS GSPHHW+ 
Sbjct  194   ADFLSTNGMPGLISDVQAAVTEVLKGKQLRDVYTASVLQETVMQILDVFMSSGSPHHWVD  253

Query  997   YLM-PEDPKIYSLAAPSSSDNTDLCRASN-----FEQLMQETRAVLSSAEFGNVVDVSLK  1158
             YLM P++ +I     P+ SDN     +S+     F+QLM E R VL+S EF N+V++SLK
Sbjct  254   YLMTPQETRI----GPNPSDNLKEVSSSDVTVTKFDQLMVEAREVLTSTEFTNIVEISLK  309

Query  1159  TVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVEL  1338
             + + A V+++  + G   L +GMPLAKLLPR+  +   +  EP RNR++Q+I++ PEV+L
Sbjct  310   SFITAFVDEMETREG---LGMGMPLAKLLPRIEGMIPTMTTEPGRNRFLQLIRDQPEVQL  366

Query  1339  IFTLLYSSTP  1368
              FTLLYSS P
Sbjct  367   FFTLLYSSMP  376



>ref|XP_010551146.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Tarenaya hassleriana]
Length=371

 Score =   424 bits (1091),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 215/372 (58%), Positives = 274/372 (74%), Gaps = 10/372 (3%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWR H++K++VT G +GSG+LLYKLY  H RR+ +LE+EL  + +N+ELIK QMK H
Sbjct  4     VRDFWRNHRRKIFVTAGCVGSGYLLYKLYHAHTRRLADLERELAIERENEELIKTQMKAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ+IAD+TTLPH MQYLS RI  E+D+  + E L KGK    TL+ +EKL+LWD+LK
Sbjct  64    FENIQMIADATTLPHAMQYLSGRIMNEIDVSIIMESLNKGK---GTLSPSEKLQLWDKLK  120

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  E+ D+I RDD+Q F
Sbjct  121   ILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARDLGSSHLLEDLDLIDRDDEQKF  180

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+SAD+LA  G+  LIS+ + A  EVLKGKQLKDVF+T++L +TV+QILD FMS GSPHH
Sbjct  181   LSSADFLATRGMPGLISNIQGAVIEVLKGKQLKDVFTTSVLQETVMQILDVFMSTGSPHH  240

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASN-----FEQLMQETRAVLSSAEFGNVVDVS  1152
             W+ YLM       S    +SSDN      SN     F+QLM ETR VL+S EF N+ ++S
Sbjct  241   WVDYLMIPQETRPSRIDSNSSDNLTKVSPSNVTVAKFDQLMVETREVLTSTEFTNIAEIS  300

Query  1153  LKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEV  1332
             LKT   A+VE++  +        GMPLAKLLPR+      +  EP +NR++Q+I++LPEV
Sbjct  301   LKTFTAALVEEMGTEGSLGT--GGMPLAKLLPRIEMTIPVVTAEPGKNRFLQLIRDLPEV  358

Query  1333  ELIFTLLYSSTP  1368
             +L FTLLY+S P
Sbjct  359   QLFFTLLYASMP  370



>gb|KHN00176.1| Peroxisome biogenesis protein 3-2 [Glycine soja]
Length=369

 Score =   424 bits (1090),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 205/364 (56%), Positives = 277/364 (76%), Gaps = 3/364 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++KV+VT+GVLGSG+LLYKLY   R  + ELE+EL    + ++L+KAQM+ HFEN
Sbjct  7     FWRRHRRKVFVTVGVLGSGYLLYKLYGAQRHGVQELERELAVQRETEDLMKAQMQAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ ++D  TLPH M  LS RI+EELDL  L E+L++GK QPNTLT +EKL+LW RLKILS
Sbjct  67    IQKMSD-VTLPHAMHELSCRITEELDLSHLLERLIQGKGQPNTLTQSEKLDLWSRLKILS  125

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRM LS+W+ T L+LY +VQVNILGRHLYIDTAR LG S   E  D++ R+DQ+ FL +
Sbjct  126   FTRMTLSVWATTMLSLYTKVQVNILGRHLYIDTARSLGISDSVESGDVVDREDQKKFLDN  185

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
              D+L+ +G+  LISD EAAT EVLKGKQL   F++T LH+T++QIL+ FMSMG+P+ W++
Sbjct  186   IDFLSQHGMPALISDMEAATKEVLKGKQLSTFFNSTTLHETIMQILNSFMSMGTPNSWIK  245

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             Y++PED + YS      SD+      + FEQLM E  AVLSSAEFG++V++SLK VVD +
Sbjct  246   YMIPEDVRPYS--TTYGSDDPVPFDMTEFEQLMMEAWAVLSSAEFGSIVEISLKAVVDTL  303

Query  1177  VEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLY  1356
             VE +  +    ++  G+PLA++LP++A +   LLEEP++N++IQ+I+N+ EVEL FTLLY
Sbjct  304   VELMGTKFSGGSVAGGLPLARVLPQVAQMCPLLLEEPSKNQFIQIIKNIQEVELFFTLLY  363

Query  1357  SSTP  1368
             ++ P
Sbjct  364   ANMP  367



>ref|NP_683410.1| peroxin 3 [Arabidopsis thaliana]
 sp|Q8S9K7.1|PEX32_ARATH RecName: Full=Peroxisome biogenesis protein 3-2; AltName: Full=Peroxin-3-2; 
Short=AtPEX3-2 [Arabidopsis thaliana]
 gb|AAL75911.1| At1g48640/F11I4_17 [Arabidopsis thaliana]
 gb|AAM70527.1| At1g48640/F11I4_17 [Arabidopsis thaliana]
 dbj|BAD43104.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32330.1| peroxin 3 [Arabidopsis thaliana]
Length=364

 Score =   423 bits (1088),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/365 (57%), Positives = 275/365 (75%), Gaps = 9/365 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++KV VT G LGSG+LLYKLY+ H RR+ +LE+EL  + +NDE+IK QMK HFE+
Sbjct  7     FWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRRLADLERELAHERENDEIIKTQMKAHFES  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH MQ+LS RISEE+D+  + ++L +GK     L+  EKL+LWD LKILS
Sbjct  67    IQMIVDSTTLPHAMQFLSIRISEEIDVSHVMDRLNQGK---GMLSPPEKLQLWDELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LGSS+  EE D+I RDD+Q FL+S
Sbjct  124   FTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGSSHLLEEVDLIDRDDEQKFLSS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L    + +LISD + +  EVLKGKQLKDV +T +L +TV+QI+D FMS GSPHHW+ 
Sbjct  184   ADFLVTNAMPSLISDMQGSAEEVLKGKQLKDVITTRVLQETVMQIVDVFMSTGSPHHWVD  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D K+    + ++SD++D    S F QLM ETR VL S EF N+V++SLK   D 
Sbjct  244   YLMMPQDTKL----SRTTSDSSDEA-VSKFHQLMVETREVLISTEFTNIVEISLKCFTDV  298

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +VE++  Q     L  G PLAK+LP++      +  EP++NR++Q+I++LPEV+L FTLL
Sbjct  299   LVEEMETQTEAGGLATGKPLAKVLPQIEKTMNVITAEPSKNRFLQIIRDLPEVKLFFTLL  358

Query  1354  YSSTP  1368
             Y++ P
Sbjct  359   YANMP  363



>gb|ACU20085.1| unknown [Glycine max]
Length=369

 Score =   423 bits (1088),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/367 (56%), Positives = 277/367 (75%), Gaps = 3/367 (1%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWRRH++KV+VT+GVLGSG+LLYKLY   R  + ELE+EL    + ++L+KAQM+ H
Sbjct  4     VRDFWRRHRRKVFVTVGVLGSGYLLYKLYGAQRHGVQELERELAVQRETEDLMKAQMQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ ++D  TLPH M  LS RI+EELDL  L E+L++GK QPNTLT +EKL+LW RLK
Sbjct  64    FENIQKMSD-VTLPHAMHELSCRITEELDLSHLLERLIQGKGQPNTLTQSEKLDLWSRLK  122

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRM LS+W+ T L+LY +VQVNILGRHLYIDTAR LG S   E  D++ R+DQ+ F
Sbjct  123   ILSFTRMTLSVWATTMLSLYTKVQVNILGRHLYIDTARSLGISDSVESGDVVDREDQKKF  182

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L + D+L+ +G+  LISD EAAT EVLKGKQL   F++T LH+T++QIL+ FMSMG+P+ 
Sbjct  183   LDNIDFLSQHGMPALISDMEAATKEVLKGKQLSTFFNSTTLHETIMQILNSFMSMGTPNS  242

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             W++Y++PED + YS      SD+      + FEQLM E  AVLSSAEFG++V++SLK VV
Sbjct  243   WIKYMIPEDVRPYS--TTHGSDDPVPFDMTEFEQLMMEAWAVLSSAEFGSIVEISLKAVV  300

Query  1168  DAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFT  1347
             D +VE +  +    ++  G+PLA++LP++A +   LLEEP +N++IQ+I+N+ EVEL FT
Sbjct  301   DTLVELMGTKFSGGSVAGGLPLARVLPQVAQMCPLLLEEPRKNQFIQIIKNIQEVELFFT  360

Query  1348  LLYSSTP  1368
             LLY++ P
Sbjct  361   LLYANMP  367



>ref|XP_003530946.1| PREDICTED: peroxisome biogenesis protein 3-2 [Glycine max]
Length=369

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/367 (56%), Positives = 277/367 (75%), Gaps = 3/367 (1%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWRRH++KV+VT+GVLGSG+LLYKLY   R  + ELE+EL    + ++L+KAQM+ H
Sbjct  4     VRDFWRRHRRKVFVTVGVLGSGYLLYKLYGAQRHGVQELERELAVQRETEDLMKAQMQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ ++D  TLPH M  LS RI+EELDL  L E+L++GK QPNTLT +EKL+LW RLK
Sbjct  64    FENIQKMSD-VTLPHAMHELSCRITEELDLSHLLERLIQGKGQPNTLTQSEKLDLWSRLK  122

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRM LS+W+ T L+LY +VQVNILGRHLYIDTAR LG S   E  D++ R+DQ+ F
Sbjct  123   ILSFTRMTLSVWATTMLSLYTKVQVNILGRHLYIDTARSLGISDSVESGDVVDREDQKKF  182

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L + D+L+ +G+  LISD EAAT EVLKGKQL   F++T LH+T++QIL+ FMSMG+P+ 
Sbjct  183   LDNIDFLSQHGMPALISDMEAATKEVLKGKQLSTFFNSTTLHETIMQILNSFMSMGTPNS  242

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             W++Y++PED + YS      SD+      + FEQLM E  AVLSSAEFG++V++SLK VV
Sbjct  243   WIKYMIPEDVRPYS--TTYGSDDPVPFDMTEFEQLMMEAWAVLSSAEFGSIVEISLKAVV  300

Query  1168  DAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFT  1347
             D +VE +  +    ++  G+PLA++LP++A +   LLEEP +N++IQ+I+N+ EVEL FT
Sbjct  301   DTLVELMGTKFSGGSVAGGLPLARVLPQVAQMCPLLLEEPRKNQFIQIIKNIQEVELFFT  360

Query  1348  LLYSSTP  1368
             LLY++ P
Sbjct  361   LLYANMP  367



>ref|XP_010687023.1| PREDICTED: peroxisome biogenesis protein 3-2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687024.1| PREDICTED: peroxisome biogenesis protein 3-2 [Beta vulgaris subsp. 
vulgaris]
Length=370

 Score =   419 bits (1078),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 282/367 (77%), Gaps = 4/367 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRHKKK++VT G++GSG+++YKLYDGHRRR+ ELE +L A  +N+E IKAQM++HFE 
Sbjct  7     FWRRHKKKIFVTFGIVGSGYVVYKLYDGHRRRLAELESDLAAQRENEERIKAQMQDHFET  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IAD+TTLP  M YLS+RI EEL+L+ LTE+L +GKD    LT  EKLELWD+LK+LS
Sbjct  67    IQRIADTTTLPRAMHYLSNRIDEELNLLVLTERLKQGKD---VLTLPEKLELWDKLKVLS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT+MVLSLWS+T L+L++RVQVNILGRH+YID AR   +S   EEA +I + D+Q FLA 
Sbjct  124   FTKMVLSLWSVTMLSLFVRVQVNILGRHMYIDIARCQETSPLPEEASLIDQVDEQNFLAR  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LA++GL  LI + +AA +EVLK KQLKDVF ++ILH+T+VQILD FMSMG P HW+ 
Sbjct  184   ADFLASHGLPALIFNMQAAAAEVLKSKQLKDVFDSSILHETIVQILDTFMSMGRPRHWVE  243

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAM  1176
             Y MP+D K+ +L    SS+N  L   S F+QLM ET+ VLSS EF NVV+VS+KTVV+A+
Sbjct  244   YFMPDDAKLPNLTPSVSSNNLILSDVSKFDQLMTETQTVLSSDEFTNVVEVSVKTVVNAI  303

Query  1177  VEDIRV-QCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             V+DI V Q G      G+ L KL+PR+A   Q LL+EP  N+++Q I+N+ +VEL FT+L
Sbjct  304   VKDIFVDQSGAGTPSSGVALVKLVPRVAQTSQLLLDEPTSNQFVQTIKNIQDVELFFTIL  363

Query  1354  YSSTPVV  1374
             Y++   V
Sbjct  364   YANALTV  370



>gb|KFK36073.1| hypothetical protein AALP_AA4G073900 [Arabis alpina]
Length=363

 Score =   419 bits (1076),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 211/368 (57%), Positives = 273/368 (74%), Gaps = 10/368 (3%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             I   WR HK+KV+VT G LGSG+LLY++Y+ H RR+ +LE+EL  + +N+ELIK QMK H
Sbjct  4     IRGLWRNHKRKVFVTAGCLGSGYLLYRVYNSHTRRLADLEQELATERENEELIKTQMKAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ+I DSTTLPH MQYLS RI+EE+D+  + E+L KGK     L+++EKL LWD LK
Sbjct  64    FENIQMIVDSTTLPHAMQYLSVRINEEIDVSNVMERLNKGK---GMLSSSEKLLLWDELK  120

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             ILSFTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LGSS+  EE D+I RDD+Q F
Sbjct  121   ILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGSSHLLEELDLIDRDDEQKF  180

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+SADYL    + +LISD +AA +EVLKGKQLKDV +T +L +TV++I+D FMS GSPHH
Sbjct  181   LSSADYLVTNAMPSLISDMQAAVNEVLKGKQLKDVITTRVLQETVLRIVDVFMSSGSPHH  240

Query  988   WLRYLM-PEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             W+ YLM P D    + +  S SD T     + F QLM ET  VL S EF N+V++SLK  
Sbjct  241   WIDYLMKPRDMLSRNTSGSSQSDET----VTKFHQLMFETHEVLISTEFTNIVEISLKRF  296

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
              D +VE++  Q     L  GMPLAK+LP++      ++ EPN+NR++Q+I++L EV+L F
Sbjct  297   TDTLVEEMETQTD--GLATGMPLAKVLPQIEKTVPVIIAEPNKNRFLQLIRDLSEVQLFF  354

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  355   TLLYANIP  362



>ref|XP_006305970.1| hypothetical protein CARUB_v10011233mg [Capsella rubella]
 gb|EOA38868.1| hypothetical protein CARUB_v10011233mg [Capsella rubella]
Length=365

 Score =   418 bits (1075),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 208/365 (57%), Positives = 272/365 (75%), Gaps = 8/365 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++KV VT G LGSG+LLYKLY+ H RR+ +LE+EL  + +NDELIK QMK HFEN
Sbjct  7     FWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRRLADLERELAYERENDELIKNQMKAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH +QYLS RISEE+D+  + E+L KGK     L+  EKL+LWD LKILS
Sbjct  67    IQLIVDSTTLPHTLQYLSVRISEEIDVSDVMERLNKGK---GLLSPPEKLQLWDELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LG S+  EE D+I R+D+Q FL+S
Sbjct  124   FTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGRSHVLEELDLIDRNDEQKFLSS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L    + +LISD + A  EVLKGKQLKDV +T +L +TV++I+D FMS GSPHHW+ 
Sbjct  184   ADFLVTNAMPSLISDMQDAAREVLKGKQLKDVITTRVLQETVMRIMDVFMSTGSPHHWVD  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D ++    +  SSD +     S F QLM ETR VL S EF N+V++SLK   DA
Sbjct  244   YLMMPQDKQLSRNTSGDSSDES----MSKFHQLMVETREVLISTEFTNIVEISLKCFTDA  299

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             ++E++ +Q     L  G PLAK+LP +      +  EP++N+++Q+I++LPEV+L FTLL
Sbjct  300   LIEEMEMQTVAGGLATGKPLAKVLPHIEKTMHVITVEPSKNQFLQLIRDLPEVKLFFTLL  359

Query  1354  YSSTP  1368
             Y++ P
Sbjct  360   YANMP  364



>ref|XP_004503305.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Cicer arietinum]
Length=367

 Score =   417 bits (1073),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/367 (54%), Positives = 269/367 (73%), Gaps = 11/367 (3%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+++++GV G G+ LYKLY  HR+R++ LE+ELE   + +E +KAQM+ HFEN
Sbjct  7     FWRRHRRKIFLSVGVFGGGYCLYKLYGAHRQRLYALERELEVQRETEEFMKAQMQNHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+ TLPH M  LS RI+EELDL  L E+L++GK QPNTLT +EKL LW RLKILS
Sbjct  67    IQRISDTITLPHTMHNLSCRIAEELDLSHLLERLIQGKGQPNTLTQSEKLNLWGRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSS--YQEEEADIIYRDDQQLFL  810
             FTRM LS+W+   L+LY +VQVNILGRHLYIDTAR  GSS    +E  D++  +DQQ FL
Sbjct  127   FTRMALSVWATVMLSLYTKVQVNILGRHLYIDTARSFGSSNLMVQEGGDVVDGEDQQKFL  186

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW  990
              S D+L+ + +  LISD EAAT EVL+GKQL  +F+    H+T+ QIL+ FMS GSPH W
Sbjct  187   GSVDFLSQHSMPALISDMEAATKEVLQGKQLTSLFNNATFHETITQILNTFMSRGSPHFW  246

Query  991   LRYLMPEDPKIYSLAAPSSS-DNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             L+Y++P+D K++S  + SS     D+   + FEQL+ E R VLSSAEFG +V++SLK VV
Sbjct  247   LKYMIPDDVKLHSTTSGSSDIVPFDMSHMTEFEQLIMEAREVLSSAEFGGIVEISLKAVV  306

Query  1168  DAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFT  1347
             D + E +    G T    G+PLA++LP++A +   L+EEP +NR+IQVI+N+ EVEL FT
Sbjct  307   DTLAELM----GTT----GVPLARILPQVAQMCPLLVEEPRKNRFIQVIKNIQEVELFFT  358

Query  1348  LLYSSTP  1368
              LY++ P
Sbjct  359   FLYANMP  365



>ref|XP_006406642.1| hypothetical protein EUTSA_v10020989mg [Eutrema salsugineum]
 gb|ESQ48095.1| hypothetical protein EUTSA_v10020989mg [Eutrema salsugineum]
Length=365

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/377 (56%), Positives = 276/377 (73%), Gaps = 22/377 (6%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++  FWR+H++K+ VT   LGSG+LLYKLY+ H R++ +LE+EL  + +NDE+IK QMK 
Sbjct  3     LVRGFWRKHRRKILVTTSCLGSGYLLYKLYNAHTRKLADLERELANERENDEIIKTQMKS  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HFENIQ+IAD+TTLPH +++LSSRI EE+D+  + E+L KGK    TLT  EKL+LW+ L
Sbjct  63    HFENIQMIADTTTLPHALRHLSSRIVEEIDVSSIMERLSKGK---GTLTPPEKLQLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  EE D+I RDD+Q 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLEELDLIDRDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL SADYLA  G+ +LIS+ ++A  EVLKGKQLKDV +T +L D V++ILD FMS GSPH
Sbjct  180   FLTSADYLATNGMPSLISNMKSAVKEVLKGKQLKDVLTTRVLQDNVIRILDVFMSTGSPH  239

Query  985   HWLRYLM--------PEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
              W+ YLM        P D    +    SSSD T     + F QL+ ETR VL+S EF NV
Sbjct  240   LWVDYLMVAQDTTMLPRD----TTTDVSSSDTT----VTKFHQLITETREVLTSTEFTNV  291

Query  1141  VDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQN  1320
              ++SLK+   A+ E++  Q G   L  GM LAKLLP++     ++  EP++NR++Q+I++
Sbjct  292   AEISLKSCAVALTEEMEKQTG---LATGMQLAKLLPQIEKTMPEISAEPDKNRFLQLIRD  348

Query  1321  LPEVELIFTLLYSSTPV  1371
             LPEV+L FTLLYS+ P+
Sbjct  349   LPEVQLFFTLLYSNMPL  365



>ref|XP_010479289.1| PREDICTED: peroxisome biogenesis protein 3-2 [Camelina sativa]
Length=358

 Score =   412 bits (1060),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/365 (56%), Positives = 270/365 (74%), Gaps = 15/365 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++KV VT G LGSG+LLYKLY+ H R++ +LE+EL    +NDE IK QMK HFEN
Sbjct  7     FWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRKLADLERELAHQRENDEFIKNQMKAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH MQYLS RISE++D+  + E+L KGK     L+++EKL+LWD LKILS
Sbjct  67    IQLIVDSTTLPHAMQYLSIRISEDIDVSDVMERLDKGK---GMLSSSEKLQLWDELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LGSS+  EE D+I R+D+Q +L+S
Sbjct  124   FTRMVLSLWSVTLLSLYIRVQVNILGRHLYVDTARALGSSHLLEELDLIDRNDEQKYLSS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L    +  LISD + A  EVLKGKQLKDV +T +L +TV++++D FMS GSPHHW+ 
Sbjct  184   ADFLVTNAMPGLISDMQDAVREVLKGKQLKDVITTAVLQETVMRVMDVFMSTGSPHHWVD  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D          SSD       S F+QLM ETR VL S EF ++V++SLK   DA
Sbjct  244   YLMMPQD-------ISGSSDEA----MSKFQQLMVETREVLISTEFTDIVEISLKCFTDA  292

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +VE++  Q     L+ G PLAK+LP++      +  EP++NR++Q+I++LPEV+L FTLL
Sbjct  293   LVEEMETQTVAGGLVTGKPLAKVLPQIEKTMHVITAEPSKNRFLQLIKDLPEVKLFFTLL  352

Query  1354  YSSTP  1368
             Y++ P
Sbjct  353   YANMP  357



>ref|XP_010923819.1| PREDICTED: peroxisome biogenesis protein 3-1-like isoform X2 
[Elaeis guineensis]
Length=377

 Score =   412 bits (1059),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 270/369 (73%), Gaps = 4/369 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++KV+V LGV GSG+++YK+YD HRRRI +L+K+LE + + DELIKAQ++ HFEN
Sbjct  7     FWSRHRRKVFVALGVFGSGYVIYKIYDDHRRRISDLDKKLEGERQVDELIKAQLQTHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP+ M YL SRI EELDL  LT+KLM+GK Q + LT+ EKLELW+ LKILS
Sbjct  67    IQRISDTTTLPYAMHYLRSRILEELDLSHLTDKLMQGKGQSHALTSKEKLELWEGLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR+  SLWSMT L LY+R QVNILGRHLY++ AR   SS   +E+D   R  +Q FLA+
Sbjct  127   FTRIASSLWSMTMLYLYVRAQVNILGRHLYLEIARGSESSQLLDESDSFSRHGRQDFLAT  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYL+ YG+ TLI + + A   VLK KQL D+FST  LH+T++QIL+ FMS+G P++W+ 
Sbjct  187   ADYLSAYGIHTLIMNMQNAAMGVLKEKQLGDLFSTVQLHETIIQILESFMSIGGPNYWIS  246

Query  997   YLMPEDPKIYS----LAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             YL+PE+   Y     ++A    D++ L      EQLM ETR VLSS +FGN V++SLK V
Sbjct  247   YLVPENAIAYRQMMVMSAKGFDDSSVLMDVGKLEQLMSETRMVLSSPDFGNTVEISLKKV  306

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             VD +V+DI +Q        G+PLAKLLPR+  L   LLEEP+ N+++Q I  LPEVEL +
Sbjct  307   VDLLVDDISMQLEGICPPSGVPLAKLLPRITQLSLPLLEEPSDNKFVQTIGRLPEVELFY  366

Query  1345  TLLYSSTPV  1371
             TLLY++ P+
Sbjct  367   TLLYANMPI  375



>ref|XP_010923811.1| PREDICTED: peroxisome biogenesis protein 3-1-like isoform X1 
[Elaeis guineensis]
Length=378

 Score =   412 bits (1059),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 270/369 (73%), Gaps = 4/369 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++KV+V LGV GSG+++YK+YD HRRRI +L+K+LE + + DELIKAQ++ HFEN
Sbjct  8     FWSRHRRKVFVALGVFGSGYVIYKIYDDHRRRISDLDKKLEGERQVDELIKAQLQTHFEN  67

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP+ M YL SRI EELDL  LT+KLM+GK Q + LT+ EKLELW+ LKILS
Sbjct  68    IQRISDTTTLPYAMHYLRSRILEELDLSHLTDKLMQGKGQSHALTSKEKLELWEGLKILS  127

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR+  SLWSMT L LY+R QVNILGRHLY++ AR   SS   +E+D   R  +Q FLA+
Sbjct  128   FTRIASSLWSMTMLYLYVRAQVNILGRHLYLEIARGSESSQLLDESDSFSRHGRQDFLAT  187

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYL+ YG+ TLI + + A   VLK KQL D+FST  LH+T++QIL+ FMS+G P++W+ 
Sbjct  188   ADYLSAYGIHTLIMNMQNAAMGVLKEKQLGDLFSTVQLHETIIQILESFMSIGGPNYWIS  247

Query  997   YLMPEDPKIYS----LAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             YL+PE+   Y     ++A    D++ L      EQLM ETR VLSS +FGN V++SLK V
Sbjct  248   YLVPENAIAYRQMMVMSAKGFDDSSVLMDVGKLEQLMSETRMVLSSPDFGNTVEISLKKV  307

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             VD +V+DI +Q        G+PLAKLLPR+  L   LLEEP+ N+++Q I  LPEVEL +
Sbjct  308   VDLLVDDISMQLEGICPPSGVPLAKLLPRITQLSLPLLEEPSDNKFVQTIGRLPEVELFY  367

Query  1345  TLLYSSTPV  1371
             TLLY++ P+
Sbjct  368   TLLYANMPI  376



>ref|XP_010461693.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Camelina sativa]
Length=358

 Score =   411 bits (1057),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 270/365 (74%), Gaps = 15/365 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++KV VT G LGSG+LLYKLY+ H R++ +LE+EL    +NDE IK QMK HFEN
Sbjct  7     FWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRKLADLERELAHQRENDEFIKNQMKAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH MQYLS RISE++D+  + E+L KGK     L+++EKL+LWD LKILS
Sbjct  67    IQLIVDSTTLPHAMQYLSIRISEDIDVSDVMERLDKGK---GMLSSSEKLQLWDELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMVLSLWS+  L+LYIRVQVNILGRHLY+DTAR LGSS+  EE D+I R+D+Q +L+S
Sbjct  124   FTRMVLSLWSVILLSLYIRVQVNILGRHLYVDTARALGSSHLLEELDLIDRNDEQKYLSS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L    +  LISD + A  EVLKGKQLKDV +TT+L +TV++++D FMS GSPHHW+ 
Sbjct  184   ADFLVTNAMPGLISDMQDAVREVLKGKQLKDVITTTVLQETVMRVMDVFMSTGSPHHWVD  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D          SSD       S F+QLM ETR VL S EF ++V++SLK   DA
Sbjct  244   YLMMPQD-------ISGSSDEA----MSKFQQLMVETREVLISTEFTDIVEISLKCFTDA  292

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +VE++  Q     L+ G PLAK+LP++      +  EP++NR++Q+I+++PEV+L FTLL
Sbjct  293   LVEEMETQTVAGGLVTGKPLAKVLPQIEKTMHVITAEPSKNRFLQLIKDMPEVKLFFTLL  352

Query  1354  YSSTP  1368
             Y++ P
Sbjct  353   YANMP  357



>ref|XP_011039101.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X2 
[Populus euphratica]
Length=333

 Score =   410 bits (1054),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 258/332 (78%), Gaps = 2/332 (1%)
 Frame = +1

Query  382   LEKELEADMKNDELIKAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLM  561
             +E+EL     NDE+IKAQ++ H EN+Q+IAD+TTLPH MQYL SRI+EELDL QLTE+L 
Sbjct  1     MERELARQRANDEVIKAQLQAHIENVQLIADTTTLPHAMQYLRSRIAEELDLSQLTERLQ  60

Query  562   KGKDQPNTLTAAEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR  741
             KGK +P TLT++EKLELWDRLKILSFT+MV+SLW++T L+LYI+VQVNILGRH+YIDTAR
Sbjct  61    KGKGKPYTLTSSEKLELWDRLKILSFTQMVVSLWAVTILSLYIKVQVNILGRHMYIDTAR  120

Query  742   RLGSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFST  921
              LGSS   E  D+I RDDQQ FL SAD+LAN GL  LIS+ +A  +EV++GK+L D+F+T
Sbjct  121   GLGSSLLLENVDLIDRDDQQKFLVSADFLANNGLPALISNIQAVVTEVIEGKKLIDLFNT  180

Query  922   TILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQE  1101
             T  H+TV+QILD+FMS+GS   W+ YLMPED   Y L   SSSD+  L  ++NF+QLM E
Sbjct  181   TSFHETVMQILDKFMSVGSLRQWIDYLMPEDSGHYKLGTSSSSDDMILPNSTNFDQLMVE  240

Query  1102  TRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGET--NLMVGMPLAKLLPRLAHLGQQL  1275
              R VLSSAEFG ++ +SLK  VDA+VED+  +C  T  +L  GMPLAKLL R+  +   L
Sbjct  241   ARTVLSSAEFGKIMGISLKVAVDALVEDMEAKCQSTGASLTSGMPLAKLLSRVMQIVPSL  300

Query  1276  LEEPNRNRYIQVIQNLPEVELIFTLLYSSTPV  1371
             L E ++N++IQ+I+ +PEVEL FTLLY++  V
Sbjct  301   LREASQNQFIQIIRTVPEVELFFTLLYANNLV  332



>ref|XP_008803262.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Phoenix dactylifera]
Length=374

 Score =   410 bits (1053),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/368 (55%), Positives = 272/368 (74%), Gaps = 1/368 (0%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++KV+  LGV GSG+++YKLYD HRRRI +LEK+LE + + +ELI+AQ+++HFE+
Sbjct  7     FWSRHRRKVFAALGVFGSGYVIYKLYDAHRRRISDLEKQLEGERQVNELIRAQLQKHFES  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP+ M YL SRI EELDL  LTEKLM+GK Q N +T+ EKLELW+RLK+LS
Sbjct  67    IQRISDTTTLPYAMHYLRSRILEELDLSHLTEKLMQGKAQSNAITSKEKLELWERLKVLS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR   SLWS+T L LY+RVQVNILGRHLY++ +R    S   +E+D   R  QQ FLA+
Sbjct  127   FTRTASSLWSVTMLCLYVRVQVNILGRHLYLEVSRGSEGSQLLDESDSFSRHGQQDFLAT  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYL+ +G+ TLI + + A  EVLK KQL+D FS   L  T++QIL+ FMS+G P+ W+ 
Sbjct  187   ADYLSAHGIDTLIMNMQKAAMEVLKEKQLRDPFSMVQLRKTIIQILELFMSIGGPNCWIS  246

Query  997   YLMPEDPKIY-SLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL+PE+   Y  L   S++D+ +L      EQLM ETR+VLSS +FGN+V++SLK VVD 
Sbjct  247   YLIPENAIAYRQLMVTSTNDSFNLMDVGKLEQLMSETRSVLSSPDFGNIVEISLKKVVDM  306

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +V+DI +Q    +   G+PLAKLLPR+  L   LLEEP+ N+++Q I+ LP+VEL +TLL
Sbjct  307   LVDDISMQLAGMSPPSGVPLAKLLPRVTQLCLPLLEEPSSNKFVQTIRGLPDVELFYTLL  366

Query  1354  YSSTPVVS  1377
             Y++  + S
Sbjct  367   YANMCIQS  374



>ref|XP_002883113.1| peroxin-3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59372.1| peroxin-3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score =   409 bits (1050),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 206/368 (56%), Positives = 273/368 (74%), Gaps = 13/368 (4%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++  FWR+H++K+ VT   LGSG+LLYKLY+ H R++ +LE+EL  + +NDE+IK QMK 
Sbjct  3     LVRGFWRKHRRKILVTTTCLGSGYLLYKLYNAHTRKLADLERELAYERENDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HF+NIQ+IAD+TTLPH M +LSSR+ EE+D+  + +KL KGK     L  +EKL LW+ L
Sbjct  63    HFDNIQMIADTTTLPHAMHHLSSRLVEEIDVSSIMDKLSKGK---GILIPSEKLHLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  EE D+I RDD+Q 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLEELDLIDRDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FLASAD+LA  G+ +LIS+ + A  EVLKGKQLKDVF+T +L +TV++ILD FMS GSPH
Sbjct  180   FLASADFLATSGIPSLISNMQGAVKEVLKGKQLKDVFTTRVLQETVMRILDVFMSTGSPH  239

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             HW+ YLM        +   SSSD T     + F QL+ ETR V++S +F NV ++SLK  
Sbjct  240   HWVDYLMMSQDATSDV---SSSDAT----VTKFHQLITETREVVTSNDFTNVAEISLKCC  292

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
               A+VE++  Q   T L  GM LAKLLP++     ++  EP++NR++Q+I++LPEV+L F
Sbjct  293   AVALVEEMETQ---TALAKGMQLAKLLPQIEKTMPEISAEPSKNRFLQLIRDLPEVKLFF  349

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  350   TLLYANMP  357



>ref|XP_010465898.1| PREDICTED: peroxisome biogenesis protein 3-1 [Camelina sativa]
Length=358

 Score =   408 bits (1049),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 200/368 (54%), Positives = 273/368 (74%), Gaps = 13/368 (4%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++  FWR+H++K+ VT   LGSG+LLYKLY+ H R + +LE+EL  + +NDE+IK QMK 
Sbjct  3     LVRGFWRKHRRKILVTTTCLGSGYLLYKLYNAHTRNLADLERELANERENDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HF+NIQ+IAD+ TLPH M +LSSR+ EE+D+  + +KL KGK     L  +EKL+LW+ L
Sbjct  63    HFDNIQMIADTATLPHAMHHLSSRLVEEIDVSSIMDKLSKGK---GILIPSEKLQLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTR+VLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  +E D+I RDD+Q 
Sbjct  120   KILSFTRLVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDLIDRDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FLASAD+L+  G+ +LISD ++A  EVLKGKQLKDV +T +L +TV++ILD FMS GSPH
Sbjct  180   FLASADFLSTSGMPSLISDMQSAVKEVLKGKQLKDVLTTKVLQETVMRILDVFMSTGSPH  239

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             HW+ YLM        +++P ++        S F QL+ ETR VL+S +F NV ++SLK+ 
Sbjct  240   HWVDYLMMSQDTTTDVSSPDAT-------LSKFHQLITETREVLTSNDFTNVAEISLKSC  292

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
               A+VE++  Q G   L  GM LAKLLP++     ++  EP++NR++Q+I++LPEV+L F
Sbjct  293   AVALVEEMETQTG---LATGMQLAKLLPQIEKTMPEISAEPDKNRFLQLIRDLPEVKLFF  349

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  350   TLLYANMP  357



>ref|XP_008812617.1| PREDICTED: peroxisome biogenesis protein 3-1-like isoform X2 
[Phoenix dactylifera]
Length=384

 Score =   409 bits (1051),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 204/371 (55%), Positives = 270/371 (73%), Gaps = 4/371 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++KV V LGV GSG+++YKL+D HRRRI +LE++LE + + +EL+KAQ++ HFEN
Sbjct  7     FWSRHRRKVLVALGVFGSGYVIYKLHDAHRRRISDLERQLEGERQVEELVKAQLQTHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP  M YL SRI EELDL  LT+KLM+GK Q N LT  EKLELW+RLKILS
Sbjct  67    IQRISDTTTLPSAMHYLRSRILEELDLSHLTDKLMQGKGQSNPLTFEEKLELWERLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR+  SLWSMT L LY RVQVNILGRHLY++ AR   SS   +E+D   R  QQ FLA+
Sbjct  127   FTRIASSLWSMTMLCLYARVQVNILGRHLYLEIARGSESSQLLDESDSFSRHGQQDFLAT  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYL+ +G+  LI + + A + VLK KQL+D+FS   L +T++QIL+ FMS+G P++W+ 
Sbjct  187   ADYLSAHGINMLIMNMQNAATGVLKEKQLRDLFSMVQLRETIIQILESFMSIGGPNYWML  246

Query  997   YLMPEDPKIYS----LAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             YL+PE+   Y     ++A    D++ L      EQLM ETR VLSS +FGN+V++SLK V
Sbjct  247   YLVPENATAYRQLMVMSAKGFDDSSILLDVGKLEQLMSETRMVLSSPDFGNIVEISLKKV  306

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             VD +V+DI +Q    +   G+PLAKLLPR+  L   LLEEP+ N++IQ I  LPEVE+ +
Sbjct  307   VDLLVDDISMQLEGISRPSGVPLAKLLPRITQLSLPLLEEPSDNKFIQSIGGLPEVEMFY  366

Query  1345  TLLYSSTPVVS  1377
             TLLY++ P+ S
Sbjct  367   TLLYANMPIPS  377



>ref|XP_008812616.1| PREDICTED: peroxisome biogenesis protein 3-1-like isoform X1 
[Phoenix dactylifera]
Length=385

 Score =   409 bits (1051),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 204/371 (55%), Positives = 270/371 (73%), Gaps = 4/371 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++KV V LGV GSG+++YKL+D HRRRI +LE++LE + + +EL+KAQ++ HFEN
Sbjct  8     FWSRHRRKVLVALGVFGSGYVIYKLHDAHRRRISDLERQLEGERQVEELVKAQLQTHFEN  67

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP  M YL SRI EELDL  LT+KLM+GK Q N LT  EKLELW+RLKILS
Sbjct  68    IQRISDTTTLPSAMHYLRSRILEELDLSHLTDKLMQGKGQSNPLTFEEKLELWERLKILS  127

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR+  SLWSMT L LY RVQVNILGRHLY++ AR   SS   +E+D   R  QQ FLA+
Sbjct  128   FTRIASSLWSMTMLCLYARVQVNILGRHLYLEIARGSESSQLLDESDSFSRHGQQDFLAT  187

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYL+ +G+  LI + + A + VLK KQL+D+FS   L +T++QIL+ FMS+G P++W+ 
Sbjct  188   ADYLSAHGINMLIMNMQNAATGVLKEKQLRDLFSMVQLRETIIQILESFMSIGGPNYWML  247

Query  997   YLMPEDPKIYS----LAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             YL+PE+   Y     ++A    D++ L      EQLM ETR VLSS +FGN+V++SLK V
Sbjct  248   YLVPENATAYRQLMVMSAKGFDDSSILLDVGKLEQLMSETRMVLSSPDFGNIVEISLKKV  307

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             VD +V+DI +Q    +   G+PLAKLLPR+  L   LLEEP+ N++IQ I  LPEVE+ +
Sbjct  308   VDLLVDDISMQLEGISRPSGVPLAKLLPRITQLSLPLLEEPSDNKFIQSIGGLPEVEMFY  367

Query  1345  TLLYSSTPVVS  1377
             TLLY++ P+ S
Sbjct  368   TLLYANMPIPS  378



>ref|XP_010500402.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Camelina sativa]
Length=358

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/365 (56%), Positives = 267/365 (73%), Gaps = 15/365 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++KV VT G LGSG+LLYKLY+ H R++ +LE+EL    +NDE IK QMK HFEN
Sbjct  7     FWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRKLADLERELAHQRENDEFIKNQMKAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH MQYLS RISEE+D+  + E+L KGK     L+++EKL+ WD LKILS
Sbjct  67    IQLIVDSTTLPHAMQYLSIRISEEIDVSDVMERLDKGK---GMLSSSEKLQFWDELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LGSS   E+ D+I R+D+Q +L+S
Sbjct  124   FTRMVLSLWSVTLLSLYIRVQVNILGRHLYVDTARALGSSRLLEDLDLIDRNDEQKYLSS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L    +  LISD + A  EVLKGKQLKDV +T +L +TV++++D FMS GSPHHW+ 
Sbjct  184   ADFLVTNAMPGLISDMQDAVREVLKGKQLKDVITTRVLQETVMRVMDVFMSTGSPHHWVD  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D          SSD       S F+QLM ETR VL S EF ++V++SLK   DA
Sbjct  244   YLMMPQD-------TSGSSDEA----MSKFQQLMVETREVLISTEFTDIVEISLKCFTDA  292

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +VE++  Q     L+ G PLAK+LP++      +  EP++NR++ +I++LPEV+L FTLL
Sbjct  293   LVEEMETQTIAGGLVTGKPLAKVLPQIEKTMHVITAEPSKNRFLHLIKDLPEVKLFFTLL  352

Query  1354  YSSTP  1368
             Y++ P
Sbjct  353   YANMP  357



>ref|XP_010506481.1| PREDICTED: peroxisome biogenesis protein 3-1-like [Camelina sativa]
Length=358

 Score =   407 bits (1046),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/368 (54%), Positives = 273/368 (74%), Gaps = 13/368 (4%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++  FWR+H++K+ VT   LGSG+LLYKLY+ H R + +LE+EL  + +NDE+IK QMK 
Sbjct  3     LVRGFWRKHRRKILVTSTCLGSGYLLYKLYNAHTRNLADLERELANERENDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HF+NIQ+IAD+ TLPH M +LSSR+ EE+D+  + +KL +GK     L  +EKL+LW+ L
Sbjct  63    HFDNIQMIADTATLPHAMHHLSSRLVEEIDVSSIMDKLSQGK---GLLIPSEKLQLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  +E D+I RDD+Q 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDLIDRDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FLASAD+L+  G+ +LISD ++A  EVLKGKQL DV +T +L +TV++ILD FMS GSPH
Sbjct  180   FLASADFLSTSGMPSLISDMQSAVKEVLKGKQLNDVLTTKVLQETVMRILDVFMSTGSPH  239

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             HW+ YLM        +++P ++        S F QL+ ETR VL+S +F NV ++SLK+ 
Sbjct  240   HWVDYLMMSQDTTTDVSSPDAT-------LSKFHQLITETREVLTSNDFTNVAEISLKSC  292

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
               A+VE+I  Q G   L +GM LAKLLP++     ++  EP++NR++Q+I++LPEV+L F
Sbjct  293   AVALVEEIETQTG---LAMGMQLAKLLPQIEKTMPEISAEPDKNRFLQLIRDLPEVKLFF  349

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  350   TLLYANMP  357



>gb|KDO62868.1| hypothetical protein CISIN_1g017709mg [Citrus sinensis]
 gb|KDO62869.1| hypothetical protein CISIN_1g017709mg [Citrus sinensis]
 gb|KDO62870.1| hypothetical protein CISIN_1g017709mg [Citrus sinensis]
Length=312

 Score =   404 bits (1039),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 191/309 (62%), Positives = 249/309 (81%), Gaps = 1/309 (0%)
 Frame = +1

Query  436   MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELW  615
             M+ H+E +Q IAD+TTLPH M YLS RI+EELDL  LT+KL++GK+QP TL+++EKLELW
Sbjct  1     MQAHYEEVQRIADATTLPHAMHYLSIRIAEELDLSPLTDKLLRGKEQPYTLSSSEKLELW  60

Query  616   DRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD  795
             DRLKILSFT++V++LW++T ++LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I RDD
Sbjct  61    DRLKILSFTKLVVALWAVTMVSLYIRVQVNILGRHLYIDTARGLGSSDLPEDADLIDRDD  120

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMG  975
             QQ FLAS DYLANYG+  +IS+ +AA  E LKGKQL+D+F+T +LH+T +QIL+ FMSMG
Sbjct  121   QQKFLASVDYLANYGMQAMISNVQAAADEALKGKQLRDIFNTVVLHETFMQILEVFMSMG  180

Query  976   SPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
             SPH W+ +LMP+D + Y L   S  D T L  A+ F++LM ETRAVLSSAE+ +VVD+S 
Sbjct  181   SPHQWVDFLMPQDIRFYKLVTASGHDETTLSGATKFDELMVETRAVLSSAEYTSVVDMSF  240

Query  1156  KTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVE  1335
             K  VDA+++++RVQ G  +L+ GMPLAKL+PR+  +   LL EP+ NR IQVI+ +PEVE
Sbjct  241   KAAVDALIDEMRVQSG-GSLISGMPLAKLVPRVVQMSPSLLAEPSNNRIIQVIRTIPEVE  299

Query  1336  LIFTLLYSS  1362
             L FTLLY++
Sbjct  300   LFFTLLYAN  308



>ref|XP_010487727.1| PREDICTED: peroxisome biogenesis protein 3-1-like [Camelina sativa]
Length=358

 Score =   406 bits (1044),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/368 (54%), Positives = 272/368 (74%), Gaps = 13/368 (4%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++  FWR+H++K+ VT   LGSG+LLYKLY+ H R + +LE+EL  + +NDE+IK QMK 
Sbjct  3     LVRGFWRKHRRKILVTTTCLGSGYLLYKLYNAHTRNLADLERELANERENDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HF+NIQ+IAD+ TLPH M +LS+R+ EE+D+  + +KL KGK     L  +EKL+LW+ L
Sbjct  63    HFDNIQMIADTATLPHAMNHLSNRLVEEIDVSSIMDKLSKGK---GILIPSEKLQLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  +E D+I RDD+Q 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDLIDRDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FLASAD+LA  G+ +LISD ++A  EVLKGKQL DV +T +L +TV++ILD FMS GSPH
Sbjct  180   FLASADFLATSGMPSLISDMQSAVKEVLKGKQLNDVLTTKVLQETVMRILDVFMSTGSPH  239

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             HW+ YLM        +++P ++        S F QL+ ETR VL+S +F NV ++SLK+ 
Sbjct  240   HWVDYLMMSQDTTTDVSSPDAT-------LSKFHQLITETREVLTSNDFTNVAEISLKSC  292

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
               A+VE++  Q G   L  GM LAKLLP++     ++  EP++NR++Q+I++LPEV+L F
Sbjct  293   AVALVEEMERQTG---LATGMQLAKLLPQIEKTMPEISAEPDKNRFLQLIRDLPEVKLFF  349

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  350   TLLYANMP  357



>ref|NP_001154410.1| peroxin 3 [Arabidopsis thaliana]
 gb|AEE32331.1| peroxin 3 [Arabidopsis thaliana]
Length=400

 Score =   407 bits (1045),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 208/401 (52%), Positives = 275/401 (69%), Gaps = 45/401 (11%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++KV VT G LGSG+LLYKLY+ H RR+ +LE+EL  + +NDE+IK QMK HFE+
Sbjct  7     FWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRRLADLERELAHERENDEIIKTQMKAHFES  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH MQ+LS RISEE+D+  + ++L +GK     L+  EKL+LWD LKILS
Sbjct  67    IQMIVDSTTLPHAMQFLSIRISEEIDVSHVMDRLNQGK---GMLSPPEKLQLWDELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSY-------------------  759
             FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LGSS+                   
Sbjct  124   FTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGSSHLLCTLLISSPTSYFSGKLT  183

Query  760   -----------------QEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVL  888
                                EE D+I RDD+Q FL+SAD+L    + +LISD + +  EVL
Sbjct  184   GCSVKNFSRLPFKATAACPEEVDLIDRDDEQKFLSSADFLVTNAMPSLISDMQGSAEEVL  243

Query  889   KGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYL-MPEDPKIYSLAAPSSSDNTDL  1065
             KGKQLKDV +T +L +TV+QI+D FMS GSPHHW+ YL MP+D K+    + ++SD++D 
Sbjct  244   KGKQLKDVITTRVLQETVMQIVDVFMSTGSPHHWVDYLMMPQDTKL----SRTTSDSSDE  299

Query  1066  CRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLL  1245
                S F QLM ETR VL S EF N+V++SLK   D +VE++  Q     L  G PLAK+L
Sbjct  300   A-VSKFHQLMVETREVLISTEFTNIVEISLKCFTDVLVEEMETQTEAGGLATGKPLAKVL  358

Query  1246  PRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
             P++      +  EP++NR++Q+I++LPEV+L FTLLY++ P
Sbjct  359   PQIEKTMNVITAEPSKNRFLQIIRDLPEVKLFFTLLYANMP  399



>ref|XP_010924142.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010924143.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X1 
[Elaeis guineensis]
Length=377

 Score =   404 bits (1038),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 199/371 (54%), Positives = 270/371 (73%), Gaps = 4/371 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RHK+KV+V LGV GSG+++YKLYD HRRRI +LEK++E + + +E I+AQ++ HFEN
Sbjct  7     FWNRHKRKVFVALGVFGSGYVIYKLYDAHRRRISDLEKQMEGERQVNEFIRAQLQTHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP+ M YL SRI+EELDL  LTEKLM+GK Q N +T+ EKLELW+ LK+LS
Sbjct  67    IQRISDTTTLPYAMHYLRSRIAEELDLSHLTEKLMQGKGQSNAITSKEKLELWETLKVLS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR   SLWSMT L LY+RVQVNILGRHLY++ AR   SS   +E+D   R  QQ FLA+
Sbjct  127   FTRTASSLWSMTMLCLYVRVQVNILGRHLYLEAARGSESSQPLDESDSFSRHGQQDFLAT  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYL+ +G+  LI + + A +EVLK KQL+D FS   LH+T++QIL+ FM++G  ++W+ 
Sbjct  187   ADYLSAHGINMLIVNMQKAATEVLKEKQLRDPFSMVQLHETIMQILELFMNIGGQNYWIN  246

Query  997   YLMPEDPKIYSLAAPSSS----DNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             YL+PE+   Y     +S+    D++        EQLM E R VLSS +FGN+V++SLK V
Sbjct  247   YLIPENEIAYRQLMVTSTNGFVDSSIPMDVGKLEQLMSEARMVLSSPDFGNIVEISLKKV  306

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             VD +V+DI +Q    +   G+PLAKLLPR+  L   LLEEP+ N+++Q I+ LP+VEL +
Sbjct  307   VDMLVDDISMQLVGMSPPSGVPLAKLLPRVTQLCHPLLEEPSSNKFVQTIRGLPDVELFY  366

Query  1345  TLLYSSTPVVS  1377
             TLLY++  + S
Sbjct  367   TLLYANLHIES  377



>ref|XP_006393377.1| hypothetical protein EUTSA_v10011573mg [Eutrema salsugineum]
 gb|ESQ30663.1| hypothetical protein EUTSA_v10011573mg [Eutrema salsugineum]
Length=379

 Score =   402 bits (1032),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 208/380 (55%), Positives = 268/380 (71%), Gaps = 24/380 (6%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++KV+VT G LGSG+LLYKLY+ H RR+ +LE+EL  + +NDELIK QMK HFEN
Sbjct  7     FWRKHRRKVFVTAGCLGSGYLLYKLYNSHTRRLADLERELANERENDELIKTQMKAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH MQYLS RI EE+ +  + E L  G+     LT +EKL+LWD LKILS
Sbjct  67    IQMIVDSTTLPHAMQYLSIRIDEEIGVSDVMETLNSGR---GMLTPSEKLQLWDELKILS  123

Query  637   --------------FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEA  774
                           FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LGSS+  EE 
Sbjct  124   MHFHTNIFVLPVLSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGSSHLLEEL  183

Query  775   DIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL  954
             D I R+D+Q FL+SAD L    +  LISD + A  EV+KGKQLKDV +T +L +TV++I+
Sbjct  184   DFIDRNDEQKFLSSADILVTSAMPGLISDMQNAVREVVKGKQLKDVITTRVLEETVIRIM  243

Query  955   DRFMSMGSPHHWLRYL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEF  1131
             D FMS GSPHHW+ YL MP+D  + S     SSD T     + F QLM ETR VL+S EF
Sbjct  244   DVFMSTGSPHHWVDYLMMPQDTNL-SRNTSGSSDET----VTKFHQLMVETREVLTSTEF  298

Query  1132  GNVVDVSLKTVVDAMVEDIRVQC-GETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQ  1308
              ++V++SLK   DA+VE++  Q      L  GMPLAK+LP++      +  EP++NR++Q
Sbjct  299   TDIVEISLKCFTDALVEEMETQTLSGAGLATGMPLAKVLPQIEKTIHVITAEPSKNRFLQ  358

Query  1309  VIQNLPEVELIFTLLYSSTP  1368
             +I++L EV+L FTLLY++ P
Sbjct  359   LIRDLSEVQLFFTLLYANMP  378



>gb|AAM63222.1| unknown [Arabidopsis thaliana]
Length=358

 Score =   400 bits (1029),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 201/368 (55%), Positives = 269/368 (73%), Gaps = 13/368 (4%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++   WR+H++K+ VT   LGSG+LLYKLY+ H R++ +LE+EL  + +NDE+IK QMK 
Sbjct  3     LVRGLWRKHRRKILVTTTCLGSGYLLYKLYNAHTRKLADLERELANERENDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HF+NIQ+IAD+TTLPH + +LSSR+ EE+D+  + +KL KGK     L  +EKL+LW+ L
Sbjct  63    HFDNIQMIADTTTLPHAIHHLSSRVVEEIDVSSIMDKLSKGK---GILIPSEKLQLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  +E D+I RDD+Q 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDLIERDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL SAD+LA  G+ +LIS+ + A  EVLKGKQLKDV +T+ L +TV++ILD FMS GSPH
Sbjct  180   FLTSADFLATSGMPSLISNMQNAVKEVLKGKQLKDVLTTSALRETVMRILDVFMSTGSPH  239

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             HW+ YLM        +   SSSD T     + F  L+ ETR VL+S +F NV ++SLK  
Sbjct  240   HWVDYLMMSQDATTDV---SSSDAT----VTKFHLLITETREVLASNDFSNVAEISLKCC  292

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
               A+VE++  Q G   L  GM LAKLLP++     ++  EP +NR++Q+I++LPEV+L F
Sbjct  293   AVALVEEMETQTG---LATGMQLAKLLPQIEKTMPEISAEPEKNRFLQLIRDLPEVKLFF  349

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  350   TLLYANMP  357



>ref|NP_566598.1| peroxin 3-1 [Arabidopsis thaliana]
 sp|Q8LDG7.2|PEX31_ARATH RecName: Full=Peroxisome biogenesis protein 3-1; AltName: Full=Peroxin-3-1; 
Short=AtPEX3-1 [Arabidopsis thaliana]
 gb|AEE76056.1| peroxin 3-1 [Arabidopsis thaliana]
Length=358

 Score =   400 bits (1029),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 201/368 (55%), Positives = 269/368 (73%), Gaps = 13/368 (4%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++   WR+H++K+ VT   LGSG+LLYKLY+ H R++ +LE+EL  + +NDE+IK QMK 
Sbjct  3     LVRGLWRKHRRKILVTTTCLGSGYLLYKLYNAHTRKLADLERELANERENDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HF+NIQ+IAD+TTLPH + +LSSR+ EE+D+  + +KL KGK     L  +EKL+LW+ L
Sbjct  63    HFDNIQMIADTTTLPHAIHHLSSRVVEEIDVSSIMDKLSKGK---GILIPSEKLQLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  +E D+I RDD+Q 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDLIERDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL SAD+LA  G+ +LIS+ + A  EVLKGKQLKDV +T+ L +TV++ILD FMS GSPH
Sbjct  180   FLTSADFLATSGMPSLISNMQNAVKEVLKGKQLKDVLTTSALRETVMRILDVFMSTGSPH  239

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             HW+ YLM        +   SSSD T     + F  L+ ETR VL+S +F NV ++SLK  
Sbjct  240   HWVDYLMMSQDATTDV---SSSDAT----VTKFHLLITETREVLTSNDFSNVAEISLKCC  292

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
               A+VE++  Q G   L  GM LAKLLP++     ++  EP +NR++Q+I++LPEV+L F
Sbjct  293   AVALVEEMETQTG---LATGMQLAKLLPQIEKTMPEISAEPEKNRFLQLIRDLPEVKLFF  349

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  350   TLLYANMP  357



>gb|AET05546.2| peroxisome biogenesis protein [Medicago truncatula]
Length=363

 Score =   400 bits (1029),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/368 (53%), Positives = 271/368 (74%), Gaps = 11/368 (3%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  FWRRH++K+++++G++G G+ LYKLY  HR+R+  LE EL+   ++DELIK+QM+ H
Sbjct  4     VRDFWRRHRRKIFLSVGIVGGGYCLYKLYGAHRQRLDALEMELDVQRQSDELIKSQMQAH  63

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FENIQ I+D+ TLPH M  LS RI+++LDL  L E+L++GK QPNTLT +EKL+LW RLK
Sbjct  64    FENIQRISDTITLPHSMHNLSCRIAQDLDLSHLLERLIQGKGQPNTLTQSEKLDLWGRLK  123

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSS-YQEEEADIIYRDDQQL  804
             ILSFTRM LS+W+   L+LY +VQVNILGRHLYIDTAR L SS    E  D++  +D+Q 
Sbjct  124   ILSFTRMALSVWATVMLSLYTKVQVNILGRHLYIDTARSLESSNLLMESEDVVDGEDKQK  183

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL S D+L+ +G+  LISD E AT EVLKGKQL  +F+ T   +T+  IL+ FMS GSPH
Sbjct  184   FLGSVDFLSQHGMPALISDMEEATKEVLKGKQLTSLFNNTTFDETITDILNTFMSRGSPH  243

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
              W++Y++PED K++S A  S S++T     + F+QL+ E R VLSSAEFG+VV++SLK V
Sbjct  244   FWVKYIIPEDAKLHSTA--SGSNDTVPLDMTEFDQLVMEARGVLSSAEFGSVVEISLKAV  301

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             VD +    R   G T++    PLA+ LP++A +   LLEEP++N++IQ+++N+PEVEL  
Sbjct  302   VDTL----RELMGTTSV----PLARALPQVAQMCPLLLEEPSKNQFIQILKNIPEVELFL  353

Query  1345  TLLYSSTP  1368
             T LY++ P
Sbjct  354   TFLYANMP  361



>ref|XP_007209400.1| hypothetical protein PRUPE_ppa009207mg [Prunus persica]
 gb|EMJ10599.1| hypothetical protein PRUPE_ppa009207mg [Prunus persica]
Length=302

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 245/309 (79%), Gaps = 11/309 (4%)
 Frame = +1

Query  436   MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELW  615
             M+ HFENIQ IAD+TTLPH MQYL+SRI+EELDL  LT++LM+ K Q    T+AEKLELW
Sbjct  1     MQAHFENIQRIADTTTLPHAMQYLNSRIAEELDLSHLTDRLMQAKGQS---TSAEKLELW  57

Query  616   DRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD  795
             DRLKILSFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I+RDD
Sbjct  58    DRLKILSFTRMVLSLWAMTILSLYIRVQVNILGRHLYIDTARGLGSSLLIEDADLIHRDD  117

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMG  975
             QQ FLAS+DYLA YG+  LIS+ +AA +EVLKGKQL+D F+ T+LH TV+QILD+FMS G
Sbjct  118   QQKFLASSDYLARYGMPALISNIQAAATEVLKGKQLRDSFNATVLHATVMQILDKFMSTG  177

Query  976   SPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
              PHHW+ YLMPED +   LA   S+D+T L   + FEQLM ETRAV+SSAEFG+V D++L
Sbjct  178   DPHHWVNYLMPEDARALELATAFSNDSTLLPDVTKFEQLMVETRAVISSAEFGSVADIAL  237

Query  1156  KTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVE  1335
             + VVD ++ D+  Q G      G+ LAK+L R+A +G  +LEEP  +++IQ+I N+PEVE
Sbjct  238   RAVVDTVIVDMGAQPG------GVQLAKVLARVARMGPTVLEEP--SKFIQIILNVPEVE  289

Query  1336  LIFTLLYSS  1362
               FTL+YSS
Sbjct  290   RFFTLIYSS  298



>gb|KEH21416.1| peroxisome biogenesis protein [Medicago truncatula]
Length=386

 Score =   400 bits (1028),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 197/375 (53%), Positives = 274/375 (73%), Gaps = 14/375 (4%)
 Frame = +1

Query  256   NCK---MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELI  426
             NC     +  FWRRH++K+++++G++G G+ LYKLY  HR+R+  LE EL+   ++DELI
Sbjct  20    NCYYHYCVRDFWRRHRRKIFLSVGIVGGGYCLYKLYGAHRQRLDALEMELDVQRQSDELI  79

Query  427   KAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKL  606
             K+QM+ HFENIQ I+D+ TLPH M  LS RI+++LDL  L E+L++GK QPNTLT +EKL
Sbjct  80    KSQMQAHFENIQRISDTITLPHSMHNLSCRIAQDLDLSHLLERLIQGKGQPNTLTQSEKL  139

Query  607   ELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSS-YQEEEADII  783
             +LW RLKILSFTRM LS+W+   L+LY +VQVNILGRHLYIDTAR L SS    E  D++
Sbjct  140   DLWGRLKILSFTRMALSVWATVMLSLYTKVQVNILGRHLYIDTARSLESSNLLMESEDVV  199

Query  784   YRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRF  963
               +D+Q FL S D+L+ +G+  LISD E AT EVLKGKQL  +F+ T   +T+  IL+ F
Sbjct  200   DGEDKQKFLGSVDFLSQHGMPALISDMEEATKEVLKGKQLTSLFNNTTFDETITDILNTF  259

Query  964   MSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
             MS GSPH W++Y++PED K++S A  S S++T     + F+QL+ E R VLSSAEFG+VV
Sbjct  260   MSRGSPHFWVKYIIPEDAKLHSTA--SGSNDTVPLDMTEFDQLVMEARGVLSSAEFGSVV  317

Query  1144  DVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNL  1323
             ++SLK VVD + E +    G T++    PLA+ LP++A +   LLEEP++N++IQ+++N+
Sbjct  318   EISLKAVVDTLRELM----GTTSV----PLARALPQVAQMCPLLLEEPSKNQFIQILKNI  369

Query  1324  PEVELIFTLLYSSTP  1368
             PEVEL  T LY++ P
Sbjct  370   PEVELFLTFLYANMP  384



>ref|XP_009147951.1| PREDICTED: peroxisome biogenesis protein 3-2 [Brassica rapa]
Length=367

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/367 (54%), Positives = 269/367 (73%), Gaps = 10/367 (3%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
              W +H++K+ VT G LGSG+LLYKLY+ H RR+ +L+++L  D ++DE IKAQMK HFEN
Sbjct  7     LWSKHRRKILVTAGCLGSGYLLYKLYNSHTRRLADLQRQLANDREHDENIKAQMKAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH M+ LS  I EE+D+  + E+L +GK     L+ +EKL LWD+LKILS
Sbjct  67    IQMIVDSTTLPHAMRCLSISIREEIDVSSVMERLNRGK---GVLSQSEKLHLWDQLKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRL--GSSYQEEEADIIYRDDQQLFL  810
             FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR L   SS+  EE D+I RDD+Q FL
Sbjct  124   FTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALDTSSSHLLEELDVIDRDDEQKFL  183

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW  990
             +SAD+L    +  LIS+ ++A SEVLKG QLKDV +T +L +T+++I+D FMS GSPHHW
Sbjct  184   SSADFLVTNAMPGLISNMQSAVSEVLKGMQLKDVITTRVLQETLLRIVDVFMSSGSPHHW  243

Query  991   LRYL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVV  1167
             + YL MP+D K+    +  SSD T     S F QLM ETR VL+S EF ++V++SLK   
Sbjct  244   VDYLMMPQDTKLSRTTSDGSSDET----VSKFNQLMVETRQVLTSTEFTDIVEISLKCFT  299

Query  1168  DAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFT  1347
             DA+VE++  Q     L  GMPLAK+LP++      ++ EP +N+++Q+I+++ EV++ FT
Sbjct  300   DALVEEMETQSISGGLATGMPLAKMLPQIEKTIPVIIAEPGKNQFLQLIRDMSEVQVFFT  359

Query  1348  LLYSSTP  1368
             LLY+S P
Sbjct  360   LLYASMP  366



>ref|XP_009135568.1| PREDICTED: peroxisome biogenesis protein 3-1-like isoform X1 
[Brassica rapa]
Length=367

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/377 (55%), Positives = 268/377 (71%), Gaps = 20/377 (5%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             +I  FWR+H+KK+ VT   LGSG+LLYKLY+ H R + +LE+EL  +  NDE+IK QMK 
Sbjct  3     LIRSFWRKHRKKILVTTTCLGSGYLLYKLYNAHTRSLADLERELADERHNDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HFENIQ+IAD TTLPH ++ LSSRI+EE+ +  + E L KGK    TL  +EKL LW+ L
Sbjct  63    HFENIQMIADVTTLPHALRRLSSRIAEEIHVSSVMETLSKGK---GTLVPSEKLHLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVN+LGRHLYIDTAR L +S+  EE D+I R++++ 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNVLGRHLYIDTARGLTTSHLLEELDLIDREEEKK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL SADYLA  G+ +LISD + A  EVLKGKQLKDV +T  L +TV++ILD FMS GSPH
Sbjct  180   FLTSADYLATNGMPSLISDMKRAVKEVLKGKQLKDVLTTRSLEETVIRILDVFMSKGSPH  239

Query  985   HWLRYLM--------PEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
             HW+ YLM        P D    S+  PSS D T     S   QL+ ETR VL+S EF NV
Sbjct  240   HWVDYLMMAQDTTMSPRDTTTTSV--PSSDDAT----VSKLHQLINETREVLTSTEFTNV  293

Query  1141  VDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQN  1320
              ++SLK+   A+ E++  Q G   L  GM LAKLLP++  +  ++   P+ NR++Q+I++
Sbjct  294   AEISLKSCTLALGEEMEKQTG---LAAGMQLAKLLPQIEKIVPEISAVPDENRFLQLIRD  350

Query  1321  LPEVELIFTLLYSSTPV  1371
             LPEV+L FTLLYS+ P+
Sbjct  351   LPEVQLFFTLLYSNMPL  367



>ref|XP_007036708.1| Peroxin 3 isoform 5, partial [Theobroma cacao]
 gb|EOY21209.1| Peroxin 3 isoform 5, partial [Theobroma cacao]
Length=296

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 230/284 (81%), Gaps = 0/284 (0%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
              WRRHK+KV VT GVLGSG+ LYKLYD HR R+ +LE++L ++ +NDE IKAQM+ HFEN
Sbjct  7     LWRRHKRKVLVTAGVLGSGYFLYKLYDAHRHRLADLERQLASERENDEFIKAQMQVHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ IAD+TTLPH M YLS RI+E+LDL  LT +LM+GK QPNTL+++EKL+LWDRLKILS
Sbjct  67    IQRIADTTTLPHAMHYLSCRIAEDLDLSHLTNRLMRGKGQPNTLSSSEKLQLWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMV+S+W++T L+LYIRVQVNILGRHLYI TAR LGSS   E+A++I RDDQQ FLA+
Sbjct  127   FTRMVVSIWAVTLLSLYIRVQVNILGRHLYIATARGLGSSNLLEDAELIDRDDQQKFLAN  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+LAN+GL+TLIS  + A +EVLK KQL+D F TT+L   ++QILD FMSMGSPHHW+ 
Sbjct  187   ADFLANHGLSTLISHMQTAATEVLKAKQLRDFFDTTVLQQIIMQILDMFMSMGSPHHWVD  246

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAE  1128
              LMPEDP++Y  A  SSSD T+    + F QLM ETR VLSS E
Sbjct  247   CLMPEDPRLYKFAMASSSDKTNPPDFTQFNQLMVETREVLSSGE  290



>ref|XP_006298003.1| hypothetical protein CARUB_v10014048mg [Capsella rubella]
 gb|EOA30901.1| hypothetical protein CARUB_v10014048mg [Capsella rubella]
Length=358

 Score =   397 bits (1020),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/368 (53%), Positives = 266/368 (72%), Gaps = 13/368 (4%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++   WR+H++K+ VT   LGSG+LLYKLY+ H R++ +LE+EL  +  NDE+IK QMK 
Sbjct  3     LVRGLWRKHRRKILVTTTCLGSGYLLYKLYNAHTRKLADLEQELANERVNDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HF+NIQ+IAD+ TLPH M +LSSR+ EE+D+  +  KL KGK     L  +EKL+LW+ L
Sbjct  63    HFDNIQMIADTATLPHAMHHLSSRLVEEMDVSSIMAKLSKGK---GILIPSEKLQLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LG+S+  EE D+I RDD+Q 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGNSHLLEELDLIDRDDEQK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL SAD+LA  G+  LI + ++A  EVLKGKQLKDV +T +L +TV++ILD FMS  SPH
Sbjct  180   FLTSADFLATTGMANLICNMQSAVKEVLKGKQLKDVLTTRVLQETVMRILDVFMSTESPH  239

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             HW+ YLM         ++P ++        S F QL+ ETR VL+S +F NV ++SLK+ 
Sbjct  240   HWVDYLMMSQDTTTDASSPDAT-------VSKFHQLITETREVLTSNDFTNVAEISLKSC  292

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
               A+VE++  + G   L  GM LAKLLP++     ++  EP++NR++Q+I++LPEV+L F
Sbjct  293   AVALVEEMETKTG---LATGMQLAKLLPQIEKTMPEISAEPDKNRFLQLIRDLPEVKLFF  349

Query  1345  TLLYSSTP  1368
             TLLY++ P
Sbjct  350   TLLYANMP  357



>ref|XP_007036709.1| Peroxin 3 isoform 6, partial [Theobroma cacao]
 gb|EOY21210.1| Peroxin 3 isoform 6, partial [Theobroma cacao]
Length=328

 Score =   394 bits (1012),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/283 (66%), Positives = 230/283 (81%), Gaps = 0/283 (0%)
 Frame = +1

Query  280   WRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFENI  459
             WRRHK+KV VT GVLGSG+ LYKLYD HR R+ +LE++L ++ +NDE IKAQM+ HFENI
Sbjct  24    WRRHKRKVLVTAGVLGSGYFLYKLYDAHRHRLADLERQLASERENDEFIKAQMQVHFENI  83

Query  460   QIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILSF  639
             Q IAD+TTLPH M YLS RI+E+LDL  LT +LM+GK QPNTL+++EKL+LWDRLKILSF
Sbjct  84    QRIADTTTLPHAMHYLSCRIAEDLDLSHLTNRLMRGKGQPNTLSSSEKLQLWDRLKILSF  143

Query  640   TRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLASA  819
             TRMV+S+W++T L+LYIRVQVNILGRHLYI TAR LGSS   E+A++I RDDQQ FLA+A
Sbjct  144   TRMVVSIWAVTLLSLYIRVQVNILGRHLYIATARGLGSSNLLEDAELIDRDDQQKFLANA  203

Query  820   DYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRY  999
             D+LAN+GL+TLIS  + A +EVLK KQL+D F TT+L   ++QILD FMSMGSPHHW+  
Sbjct  204   DFLANHGLSTLISHMQTAATEVLKAKQLRDFFDTTVLQQIIMQILDMFMSMGSPHHWVDC  263

Query  1000  LMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAE  1128
             LMPEDP++Y  A  SSSD T+    + F QLM ETR VLSS E
Sbjct  264   LMPEDPRLYKFAMASSSDKTNPPDFTQFNQLMVETREVLSSGE  306



>emb|CDX75959.1| BnaC03g40420D [Brassica napus]
Length=367

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 266/377 (71%), Gaps = 20/377 (5%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             ++  FWR+H+KK+ VT   LGSG+LLYKLY+ H R + +LE+EL  +  NDE+IK QMK 
Sbjct  3     LVRSFWRKHRKKILVTTTCLGSGYLLYKLYNAHTRNLADLERELADERHNDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HFENIQ+IAD TTLPH ++ LSSRI EE+ +  + E L KGK    TL  +EKL LW+ L
Sbjct  63    HFENIQMIADVTTLPHALRRLSSRIGEEIHVSGVMETLSKGK---GTLVPSEKLHLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KILSFTRMVLSLWS+T L+LYIRVQVN+LGRHLYIDTAR L SS+  EE D+I R++++ 
Sbjct  120   KILSFTRMVLSLWSVTMLSLYIRVQVNVLGRHLYIDTARGLTSSHLLEELDLIDREEEKK  179

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL SADYLA  G+ +LISD + A  EVLKGKQL D+ +T  L +TV++ILD FMS GSPH
Sbjct  180   FLTSADYLATNGMPSLISDMKRAVKEVLKGKQLNDMLTTRSLEETVIRILDVFMSKGSPH  239

Query  985   HWLRYLM--------PEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
             HW+ YLM        P D    S+  PSS D T     +   QL+ ETR VL+S EF NV
Sbjct  240   HWVDYLMMAQDATMSPRDTTTTSV--PSSDDAT----VTKLHQLINETREVLTSTEFTNV  293

Query  1141  VDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQN  1320
              ++SLK+   A+VE++  Q G   L  GM LAKLLP++     ++   P+ NR++Q+I++
Sbjct  294   AEISLKSCTVALVEEMEKQTG---LAAGMQLAKLLPQIEKTVPEISAVPDENRFLQLIRD  350

Query  1321  LPEVELIFTLLYSSTPV  1371
             LPEV+L FTLLYS+ P+
Sbjct  351   LPEVQLFFTLLYSNMPL  367



>ref|XP_009419367.1| PREDICTED: peroxisome biogenesis protein 3-1-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   394 bits (1012),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 195/371 (53%), Positives = 269/371 (73%), Gaps = 5/371 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++++ ++LGVLGSG+L+YKLY+ H RR+ ELE++L+   + DELIK Q++ HFEN
Sbjct  7     FWSRHRRRILISLGVLGSGYLVYKLYESHSRRLSELERQLDGARRVDELIKNQLQAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP+ M YL SRI E+LDL  LTEKLM+GK Q N L+  EKLELWDRLKILS
Sbjct  67    IQRISDTTTLPYAMHYLRSRILEDLDLSHLTEKLMQGKGQSNALSGKEKLELWDRLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR   SLWSMT L LY+RVQVNILGR LY++ AR   +S   +E D   R  QQ FLA+
Sbjct  127   FTRTAASLWSMTVLCLYVRVQVNILGRQLYLEIARGSENSLSLDEIDSFSRHGQQDFLAT  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA YG+ +LI + + A  EVLK KQLK+ FS   L +T++QIL+ FM+    ++W+ 
Sbjct  187   ADYLATYGINSLIMNMQNAAMEVLKDKQLKEPFSMLQLRETMIQILEMFMNTSESNYWIH  246

Query  997   YLMPEDPKIY----SLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             YL+P++   Y    +++A    D++ L  A+  EQL+ ET AVLSS +FGNV+++SLK V
Sbjct  247   YLVPDNVNDYKQQMAMSAKGFDDSSILMDATKLEQLLFETHAVLSSPDFGNVLEISLKKV  306

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             V+ ++EDI +  G T+  +G+PL KLLP++  L   LL+EP+ N+++Q I++L EVEL +
Sbjct  307   VNILIEDIGIHVGGTS-SIGIPLVKLLPQITRLSLPLLDEPSSNKFVQAIRSLSEVELFY  365

Query  1345  TLLYSSTPVVS  1377
             TLLY++ P  S
Sbjct  366   TLLYANMPSAS  376



>ref|NP_001154622.1| peroxin 3-1 [Arabidopsis thaliana]
 gb|AEE76057.1| peroxin 3-1 [Arabidopsis thaliana]
Length=376

 Score =   394 bits (1011),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 265/361 (73%), Gaps = 13/361 (4%)
 Frame = +1

Query  286   RHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFENIQI  465
             +H++K+ VT   LGSG+LLYKLY+ H R++ +LE+EL  + +NDE+IK QMK HF+NIQ+
Sbjct  28    KHRRKILVTTTCLGSGYLLYKLYNAHTRKLADLERELANERENDEIIKTQMKAHFDNIQM  87

Query  466   IADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILSFTR  645
             IAD+TTLPH + +LSSR+ EE+D+  + +KL KGK     L  +EKL+LW+ LKILSFTR
Sbjct  88    IADTTTLPHAIHHLSSRVVEEIDVSSIMDKLSKGK---GILIPSEKLQLWNELKILSFTR  144

Query  646   MVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLASADY  825
             MVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  +E D+I RDD+Q FL SAD+
Sbjct  145   MVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDLIERDDEQKFLTSADF  204

Query  826   LANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYLM  1005
             LA  G+ +LIS+ + A  EVLKGKQLKDV +T+ L +TV++ILD FMS GSPHHW+ YLM
Sbjct  205   LATSGMPSLISNMQNAVKEVLKGKQLKDVLTTSALRETVMRILDVFMSTGSPHHWVDYLM  264

Query  1006  PEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVED  1185
                     +   SSSD T     + F  L+ ETR VL+S +F NV ++SLK    A+VE+
Sbjct  265   MSQDATTDV---SSSDAT----VTKFHLLITETREVLTSNDFSNVAEISLKCCAVALVEE  317

Query  1186  IRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSST  1365
             +  Q G   L  GM LAKLLP++     ++  EP +NR++Q+I++LPEV+L FTLLY++ 
Sbjct  318   METQTG---LATGMQLAKLLPQIEKTMPEISAEPEKNRFLQLIRDLPEVKLFFTLLYANM  374

Query  1366  P  1368
             P
Sbjct  375   P  375



>emb|CDY51933.1| BnaAnng11100D [Brassica napus]
Length=365

 Score =   389 bits (1000),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 262/373 (70%), Gaps = 16/373 (4%)
 Frame = +1

Query  253   GNCKMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKA  432
             G C+    FWR+H+KK+ VT   LGSG+LLYKLY+ H R + +LE+EL  +  ND +IK 
Sbjct  2     GKCR---SFWRKHRKKILVTTTCLGSGYLLYKLYNAHTRSLADLERELAEERHNDAIIKT  58

Query  433   QMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLEL  612
             QMK HFENIQ+IAD TTLPH ++ LSSRI+EE+ +  + E L KGK    TL  +EKL L
Sbjct  59    QMKAHFENIQMIADVTTLPHALRRLSSRIAEEIHVSGVMETLSKGK---GTLVPSEKLYL  115

Query  613   WDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRD  792
             W+ LKILSFTRMVLSLWS+T L+LYIRVQVN+LGRHLYIDTAR L +S+  EE D+I R+
Sbjct  116   WNELKILSFTRMVLSLWSVTMLSLYIRVQVNVLGRHLYIDTARGLTTSHLLEELDLIDRE  175

Query  793   DQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSM  972
             +++ FL SADYLA  G+ +LISD + A  EVLKGKQLKDV +T  L +TV++ILD FMS 
Sbjct  176   EEKKFLTSADYLATNGMPSLISDMKRAVKEVLKGKQLKDVLTTRTLEETVIRILDVFMSK  235

Query  973   GSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVS  1152
             GSPHHW+ YLM       S   P  +  T     S    L+ ETR VL+S EF NV ++S
Sbjct  236   GSPHHWVDYLMMAQDTTMS---PRDTTTT----VSKLHHLINETREVLTSTEFTNVAEIS  288

Query  1153  LKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEV  1332
             LK+   A+VE++  Q G   L  GM LAKLLP++     ++   P+ NR++Q+I++LPEV
Sbjct  289   LKSCTVALVEEMEKQTG---LAAGMQLAKLLPQIEKTIPEISAVPDENRFLQLIRDLPEV  345

Query  1333  ELIFTLLYSSTPV  1371
             +L FTLLYS+ P+
Sbjct  346   QLFFTLLYSNMPL  358



>ref|XP_009113491.1| PREDICTED: peroxisome biogenesis protein 3-1 isoform X1 [Brassica 
rapa]
Length=357

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 262/362 (72%), Gaps = 15/362 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H+KK+ VT   LGSG L+YKLY+ H R + +LE+EL  +  NDELIKAQMK HFE 
Sbjct  7     FWRKHRKKILVTTTCLGSGLLIYKLYNAHTRNLADLERELANERHNDELIKAQMKAHFET  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+IAD+TTLPH + +LSSRI EE+++  + EKL +GK    TL  +EKL LW  LKILS
Sbjct  67    IQMIADTTTLPHALHHLSSRIVEEINVSSVMEKLSRGK---GTLVPSEKLHLWSELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMV++LWS+T L+LYIRVQVNILGRHLYIDTAR L SS+  EE D+I R+D+Q FL S
Sbjct  124   FTRMVVTLWSVTMLSLYIRVQVNILGRHLYIDTARGLASSHLLEELDLIDREDEQKFLTS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA   + +LIS  ++A  EVLKGKQLKDV +T  L +TV++IL  FMS GSPHHW+ 
Sbjct  184   ADYLATNSMPSLISHVKSAVKEVLKGKQLKDVLTTRTLEETVIRILGLFMSTGSPHHWID  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D    +    SSSD T     + F  L+ ETR VL+S EF +VV+++LK+   A
Sbjct  244   YLMMPQD----TTTDVSSSDAT----VTKFHLLITETREVLTSNEFTDVVEIALKSCTVA  295

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +VE++  Q G   L  G+ LAKLLP++     ++   P++NR++Q+I++LP+V L FTLL
Sbjct  296   LVEEMETQPG---LATGIQLAKLLPQIEKTVPEISAVPDKNRFLQLIRDLPQVHLFFTLL  352

Query  1354  YS  1359
             YS
Sbjct  353   YS  354



>ref|XP_009403556.1| PREDICTED: peroxisome biogenesis protein 3-1-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   386 bits (991),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 267/371 (72%), Gaps = 5/371 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW R+++K+ ++LGVLGSG+ +YKLY+ H RR+ +LE++L+   + DELIK Q+  HFEN
Sbjct  7     FWGRYRRKILISLGVLGSGYFVYKLYESHSRRLSDLERQLDGARQVDELIKKQLHAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP+ M YL SRISE+LDL  LTEKLM+GK   ++L   EKLELW+RLKILS
Sbjct  67    IQRISDTTTLPYAMHYLRSRISEDLDLSHLTEKLMQGKGHSSSLAVKEKLELWERLKILS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR   SLWSMT L LY+RVQVNILGR LY++ AR   +S   +E D   R  QQ FLA+
Sbjct  127   FTRTAASLWSMTVLCLYVRVQVNILGRQLYVEIARDSENSEALDEIDSFGRHSQQDFLAT  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA YG+ +L+ + ++A  EVLK KQLK+ F+   L +T++QIL RFM++G P++WL 
Sbjct  187   ADYLATYGINSLVMNMQSAAREVLKDKQLKEPFTAVQLRETMIQILQRFMNIGEPNYWLS  246

Query  997   YLMPEDPKIY----SLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             Y++PE+   Y    +++     D++ +  AS  E L+ ETRAVLSS +F NV+++SL  V
Sbjct  247   YVVPENVNDYKQQMAMSDTGFDDSSIIMDASKLEHLLFETRAVLSSPDFRNVLEISLNKV  306

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             VD + ED+ +  G T+   G+PLAKLLP++  L   LL EP  N+++Q +++LPEVEL +
Sbjct  307   VDILTEDVGIHVGGTS-SSGVPLAKLLPQITWLSLPLLGEPGDNKFVQSVRSLPEVELFY  365

Query  1345  TLLYSSTPVVS  1377
             TLLY++ P+ +
Sbjct  366   TLLYANMPLAT  376



>emb|CDX95552.1| BnaC01g34440D [Brassica napus]
Length=357

 Score =   385 bits (988),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 262/362 (72%), Gaps = 15/362 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H++K+ VT   LGSG L+YKLY+ H R + +LE+EL  +  NDELIKAQMK HFE 
Sbjct  7     FWRKHRRKILVTTTCLGSGLLIYKLYNAHTRNLADLERELANERHNDELIKAQMKAHFET  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+IAD+TTLPH + +LSSRI EE+++  + EKL +GK    TL  +EKL LW  LKILS
Sbjct  67    IQMIADTTTLPHALHHLSSRIVEEINVSSVMEKLSRGK---GTLVPSEKLHLWSELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMV++LWS+T L+LYIRVQVNILGRHLYIDTAR L SS+  EE D+I R+D+Q FL S
Sbjct  124   FTRMVVTLWSVTMLSLYIRVQVNILGRHLYIDTARGLASSHLLEELDLIDREDEQKFLTS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA   + +LIS  ++A  EVLKGKQLKDV +T  L +TV++IL  FMS GSPHHW+ 
Sbjct  184   ADYLATNSMPSLISHVKSAVKEVLKGKQLKDVLTTRTLEETVIRILGLFMSTGSPHHWID  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D    +    SSSD T     + F  L+ ETR VL+S EF +VV+++LK+   A
Sbjct  244   YLMMPQD----TTTDVSSSDAT----VTKFHLLVTETREVLTSNEFTDVVEIALKSCTVA  295

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +VE++  Q G   L  G+ LAKLLP++     ++   P++NR++Q+I++LP+V L FTLL
Sbjct  296   LVEEMETQPG---LGTGIQLAKLLPQIEKTVPEISAVPDKNRFLQLIRDLPQVHLFFTLL  352

Query  1354  YS  1359
             YS
Sbjct  353   YS  354



>emb|CDY69671.1| BnaCnng64690D [Brassica napus]
Length=396

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/400 (49%), Positives = 267/400 (67%), Gaps = 47/400 (12%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW +H++KV VT G LGSG+ LYKLY+ H RR+ +L+++L  D ++DE IKAQMK HFEN
Sbjct  7     FWSKHRRKVLVTAGCLGSGYFLYKLYNSHTRRLADLQRQLANDREHDENIKAQMKAHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+I DSTTLPH M+ LS  I EE+D+  + E+L +GK     L+ +EKL LWD+LKILS
Sbjct  67    IQMIVDSTTLPHAMRCLSISIREEIDVSSVMERLNRGK---GVLSQSEKLHLWDQLKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSS--------------------  756
             FTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR L +S                    
Sbjct  124   FTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALDTSSHLLYALLVSSPTSTTCSSS  183

Query  757   ---------------YQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLK  891
                            + +EE D+I RDD+Q FL+SAD+L    +  LI + + A SEVLK
Sbjct  184   SFWLPSKAAAPCTVMFSQEELDLIDRDDEQKFLSSADFLVTNAMPGLILNMQTAVSEVLK  243

Query  892   GKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYL-MPEDPKIYSLAAPSSSDNTDLC  1068
             G QLKDV +T +L +T+++I+D FMS GSPHHW+ YL MP+D K+    + ++S  T   
Sbjct  244   GMQLKDVITTRVLQETLLRIVDVFMSSGSPHHWVDYLMMPQDTKL----SRTTSGET---  296

Query  1069  RASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLP  1248
               S F QLM ETR VL S EF ++V++SLK   DA+VE++  Q     L  GMPLAK+LP
Sbjct  297   -VSKFNQLMVETRQVLISTEFTDIVEISLKCFTDALVEEMETQSVAGGLATGMPLAKMLP  355

Query  1249  RLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
             ++      ++ EP +N+++Q+I+++ EV++ FTLLY+S P
Sbjct  356   QIEKTIPVIIAEPGKNQFLQLIRDMSEVQVFFTLLYASMP  395



>ref|XP_009113500.1| PREDICTED: peroxisome biogenesis protein 3-1 isoform X2 [Brassica 
rapa]
Length=351

 Score =   374 bits (960),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 196/362 (54%), Positives = 258/362 (71%), Gaps = 21/362 (6%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H+KK+ VT   LGSG L+YKLY+ H R + +LE+EL  +  NDELIKAQMK HFE 
Sbjct  7     FWRKHRKKILVTTTCLGSGLLIYKLYNAHTRNLADLERELANERHNDELIKAQMKAHFET  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+IAD+TTLPH + +LSSRI EE+++  + EKL +GK    TL  +EKL LW      S
Sbjct  67    IQMIADTTTLPHALHHLSSRIVEEINVSSVMEKLSRGK---GTLVPSEKLHLW------S  117

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMV++LWS+T L+LYIRVQVNILGRHLYIDTAR L SS+  EE D+I R+D+Q FL S
Sbjct  118   FTRMVVTLWSVTMLSLYIRVQVNILGRHLYIDTARGLASSHLLEELDLIDREDEQKFLTS  177

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA   + +LIS  ++A  EVLKGKQLKDV +T  L +TV++IL  FMS GSPHHW+ 
Sbjct  178   ADYLATNSMPSLISHVKSAVKEVLKGKQLKDVLTTRTLEETVIRILGLFMSTGSPHHWID  237

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D    +    SSSD T     + F  L+ ETR VL+S EF +VV+++LK+   A
Sbjct  238   YLMMPQD----TTTDVSSSDAT----VTKFHLLITETREVLTSNEFTDVVEIALKSCTVA  289

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLL  1353
             +VE++  Q G   L  G+ LAKLLP++     ++   P++NR++Q+I++LP+V L FTLL
Sbjct  290   LVEEMETQPG---LATGIQLAKLLPQIEKTVPEISAVPDKNRFLQLIRDLPQVHLFFTLL  346

Query  1354  YS  1359
             YS
Sbjct  347   YS  348



>ref|XP_006451672.1| hypothetical protein CICLE_v10008707mg [Citrus clementina]
 gb|ESR64912.1| hypothetical protein CICLE_v10008707mg [Citrus clementina]
Length=297

 Score =   370 bits (950),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/281 (62%), Positives = 229/281 (81%), Gaps = 4/281 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+++T GVLG G+LLYKLYD  +RRI +L+++     ++DEL+KAQM+ H+E 
Sbjct  7     FWRRHRRKIFITTGVLGGGYLLYKLYDS-QRRIADLDRQ---QCEHDELLKAQMQAHYEE  62

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q IAD+TTLPH M YLS RI+EELDL  LT+KL++GK+QP TL+++EKLELWDRLKILS
Sbjct  63    VQRIADATTLPHAMHYLSIRIAEELDLSPLTDKLLRGKEQPYTLSSSEKLELWDRLKILS  122

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT++V++LW++T ++LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I RDDQQ FLAS
Sbjct  123   FTKLVVALWAVTMVSLYIRVQVNILGRHLYIDTARGLGSSDLPEDADLIDRDDQQKFLAS  182

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
              DYLANYG+  +IS+ +AA  E LKGKQL+D+F+T +LH+T +QIL+ FMSMGSPH W+ 
Sbjct  183   VDYLANYGMQAMISNVQAAADEALKGKQLRDIFNTAVLHETFMQILEVFMSMGSPHQWVD  242

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLS  1119
             +LMP+D + Y L   S  D T L  A+ F++LM ETRAVLS
Sbjct  243   FLMPQDIRFYKLVTASGHDETTLSGATKFDELMVETRAVLS  283



>gb|KDO62871.1| hypothetical protein CISIN_1g017709mg [Citrus sinensis]
Length=301

 Score =   370 bits (950),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/281 (62%), Positives = 229/281 (81%), Gaps = 4/281 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWRRH++K+++T GVLG G+LLYKLYD  +RRI +L+++     ++DEL+KAQM+ H+E 
Sbjct  7     FWRRHRRKIFITTGVLGGGYLLYKLYDS-QRRIADLDRQ---QCEHDELLKAQMQAHYEE  62

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q IAD+TTLPH M YLS RI+EELDL  LT+KL++GK+QP TL+++EKLELWDRLKILS
Sbjct  63    VQRIADATTLPHAMHYLSIRIAEELDLSPLTDKLLRGKEQPYTLSSSEKLELWDRLKILS  122

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FT++V++LW++T ++LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I RDDQQ FLAS
Sbjct  123   FTKLVVALWAVTMVSLYIRVQVNILGRHLYIDTARGLGSSDLPEDADLIDRDDQQKFLAS  182

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
              DYLANYG+  +IS+ +AA  E LKGKQL+D+F+T +LH+T +QIL+ FMSMGSPH W+ 
Sbjct  183   VDYLANYGMQAMISNVQAAADEALKGKQLRDIFNTVVLHETFMQILEVFMSMGSPHQWVD  242

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLS  1119
             +LMP+D + Y L   S  D T L  A+ F++LM ETRAVLS
Sbjct  243   FLMPQDIRFYKLVTASGHDETTLSGATKFDELMVETRAVLS  283



>ref|XP_009135569.1| PREDICTED: peroxisome biogenesis protein 3-1-like isoform X2 
[Brassica rapa]
Length=356

 Score =   367 bits (942),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 257/377 (68%), Gaps = 31/377 (8%)
 Frame = +1

Query  265   MIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKE  444
             +I  FWR+H+KK+ VT   LGSG+LLYKLY+ H R + +LE+EL  +  NDE+IK QMK 
Sbjct  3     LIRSFWRKHRKKILVTTTCLGSGYLLYKLYNAHTRSLADLERELADERHNDEIIKTQMKA  62

Query  445   HFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRL  624
             HFENIQ+IAD TTLPH ++ LSSRI+EE+ +  + E L KGK    TL  +EKL LW+ L
Sbjct  63    HFENIQMIADVTTLPHALRRLSSRIAEEIHVSSVMETLSKGK---GTLVPSEKLHLWNEL  119

Query  625   KILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL  804
             KIL           +T L+LYIRVQVN+LGRHLYIDTAR L +S+  EE D+I R++++ 
Sbjct  120   KIL-----------ITMLSLYIRVQVNVLGRHLYIDTARGLTTSHLLEELDLIDREEEKK  168

Query  805   FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPH  984
             FL SADYLA  G+ +LISD + A  EVLKGKQLKDV +T  L +TV++ILD FMS GSPH
Sbjct  169   FLTSADYLATNGMPSLISDMKRAVKEVLKGKQLKDVLTTRSLEETVIRILDVFMSKGSPH  228

Query  985   HWLRYLM--------PEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
             HW+ YLM        P D    S+  PSS D T     S   QL+ ETR VL+S EF NV
Sbjct  229   HWVDYLMMAQDTTMSPRDTTTTSV--PSSDDAT----VSKLHQLINETREVLTSTEFTNV  282

Query  1141  VDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQN  1320
              ++SLK+   A+ E++  Q G   L  GM LAKLLP++  +  ++   P+ NR++Q+I++
Sbjct  283   AEISLKSCTLALGEEMEKQTG---LAAGMQLAKLLPQIEKIVPEISAVPDENRFLQLIRD  339

Query  1321  LPEVELIFTLLYSSTPV  1371
             LPEV+L FTLLYS+ P+
Sbjct  340   LPEVQLFFTLLYSNMPL  356



>gb|AAG50845.1|AC074308_1 hypothetical protein, 3' partial [Arabidopsis thaliana]
Length=443

 Score =   369 bits (948),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 256/382 (67%), Gaps = 44/382 (12%)
 Frame = +1

Query  289   HKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQ-----------  435
             H++KV VT G LGSG+LLYKLY+ H RR+ +LE+EL  + +NDE+IK Q           
Sbjct  8     HRRKVLVTAGCLGSGYLLYKLYNSHTRRLADLERELAHERENDEIIKTQLSSVLIKTDPL  67

Query  436   -------------------MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKL  558
                                MK HFE+IQ+I DSTTLPH MQ+LS RISEE+D+  + ++L
Sbjct  68    DFSSYGFSNGPVLFVLLFRMKAHFESIQMIVDSTTLPHAMQFLSIRISEEIDVSHVMDRL  127

Query  559   MKGKDQPNTLTAAEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTA  738
              +GK     L+  EKL+LWD LKILSFTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTA
Sbjct  128   NQGK---GMLSPPEKLQLWDELKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTA  184

Query  739   RRLGSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFS  918
             R LGSS+  EE D+I RDD+Q FL+SAD+L    + +LISD + +  EVLKGKQLKDV +
Sbjct  185   RALGSSHLLEEVDLIDRDDEQKFLSSADFLVTNAMPSLISDMQGSAEEVLKGKQLKDVIT  244

Query  919   TTILHDTVVQILDRFMSMGSPHHWLRYL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLM  1095
             T +L +TV+QI+D FMS GSPHHW+ YL MP+D K+    + ++SD++D    S F QLM
Sbjct  245   TRVLQETVMQIVDVFMSTGSPHHWVDYLMMPQDTKL----SRTTSDSSDEA-VSKFHQLM  299

Query  1096  QETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQL  1275
              ETR VL S EF N+V++SLK   D +VE++  Q     L  G PLAK+LP++      +
Sbjct  300   VETREVLISTEFTNIVEISLKCFTDVLVEEMETQTEAGGLATGKPLAKVLPQIEKTMNVI  359

Query  1276  LEEPNRNR-----YIQVIQNLP  1326
               EP++NR     YIQ+   +P
Sbjct  360   TAEPSKNRLSDKMYIQMTDGVP  381



>gb|AAG60126.1|AC073555_10 lysine and histidine specific transporter, putative [Arabidopsis 
thaliana]
Length=809

 Score =   379 bits (974),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 262/380 (69%), Gaps = 39/380 (10%)
 Frame = +1

Query  289   HKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQ-----------  435
             H++KV VT G LGSG+LLYKLY+ H RR+ +LE+EL  + +NDE+IK Q           
Sbjct  8     HRRKVLVTAGCLGSGYLLYKLYNSHTRRLADLERELAHERENDEIIKTQLSSVLIKTDPL  67

Query  436   -------------------MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKL  558
                                MK HFE+IQ+I DSTTLPH MQ+LS RISEE+D+  + ++L
Sbjct  68    DFSSYGFSNGPVLFVLLFRMKAHFESIQMIVDSTTLPHAMQFLSIRISEEIDVSHVMDRL  127

Query  559   MKGKDQPNTLTAAEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTA  738
              +GK     L+  EKL+LWD LKILSFTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTA
Sbjct  128   NQGK---GMLSPPEKLQLWDELKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTA  184

Query  739   RRLGSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFS  918
             R LGSS+  EE D+I RDD+Q FL+SAD+L    + +LISD + +  EVLKGKQLKDV +
Sbjct  185   RALGSSHLLEEVDLIDRDDEQKFLSSADFLVTNAMPSLISDMQGSAEEVLKGKQLKDVIT  244

Query  919   TTILHDTVVQILDRFMSMGSPHHWLRYL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLM  1095
             T +L +TV+QI+D FMS GSPHHW+ YL MP+D K+    + ++SD++D    S F QLM
Sbjct  245   TRVLQETVMQIVDVFMSTGSPHHWVDYLMMPQDTKL----SRTTSDSSDEA-VSKFHQLM  299

Query  1096  QETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQL  1275
              ETR VL S EF N+V++SLK   D +VE++  Q     L  G PLAK+LP++      +
Sbjct  300   VETREVLISTEFTNIVEISLKCFTDVLVEEMETQTEAGGLATGKPLAKVLPQIEKTMNVI  359

Query  1276  LEEPNRNRYIQVIQNLPEVE  1335
               EP++NR++Q+I++LPE++
Sbjct  360   TAEPSKNRFLQIIRDLPEID  379



>emb|CDY18500.1| BnaA01g26950D [Brassica napus]
Length=599

 Score =   370 bits (951),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 192/353 (54%), Positives = 254/353 (72%), Gaps = 15/353 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FWR+H+KK+ VT   LGSG L+YKLY+ H R + +LE+EL  +  NDELIKAQMK HFE 
Sbjct  7     FWRKHRKKILVTTTCLGSGLLIYKLYNAHTRNLADLERELANERHNDELIKAQMKAHFET  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ+IAD+TTLPH + +LSSRI EE+++  + EKL +GK    TL  +EKL LW  LKILS
Sbjct  67    IQMIADTTTLPHALHHLSSRIVEEINVSSVMEKLSRGK---GTLVPSEKLHLWSELKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTRMV++LWS+T L+LYIRVQVNILGRHLYIDTAR L SS+  EE D+I R+D+Q FL S
Sbjct  124   FTRMVVTLWSVTMLSLYIRVQVNILGRHLYIDTARGLASSHLLEELDLIDREDEQKFLTS  183

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA   + +LIS  ++A  EVLKGKQLKDV +T  L +TV++IL  FMS GSPHHW+ 
Sbjct  184   ADYLATNSMPSLISHVKSAVKEVLKGKQLKDVLTTRTLEETVIRILGLFMSTGSPHHWID  243

Query  997   YL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDA  1173
             YL MP+D    +    SSSD T     + F  L+ ETR VL+S EF +VV+++LK+   A
Sbjct  244   YLMMPQD----TTTDVSSSDAT----VTKFHLLITETREVLTSNEFTDVVEIALKSCTVA  295

Query  1174  MVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEV  1332
             +VE++  Q G   L  G+ LAKLLP++     ++   P++NR++Q+I++LP+ 
Sbjct  296   LVEEMETQPG---LATGIQLAKLLPQIEKTVPEISAVPDKNRFLQLIRDLPQA  345



>ref|XP_003558994.1| PREDICTED: peroxisome biogenesis protein 3-1-like [Brachypodium 
distachyon]
Length=382

 Score =   362 bits (930),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 255/369 (69%), Gaps = 4/369 (1%)
 Frame = +1

Query  274   QFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFE  453
             +FW RH+ KV ++LGV G+G+  Y+LYD HR ++  +E+    +   DEL+K Q++ HFE
Sbjct  11    RFWARHRWKVLLSLGVAGAGYAAYRLYDAHRSQLVRVEQRQLEERAADELVKNQLQAHFE  70

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
             N+Q I+D+TTLP  M YL SRI EELD+  LTEKL++GK +   LT  EK + W+++KI+
Sbjct  71    NVQRISDTTTLPFAMHYLRSRIVEELDISHLTEKLLQGKGESGVLTTKEKYDTWEKIKIM  130

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFTR V S+W+MT L+LY+RVQV ILGRHLY+D AR    S  + E+D + R+  + FLA
Sbjct  131   SFTRTVSSMWAMTLLSLYVRVQVTILGRHLYLDFARGTDGSQLQAESDTLGRNGHKDFLA  190

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             +ADYLA YG+ TLI   E A +E+LK KQLKD+ S   +  TV+QI D+FMS+     W+
Sbjct  191   TADYLATYGINTLIMQMEHAATEILKEKQLKDLMSMDQVLQTVLQIFDQFMSLCEDKSWI  250

Query  994   RYLMPEDPKIYS-LAAPSSS---DNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKT  1161
              YL+PE+   Y+ L A S S   D++ L      +QLM ETR VL+S +F NV+D+SL+ 
Sbjct  251   NYLVPENANRYAQLLAVSGSGFDDSSLLMDVRKLDQLMTETRIVLASDDFRNVMDMSLRK  310

Query  1162  VVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELI  1341
             + D ++ED+  Q G      G+PLAKLL R+A L   LLEEP++N++IQ+I+++PEVEL 
Sbjct  311   IADVVIEDLGAQLGAAVPPSGLPLAKLLARVAQLSSPLLEEPSKNKHIQIIRSMPEVELF  370

Query  1342  FTLLYSSTP  1368
             +T LY++ P
Sbjct  371   YTFLYANMP  379



>ref|NP_001062839.1| Os09g0314300 [Oryza sativa Japonica Group]
 dbj|BAD33995.1| peroxisomal biogenesis factor 3-like [Oryza sativa Japonica Group]
 dbj|BAF24753.1| Os09g0314300 [Oryza sativa Japonica Group]
 gb|EEC84328.1| hypothetical protein OsI_30834 [Oryza sativa Indica Group]
 gb|EEE69436.1| hypothetical protein OsJ_28827 [Oryza sativa Japonica Group]
Length=380

 Score =   347 bits (891),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/370 (47%), Positives = 252/370 (68%), Gaps = 6/370 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++K+ V+LGV G+G+  Y+  D HRR++  +E+    +   +E+IK Q++ HFEN
Sbjct  8     FWGRHRRKILVSLGVAGAGYAAYRYLDSHRRQLVRVEQRALEERAAEEIIKNQLQTHFEN  67

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNT--LTAAEKLELWDRLKI  630
             +Q I+D+TTLP  M YL SRI EELD+  LTEKLM GK + +   LT  EK + W+++KI
Sbjct  68    VQKISDTTTLPFAMHYLRSRIMEELDISHLTEKLMHGKGESSAPALTPKEKYDTWEKIKI  127

Query  631   LSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFL  810
             LSFTR V S+W+MT L+LY+RVQV ILGRHLY+D AR    +  +E +D   +   + FL
Sbjct  128   LSFTRTVSSIWAMTLLSLYVRVQVTILGRHLYLDFARVTDGAQLQEGSDTFSKSGHKDFL  187

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW  990
             A+ADYLA YG+  LI+  + A +E+LK KQLKD      + +T++QIL +FM +   + W
Sbjct  188   ATADYLATYGINALITKMQHAATEILKEKQLKDPMGIDEVLETILQILKQFMGLCEDNSW  247

Query  991   LRYLMPEDPKIYS-LAAPSSS---DNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK  1158
             + YL+PE+  +Y+ L A SSS   D++ L      +QLM ETR VLSS +F N++D SLK
Sbjct  248   INYLVPENANVYAQLMAVSSSGFDDSSLLKDVRKLDQLMSETRIVLSSDDFRNIMDRSLK  307

Query  1159  TVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVEL  1338
              +   +VED+ VQ G      G+PLAKLL ++A L   LLEEP++N++IQ+I+++PEVEL
Sbjct  308   KIASVVVEDLAVQIGAPIPPPGLPLAKLLAKVAQLSLPLLEEPDKNKHIQIIRSMPEVEL  367

Query  1339  IFTLLYSSTP  1368
              +T LY++ P
Sbjct  368   FYTFLYANMP  377



>ref|XP_006661110.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Oryza brachyantha]
Length=367

 Score =   347 bits (889),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/368 (48%), Positives = 252/368 (68%), Gaps = 15/368 (4%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH++K+  +LGV G+G++ YKLYD HR      + +L        +IK Q++ HFEN
Sbjct  8     FWGRHRRKILASLGVAGAGYVAYKLYDAHRS-----QSQLV------RIIKNQLQTHFEN  56

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q I+D+TTLP  M YL SRI EELD+  LTE+LM GK +P+ LT  EK + W+++KILS
Sbjct  57    VQNISDTTTLPFAMHYLRSRIMEELDISHLTERLMHGKGEPSALTPKEKYDTWEKIKILS  116

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR V S+W+MT L+LY+RVQV ILGRHLY+D AR    +  +E +D   ++  + FLA+
Sbjct  117   FTRTVSSIWAMTLLSLYVRVQVTILGRHLYLDFARVTDGAQLQEGSDTFGKNGHKDFLAT  176

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA YG+  LI+  + A +++LK KQLKD  S   + +T++QIL++FM +   + W+ 
Sbjct  177   ADYLATYGINALITKMQHAATDILKEKQLKDPMSIDQVLETILQILNQFMGLCEDNSWIN  236

Query  997   YLMPEDPKIYS-LAAPSSS---DNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             YL+PE+  +Y+ L A SSS   D++ L      +QLM ETR VLSS +F N++D SLK +
Sbjct  237   YLVPENANLYAQLMAVSSSGFDDSSLLKDVRKLDQLMSETRIVLSSDDFRNIMDRSLKKI  296

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
                ++ED+ VQ G      G+PLAKLL ++A L   LLEEPN+N++IQ+I+++PEVEL +
Sbjct  297   AGVVIEDLAVQIGTPIPPSGLPLAKLLAKVAQLSLPLLEEPNKNKHIQIIRSMPEVELFY  356

Query  1345  TLLYSSTP  1368
             T LY++ P
Sbjct  357   TFLYANMP  364



>dbj|BAK07109.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   340 bits (873),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 171/368 (46%), Positives = 249/368 (68%), Gaps = 7/368 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RH+ K+ ++LGV G+G+  Y+ YD H +++  +E+  + +   DE+IK Q++ HFE 
Sbjct  12    FWARHRWKMLLSLGVAGAGYAAYRFYDAHHKQLVRVEQRAQEERAADEIIKNQLQAHFEK  71

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q IAD+TTLP  M YL SR+ EELD+  LTE+L++GK +   LT  EK E W+++KILS
Sbjct  72    VQRIADTTTLPFAMHYLRSRVMEELDISHLTERLLQGKGE---LTPEEKYETWEKIKILS  128

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR V S+W+MT L+LY+RVQV ILGRHLY+D AR    +  + E+D    +  + FL +
Sbjct  129   FTRTVSSMWAMTLLSLYVRVQVTILGRHLYLDFARGTDGAQLQAESDAFSANGHKDFLGT  188

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYLA YG+T LI   + A +E+LK KQLKD  S   +  T++QI ++FMS+   + W+ 
Sbjct  189   ADYLATYGITALIRQMQHAATEILKEKQLKDPMSMDQVLQTMLQISEQFMSLCEGNSWIN  248

Query  997   YLMPEDPKIYS-LAAPSSS---DNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTV  1164
             +L+PE+   Y+ L A SSS   D++ L  A   +QLM ETR VL+S +F N++D+SL+ V
Sbjct  249   FLVPENANRYAQLMAVSSSGFDDSSLLMDAGKLDQLMTETRIVLASDDFRNIMDMSLRKV  308

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
              D + ED+  Q G      G+PLAKLL R+A L   LLEEP++N++IQ I+++PEV L +
Sbjct  309   ADLVTEDLGAQVGTALPPSGLPLAKLLARVAQLSSTLLEEPSKNKHIQTIRSMPEVGLFY  368

Query  1345  TLLYSSTP  1368
             T LY++ P
Sbjct  369   TFLYANMP  376



>ref|NP_974332.1| peroxin 3-1 [Arabidopsis thaliana]
 gb|AEE76055.1| peroxin 3-1 [Arabidopsis thaliana]
Length=304

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 229/316 (72%), Gaps = 13/316 (4%)
 Frame = +1

Query  421   LIKAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAE  600
             ++  +MK HF+NIQ+IAD+TTLPH + +LSSR+ EE+D+  + +KL KGK     L  +E
Sbjct  1     MLYVRMKAHFDNIQMIADTTTLPHAIHHLSSRVVEEIDVSSIMDKLSKGK---GILIPSE  57

Query  601   KLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADI  780
             KL+LW+ LKILSFTRMVLSLWS+T L+LYIRVQVNILGRHLYIDTAR LGSS+  +E D+
Sbjct  58    KLQLWNELKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGLGSSHLLDELDL  117

Query  781   IYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR  960
             I RDD+Q FL SAD+LA  G+ +LIS+ + A  EVLKGKQLKDV +T+ L +TV++ILD 
Sbjct  118   IERDDEQKFLTSADFLATSGMPSLISNMQNAVKEVLKGKQLKDVLTTSALRETVMRILDV  177

Query  961   FMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
             FMS GSPHHW+ YLM        +   SSSD T     + F  L+ ETR VL+S +F NV
Sbjct  178   FMSTGSPHHWVDYLMMSQDATTDV---SSSDAT----VTKFHLLITETREVLTSNDFSNV  230

Query  1141  VDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQN  1320
              ++SLK    A+VE++  Q G   L  GM LAKLLP++     ++  EP +NR++Q+I++
Sbjct  231   AEISLKCCAVALVEEMETQTG---LATGMQLAKLLPQIEKTMPEISAEPEKNRFLQLIRD  287

Query  1321  LPEVELIFTLLYSSTP  1368
             LPEV+L FTLLY++ P
Sbjct  288   LPEVKLFFTLLYANMP  303



>gb|KEH21417.1| peroxisome biogenesis protein [Medicago truncatula]
Length=330

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 228/313 (73%), Gaps = 11/313 (4%)
 Frame = +1

Query  433   QMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLEL  612
             +M+ HFENIQ I+D+ TLPH M  LS RI+++LDL  L E+L++GK QPNTLT +EKL+L
Sbjct  26    RMQAHFENIQRISDTITLPHSMHNLSCRIAQDLDLSHLLERLIQGKGQPNTLTQSEKLDL  85

Query  613   WDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSS-YQEEEADIIYR  789
             W RLKILSFTRM LS+W+   L+LY +VQVNILGRHLYIDTAR L SS    E  D++  
Sbjct  86    WGRLKILSFTRMALSVWATVMLSLYTKVQVNILGRHLYIDTARSLESSNLLMESEDVVDG  145

Query  790   DDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMS  969
             +D+Q FL S D+L+ +G+  LISD E AT EVLKGKQL  +F+ T   +T+  IL+ FMS
Sbjct  146   EDKQKFLGSVDFLSQHGMPALISDMEEATKEVLKGKQLTSLFNNTTFDETITDILNTFMS  205

Query  970   MGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDV  1149
              GSPH W++Y++PED K++S A  S S++T     + F+QL+ E R VLSSAEFG+VV++
Sbjct  206   RGSPHFWVKYIIPEDAKLHSTA--SGSNDTVPLDMTEFDQLVMEARGVLSSAEFGSVVEI  263

Query  1150  SLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPE  1329
             SLK VVD +    R   G T++    PLA+ LP++A +   LLEEP++N++IQ+++N+PE
Sbjct  264   SLKAVVDTL----RELMGTTSV----PLARALPQVAQMCPLLLEEPSKNQFIQILKNIPE  315

Query  1330  VELIFTLLYSSTP  1368
             VEL  T LY++ P
Sbjct  316   VELFLTFLYANMP  328



>ref|XP_010924144.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X2 
[Elaeis guineensis]
Length=344

 Score =   328 bits (840),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 226/316 (72%), Gaps = 4/316 (1%)
 Frame = +1

Query  427   KAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKL  606
             + +++ HFENIQ I+D+TTLP+ M YL SRI+EELDL  LTEKLM+GK Q N +T+ EKL
Sbjct  24    RDKLQTHFENIQRISDTTTLPYAMHYLRSRIAEELDLSHLTEKLMQGKGQSNAITSKEKL  83

Query  607   ELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIY  786
             ELW+ LK+LSFTR   SLWSMT L LY+RVQVNILGRHLY++ AR   SS   +E+D   
Sbjct  84    ELWETLKVLSFTRTASSLWSMTMLCLYVRVQVNILGRHLYLEAARGSESSQPLDESDSFS  143

Query  787   RDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFM  966
             R  QQ FLA+ADYL+ +G+  LI + + A +EVLK KQL+D FS   LH+T++QIL+ FM
Sbjct  144   RHGQQDFLATADYLSAHGINMLIVNMQKAATEVLKEKQLRDPFSMVQLHETIMQILELFM  203

Query  967   SMGSPHHWLRYLMPEDPKIYSLAAPSSS----DNTDLCRASNFEQLMQETRAVLSSAEFG  1134
             ++G  ++W+ YL+PE+   Y     +S+    D++        EQLM E R VLSS +FG
Sbjct  204   NIGGQNYWINYLIPENEIAYRQLMVTSTNGFVDSSIPMDVGKLEQLMSEARMVLSSPDFG  263

Query  1135  NVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVI  1314
             N+V++SLK VVD +V+DI +Q    +   G+PLAKLLPR+  L   LLEEP+ N+++Q I
Sbjct  264   NIVEISLKKVVDMLVDDISMQLVGMSPPSGVPLAKLLPRVTQLCHPLLEEPSSNKFVQTI  323

Query  1315  QNLPEVELIFTLLYSS  1362
             + LP+VEL +TLLY++
Sbjct  324   RGLPDVELFYTLLYAN  339



>ref|XP_004956552.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Setaria italica]
Length=379

 Score =   327 bits (838),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 166/369 (45%), Positives = 244/369 (66%), Gaps = 5/369 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEK-ELEADMKNDELIKAQMKEHFE  453
             FW RH++K+ V+LGV G+G+  Y+LYD HR ++  +E+     +   D+L+K Q++EHFE
Sbjct  8     FWGRHRRKILVSLGVAGAGYAAYRLYDAHRAQLVRVEQLRAREEQAADDLVKNQLQEHFE  67

Query  454   NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
              +Q I DSTTLP  M  L  +I  ELD+ +L +KL +GK + + LT  EK + W+ +KI 
Sbjct  68    KVQSICDSTTLPLAMHQLCEKIMSELDISKLIDKLRQGKVESSALTPKEKYDTWEEIKIK  127

Query  634   SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLA  813
             SFT+ V S+W+MT L+LY RVQV ILGRHLY+D AR    +  +EE+D    +  + FL 
Sbjct  128   SFTKTVSSIWAMTLLSLYTRVQVTILGRHLYLDFARGSHRAQIQEESDTFSENGHKSFLT  187

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             +ADYL    +   I   + A +EVLK KQLKD+ ST  +  TV+QILD FM +   + W+
Sbjct  188   TADYLPTGKINAYIMQMQHAATEVLKEKQLKDLMSTDQVLQTVLQILDMFMGLCEDNSWI  247

Query  994   RYLMPEDPKIYS-LAAPSSSDNTDLCRASNF---EQLMQETRAVLSSAEFGNVVDVSLKT  1161
              YL+P+D  +++ L A SS+   D    ++F   EQLM ETR VL+S +F N+++ SL+ 
Sbjct  248   NYLVPDDASVHAQLMAVSSTGFDDSSLLNDFRKLEQLMAETRIVLASDDFKNIMERSLRK  307

Query  1162  VVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELI  1341
             + D ++ED+  Q G  +   G+PLA LLPR+AHL   LL EPN+N++IQ+I+++PEVEL 
Sbjct  308   IADMVIEDLAAQTGIPSPPSGLPLATLLPRVAHLSSPLLVEPNKNKHIQMIRSMPEVELF  367

Query  1342  FTLLYSSTP  1368
             +T LY++ P
Sbjct  368   YTFLYANMP  376



>ref|XP_002891447.1| hypothetical protein ARALYDRAFT_336986 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67706.1| hypothetical protein ARALYDRAFT_336986 [Arabidopsis lyrata subsp. 
lyrata]
Length=647

 Score =   332 bits (851),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 221/301 (73%), Gaps = 9/301 (3%)
 Frame = +1

Query  436   MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELW  615
             MK HFE+IQ+I DSTTLPH +QYLS RISEE+D+  + ++L KGK     L++ EKL+LW
Sbjct  1     MKAHFESIQMIVDSTTLPHAIQYLSIRISEEIDVSYVMDRLDKGK---GMLSSPEKLQLW  57

Query  616   DRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD  795
             D LKILSFTRMVLSLWS+T L+LYIRVQVNILGRHLY+DTAR LGSS+  EE D+I RDD
Sbjct  58    DELKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGSSHILEELDLIDRDD  117

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMG  975
             +Q FL+SAD+L    + +LISD + A  EVL+GKQLKDV +T +L +TV+++L+ FMS G
Sbjct  118   EQKFLSSADFLVTNAMPSLISDMQGAVEEVLRGKQLKDVITTRVLQETVMRVLEVFMSTG  177

Query  976   SPHHWLRYL-MPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVS  1152
             SPHHW+ YL MP+D K+ S     SSD T     S F QLM ETR VL + EF N+V++S
Sbjct  178   SPHHWVDYLMMPQDTKL-SGTTSGSSDET----VSKFHQLMVETREVLINTEFTNIVEIS  232

Query  1153  LKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEV  1332
             LK   DA+VE++  Q     L  G PLAK+LP +      +  EP++NR++Q+I++LPE+
Sbjct  233   LKCFTDALVEEMETQTIAGGLATGKPLAKVLPHIEKTMNVITAEPSKNRFLQIIRDLPEI  292

Query  1333  E  1335
             E
Sbjct  293   E  293



>ref|XP_010924145.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X3 
[Elaeis guineensis]
Length=317

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 211/295 (72%), Gaps = 4/295 (1%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             FW RHK+KV+V LGV GSG+++YKLYD HRRRI +LEK++E + + +E I+AQ++ HFEN
Sbjct  7     FWNRHKRKVFVALGVFGSGYVIYKLYDAHRRRISDLEKQMEGERQVNEFIRAQLQTHFEN  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             IQ I+D+TTLP+ M YL SRI+EELDL  LTEKLM+GK Q N +T+ EKLELW+ LK+LS
Sbjct  67    IQRISDTTTLPYAMHYLRSRIAEELDLSHLTEKLMQGKGQSNAITSKEKLELWETLKVLS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR   SLWSMT L LY+RVQVNILGRHLY++ AR   SS   +E+D   R  QQ FLA+
Sbjct  127   FTRTASSLWSMTMLCLYVRVQVNILGRHLYLEAARGSESSQPLDESDSFSRHGQQDFLAT  186

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             ADYL+ +G+  LI + + A +EVLK KQL+D FS   LH+T++QIL+ FM++G  ++W+ 
Sbjct  187   ADYLSAHGINMLIVNMQKAATEVLKEKQLRDPFSMVQLHETIMQILELFMNIGGQNYWIN  246

Query  997   YLMPEDPKIYSLAAPSSS----DNTDLCRASNFEQLMQETRAVLSSAEFGNVVDV  1149
             YL+PE+   Y     +S+    D++        EQLM E R VLSS  F   + +
Sbjct  247   YLIPENEIAYRQLMVTSTNGFVDSSIPMDVGKLEQLMSEARMVLSSIRFIKAITI  301



>ref|XP_002460028.1| hypothetical protein SORBIDRAFT_02g021030 [Sorghum bicolor]
 gb|EER96549.1| hypothetical protein SORBIDRAFT_02g021030 [Sorghum bicolor]
Length=377

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 245/370 (66%), Gaps = 9/370 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEA--DMKNDELIKAQMKEHF  450
             FW RH++K+ V++GV G G+  Y+ YD  R ++  ++ +L A  +   ++L+K Q++ HF
Sbjct  8     FWARHRRKILVSMGVAGVGYAAYRFYDARRAQLVRVQ-QLRAMEEQAAEDLVKDQLQAHF  66

Query  451   ENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKI  630
             E ++ I D+TTLP  M +LS +++ ELD+ +LT+KL +GK   + LT  EK + W+ +KI
Sbjct  67    EKVKRICDTTTLPLAMHHLSDKVASELDISKLTDKLRQGKVDSSALTPKEKYDTWEEIKI  126

Query  631   LSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFL  810
              SFT+ V S+W+MT L+LY+RVQV ILGRHLY+D AR    +  + E+D    +  + FL
Sbjct  127   KSFTKTVSSMWAMTLLSLYVRVQVTILGRHLYLDIARGTNGAQLQAESDTFSENGHKSFL  186

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW  990
             A ADYL    +T  I+  + A +EVLK KQLKD  +   +  TV+QILD FM +   + W
Sbjct  187   AMADYLVTDKITAFITQMQRAATEVLKEKQLKDRMNMDQVLQTVIQILDTFMGLCEDNSW  246

Query  991   LRYLMPEDPKIYS-LAAPSSSDNTDLCRASNF---EQLMQETRAVLSSAEFGNVVDVSLK  1158
             + YL+PE+P +Y+ L A SSS   D    ++F   +QLM ETR VL+S +F N+++ SL+
Sbjct  247   INYLVPENPSVYAQLMAVSSSGFDDSSLLNDFRKLDQLMSETRIVLASDDFRNIMERSLR  306

Query  1159  TVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVEL  1338
              + + +VED+ VQ        G+PLA LLP++ HL   LLEEPN+N++IQ+I+++PEVEL
Sbjct  307   KIAEVVVEDLAVQIVTPG--SGLPLATLLPKVGHLSSPLLEEPNKNKHIQIIRSMPEVEL  364

Query  1339  IFTLLYSSTP  1368
              +T LY++ P
Sbjct  365   FYTFLYANMP  374



>gb|ACG41301.1| lysine and histidine specific transporter [Zea mays]
Length=377

 Score =   317 bits (811),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/370 (44%), Positives = 244/370 (66%), Gaps = 9/370 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEA--DMKNDELIKAQMKEHF  450
             FW RH++K+ V+LGV G G+  Y  YD  R +   +E +L A  +   D+L+K Q++ HF
Sbjct  8     FWARHRRKILVSLGVAGVGYAAYHFYDARRAQAVRVE-QLRAMEEQAADDLVKNQLQAHF  66

Query  451   ENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKI  630
             E +++I D+TTLP  M +LS +I+ +LD+ +LT+KL + K   + LT  EK E W+ +KI
Sbjct  67    EKVKMICDTTTLPLAMHHLSDKITSQLDISKLTDKLRQAKVDSSALTPKEKYETWEEIKI  126

Query  631   LSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFL  810
              SFT+ V S+W+MT L+LY+RVQV ILGRHLY+D A+    +  + E+D    +  + FL
Sbjct  127   KSFTKTVSSMWAMTLLSLYVRVQVTILGRHLYLDFAQGTNGAQLQAESDTFSENGHRSFL  186

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW  990
             A ADYL    +T  ++  + A +EVLK KQLKD  +   +  TV+QILD FM++   + W
Sbjct  187   AMADYLVTDKITAFLAQMQRAATEVLKEKQLKDRMNMDQVLQTVLQILDMFMALSEDNSW  246

Query  991   LRYLMPEDPKIYS-LAAPSSSDNTDLCRASNF---EQLMQETRAVLSSAEFGNVVDVSLK  1158
             + YL+PE+P +Y+ L A SSS   D    ++F   +QLM ETR VL+S +F N+++ SL+
Sbjct  247   INYLVPENPPVYAQLMAVSSSGFDDSSLLNDFRKLDQLMSETRIVLASDDFRNIMERSLR  306

Query  1159  TVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVEL  1338
              +   +VED+ VQ        G+PLA LLP++ HL   LLEEPN+N++IQ+I+++PEVEL
Sbjct  307   KIAGVVVEDLGVQIVTPG--SGLPLATLLPKVDHLSSPLLEEPNKNKHIQIIRSMPEVEL  364

Query  1339  IFTLLYSSTP  1368
              +TLLY++ P
Sbjct  365   FYTLLYTNMP  374



>ref|NP_001141850.1| lysine and histidine specific transporter [Zea mays]
 gb|ACF87167.1| unknown [Zea mays]
 tpg|DAA39894.2| TPA: lysine and histidine specific transporter [Zea mays]
Length=377

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 241/370 (65%), Gaps = 9/370 (2%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEA--DMKNDELIKAQMKEHF  450
             FW RH++K+ V+LGV G G+  Y  YD  R ++  +E +L A  +   D+ +K Q++ HF
Sbjct  8     FWARHRRKILVSLGVAGVGYAAYHFYDARRAQVVRVE-QLRAMEEQAADDFVKNQLQAHF  66

Query  451   ENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKI  630
             E ++ I D+TTLP  M +LS +I+ +LD+ +LT+KL + K   + LT  EK E W+ +KI
Sbjct  67    EKVKRICDTTTLPLAMHHLSDKITSQLDISKLTDKLRQAKVDSSALTPKEKYETWEEIKI  126

Query  631   LSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFL  810
              SF ++V S+W+MT L+LY+RVQV ILGRHLY+D A+       + E+D    +  + FL
Sbjct  127   KSFAKIVSSMWAMTLLSLYVRVQVTILGRHLYLDFAQGTNGPQLQAESDTFSENGHRSFL  186

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW  990
             A ADYL    +T  ++  + A +EVLK KQLKD  +   +  TV+QILD FM +   + W
Sbjct  187   AMADYLVTDKITGFLTQMQRAATEVLKEKQLKDRMNMDQVLQTVLQILDMFMGLSEDNSW  246

Query  991   LRYLMPEDPKIYS-LAAPSSSDNTDLCRASNF---EQLMQETRAVLSSAEFGNVVDVSLK  1158
             + YL+PE+P +Y+ L A SSS   D    ++F   +QLM ETR VL+S +F N+++ SL+
Sbjct  247   INYLVPENPPVYAQLMAVSSSGFDDSSLLNDFRKLDQLMSETRIVLASDDFRNIMERSLR  306

Query  1159  TVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVEL  1338
              +   +VED+ VQ        G+PLA LLP++ HL   LLEEPN+N++IQ+I+++PEVEL
Sbjct  307   KIAGVVVEDLGVQIVTPG--SGLPLATLLPKVDHLSSPLLEEPNKNKHIQIIRSMPEVEL  364

Query  1339  IFTLLYSSTP  1368
              +TLLY++ P
Sbjct  365   FYTLLYTNMP  374



>ref|XP_011039102.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X3 
[Populus euphratica]
Length=298

 Score =   292 bits (748),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 174/217 (80%), Gaps = 0/217 (0%)
 Frame = +1

Query  277  FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
            FWRRH+ K+ +T GVLGSG+ LY+LY+ H +R+ ++E+EL     NDE+IKAQ++ H EN
Sbjct  7    FWRRHRSKILITAGVLGSGYFLYRLYNAHEQRLADMERELARQRANDEVIKAQLQAHIEN  66

Query  457  IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
            +Q+IAD+TTLPH MQYL SRI+EELDL QLTE+L KGK +P TLT++EKLELWDRLKILS
Sbjct  67   VQLIADTTTLPHAMQYLRSRIAEELDLSQLTERLQKGKGKPYTLTSSEKLELWDRLKILS  126

Query  637  FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
            FT+MV+SLW++T L+LYI+VQVNILGRH+YIDTAR LGSS   E  D+I RDDQQ FL S
Sbjct  127  FTQMVVSLWAVTILSLYIKVQVNILGRHMYIDTARGLGSSLLLENVDLIDRDDQQKFLVS  186

Query  817  ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTI  927
            AD+LAN GL  LIS+ +A  +EV++G +   +   ++
Sbjct  187  ADFLANNGLPALISNIQAVVTEVIEGAEFGKIMGISL  223


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 79/123 (64%), Gaps = 5/123 (4%)
 Frame = +1

Query  1009  EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDI  1188
             +D + + ++A   ++N      SN + ++ E   V+  AEFG ++ +SLK  VDA+VED+
Sbjct  178   DDQQKFLVSADFLANNGLPALISNIQAVVTE---VIEGAEFGKIMGISLKVAVDALVEDM  234

Query  1189  RVQCGET--NLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSS  1362
               +C  T  +L  GMPLAKLL R+  +   LL E ++N++IQ+I+ +PEVEL FTLLY++
Sbjct  235   EAKCQSTGASLTSGMPLAKLLSRVMQIVPSLLREASQNQFIQIIRTVPEVELFFTLLYAN  294

Query  1363  TPV  1371
               V
Sbjct  295   NLV  297



>emb|CDX93687.1| BnaA06g03610D [Brassica napus]
Length=271

 Score =   290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/276 (54%), Positives = 200/276 (72%), Gaps = 10/276 (4%)
 Frame = +1

Query  550   EKLMKGKDQPNTLTAAEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYI  729
             E+L +GK     L+ +EKL LWD+LKILSFTRMVLSLWS+T L+LYIRVQVNILGRHLY+
Sbjct  2     ERLNRGK---GVLSQSEKLHLWDQLKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYV  58

Query  730   DTARRL--GSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQL  903
             DTAR L   SS+  EE D+I RDD+Q FL+SAD+L    +  LIS+ ++A SEVLKG QL
Sbjct  59    DTARALDTSSSHLLEELDVIDRDDEQKFLSSADFLVTNAMPGLISNMQSAVSEVLKGMQL  118

Query  904   KDVFSTTILHDTVVQILDRFMSMGSPHHWLRYL-MPEDPKIYSLAAPSSSDNTDLCRASN  1080
             KDV +T +L +T+++I+D FMS GSPHHW+ YL MP+D K+    +  SSD T     S 
Sbjct  119   KDVITTRVLQETLLRIVDVFMSSGSPHHWVDYLMMPQDTKLSRTTSDGSSDET----VSK  174

Query  1081  FEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAH  1260
             F QLM ETR VL+S EF ++V++SLK   DA+VE++  Q     L  GMPLAK+LP++  
Sbjct  175   FNQLMVETRQVLTSTEFTDIVEISLKCFTDALVEEMETQSISGGLATGMPLAKMLPQIEK  234

Query  1261  LGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
                 ++ EP +N+++Q+I+++ EV++ FTLLY+S P
Sbjct  235   TIPVIIAEPGKNQFLQLIRDMSEVQVFFTLLYASMP  270



>gb|EMT02612.1| Peroxisomal biogenesis factor 3 [Aegilops tauschii]
Length=494

 Score =   292 bits (747),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 217/317 (68%), Gaps = 7/317 (2%)
 Frame = +1

Query  430   AQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLE  609
             A+++ HFE +Q I+D+TTLP  M YL SR+ EELD+  LTE+L++GK +   LT  +K E
Sbjct  178   ARLEAHFEKVQRISDTTTLPFAMHYLRSRVMEELDISHLTERLLQGKGE---LTPEDKYE  234

Query  610   LWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYR  789
              W+++KILSFTR V S+W+MT L+LY+RVQV ILGRHLY+D AR    +  + E+D    
Sbjct  235   TWEKIKILSFTRTVSSMWAMTLLSLYVRVQVTILGRHLYLDFARGTDGAQLQAESDTFSG  294

Query  790   DDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMS  969
             +  + FL +ADYLA YG+T LI   + A +E+LK KQLKD  S   +  T++QI ++FMS
Sbjct  295   NGHKDFLGTADYLATYGITALIRQMQHAATEILKEKQLKDPMSMDQVSQTMLQISEQFMS  354

Query  970   MGSPHHWLRYLMPEDPKIYS-LAAPSSS---DNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
             +   + W+ +L+PE+   Y+ L A SSS   D++ L      +QLM ETR VL+S +F N
Sbjct  355   LCEGNSWINFLVPENANRYAQLMAVSSSGFDDSSLLMDVGKLDQLMTETRIVLASDDFRN  414

Query  1138  VVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQ  1317
             ++D+SL+ V D ++ED+R Q G      G+PLAKLL R+A L   LLEEP++N++IQ I+
Sbjct  415   IMDMSLRKVADLVIEDLRAQVGAALPPSGLPLAKLLARVAQLSSMLLEEPSKNKHIQTIR  474

Query  1318  NLPEVELIFTLLYSSTP  1368
             ++PEV L +T LY++ P
Sbjct  475   SMPEVGLFYTFLYANMP  491



>ref|XP_006490735.1| PREDICTED: peroxisome biogenesis protein 3-2-like isoform X4 
[Citrus sinensis]
 gb|KDO62866.1| hypothetical protein CISIN_1g017709mg [Citrus sinensis]
Length=291

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 175/212 (83%), Gaps = 4/212 (2%)
 Frame = +1

Query  277  FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
            FWRRH++K+++T GVLG G+LLYKLYD  +RRI +L+++     ++DEL+KAQM+ H+E 
Sbjct  7    FWRRHRRKIFITTGVLGGGYLLYKLYDS-QRRIADLDRQ---QCEHDELLKAQMQAHYEE  62

Query  457  IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
            +Q IAD+TTLPH M YLS RI+EELDL  LT+KL++GK+QP TL+++EKLELWDRLKILS
Sbjct  63   VQRIADATTLPHAMHYLSIRIAEELDLSPLTDKLLRGKEQPYTLSSSEKLELWDRLKILS  122

Query  637  FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
            FT++V++LW++T ++LYIRVQVNILGRHLYIDTAR LGSS   E+AD+I RDDQQ FLAS
Sbjct  123  FTKLVVALWAVTMVSLYIRVQVNILGRHLYIDTARGLGSSDLPEDADLIDRDDQQKFLAS  182

Query  817  ADYLANYGLTTLISDFEAATSEVLKGKQLKDV  912
             DYLANYG+  +IS+ +AA  E LKG +   V
Sbjct  183  VDYLANYGMQAMISNVQAAADEALKGAEYTSV  214


 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +1

Query  1111  VLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPN  1290
              L  AE+ +VVD+S K  VDA+++++RVQ G  +L+ GMPLAKL+PR+  +   LL EP+
Sbjct  205   ALKGAEYTSVVDMSFKAAVDALIDEMRVQSG-GSLISGMPLAKLVPRVVQMSPSLLAEPS  263

Query  1291  RNRYIQVIQNLPEVELIFTLLYSS  1362
              NR IQVI+ +PEVEL FTLLY++
Sbjct  264   NNRIIQVIRTIPEVELFFTLLYAN  287



>ref|XP_008667564.1| PREDICTED: lysine and histidine specific transporter isoform 
X1 [Zea mays]
Length=323

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 209/317 (66%), Gaps = 6/317 (2%)
 Frame = +1

Query  430   AQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLE  609
              +++ HFE ++ I D+TTLP  M +LS +I+ +LD+ +LT+KL + K   + LT  EK E
Sbjct  6     CRLQAHFEKVKRICDTTTLPLAMHHLSDKITSQLDISKLTDKLRQAKVDSSALTPKEKYE  65

Query  610   LWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYR  789
              W+ +KI SF ++V S+W+MT L+LY+RVQV ILGRHLY+D A+       + E+D    
Sbjct  66    TWEEIKIKSFAKIVSSMWAMTLLSLYVRVQVTILGRHLYLDFAQGTNGPQLQAESDTFSE  125

Query  790   DDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMS  969
             +  + FLA ADYL    +T  ++  + A +EVLK KQLKD  +   +  TV+QILD FM 
Sbjct  126   NGHRSFLAMADYLVTDKITGFLTQMQRAATEVLKEKQLKDRMNMDQVLQTVLQILDMFMG  185

Query  970   MGSPHHWLRYLMPEDPKIYS-LAAPSSSDNTDLCRASNF---EQLMQETRAVLSSAEFGN  1137
             +   + W+ YL+PE+P +Y+ L A SSS   D    ++F   +QLM ETR VL+S +F N
Sbjct  186   LSEDNSWINYLVPENPPVYAQLMAVSSSGFDDSSLLNDFRKLDQLMSETRIVLASDDFRN  245

Query  1138  VVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQ  1317
             +++ SL+ +   +VED+ VQ        G+PLA LLP++ HL   LLEEPN+N++IQ+I+
Sbjct  246   IMERSLRKIAGVVVEDLGVQIVTPG--SGLPLATLLPKVDHLSSPLLEEPNKNKHIQIIR  303

Query  1318  NLPEVELIFTLLYSSTP  1368
             ++PEVEL +TLLY++ P
Sbjct  304   SMPEVELFYTLLYTNMP  320



>gb|EMS62415.1| Peroxisome biogenesis protein 3-2 [Triticum urartu]
Length=397

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 211/320 (66%), Gaps = 8/320 (3%)
 Frame = +1

Query  421   LIKAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAE  600
             ++ + ++ HFE +Q I+D+TTLP  M YL SR+ EELD+  LTE+L++GK +   LT  +
Sbjct  79    IMSSWLEAHFEKVQRISDTTTLPFAMHYLRSRVMEELDISHLTERLLQGKGE---LTPED  135

Query  601   KLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADI  780
             K E W+++KILS++ M  +      L+LY+RVQV ILGRHLY+D AR    +  + E+D 
Sbjct  136   KYETWEKIKILSWS-MSFNCCYFFYLDLYVRVQVTILGRHLYLDFARGTDGAQLQAESDT  194

Query  781   IYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR  960
                +  + FL +ADYLA YG+T LI   + A +E+LK KQLKD  S   +  T++QI ++
Sbjct  195   FSGNGHKDFLGTADYLATYGITALIRQMQQAATEILKEKQLKDPMSMDQVLQTMLQISEQ  254

Query  961   FMSMGSPHHWLRYLMPEDPKIYS-LAAPSSS---DNTDLCRASNFEQLMQETRAVLSSAE  1128
             FMS+   + W+ +L+PE    Y+ L A SSS   D++ L      +QLM ETR VL+S +
Sbjct  255   FMSLCEGNSWINFLVPESANRYAQLMAVSSSGFDDSSLLMDVGKLDQLMTETRIVLASDD  314

Query  1129  FGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQ  1308
             F N++D+SL+ V D ++ED+R Q G      G+PLAKLL R+A L   LLEEP++N++IQ
Sbjct  315   FRNIMDMSLRKVADLVIEDLRAQVGAALPPSGLPLAKLLARVAQLSSMLLEEPSKNKHIQ  374

Query  1309  VIQNLPEVELIFTLLYSSTP  1368
              I+++PEV L +T LY++ P
Sbjct  375   TIRSMPEVGLFYTFLYANMP  394



>gb|ABR17606.1| unknown [Picea sitchensis]
Length=375

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 156/378 (41%), Positives = 230/378 (61%), Gaps = 20/378 (5%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F  RH++KV  TLG++G G+ LY++Y   + R+  LE+E EA+ + DEL++ +++EHFE+
Sbjct  7     FVNRHRRKVLFTLGIVGGGYALYRVYCAQKERMLVLEEEEEAERRADELVEIRLREHFES  66

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
             +Q ++DS++L   +  L   + E LD  +LTE+L KGK     L   EKLELW+RLKILS
Sbjct  67    LQRMSDSSSLAAALDNLKDHLFEALDYSELTERLNKGKGH---LIPQEKLELWERLKILS  123

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR V +LW+MT LNLY R Q+NILGRH +I+ AR   +    E  D      QQ FL S
Sbjct  124   FTRTVCALWAMTVLNLYTRTQLNILGRHFFINQARGFENL---ESMDQSIALCQQKFLGS  180

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
             AD+L  YG+T LI   E     +L+ K L++  +   L+D   +IL+ F S  S   W+ 
Sbjct  181   ADFLPQYGVTGLIVRMEKIVENILESKHLREPLTVGELYDIFRRILNNFPS--SSLQWIN  238

Query  997   YLMPEDPKIYS--LAAPSSSDNTDLCRA---------SNFEQLMQETRAVLSSAEFGNVV  1143
             Y++PE+  +Y    +  S+   + L RA         +  EQLM ETR VLSS +F  ++
Sbjct  239   YVIPENGLLYQELSSGTSTFGVSQLPRAVLSPFETERAKLEQLMAETRDVLSSNDFALIL  298

Query  1144  DVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNL  1323
             + SLKTV+D+M+E+      E      +PLAKLLP ++H    LLE P +NR+I +I NL
Sbjct  299   EQSLKTVLDSMMEEFNTMF-EGVTSGSIPLAKLLPPVSHASTVLLEHPTKNRFINIIGNL  357

Query  1324  PEVELIFTLLYSSTPVVS  1377
             P+V+  + L+Y++   +S
Sbjct  358   PQVQSFYALVYANAGGIS  375



>ref|XP_010097593.1| Peroxisome biogenesis protein 3-2 [Morus notabilis]
 gb|EXB69125.1| Peroxisome biogenesis protein 3-2 [Morus notabilis]
Length=213

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = +1

Query  277  FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKN-DELIKAQMKEHFE  453
            FWR+HK+KV V  G++GSG++LYKLY+ HR+R+ +LE+EL ++ +  DEL+K QM+ HFE
Sbjct  31   FWRKHKRKVLVGAGLIGSGYVLYKLYNAHRQRLDDLERELASERRKVDELVKDQMQAHFE  90

Query  454  NIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKIL  633
            NIQ IAD+TTLPH MQYLS+RI EELDL  LT++LMKGK QPNTL ++EK ELWDRLKIL
Sbjct  91   NIQRIADTTTLPHAMQYLSNRIEEELDLSHLTDRLMKGKGQPNTLMSSEKHELWDRLKIL  150

Query  634  SFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRL  747
            SFTRMVLSLW+MT L+LYIRVQVNILGRHLYIDTAR L
Sbjct  151  SFTRMVLSLWTMTILSLYIRVQVNILGRHLYIDTARHL  188



>gb|EMS51732.1| Peroxisome biogenesis protein 3-1 [Triticum urartu]
Length=318

 Score =   233 bits (595),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 177/268 (66%), Gaps = 7/268 (3%)
 Frame = +1

Query  328   SGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFENIQIIADSTTLPHVMQYL  507
             +G+  Y+ YD H++++  +E+  E +   DE+IK Q++ HFE +Q I+D+TTLP  M YL
Sbjct  52    AGYAAYRFYDAHQKQLVRVEQRAEEERAADEIIKNQLEAHFEKVQRISDTTTLPFAMHYL  111

Query  508   SSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILSFTRMVLSLWSMTTLNLY  687
              SR+ EELD+  LTE+L++GK +   LT  +K E W+++KILSFTR V S+W+MT L+LY
Sbjct  112   RSRVMEELDISHLTERLLQGKGE---LTPEDKYETWEKIKILSFTRTVSSMWAMTLLSLY  168

Query  688   IRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFE  867
             +RVQV ILGRHLY+D AR    +  + E+D    +  + FL +ADYLA YG+T LI   +
Sbjct  169   VRVQVTILGRHLYLDFARGTDGAQLQAESDTFSGNGHKDFLGTADYLATYGITALIRQMQ  228

Query  868   AATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYS-LAAPS  1044
              A +E+LK KQLKD  S   +  T++QI ++FMS+   + W+ +L+PE    Y+ L A S
Sbjct  229   QAATEILKEKQLKDPMSMDQVLQTMLQISEQFMSLCEGNSWINFLVPESANRYAQLMAVS  288

Query  1045  SS---DNTDLCRASNFEQLMQETRAVLS  1119
             SS   D++ L      +QLM ETR VL+
Sbjct  289   SSGFDDSSLLMDVGKLDQLMTETRIVLA  316



>dbj|BAG92761.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 173/258 (67%), Gaps = 4/258 (2%)
 Frame = +1

Query  607   ELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIY  786
             +LW  + +L FTR V S+W+MT L+LY+RVQV ILGRHLY+D AR    +  +E +D   
Sbjct  5     KLWIYIVVLGFTRTVSSIWAMTLLSLYVRVQVTILGRHLYLDFARVTDGAQLQEGSDTFS  64

Query  787   RDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFM  966
             +   + FLA+ADYLA YG+  LI+  + A +E+LK KQLKD      + +T++QIL +FM
Sbjct  65    KSGHKDFLATADYLATYGINALITKMQHAATEILKEKQLKDPMGIDEVLETILQILKQFM  124

Query  967   SMGSPHHWLRYLMPEDPKIYS-LAAPSSS---DNTDLCRASNFEQLMQETRAVLSSAEFG  1134
              +   + W+ YL+PE+  +Y+ L A SSS   D++ L      +QLM ETR VLSS +F 
Sbjct  125   GLCEDNSWINYLVPENANVYAQLMAVSSSGFDDSSLLKDVRKLDQLMSETRIVLSSDDFR  184

Query  1135  NVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVI  1314
             N++D SLK +   +VED+ VQ G      G+PLAKLL ++A L   LLEEP++N++IQ+I
Sbjct  185   NIMDRSLKKIASVVVEDLAVQIGAPIPPPGLPLAKLLAKVAQLSLPLLEEPDKNKHIQII  244

Query  1315  QNLPEVELIFTLLYSSTP  1368
             +++PEVEL +T LY++ P
Sbjct  245   RSMPEVELFYTFLYANMP  262



>gb|EYU40233.1| hypothetical protein MIMGU_mgv1a0090641mg, partial [Erythranthe 
guttata]
Length=189

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 149/202 (74%), Gaps = 13/202 (6%)
 Frame = +1

Query  766   EEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVV  945
             +EA++I ++D++ F+ SA YL+NYGL  L+++ EAATSEVLKGKQLKD F+ + LHD ++
Sbjct  1     DEAELIDKNDEEQFMDSAYYLSNYGLPALLANAEAATSEVLKGKQLKDYFNVSTLHDAII  60

Query  946   QILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
             QI+D  M M SPH+W+ YLMPED   YS          D  RA+ F+ LM ETRAVL SA
Sbjct  61    QIMDTLMIMRSPHYWVGYLMPED---YS----------DRSRATKFDLLMGETRAVLLSA  107

Query  1126  EFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYI  1305
             EF N+VD+SL  VV  +++D+ + CGE NLM G+PLA+++PR+AH+   L+ E NR RYI
Sbjct  108   EFANIVDISLGAVVKRVLKDVSISCGENNLMSGIPLARVIPRIAHISDSLIGEDNRFRYI  167

Query  1306  QVIQNLPEVELIFTLLYSSTPV  1371
             ++ +++PEVE  FTLLYSSTPV
Sbjct  168   RITRSIPEVEQFFTLLYSSTPV  189



>ref|XP_001769437.1| predicted protein [Physcomitrella patens]
 gb|EDQ65806.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 143/396 (36%), Positives = 224/396 (57%), Gaps = 37/396 (9%)
 Frame = +1

Query  247   LNGNCKMIMQFW-RRHKKKVYVTLGVLGSGFLLY-------------KLYDGHRRRIFEL  384
             L+  C    + W ++H++ + V  G++G G  +Y             K  D  R  +   
Sbjct  5     LHITCYYDFKAWVKKHQRSLLVAAGLVGGGSAVYYGLHYLGLTSQARKERDAARAALLHR  64

Query  385   EKELEADMKNDELIKAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMK  564
             E E        E  +AQ++ HFE+IQ I+D+TTLP V+  L + +  ++DL  LTEKL+ 
Sbjct  65    EAE--------ERAEAQLQSHFESIQRISDTTTLPSVLPQLKASLFSKVDLSGLTEKLIL  116

Query  565   GKDQPNTLTAAEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARR  744
             GKD P  L+  +K++LW  LK LSFTR V ++ +++ L+L+IR+Q+NILGR +Y DTAR 
Sbjct  117   GKDDPQALSQRDKMQLWQELKTLSFTRTVCAMSALSLLDLFIRIQLNILGRRVYFDTARD  176

Query  745   LGSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTT  924
               +   E+    +    Q  F+A A YL + GL  L+ D   A    L+GKQLK+ F+  
Sbjct  177   FMNP--EDLHAPLSMSVQHKFIAFAGYLHHKGLAALVGDIYKAAEIELRGKQLKESFTLY  234

Query  925   ILHDTVVQILDRFMSMGSPHHWLRY------LMPEDPKIYSLAAPSSSDNTDLCRASN--  1080
              L +  V+IL    S      W++Y      ++PED    S AA +S+   D+  + N  
Sbjct  235   DLKNVFVRILATLDSKRPA--WVQYVLPPDNVLPEDLAGASSAADASNQFADVATSDNEV  292

Query  1081  FEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDI-RVQCGETNLMVGMPLAKLLPRLA  1257
              +QLM ETRAVL+S EF  V  V L+ ++D ++E++  +  G ++   G+PLAKLLP +A
Sbjct  293   LDQLMNETRAVLASNEFHEVQAVCLEVMLDGVMEELYTIYRGSSD--SGIPLAKLLPPVA  350

Query  1258  HLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSST  1365
               G  LLE P+ NR+I+++ +LP+V     L+Y+++
Sbjct  351   GAGSTLLEHPDENRFIRILASLPQVHAFCALVYTNS  386



>gb|EYU40232.1| hypothetical protein MIMGU_mgv1a0090642mg, partial [Erythranthe 
guttata]
Length=165

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  271  MQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHF  450
            M+FWRRHK+KVY+TLGV GSG+LL+K YD  RRRI +L+K+L  D +  EL+KAQ++ HF
Sbjct  1    MEFWRRHKRKVYITLGVCGSGYLLFKSYDAWRRRIGDLKKQLADDKEEGELLKAQVRTHF  60

Query  451  ENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKI  630
            ENIQ   DS  LP VM  L  R++E LDL  L ++LM+GK QPNTLTA EK ELWDRLK 
Sbjct  61   ENIQRTMDSIILPKVMDTLDKRLAENLDLTLLLDRLMQGKGQPNTLTANEKHELWDRLKC  120

Query  631  LSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSS  756
            LSFT++V SLWSMT L+LY+RVQVNILGRHL+I+TAR LG S
Sbjct  121  LSFTKLVSSLWSMTMLSLYLRVQVNILGRHLFINTARGLGIS  162



>ref|XP_003631070.1| Peroxisomal biogenesis factor [Medicago truncatula]
Length=552

 Score =   218 bits (556),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +1

Query  268  IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
            +  FWRRH++K+++++G++G G+ LYKLY  HR+R+  LE EL+   ++DELIK+QM+ H
Sbjct  4    VRDFWRRHRRKIFLSVGIVGGGYCLYKLYGAHRQRLDALEMELDVQRQSDELIKSQMQAH  63

Query  448  FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
            FENIQ I+D+ TLPH M  LS RI+++LDL  L E+L++GK QPNTLT +EKL+LW RLK
Sbjct  64   FENIQRISDTITLPHSMHNLSCRIAQDLDLSHLLERLIQGKGQPNTLTQSEKLDLWGRLK  123

Query  628  ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSS  756
            ILSFTRM LS+W+   L+LY +VQVNILGRHLYIDTAR L SS
Sbjct  124  ILSFTRMALSVWATVMLSLYTKVQVNILGRHLYIDTARSLESS  166


 Score =   194 bits (493),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 147/214 (69%), Gaps = 13/214 (6%)
 Frame = +1

Query  727   IDTARRLGSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLK  906
             +DT  R   S  +E  D++  +D+Q FL S D+L+ +G+  LISD E AT EVLKGKQL 
Sbjct  350   LDTTHR---SNIKESEDVVDGEDKQKFLGSVDFLSQHGMPALISDMEEATKEVLKGKQLT  406

Query  907   DVFSTTILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFE  1086
              +F+ T   +T+  IL+ FMS GSPH W++Y++PED K++S A  S S++T     + F+
Sbjct  407   SLFNNTTFDETITDILNTFMSRGSPHFWVKYIIPEDAKLHSTA--SGSNDTVPLDMTEFD  464

Query  1087  QLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLG  1266
             QL+ E R VLSSAEFG+VV++SLK VVD + E +    G T++    PLA+ LP++A + 
Sbjct  465   QLVMEARGVLSSAEFGSVVEISLKAVVDTLRELM----GTTSV----PLARALPQVAQMC  516

Query  1267  QQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
               LLEEP++N++IQ+++N+PEVEL  T LY++ P
Sbjct  517   PLLLEEPSKNQFIQILKNIPEVELFLTFLYANMP  550



>gb|EPS67028.1| hypothetical protein M569_07748, partial [Genlisea aurea]
Length=169

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = +1

Query  268  IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
            + +FWRRHK+KVYVTLGV+GSG+L YKLYD  +R + +LEK+ E + K +ELIK+Q++ H
Sbjct  1    MWEFWRRHKRKVYVTLGVVGSGYLAYKLYDSWKRSVSDLEKQREEERKAEELIKSQIEAH  60

Query  448  FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
            FE++Q  AD TTLPHV+  LSSR+SE LDL  L ++L++ KDQ N L+ A+K+ELW+R+ 
Sbjct  61   FESVQKTAD-TTLPHVIYLLSSRLSENLDLDHLMQRLVQAKDQENPLSTAQKVELWNRVN  119

Query  628  ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGS  753
            IL FT+++ SLWSMT L+L+IR+ +NILGRHLYID+AR LGS
Sbjct  120  ILCFTKLISSLWSMTILSLFIRILLNILGRHLYIDSARGLGS  161



>ref|XP_001755103.1| predicted protein [Physcomitrella patens]
 gb|EDQ80047.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/325 (38%), Positives = 198/325 (61%), Gaps = 14/325 (4%)
 Frame = +1

Query  415   DELIKAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTA  594
             +E  +AQ++ HFE+IQ I+D+TTLP ++  L  R+  ++DL  LTEKL+ GK+ P +L+ 
Sbjct  67    EERAEAQLQSHFESIQRISDTTTLPSMLPQLKDRLFSKVDLSGLTEKLILGKEDPQSLSQ  126

Query  595   AEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEA  774
              EK++LW  LK LSF R V ++ +++ L+L+IR+Q+NILGRH+Y DTAR   +   E+  
Sbjct  127   REKMQLWQELKTLSFVRTVCAMSALSLLDLFIRIQLNILGRHVYFDTARDFMNP--EDSH  184

Query  775   DIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL  954
               +    Q  F+A A YL + GL  L+ D   A   VL+ K LK+ ++   L D  ++I 
Sbjct  185   VPLSMSVQHKFIAYAGYLHHKGLDALVGDVNQAAEIVLRSKPLKEPYTLDDLRDVFMRIR  244

Query  955   DRFMSMGSPHHWLRYLMPED---PKIYSLAAPSSSDNTDLCRASN----FEQLMQETRAV  1113
                 S  S   W++Y++P D   P   S+A+ + + N     A N     +QLM ETRAV
Sbjct  245   ATLDSKRSA--WVQYVLPPDNVLPDDLSVASSADASNPVAEMALNDNEVLDQLMNETRAV  302

Query  1114  LSSAEFGNVVDVSLKTVVDAMVEDI-RVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPN  1290
             L S EF  V+ V + +++D ++E++  +  G ++   G+PLAKLLP +A  G  LLE  +
Sbjct  303   LVSNEFHEVMAVCVDSMLDGVMEELYAIYRGSSD--NGIPLAKLLPPVAGAGSALLESLD  360

Query  1291  RNRYIQVIQNLPEVELIFTLLYSST  1365
              NR+I+++ +LP+V     L+Y+++
Sbjct  361   DNRFIRILADLPQVHAFCALVYTNS  385



>ref|XP_001753372.1| predicted protein [Physcomitrella patens]
 gb|EDQ81595.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/387 (33%), Positives = 219/387 (57%), Gaps = 20/387 (5%)
 Frame = +1

Query  247   LNGNCKMIMQFW-RRHKKKVYVTLGVLGSGFLLYKLY-----DGHRRRIFELEKELEADM  408
             L+  C   ++ W +++++ + +  G++G G  +Y        D   R+  +  +      
Sbjct  5     LHITCHYDLKAWVKKYRRSLLIAAGLVGGGTAIYYGVQYLGLDSQSRKERDAARVALVQK  64

Query  409   KNDELIKAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTL  588
             + +E  + Q++ HFE IQ I+DSTTLP V+ +L + +  ++DL  LT+KLM  K  P  L
Sbjct  65    EAEERAEVQLQSHFEGIQRISDSTTLPSVLPHLKASLYSKVDLEGLTDKLMLCKVDPQLL  124

Query  589   TAAEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEE  768
             +  +K++LW  LK  SF R V ++ +++ L+L+IR+Q+NILGR +Y DTAR + +S  E+
Sbjct  125   SHRDKMQLWQELKTRSFARTVCAMTAVSLLDLFIRIQLNILGRRVYFDTARNMMNS--ED  182

Query  769   EADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQ  948
                 +    Q  F+A A YL + GL TL++D       VL+GKQLK+ ++   L D  ++
Sbjct  183   SHVPLSMSVQHKFIAFAGYLHHKGLATLVADTYKVVEIVLRGKQLKEPYTIDELRDVFMK  242

Query  949   ILDRFMSMGSPHHWLRYLMPED---PKIYSLAAPSSSDNTDLCRASN----FEQLMQETR  1107
             I     S  SP  W++Y++P +   P  +   + ++     +   ++      QLM ETR
Sbjct  243   IRASLDSRRSP--WVQYVLPPENVLPDEFVATSSAADAAASVSDMTHEDDVLAQLMNETR  300

Query  1108  AVLSSAEFGNVVDVSLKTVVDAMVEDI-RVQCGETNLMVGMPLAKLLPRLAHLGQQLLEE  1284
             AV+SS EF  V+ V L  ++D ++E++  +  G  +    +PLA++LP +A  G  LLE 
Sbjct  301   AVVSSDEFNEVLAVCLDAILDGVMEELYTIYRGSPD--NSIPLARMLPPVAGAGSTLLEH  358

Query  1285  PNRNRYIQVIQNLPEVELIFTLLYSST  1365
             P+ NR+I ++ NLP+V     L+Y+++
Sbjct  359   PDENRFISILANLPQVHAFCALVYTNS  385



>ref|XP_002960244.1| hypothetical protein SELMODRAFT_74269 [Selaginella moellendorffii]
 gb|EFJ37783.1| hypothetical protein SELMODRAFT_74269 [Selaginella moellendorffii]
Length=362

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 206/367 (56%), Gaps = 35/367 (10%)
 Frame = +1

Query  301   VYVTLGVLGSGFLLYKLYDGHRRR-------IFELEKELEADMKNDELIKAQMKEHFENI  459
             + +  G LG+G +LY  +  +          + E E  L A+ + + ++   ++ H + I
Sbjct  18    ILIAAGALGAGCVLYYGFTRYSAAALARARAVEEEESRLRAETEEERIL--HLRRHCDEI  75

Query  460   QIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILSF  639
             Q++AD+TTLP ++ +LS R+ E ++L +LT +LM GK+ P  LT  EKL LW +LK+ SF
Sbjct  76    QLLADATTLPSLLAHLSERLFELVNLSELTRQLMAGKEGPQALTPDEKLNLWQKLKVSSF  135

Query  640   TRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLASA  819
             TR + + W M  + L++RVQ+N+LGR L+I TA     S+     D+ +   Q  FLA  
Sbjct  136   TRTLCAAWGMGLVQLFVRVQLNLLGRQLFISTA-----SF----GDLPF-STQHKFLAFG  185

Query  820   DYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRY  999
             D+L  +G+  L+ D E A +EV++   LK  +S   L D ++QI   F        W RY
Sbjct  186   DFLPLHGIALLVQDVEEAVTEVMRDISLKKAYSFDELRDLLIQIQAAFEK--QQKDWCRY  243

Query  1000  LMPEDPKI----YSLAAPSSSDNTDLCRASNFEQLM-QETRAVLSSAEFGNVVDVSLKTV  1164
             L+PE+ K+    Y +A  S S + D       EQL+  + R V+SSAEF + +   L  +
Sbjct  244   LLPENDKLPEEDYPVAESSHSRDDD-------EQLLVAKARDVISSAEFQHTLGAVLDAL  296

Query  1165  VDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIF  1344
             +D MV+D+ +   +    VG+PLAKL+P ++ +G  LL+    ++Y++ +  LPEV+   
Sbjct  297   LDTMVQDL-LPYYQGQPAVGLPLAKLVPAVSSVG-MLLDNRQDSKYVRAVAELPEVKSFS  354

Query  1345  TLLYSST  1365
              ++Y S 
Sbjct  355   AMVYGSA  361



>emb|CBI15533.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +1

Query  895   KQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRA  1074
             KQL+DVF++ +LH T++QILD F+S G PH+ + YLMP+D K Y  A+PS+ D++     
Sbjct  6     KQLRDVFNSMVLHGTIMQILDLFISTGKPHNLVDYLMPDDTKSYKPASPSNGDSSTPADV  65

Query  1075  SNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIR-VQCGETNLMVGMPLAKLLPR  1251
             + F+QLM ETRAVLSSAEF NV+DVSL+TVVDA+VED+  VQ G  +   GM LAKLLPR
Sbjct  66    TKFDQLMVETRAVLSSAEFINVIDVSLRTVVDAVVEDMMGVQLGGGSPSSGMVLAKLLPR  125

Query  1252  LAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
             +A +G  LLEEP++NR+IQ+IQ  PEVE  FTLLY++ P
Sbjct  126   VAQMGPLLLEEPSKNRFIQIIQKAPEVEFFFTLLYANMP  164



>ref|XP_010663658.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Vitis vinifera]
Length=170

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +1

Query  895   KQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRA  1074
             KQL+DVF++ +LH T++QILD F+S G PH+ + YLMP+D K Y  A+PS+ D++     
Sbjct  10    KQLRDVFNSMVLHGTIMQILDLFISTGKPHNLVDYLMPDDTKSYKPASPSNGDSSTPADV  69

Query  1075  SNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIR-VQCGETNLMVGMPLAKLLPR  1251
             + F+QLM ETRAVLSSAEF NV+DVSL+TVVDA+VED+  VQ G  +   GM LAKLLPR
Sbjct  70    TKFDQLMVETRAVLSSAEFINVIDVSLRTVVDAVVEDMMGVQLGGGSPSSGMVLAKLLPR  129

Query  1252  LAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
             +A +G  LLEEP++NR+IQ+IQ  PEVE  FTLLY++ P
Sbjct  130   VAQMGPLLLEEPSKNRFIQIIQKAPEVEFFFTLLYANMP  168



>dbj|BAB02028.1| unnamed protein product [Arabidopsis thaliana]
Length=197

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 138/204 (68%), Gaps = 10/204 (5%)
 Frame = +1

Query  757   YQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHD  936
             + ++E D+I RDD+Q FL SAD+LA  G+ +LIS+ + A  EVLKGKQLKDV +T+ L +
Sbjct  3     FSQDELDLIERDDEQKFLTSADFLATSGMPSLISNMQNAVKEVLKGKQLKDVLTTSALRE  62

Query  937   TVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVL  1116
             TV++ILD FMS GSPHHW+ YLM        +   SSSD T     + F  L+ ETR VL
Sbjct  63    TVMRILDVFMSTGSPHHWVDYLMMSQDATTDV---SSSDAT----VTKFHLLITETREVL  115

Query  1117  SSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRN  1296
             +S +F NV ++SLK    A+VE++  Q G   L  GM LAKLLP++     ++  EP +N
Sbjct  116   TSNDFSNVAEISLKCCAVALVEEMETQTG---LATGMQLAKLLPQIEKTMPEISAEPEKN  172

Query  1297  RYIQVIQNLPEVELIFTLLYSSTP  1368
             R++Q+I++LPEV+L FTLLY++ P
Sbjct  173   RFLQLIRDLPEVKLFFTLLYANMP  196



>gb|ACU17567.1| unknown [Glycine max]
Length=176

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = +1

Query  841   LTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYLMPEDPK  1020
             +  LISD EAAT EVLKGKQL   F++T LH+T++QIL+ FMSMG+P+ W++Y++PED +
Sbjct  1     MPALISDMEAATKEVLKGKQLSTFFNSTTLHETIMQILNSFMSMGTPNSWIKYMIPEDVR  60

Query  1021  IYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQC  1200
              YS      SD+      + FEQLM E  AVLSSAEFG++V++ LK VVD +VE +  + 
Sbjct  61    PYSTT--HGSDDPVPFDMTEFEQLMMEAWAVLSSAEFGSIVEIFLKAVVDTLVELMGTKF  118

Query  1201  GETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
                ++  G+PLA++LP++A +   LLEEP +N++IQ+I+N+ EVEL FTLLY++ P
Sbjct  119   SGGSVAGGLPLARVLPQVAQMCPLLLEEPRKNQFIQIIKNIQEVELFFTLLYANMP  174



>ref|XP_008653862.1| PREDICTED: peroxisome biogenesis protein 3-2-like, partial [Zea 
mays]
Length=215

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 131/206 (64%), Gaps = 7/206 (3%)
 Frame = +1

Query  763   EEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTV  942
             + E+D    +  + FLA ADYL    +T  I   + A +EVLK K LKD  +   +  TV
Sbjct  10    QAESDTFSENGHKSFLAMADYLVTDKITAFIMQMQRAATEVLKEKPLKDRMNMDQVLQTV  69

Query  943   VQILDRFMSMGSPHHWLRYLMPEDPKIYS-LAAPSSSDNTDLCRASNF---EQLMQETRA  1110
             +QILD FM +   + W+ YL+PE+P +Y+ L A SSS   D    ++F   +QLM ETR 
Sbjct  70    IQILDTFMDLCEANSWINYLVPENPPVYAQLMAVSSSGFDDSSLLNDFRKLDQLMSETRI  129

Query  1111  VLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPN  1290
             VL+S +F N+++ SL+ + + +V D+ VQ   T L  G+PLA LLP++ HL   LLEEPN
Sbjct  130   VLASDDFRNIMERSLRKIAEVVVGDLAVQ---TTLGSGLPLATLLPKVGHLSSPLLEEPN  186

Query  1291  RNRYIQVIQNLPEVELIFTLLYSSTP  1368
              N+YIQ+I+++PEVEL +T LY++ P
Sbjct  187   NNKYIQIIRSMPEVELFYTFLYANMP  212



>gb|ACU17566.1| unknown [Glycine max]
Length=123

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = +1

Query  268  IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
            +  FWRRH++KV+VT+GVLGSG+LLYKLY   R  + ELE+EL    + ++L+KAQM+ H
Sbjct  4    VRDFWRRHRRKVFVTVGVLGSGYLLYKLYGAQRHGVQELERELAVQRETEDLMKAQMQAH  63

Query  448  FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
            FENIQ ++D  TLPH M  LS RI+EELDL  L E+L++GK QPNTLT +EKL+LW RLK
Sbjct  64   FENIQKMSD-VTLPHAMHELSCRITEELDLSHLLERLIQGKGQPNTLTQSEKLDLWSRLK  122

Query  628  I  630
             
Sbjct  123  F  123



>ref|XP_006837203.1| hypothetical protein AMTR_s00105p00087820 [Amborella trichopoda]
 gb|ERN00057.1| hypothetical protein AMTR_s00105p00087820 [Amborella trichopoda]
Length=172

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 113/175 (65%), Gaps = 10/175 (6%)
 Frame = +1

Query  865   EAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPS  1044
             ++A +++LK K L+D F+   LHDT  ++L  FMS   PHHW+ Y++PE    Y    P+
Sbjct  2     QSAATDILKEKHLRDPFTMADLHDTFARMLQSFMS--GPHHWVNYIVPETASAYKELTPA  59

Query  1045  SSDNTDLCRAS---NFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQ--CGET  1209
             SS   +    S     EQL+ ETRAVL+S +F  V +++LK V D ++E++R     G +
Sbjct  60    SSHIGESLHPSATGKLEQLVVETRAVLASDDFSRVAEIALKNVTDGVMEEVRPHFDGGSS  119

Query  1210  NLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTPVV  1374
             N   G+PLAK+L R+A L   LLEEP+RNRYI +I++LPEVEL + LLY++ P+ 
Sbjct  120   N---GIPLAKILARVAQLSSDLLEEPSRNRYIHIIRSLPEVELFYRLLYANMPLA  171



>ref|XP_010097594.1| Peroxisome biogenesis protein 3-2 [Morus notabilis]
 gb|EXB69126.1| Peroxisome biogenesis protein 3-2 [Morus notabilis]
Length=383

 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +1

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMG  975
             QQ FLASAD+L+ Y L  LIS+ +AA +EVLKGKQL+D  +TT+LH+T++QIL+ FMS+ 
Sbjct  54    QQRFLASADFLSTYALPALISNMQAAVTEVLKGKQLRDFINTTVLHETIIQILNTFMSIR  113

Query  976   SPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSS  1122
             SPH W+ YLMPED +++ LA  SSSD+  L   + F+QLM ETRAV+SS
Sbjct  114   SPHLWVGYLMPEDARLHELATASSSDDKGLSDVTKFDQLMVETRAVISS  162


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = +1

Query  1015  PKIYSLAAPSS-SDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIR  1191
             P  ++ ++PS  S   D C   +   +    R   S A+F NV +++LK VV+ +V++I 
Sbjct  262   PCNFTRSSPSRLSCLVDACVIFSASVVSSGLRINGSFAKFVNVAEIALKAVVNTLVKEIG  321

Query  1192  VQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNLPEVELIFTLLYSSTPV  1371
             +QCG   L  GMPLA+LL R+ H+G  LL EP++N++IQ I+N  EVE++ TL+Y+   V
Sbjct  322   IQCGGDTLANGMPLARLLARVTHVGPILLVEPSKNQFIQTIRNEKEVEMLITLIYTDANV  381

Query  1372  V  1374
             +
Sbjct  382   M  382



>gb|AFK37561.1| unknown [Medicago truncatula]
Length=127

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 96/135 (71%), Gaps = 10/135 (7%)
 Frame = +1

Query  964   MSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
             MS GSPH W++Y++PED K++S A  S S++T     + F+QL+ E R VLSSAEFG+VV
Sbjct  1     MSRGSPHFWVKYIIPEDAKLHSTA--SGSNDTVPLDMTEFDQLVMEARGVLSSAEFGSVV  58

Query  1144  DVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLLEEPNRNRYIQVIQNL  1323
             ++SLK VVD +    R   G T++    PLA+ LP++A +   LLEEP++N++IQ+++N+
Sbjct  59    EISLKAVVDTL----RELMGTTSV----PLARALPQVAQMCPLLLEEPSKNQFIQILKNI  110

Query  1324  PEVELIFTLLYSSTP  1368
             PEVEL  T LY++ P
Sbjct  111   PEVELFLTFLYANMP  125



>ref|XP_005846323.1| hypothetical protein CHLNCDRAFT_135719 [Chlorella variabilis]
 gb|EFN54221.1| hypothetical protein CHLNCDRAFT_135719 [Chlorella variabilis]
Length=395

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/297 (30%), Positives = 141/297 (47%), Gaps = 18/297 (6%)
 Frame = +1

Query  427   KAQMKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKL  606
             +A ++ HF++IQ IADSTTLP ++  LS  +    D+    E L + K+    L+ AEKL
Sbjct  72    EAHLQHHFDSIQDIADSTTLPSLLPALSRALMAAADVETPLELLRRAKEGSAPLSQAEKL  131

Query  607   ELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEE-EADII  783
               W+ LK+ +F+R V + W +  L+L++RVQ+NILGRHLY+++A   GS  Q       +
Sbjct  132   ATWEELKVAAFSRAVGAAWLLPLLDLFVRVQLNILGRHLYLESAVE-GSGVQRPLGVPKL  190

Query  784   YRDDQQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTT----ILHDTVVQI  951
                 Q+ FL+ A++L+  G   L+          L    L +  S      ++       
Sbjct  191   SAPSQERFLSFAEFLSQQGTRELVGVLRRVAVTQLAHVPLAESLSAAQVQQLMAGIAAAF  250

Query  952   LDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASN--------FEQLMQETR  1107
              D+  +  +   W ++L+P+   +     P + D+  +   +          EQL  E  
Sbjct  251   ADQIPAAIAGRGWAQFLLPDPKSLQESLTPRAPDDRAVLLGAEAMLVDGHVVEQLAAEAE  310

Query  1108  AVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQLL  1278
             AV S  EF   + V  K V+      +    G+  L    PLAK +P +A LG  LL
Sbjct  311   AVASGDEFAAALQVCSKEVLKVASHRLGSSMGDREL----PLAKAVPLVATLGGDLL  363



>ref|XP_002609626.1| hypothetical protein BRAFLDRAFT_125038 [Branchiostoma floridae]
 gb|EEN65636.1| hypothetical protein BRAFLDRAFT_125038 [Branchiostoma floridae]
Length=373

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 106/370 (29%), Positives = 179/370 (48%), Gaps = 53/370 (14%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHKKK+     V+G    L K  +   R +   EKE+   ++N     A+ K H
Sbjct  5     VWNFIKRHKKKLIFAGVVVGGAVFLGKYAETKLREL--QEKEMAEQLEN-----ARKKHH  57

Query  448   FENIQIIADSTTL---PHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWD  618
             F+N Q   + T L   P + + L  RI+ E       E + K K +P       K+ELW+
Sbjct  58    FDNNQRTCNMTVLSMIPSLRETLMQRINTE-------ELVAKLKSKP-----PNKVELWE  105

Query  619   RLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRL-GSSYQEEEADIIYRDD  795
              LKI SFTR++++L+    L + +RVQ+NI+G ++Y+D+   L G+S +  +A    R+ 
Sbjct  106   DLKIDSFTRVLVALYGTCILVVLLRVQLNIIGGYMYLDSLLNLNGASKEVVQAP---REI  162

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI--------  951
             Q+ +LAS  YL   GLT LISD   A  EV+    L+   S   +H  V ++        
Sbjct  163   QERYLASIQYLLGDGLTLLISDTRQAVQEVIGSLSLRQELSLEEVHQAVWKVRREVERAP  222

Query  952   ---LDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSS  1122
                LD      S     +Y++PE+ +     A S S +  +      ++L+ ETR ++ S
Sbjct  223   EDGLDITGRSASTSGLTKYMLPEEEEEKLDQASSLSQDDQV-----LQKLLSETRDMIES  277

Query  1123  AEFGNVVDVSLKTVVDAMVEDIRVQCGETNLM--------VGMPLAKLLPRLAHLGQQLL  1278
              +F  V+   L+     + ++  +    T+L         V +P+AK++P +     Q+ 
Sbjct  278   IDFQTVLSKCLEASFTRLCDESVIT--STSLARDFKPHNEVTLPMAKVIPVMNGQIHQIC  335

Query  1279  EEPNRNRYIQ  1308
              + + N+Y+Q
Sbjct  336   SD-SPNKYVQ  344



>ref|XP_007245524.1| PREDICTED: peroxisomal biogenesis factor 3 [Astyanax mexicanus]
Length=366

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 101/339 (30%), Positives = 164/339 (48%), Gaps = 41/339 (12%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHK+K ++  G    G  L   Y   +R++ E+++   A+     + +A+ + HFE+
Sbjct  8     FIKRHKRK-FIFAGAFAGGVYLLGKYA--QRKLQEMQEREAAEY----IAQARRQFHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   I   L+   LT  L+K K        A K+E+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREAIIHHLNSESLT-ALLKSK-------PANKVEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR  ++++S   L + +RVQ+NI+G +LY+D +     +      ++     QQ +L+S
Sbjct  112   FTRSTVAVYSTCMLVVLLRVQLNIIGGYLYLDNSVTKNGTLPLAPPEV-----QQQYLSS  166

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI--LDRFMSMGSPHHW  990
               +L   GL  LI+  + A  EVL    LK   S   L   V QI  L    S  S H  
Sbjct  167   IQHLLGDGLIELITVVKKAVQEVLGPVSLKQTLSLQELEQHVTQIRQLVEGGSGSSRHKA  226

Query  991   LR-YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL----  1155
             L  Y+MP++    +  A   ++N D+       +L+ ETR +L S +F  V++  L    
Sbjct  227   LSWYMMPDEENTLADQASGLTEN-DITTI----KLLNETRDMLDSPDFSTVLNTCLSRGF  281

Query  1156  KTVVDAMVEDIRVQCGETNLM--------VGMPLAKLLP  1248
                +D M E  R   G++ L         V +PLAK++P
Sbjct  282   SRFLDNMAEFFRPPAGDSTLCSTPDSLSHVSLPLAKIIP  320



>ref|XP_006821234.1| PREDICTED: peroxisomal biogenesis factor 3-like [Saccoglossus 
kowalevskii]
Length=360

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 99/346 (29%), Positives = 171/346 (49%), Gaps = 57/346 (16%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             I +FW RH+ K++VT  V+G   LL K       ++ EL +E EA    + L   + + H
Sbjct  5     IRRFWHRHRTKLFVTGAVIGGAVLLGKYASW---KLNEL-REQEAV---EYLSLTRRQHH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             F++ Q   + T L  ++  L   + + LD   LT +L   K++P       ++E+W+ LK
Sbjct  58    FDSNQRTCNMTVLS-MIPNLKEILMQLLDSENLTAQL---KNKP-----TNRVEIWEELK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQL-  804
             I+SFTR +++++S   L + +R+Q+NI+G ++Y+D     G S Q    D+    DQ+L 
Sbjct  109   IISFTRTIVAVYSSCMLVVLLRIQLNIIGGYMYLD-----GMSSQ----DMFQSTDQKLP  159

Query  805   ------FLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFST---TILHDTVVQIL-  954
                   +LA+  YL   GL   I+   +A   VL    LK   ST   T + + V  ++ 
Sbjct  160   PEIQQRYLATIQYLLEQGLKDFITSVRSAVEAVLTCVSLKHCISTHEVTAMINKVRSLIE  219

Query  955   -DRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEF  1131
              ++     S H   +Y++P             S+ T +       QLM ET+ +L S + 
Sbjct  220   TEKTEQFDSAHSLCKYMLP-------------SEATVMQENGIIHQLMIETKDMLESDDC  266

Query  1132  GNVVDVSLKTVVDAMVEDIRV------QCGETNLM-VGMPLAKLLP  1248
              N++++ LKT  + + ++I+          E NL  + +PLAK++P
Sbjct  267   SNIINLCLKTGFNRLEDNIQQFYNPVDVTNENNLQYLNIPLAKIIP  312



>ref|XP_007171382.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=373

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 166/348 (48%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KL++W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLDIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D  +    P  W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRD-LIEQHKPSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   NDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_005815437.1| PREDICTED: peroxisomal biogenesis factor 3-like isoform X2 [Xiphophorus 
maculatus]
Length=360

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 104/339 (31%), Positives = 169/339 (50%), Gaps = 41/339 (12%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHKKK   T  V+G  +LL K     +++I    KE++    ++ + +A+ + H
Sbjct  5     VWNFIKRHKKKFIFTGAVVGGVYLLGKY---AQKKI----KEVQEKEASEYIAQARRQFH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   I  +L+   LT  L   K +P     A KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPPLREAIVTQLNSESLTVML---KTKP-----ANKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR V++++S   L + +RVQ+NI+G +LY+D +  +G S     + +   D QQ +
Sbjct  109   IISFTRTVVAVYSTCMLVVLLRVQLNIIGGYLYLDNS--VGKS---AASPLTPPDVQQQY  163

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+S  +L   GLT LIS  + A    L G  LK   S   L   ++ I     S G P  
Sbjct  164   LSSIQHLLGDGLTELISRVKTAVQSSLGGVSLKQSLSLLELEQQLIWIRAEVDS-GRPLS  222

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK---  1158
                Y++ +D  + +  A   ++N DL       +L+ ETR +L S +   V+   L    
Sbjct  223   --SYMLADDEDVLADQACGLTEN-DLVTI----RLLNETRDMLDSPDLSKVLSACLNRGF  275

Query  1159  -TVVDAMVEDIRV-------QCGETNL-MVGMPLAKLLP  1248
               ++D + E  R+        C   +L  V +PLAK++P
Sbjct  276   SRLLDNLAEFFRLPVSDSAPNCAPDSLSAVSLPLAKIIP  314



>ref|XP_008577085.1| PREDICTED: peroxisomal biogenesis factor 3 [Galeopterus variegatus]
Length=374

 Score =   104 bits (259),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 102/348 (29%), Positives = 166/348 (48%), Gaps = 51/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  +VL    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITIIKQAVQKVLGSVSLKHSLSLVDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR-----VQCGETNL----MVGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G  ++     V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMAEFFRPTEQDLQHGNNSMDSLSSVSLPLAKIIP  328



>ref|XP_010360989.1| PREDICTED: peroxisomal biogenesis factor 3 [Rhinopithecus roxellana]
Length=373

 Score =   103 bits (258),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 103/352 (29%), Positives = 170/352 (48%), Gaps = 50/352 (14%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQ  801
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +   A +   D QQ
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTAILAPPDVQQ  162

Query  802   LFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM  972
              +L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S 
Sbjct  163   QYLSSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSS  222

Query  973   ------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAE  1128
                   GS      Y+MP  E P        S  D T +       +L+ ETR +L S +
Sbjct  223   SWINKDGSKSLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESPD  275

Query  1129  FGNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             F  V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  276   FSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_002113974.1| hypothetical protein TRIADDRAFT_57948 [Trichoplax adhaerens]
 gb|EDV23064.1| hypothetical protein TRIADDRAFT_57948 [Trichoplax adhaerens]
Length=383

 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 92/381 (24%), Positives = 179/381 (47%), Gaps = 64/381 (17%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F+ RH++K+ ++  + G   +L K      ++  E E  L+       + +A+M+ HF N
Sbjct  10    FFNRHRRKIIISSAIAGGVVVLVKYSQWRLQKYIEGETTLQ-------MTRARMENHFNN  62

Query  457   IQIIADST--------------TLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTA  594
              Q     T              T+  ++  LS  I +E++L +LTEKL   K +P     
Sbjct  63    NQKTCHLTSKTNSSIHTLISILTIISLLPNLSEAIEKEINLDELTEKL---KARP-----  114

Query  595   AEKLELWDRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEA  774
               +L++W+ LK L+FT++V  L+S+  L + +R+Q+NI+G ++Y+D+        +  ++
Sbjct  115   PNRLQIWENLKTLTFTQVVTKLYSVCMLTILVRIQLNIIGGYMYLDSTN--DKETKNADS  172

Query  775   DIIYRDD--QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFS----------  918
             D  Y     QQ +L+   YL   G+   I   +   S+++    LK   S          
Sbjct  173   DQTYASARLQQRYLSVVYYLLGDGMKEFIKVVKDTISDIVTNLSLKKEVSLGDISQLFQR  232

Query  919   -TTILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASN-FEQL  1092
                +LHD + Q      +  S      +++P + +I        SD+ +  + +  F +L
Sbjct  233   IRMVLHDKLCQ-----ANQDSKSFLTSFMIPPNDEI--------SDSFESLQENQLFSKL  279

Query  1093  MQETRAVLSSAE----FGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAH  1260
             M ETR ++ S +      + +D    T +D + E ++ Q    N+ + + +AKLLP +  
Sbjct  280   MSETRDMIESQDCIKVMNHCLDFGFNTFMDKVDEAVKQQVTSKNIEITLAVAKLLPVVTS  339

Query  1261  LGQQLLEEPNR--NRYIQVIQ  1317
               + +++E +   N ++Q+I+
Sbjct  340   QLKVMMKESSNTSNSFLQLIR  360



>gb|ELU04467.1| hypothetical protein CAPTEDRAFT_227264 [Capitella teleta]
Length=387

 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 95/371 (26%), Positives = 176/371 (47%), Gaps = 41/371 (11%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F RRH++K   T  V+G       +Y G   R  +  KE +    ++ L + + + H
Sbjct  5     VWNFVRRHRRKFIFTGAVIGG-----VVYLGRYAR--QKLKEFQDREASECLAQTRRQHH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             F++ Q   + T L  ++  L   + + L+  +LTE+L   K +P       K+E+WD LK
Sbjct  58    FDSNQRTCNVTAL-SMLPNLREALLQALNAEELTEQL---KQRP-----PNKVEIWDELK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SF R V +++S   + + +RVQ+NI+G ++++D A++  +   E+ +  I  D Q+ +
Sbjct  109   IISFARSVTAVYSCCLMMVMLRVQLNIIGGYMFLDNAKKESTDQVEQASLSITPDVQRRY  168

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR--FMSMGSP  981
             LA   +L + G+  L +   +AT ++LK   LK   S   + + V  I  R  F   G  
Sbjct  169   LALIQFLLDQGVVNLSAAVRSATEDLLKDFPLKKSVSLLEIQNIVTSIRTRVEFRCSGGY  228

Query  982   H-----HWLRYLMPEDPKIYSLAAPS--------SSDNTDLCRASNFEQLMQETRAVLSS  1122
             H         YL+PE  +   +++           S+  D+ + S F      T     S
Sbjct  229   HDASASSLCSYLIPEADESVEISSNGEDALLQQLKSETEDMLKRSAFAFTFALTFGFSLS  288

Query  1123  AEFGNVVDVSLKT----VVDAMVEDIRVQCGETNLM-----VGMPLAKLLPRLAHLGQQL  1275
              +F +++ + L T    +VD + +       E  ++     + MP+AK++P +  L   +
Sbjct  289   GDFHSILLICLDTGFTRLVDKLADYFSPVASENGVIQNPNQMKMPMAKVIPVMTGLVHTI  348

Query  1276  LEEPNRNRYIQ  1308
             + +P  N +IQ
Sbjct  349   VGDPP-NPFIQ  358



>ref|XP_007574808.1| PREDICTED: peroxisomal biogenesis factor 3 [Poecilia formosa]
Length=356

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 168/335 (50%), Gaps = 37/335 (11%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHKKK   T  V+G  +LL K     +++I    KE++    ++ + +A+ + H
Sbjct  5     VWNFIKRHKKKFIFTGAVVGGVYLLSKY---AQKKI----KEVQEKEASEYIAQARRQFH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   I  +L+   LT  L   K +P     A KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPPLREAIVTQLNSESLTAML---KTKP-----ANKLEIWENLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR V++++S   L + +RVQ+NI+G +LY+D +  +G S     + +   D QQ +
Sbjct  109   IISFTRTVVAVYSTCMLVVLLRVQLNIIGGYLYLDNS--VGKS---AASPLTPPDVQQQY  163

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+S  +L   GLT LIS  + A    L G  LK   S   L   ++ I     S G P  
Sbjct  164   LSSIQHLLGDGLTELISRVKTAVQNSLGGVSLKQSLSLLELEQQLIWIRAEVDS-GRPLS  222

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK---  1158
                Y++ +D ++ +  A   ++  DL       +L+ ETR +L S +   V+   L    
Sbjct  223   --SYMLADDEEVLADQACGLTEK-DLVTI----RLLNETRDMLDSPDLSKVLGACLNRGF  275

Query  1159  -TVVDAMVEDIRVQCGETNL----MVGMPLAKLLP  1248
               ++D + E  R+   ++       V +PLAK++P
Sbjct  276   SRLLDNLAEFFRLPVSDSAPDSLSAVSLPLAKIIP  310



>ref|XP_003215753.1| PREDICTED: peroxisomal biogenesis factor 3 [Anolis carolinensis]
Length=373

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 100/347 (29%), Positives = 165/347 (48%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F RRHKKK +     LG  ++L K   G ++      KE++     + + +A+ + HFE+
Sbjct  8     FLRRHKKKCFFLGAFLGGVYVLGKY--GQKKM-----KEIQEREAAEYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W  LKI+S
Sbjct  61    NQRTCNITVL-SMLPTLRDALMYQLNTESLTSLL---KNKP-----ANKLEIWGDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  + E   +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNETTLLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL-------DRFMSMG  975
               +L   GL  LI+  + A  +V     LK   S   L + + +I        D F S  
Sbjct  168   IQHLLGDGLIELITVVKKAVQKVFMSVSLKHALSLLDLDEKLREIRRAVEEPEDNFTSEE  227

Query  976   SPHHWL--RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
             +  H L   Y+MP  E+P        +  D T +       +L+ ETR +L S +F  V+
Sbjct  228   TGSHSLLCHYMMPDEENPLASQANGLTEKDITTI-------KLLNETRDMLESPDFNRVL  280

Query  1144  DVSLK----TVVDAMVEDIRVQ----CGETNL----MVGMPLAKLLP  1248
                L      ++D M E  +      C   ++     V +PLAK++P
Sbjct  281   TSCLNRGFSRLLDNMAEFFKPTEQDICHTASMNSLSSVSLPLAKIIP  327



>tpg|DAA60994.1| TPA: hypothetical protein ZEAMMB73_962101 [Zea mays]
Length=92

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 67/92 (73%), Gaps = 3/92 (3%)
 Frame = +1

Query  1093  MQETRAVLSSAEFGNVVDVSLKTVVDAMVEDIRVQCGETNLMVGMPLAKLLPRLAHLGQQ  1272
             M ETR VL+S +F N+++ SL+ + + +V D+ VQ   T L  G+PLA LLP++ HL   
Sbjct  1     MSETRIVLASDDFRNIMERSLRKIAEVVVGDLAVQ---TTLGSGLPLATLLPKVGHLSSP  57

Query  1273  LLEEPNRNRYIQVIQNLPEVELIFTLLYSSTP  1368
             LLEEPN N+YIQ+I+++PEVEL +T LY++ P
Sbjct  58    LLEEPNNNKYIQIIRSMPEVELFYTFLYANMP  89



>ref|XP_006161971.1| PREDICTED: peroxisomal biogenesis factor 3 [Tupaia chinensis]
Length=373

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 103/348 (30%), Positives = 168/348 (48%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D QQ +L+
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQQQYLS  166

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM----  972
             S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S     
Sbjct  167   SIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWIN  226

Query  973   --GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
               GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDGSKSFLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_004895703.1| PREDICTED: peroxisomal biogenesis factor 3 [Heterocephalus glaber]
 ref|XP_004846101.1| PREDICTED: peroxisomal biogenesis factor 3 [Heterocephalus glaber]
 gb|EHB10017.1| Peroxisomal biogenesis factor 3 [Heterocephalus glaber]
Length=372

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 100/345 (29%), Positives = 166/345 (48%), Gaps = 47/345 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLKEALLQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D QQ +L+
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQQQYLS  166

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM----  972
             S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S     
Sbjct  167   SIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRTLVEQHKSSWINK  226

Query  973   -GSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDV  1149
              GS      Y+MP++    ++ A   S     CR     +L+ ETR +L S +F  V++ 
Sbjct  227   DGSKSFLCHYMMPDEETPLAVQACGLS-----CRDITTIKLLNETRDMLESPDFSTVLNT  281

Query  1150  SLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
              L      ++D M    R        +N M     V +PLAK++P
Sbjct  282   CLNRGFSRLLDNMATFFRPTEQDLHPSNSMTSYSSVSLPLAKIIP  326



>ref|XP_006793578.1| PREDICTED: peroxisomal biogenesis factor 3-like [Neolamprologus 
brichardi]
Length=362

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 102/336 (30%), Positives = 164/336 (49%), Gaps = 39/336 (12%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK   T  ++G  +LL K    + ++ F   +E EA    + + +A+ + HFE+
Sbjct  8     FIKRHKKKFIFTGALIGGVYLLGK----YAQKKFSEIQEREA---TEYIAQARRQFHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   I  +L+   LT  L+K K        A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPALKEAIVTQLNSESLT-TLLKSK-------PANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR V++++S   L + +RVQ+NI+G +LY+D +  +G S     A     D QQ +L+S
Sbjct  112   FTRTVVAVYSTCMLVVLLRVQLNIIGGYLYLDNS--VGKSTTTPLAP---PDVQQQYLSS  166

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A    L    LK+ +S   L   +  I    +   S      
Sbjct  167   IQHLLGDGLTELITVVKKAVQSSLGSVSLKETWSLLELEQQLNWIRAE-VETSSRRSLSW  225

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK----TV  1164
             YL+ +D  + +  A   ++N  +       +L+ ETR +L S +F  V+ V L      +
Sbjct  226   YLLADDENVLADQACGLTENDIMTI-----KLLNETRDMLDSPDFTTVLKVCLNRGFSRL  280

Query  1165  VDAMVE-------DIRVQCGETNL-MVGMPLAKLLP  1248
              D + E       D    C   +L  V +PLAK++P
Sbjct  281   CDNLAEFFRPLPSDSAPSCAPDSLSAVSLPLAKIIP  316



>ref|NP_001244856.1| peroxisomal biogenesis factor 3 [Macaca mulatta]
 ref|XP_003898144.1| PREDICTED: peroxisomal biogenesis factor 3 [Papio anubis]
 ref|XP_005552063.1| PREDICTED: uncharacterized LOC101865844 isoform X1 [Macaca fascicularis]
 ref|XP_008005002.1| PREDICTED: peroxisomal biogenesis factor 3 [Chlorocebus sabaeus]
 sp|Q60HE1.1|PEX3_MACFA RecName: Full=Peroxisomal biogenesis factor 3; AltName: Full=Peroxin-3; 
AltName: Full=Peroxisomal assembly protein PEX3 [Macaca 
fascicularis]
 dbj|BAD51974.1| peroxisomal biogenesis factor 3 [Macaca fascicularis]
 gb|EHH18641.1| hypothetical protein EGK_15288 [Macaca mulatta]
 gb|EHH53334.1| hypothetical protein EGM_13953 [Macaca fascicularis]
Length=373

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 170/353 (48%), Gaps = 52/353 (15%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-Q  798
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D Q
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQ  161

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMS  969
             Q +L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S
Sbjct  162   QQYLSSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKS  221

Query  970   M------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
                    GS      Y+MP  E P        S  D T +       +L+ ETR +L S 
Sbjct  222   SSWINKDGSKSLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESP  274

Query  1126  EFGNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +F  V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   DFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>emb|CDQ67741.1| unnamed protein product [Oncorhynchus mykiss]
Length=369

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 99/342 (29%), Positives = 165/342 (48%), Gaps = 44/342 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHK+K       +G  + L K     +++I E++ E EA   ++ + +A+ + HFE+
Sbjct  8     FLKRHKRKCIFAGAFVGGVYFLGKYA---QKKIREMQ-EREA---SEYIAQARRQFHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   I   L+   LT  L+K K        A KL++W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREAILHHLNSESLT-TLLKSK-------PANKLDIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR V++++S   L + +RVQ+NI+G +LY+D +            D+     QQ +L+S
Sbjct  112   FTRSVVAVYSTCMLVVLLRVQLNIIGGYLYLDNSVSKSGMMPLAPPDV-----QQQYLSS  166

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRF--MSMGSPHHW  990
               +L   GL+ +I+  + A    L G  LK   S   L   + QI  +      GS H  
Sbjct  167   IQHLLGDGLSEMITAVKKAVQNTLGGVSLKQSLSLQELEQHLNQIRAQVEEGDGGSTHRP  226

Query  991   LR-YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL----  1155
             L  Y+MP++    +  A   ++N D+       +L+ ETR +L S +FG V++  L    
Sbjct  227   LSWYMMPDEENTLAAQACGLTEN-DVTTI----KLLNETRDMLESPDFGTVLNTCLNRGF  281

Query  1156  KTVVDAMVEDIRVQCG-----------ETNLMVGMPLAKLLP  1248
                +D M E  R   G           ++   V +P+AK++P
Sbjct  282   NRFLDNMAEFFRPPPGAQGDSTPITTPDSLSHVSLPVAKIIP  323



>ref|XP_005654424.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Sus scrofa]
Length=348

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 98/348 (28%), Positives = 169/348 (49%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K     +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKY---GQKKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTVLL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + +  ++L    LK   S   L   + +I D  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQSVQKILGSVSLKHSLSLLDLEQKLKEIRD-LVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGETN---LMVGMPLAKLLP  1248
             +++ L      ++D M E  R     +Q G +      V +PLAK++P
Sbjct  280   LNICLNRGFSRLLDNMAEFFRPTEQDLQHGNSRNSLSSVSLPLAKIIP  327



>ref|XP_005334908.1| PREDICTED: peroxisomal biogenesis factor 3 [Ictidomys tridecemlineatus]
Length=373

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 103/347 (30%), Positives = 163/347 (47%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL-----DRFMSM---  972
               +L   GLT LI+  + A   +L    LK   S   L   + +I      D+  S    
Sbjct  168   IHHLLGDGLTELITVIKQAVQNILGSVSLKYSLSLLDLEQKIKEIRTLVEQDKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        SS D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSSRDITTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
             +  L      ++D M E  R        +N M     V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMAEFFRPTEQDLQHSNSMNSLSSVSLPLAKIIP  327



>ref|XP_006643036.1| PREDICTED: peroxisomal biogenesis factor 3-like [Lepisosteus 
oculatus]
Length=370

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 100/350 (29%), Positives = 166/350 (47%), Gaps = 52/350 (15%)
 Frame = +1

Query  265   MIMQFW---RRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQ  435
             M M  W   +RHK+K      ++G  +LL K     +R+I E+++   A+     + +A+
Sbjct  1     MFMSTWSFLKRHKRKFIFAGALVGGVYLLGKYA---QRKIREIQEREAAEY----IAQAR  53

Query  436   MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELW  615
              + HFE+ Q   + T L  ++  L   I + L    LT  L   K++P     A KLE+W
Sbjct  54    RQYHFESNQRTCNMTVL-SMLPTLRDAIIQHLHSESLTALL---KNKP-----ANKLEIW  104

Query  616   DRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD  795
             + LKI+SF R +++++S   L + +RVQ+NI+G ++Y+D +     +      D+     
Sbjct  105   EDLKIISFARSIVAVYSTCMLVILLRVQLNIIGGYIYLDNSVSKNGTTPLAPPDV-----  159

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMG  975
             QQ +L+S  +L   GL  LI+  + A  EVL G  LK   S   L   + QI  R +  G
Sbjct  160   QQQYLSSIQHLLGDGLHELITVVKQAVQEVLGGVSLKQSLSLQELEQHINQI--RALVEG  217

Query  976   S-------PHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFG  1134
                     P  W  Y+MP++    +  A   ++  D+       +L+ ETR +L + +F 
Sbjct  218   GNITGHQRPLSW--YMMPDEENTLASQACGLTEK-DVATL----KLLNETRDMLENPDFS  270

Query  1135  NVVDVSL----KTVVDAMVEDIRVQCGETNLM--------VGMPLAKLLP  1248
              V+   L      ++D M E  R   G+            V +PLAK++P
Sbjct  271   TVLGTCLSRGFSRLLDNMAEFFRPPQGDPARSSTADSLSHVSLPLAKIIP  320



>ref|XP_008070276.1| PREDICTED: peroxisomal biogenesis factor 3 [Tarsius syrichta]
Length=373

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 102/348 (29%), Positives = 166/348 (48%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTSLL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D QQ +L+
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AIGKNGTTILAPPDVQQQYLS  166

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM----  972
             S  +L   GLT LI+  + A  ++L    LK   S   L  ++ +I   +++  S     
Sbjct  167   SIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQSLKEIRNLVEQHKSSSWIN  226

Query  973   --GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
               GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDGSKSLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
             ++  L      ++D M E  R        +N M     V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHSNSMDSLSSVSLPLAKIIP  327



>ref|XP_004651209.1| PREDICTED: peroxisomal biogenesis factor 3 [Jaculus jaculus]
Length=372

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 100/346 (29%), Positives = 169/346 (49%), Gaps = 49/346 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K     +R+I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKY---GQRKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT L++  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELVTVIKHAVQKILGSVSLKHSLSLLDLEQKLKEIRSVVEQHNSSWISRD  227

Query  973   GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVD  1146
             GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V++
Sbjct  228   GSKSLLCHYMMPDEETPLAAQACGLSPRDITTI-------KLLNETRDMLESPDFSTVLN  280

Query  1147  VSLK----TVVDAMVEDIRV------QCGETNLM--VGMPLAKLLP  1248
               L      ++D M E  R       Q    N +  V +PLAK++P
Sbjct  281   TCLNRGFSRLLDNMAEFFRPTEQDLQQGNSINSLSSVSLPLAKIIP  326



>ref|XP_002747142.1| PREDICTED: peroxisomal biogenesis factor 3 [Callithrix jacchus]
Length=373

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 170/353 (48%), Gaps = 52/353 (15%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-Q  798
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D Q
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQ  161

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMS  969
             Q +L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S
Sbjct  162   QQYLSSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKS  221

Query  970   M------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
                    GS      Y+MP  E P        S  D T +       +L+ ETR +L S 
Sbjct  222   SSWINKDGSKSLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESP  274

Query  1126  EFGNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +F  V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   DFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVNLPLAKIIP  327



>ref|XP_005280460.1| PREDICTED: peroxisomal biogenesis factor 3 [Chrysemys picta bellii]
Length=373

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 99/347 (29%), Positives = 163/347 (47%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK       LG  +LL K     +R+I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCLFLGTFLGGVYLLGKY---GQRKIKEIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P       KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPALRDALMHQLNSESLTSLL---KNRP-----PNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AICKNGTTLLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---------LDRFMS  969
               +L   GLT LI+  + A  +V     LK   S   L   + +I         L     
Sbjct  168   IQHLLGDGLTELITVVKQAVQKVFGSVSLKHTLSLLELEQKLKEIRKLIEQHKDLSHSDK  227

Query  970   MGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
             +GS      Y+MP  E+P        +  D   +       +L+ ETR +L S +F  V+
Sbjct  228   IGSRSLLCHYMMPDEENPLATQACGLTERDVATI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR------VQCGETNLM--VGMPLAKLLP  1248
                L      ++D M E  R       Q G  N +  V +PLAK++P
Sbjct  281   STCLNRGFSRLLDNMAEFFRPTEQDLCQSGSVNSLCSVSLPLAKIIP  327



>ref|XP_518776.1| PREDICTED: peroxisomal biogenesis factor 3 [Pan troglodytes]
 ref|XP_002817479.1| PREDICTED: peroxisomal biogenesis factor 3 [Pongo abelii]
 ref|XP_003255856.1| PREDICTED: peroxisomal biogenesis factor 3 [Nomascus leucogenys]
 ref|XP_003811599.1| PREDICTED: peroxisomal biogenesis factor 3 [Pan paniscus]
 ref|XP_004044822.1| PREDICTED: peroxisomal biogenesis factor 3 [Gorilla gorilla gorilla]
Length=373

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 170/353 (48%), Gaps = 52/353 (15%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-Q  798
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D Q
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQ  161

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMS  969
             Q +L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S
Sbjct  162   QQYLSSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKS  221

Query  970   M------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
                    GS      Y+MP  E P        S  D T +       +L+ ETR +L S 
Sbjct  222   SSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESP  274

Query  1126  EFGNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +F  V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   DFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_004011437.1| PREDICTED: peroxisomal biogenesis factor 3 [Ovis aries]
 ref|XP_005684919.1| PREDICTED: peroxisomal biogenesis factor 3 [Capra hircus]
Length=373

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 102/347 (29%), Positives = 164/347 (47%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KTRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------FMS  969
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D            +
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRDLVEQHKSSSWINN  227

Query  970   MGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_006188573.1| PREDICTED: peroxisomal biogenesis factor 3 [Camelus ferus]
 ref|XP_010963961.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Camelus 
bactrianus]
 ref|XP_010982010.1| PREDICTED: peroxisomal biogenesis factor 3 [Camelus dromedarius]
Length=373

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 103/349 (30%), Positives = 165/349 (47%), Gaps = 54/349 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KSRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDDQQLFL  810
             FTR +++++S   L + +RVQ+NI+G ++Y+D A   R G++       +   D QQ +L
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGRNGTTV------LAPPDVQQQYL  165

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------F  963
             +S  +L   GLT LI+  + A  ++L    LK   S   L   + ++ D           
Sbjct  166   SSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEVRDLVEQHKSSSWI  225

Query  964   MSMGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
              + GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  
Sbjct  226   NNDGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFST  278

Query  1138  VVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             V+   L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  279   VLSTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|NP_001231114.1| peroxisomal biogenesis factor 3 [Sus scrofa]
Length=373

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 164/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTVLL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + +  ++L    LK   S   L   + +I D  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQSVQKILGSVSLKHSLSLLDLEQKLKEIRD-LVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGETN---LMVGMPLAKLLP  1248
             +++ L      ++D M E  R     +Q G +      V +PLAK++P
Sbjct  280   LNICLNRGFSRLLDNMAEFFRPTEQDLQHGNSRNSLSSVSLPLAKIIP  327



>ref|XP_006075251.1| PREDICTED: peroxisomal biogenesis factor 3 [Bubalus bubalis]
Length=373

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 102/347 (29%), Positives = 164/347 (47%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KTRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------FMS  969
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D            +
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRDLVEQHKSSSWINN  227

Query  970   MGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSL----KTVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  281   NTCLSRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_005211059.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Bos taurus]
Length=355

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 102/347 (29%), Positives = 164/347 (47%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KTRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------FMS  969
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D            +
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRDLVEQHKSSSWINN  227

Query  970   MGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSL----KTVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  281   NTCLSRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  327



>ref|XP_005889151.1| PREDICTED: peroxisomal biogenesis factor 3 [Bos mutus]
 ref|XP_010849763.1| PREDICTED: peroxisomal biogenesis factor 3 [Bison bison bison]
 tpg|DAA26060.1| TPA: peroxisomal biogenesis factor 3 [Bos taurus]
 gb|ELR61195.1| Peroxisomal biogenesis factor 3 [Bos mutus]
Length=373

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 102/347 (29%), Positives = 164/347 (47%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KTRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------FMS  969
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D            +
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRDLVEQHKSSSWINN  227

Query  970   MGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSL----KTVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  281   NTCLSRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  327



>ref|XP_003403999.1| PREDICTED: peroxisomal biogenesis factor 3 [Loxodonta africana]
Length=373

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 104/349 (30%), Positives = 169/349 (48%), Gaps = 54/349 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDDQQLFL  810
             FTR +++++S   L + +RVQ+NI+G ++Y+D A   R G++       +   D QQ +L
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGRNGTTV------LAPPDVQQQYL  165

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM---  972
             +S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S    
Sbjct  166   SSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKKIRNLVEQHKSSSSV  225

Query  973   ---GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
                GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  
Sbjct  226   NKDGSKSLLRHYMMPDEETPLAAQACGLSPRDVTTI-------KLLNETRDMLESPDFST  278

Query  1138  VVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  279   VLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  327



>ref|XP_006197822.1| PREDICTED: peroxisomal biogenesis factor 3 [Vicugna pacos]
Length=373

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 103/349 (30%), Positives = 165/349 (47%), Gaps = 54/349 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KSRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTA--RRLGSSYQEEEADIIYRDDQQLFL  810
             FTR +++++S   L + +RVQ+NI+G ++Y+D A   R G++       +   D QQ +L
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVARNGTTV------LAPPDVQQQYL  165

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------F  963
             +S  +L   GLT LI+  + A  ++L    LK   S   L   + ++ D           
Sbjct  166   SSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEVRDLVEQHKSSSWI  225

Query  964   MSMGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
              + GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  
Sbjct  226   NNDGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFST  278

Query  1138  VVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             V+   L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  279   VLSTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_003926909.1| PREDICTED: peroxisomal biogenesis factor 3 [Saimiri boliviensis 
boliviensis]
Length=373

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 102/353 (29%), Positives = 170/353 (48%), Gaps = 52/353 (15%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-Q  798
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D Q
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQ  161

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMS  969
             Q +L+S  +L   GLT L++  + A  ++L    LK   S   L   + +I   +++  S
Sbjct  162   QQYLSSIQHLLGDGLTELVTVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKS  221

Query  970   M------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
                    GS      Y+MP  E P        S  D T +       +L+ ETR +L S 
Sbjct  222   SSWINKDGSKSLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESP  274

Query  1126  EFGNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +F  V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   DFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|NP_001092457.1| peroxisomal biogenesis factor 3 [Bos taurus]
 sp|A6H7C2.1|PEX3_BOVIN RecName: Full=Peroxisomal biogenesis factor 3; AltName: Full=Peroxin-3; 
AltName: Full=Peroxisomal assembly protein PEX3 [Bos 
taurus]
 gb|AAI46193.1| PEX3 protein [Bos taurus]
Length=373

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 102/347 (29%), Positives = 164/347 (47%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KTRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------FMS  969
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D            +
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRDLVEQHKSSSWINN  227

Query  970   MGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSL----KTVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  281   NTCLSRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  327



>ref|XP_004368919.1| PREDICTED: peroxisomal biogenesis factor 3 [Trichechus manatus 
latirostris]
Length=373

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 103/349 (30%), Positives = 169/349 (48%), Gaps = 54/349 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNKP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDDQQLFL  810
             FTR +++++S   L + +RVQ+NI+G ++Y+D A   R G++       +   + QQ +L
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGRNGTTV------LAPPEVQQQYL  165

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM---  972
             +S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S    
Sbjct  166   SSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKKIRNLVEQHKSSSSV  225

Query  973   ---GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
                GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  
Sbjct  226   NKDGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFST  278

Query  1138  VVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  279   VLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_007904528.1| PREDICTED: peroxisomal biogenesis factor 3 [Callorhinchus milii]
Length=371

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 178/353 (50%), Gaps = 53/353 (15%)
 Frame = +1

Query  265   MIMQFW---RRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQ  435
             M+   W   RRH++K+ VT  +LG  +LL K     +R++ EL++   A+     + +A+
Sbjct  1     MLGTVWGLVRRHRRKLAVTGVLLGGVYLLGKYA---QRKLRELQEHEAAEY----ISQAR  53

Query  436   MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELW  615
              + HFE+ Q   + T L  ++  L   I ++L+   LT  L   K++P     A KLE+W
Sbjct  54    RQFHFESNQRTCNMTVLS-MLPTLREAIMQQLNSESLTALL---KNRP-----ANKLEIW  104

Query  616   DRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD  795
             + LKI+SF+R +++++S   L + +RVQ+NI+G ++Y+D A  +G +   +    +    
Sbjct  105   EDLKIISFSRGLVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-AMGKNVATQAPPEV----  159

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILD------  957
             QQ +L+S  +L   GL+ L++  + A  EV+ G  LK   +   L   +  I +      
Sbjct  160   QQQYLSSIQHLLGDGLSELVTVVKQAVREVIGGISLKQSLTLVDLEHHIRTIREQIERRH  219

Query  958   -RFMSMGSPHHWL-RYLMP-EDPKIYSLAAP-SSSDNTDLCRASNFEQLMQETRAVLSSA  1125
              R M   S    L RYL+P ED  + S A   +  D T +       +L+ ETR +L S 
Sbjct  220   SRNMERPSTRSPLCRYLIPDEDDTLASQACGLTDKDKTTI-------KLLNETRDMLESC  272

Query  1126  EFGNVVDVSL----KTVVDAMVEDIRVQCGE-------TNL-MVGMPLAKLLP  1248
             +F  V+   L      ++D + E  R    E       T+L  V +PLAK++P
Sbjct  273   DFSTVLSSCLTRGFSRLLDNIAEFFRPTEHELTPNGKITSLSSVSLPLAKIIP  325



>ref|XP_007114376.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Physeter 
catodon]
Length=373

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 165/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KL++W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLDIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRD-LIEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   NDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPIEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|NP_003621.1| peroxisomal biogenesis factor 3 [Homo sapiens]
 sp|P56589.1|PEX3_HUMAN RecName: Full=Peroxisomal biogenesis factor 3; AltName: Full=Peroxin-3; 
AltName: Full=Peroxisomal assembly protein PEX3 [Homo 
sapiens]
 emb|CAA04879.1| Pex3 protein [Homo sapiens]
 emb|CAA10362.1| PEX3 protein [Homo sapiens]
 emb|CAA08904.1| Pex3p [Homo sapiens]
 dbj|BAA97993.1| Pex3p [Homo sapiens]
 gb|AAH14551.1| Peroxisomal biogenesis factor 3 [Homo sapiens]
 gb|AAH15506.1| Peroxisomal biogenesis factor 3 [Homo sapiens]
 gb|AAQ18039.1| transformation-related protein 18 [Homo sapiens]
 emb|CAG46859.1| PEX3 [Homo sapiens]
 gb|EAW47866.1| peroxisomal biogenesis factor 3 [Homo sapiens]
 gb|AIC50132.1| PEX3, partial [synthetic construct]
Length=373

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 169/353 (48%), Gaps = 52/353 (15%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-Q  798
             LKI+SFTR  ++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D Q
Sbjct  107   LKIISFTRSTVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQ  161

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMS  969
             Q +L+S  +L   GLT LI+  + A  +VL    LK   S   L   + +I   +++  S
Sbjct  162   QQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKS  221

Query  970   M------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
                    GS      Y+MP  E P        S  D T +       +L+ ETR +L S 
Sbjct  222   SSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESP  274

Query  1126  EFGNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +F  V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   DFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_780894.3| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
3-like [Strongylocentrotus purpuratus]
Length=317

 Score =   100 bits (250),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 93/325 (29%), Positives = 157/325 (48%), Gaps = 43/325 (13%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             I  F +RH++K  V   V G   LLYK  +   +   E E   EA+     L  A+   H
Sbjct  5     IWNFVKRHRRKFLVLGAVAGGASLLYKYAEWKLKEWRETE---EAEC----LAMARRAHH  57

Query  448   FENIQIIADSTTL---PHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWD  618
             FE+ Q   + T L   P + + L   ++ E    +L +KL  G +         K+ +W+
Sbjct  58    FESNQRTCNMTVLSMIPKLRELLLYHLNSE----ELIQKLKSGTEN--------KVVVWN  105

Query  619   RLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDT-ARRLGSSYQEEEADIIYRDD  795
              LK++SFTRMV+S++S   L  ++RVQ+NILG ++Y+DT A + G +Y +  A    +D 
Sbjct  106   ELKVVSFTRMVVSVYSTVLLTAFLRVQLNILGGYMYLDTLAGKNGLTYYQVHAT---QDV  162

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMG  975
             Q+ +LA   YL   GLT LI+  +     V+    L+ + S + + + + ++  +   + 
Sbjct  163   QKEYLAMVQYLLTDGLTELINHVQEVVQNVVGSISLQQLLSLSDMEEIIAKVRGQ---VE  219

Query  976   SPHHWLRYLMPEDPKIYSLA----APSSSDNTD-LCRASN----FEQLMQETRAVLSSAE  1128
             +  +    ++P D  I+ L      P   D  +  CR S+      Q+  ETR ++ S +
Sbjct  220   TTQYGGEVVVP-DCSIHPLGRYLLKPEGLDGEESACRLSDDQLVLSQMQIETRDLVESHD  278

Query  1129  FGNV----VDVSLKTVVDAMVEDIR  1191
             F  V    +D+    ++D M E  R
Sbjct  279   FSCVMNSCLDIGFSRLLDNMAEFFR  303



>gb|AAX37078.1| peroxisomal biogenesis factor 3 [synthetic construct]
Length=374

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 169/353 (48%), Gaps = 52/353 (15%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-Q  798
             LKI+SFTR  ++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D Q
Sbjct  107   LKIISFTRSTVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQ  161

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMS  969
             Q +L+S  +L   GLT LI+  + A  +VL    LK   S   L   + +I   +++  S
Sbjct  162   QQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKS  221

Query  970   M------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
                    GS      Y+MP  E P        S  D T +       +L+ ETR +L S 
Sbjct  222   SSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLESP  274

Query  1126  EFGNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +F  V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   DFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_003986666.1| PREDICTED: peroxisomal biogenesis factor 3 [Felis catus]
Length=373

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 93/324 (29%), Positives = 152/324 (47%), Gaps = 44/324 (14%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ + H
Sbjct  5     VWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +
Sbjct  109   IISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQY  164

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I D  +    P  
Sbjct  165   LSSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRD-LVEQHKPSS  223

Query  988   WLR----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEF  1131
             W+           Y+MP  E P        S  D T +       +L+ ETR +L S +F
Sbjct  224   WVNKDGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDF  276

Query  1132  GNVVDVSLK----TVVDAMVEDIR  1191
               V++  L      ++D M E  R
Sbjct  277   STVLNTCLNRGFSRLLDNMAEFFR  300



>ref|XP_007450373.1| PREDICTED: peroxisomal biogenesis factor 3 [Lipotes vexillifer]
Length=373

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 165/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KL++W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLDIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRD-LVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   NDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_005654423.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Sus scrofa]
Length=387

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 98/348 (28%), Positives = 169/348 (49%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K     +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKY---GQKKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTVLL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL-  993
               +L   GLT LI+  + +  ++L    LK   S   L   + +I D  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQSVQKILGSVSLKHSLSLLDLEQKLKEIRD-LVEQHKSSSWIN  226

Query  994   ---------RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGETN---LMVGMPLAKLLP  1248
             +++ L      ++D M E  R     +Q G +      V +PLAK++P
Sbjct  280   LNICLNRGFSRLLDNMAEFFRPTEQDLQHGNSRNSLSSVSLPLAKIIP  327



>ref|XP_005974994.1| PREDICTED: peroxisomal biogenesis factor 3 [Pantholops hodgsonii]
Length=373

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 164/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KTRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + ++ D  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEVRD-LVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   NDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_004263803.1| PREDICTED: peroxisomal biogenesis factor 3 [Orcinus orca]
Length=373

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 165/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KL++W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLDIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRD-LVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   NDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_005389308.1| PREDICTED: peroxisomal biogenesis factor 3 [Chinchilla lanigera]
Length=373

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 101/347 (29%), Positives = 165/347 (48%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRTLVEQHTSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        SS D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSFLCHYMMPDEETPLAIQAYGLSSRDITTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
             +  L     +++D M    R        +N M     V +PLAK++P
Sbjct  281   NTCLNRGFSSLLDNMATFFRPTEQDLQPSNSMASYSSVSLPLAKIIP  327



>ref|XP_006976733.1| PREDICTED: peroxisomal biogenesis factor 3 [Peromyscus maniculatus 
bairdii]
Length=373

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 101/347 (29%), Positives = 168/347 (48%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT L++  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELVTVIKQAVQKILGSVSLKQSLSLLDLEQKLKEIRILVEQHRSPSWIDK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS     +Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSSLCQYMMPDEETPLAAQAYGLSPRDITTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  327



>ref|XP_004568496.1| PREDICTED: peroxisomal biogenesis factor 3-like [Maylandia zebra]
 ref|XP_005732759.1| PREDICTED: peroxisomal biogenesis factor 3-like [Pundamilia nyererei]
 ref|XP_005929959.1| PREDICTED: peroxisomal biogenesis factor 3-like [Haplochromis 
burtoni]
Length=362

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 101/336 (30%), Positives = 163/336 (49%), Gaps = 39/336 (12%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK   T  ++G  +LL K    + ++ F   +E EA    + + +A+ + HFE+
Sbjct  8     FIKRHKKKFIFTGALIGGVYLLGK----YAQKKFSEIQEREA---TEYIAQARRQFHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   I  +L+   LT  L+K K        A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPALKEAIVTQLNSESLT-TLLKSK-------PANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR V++++S   L + +RVQ+NI+G +LY+D +  +G S     A     D QQ +L+S
Sbjct  112   FTRTVVAVYSTCMLVVLLRVQLNIIGGYLYLDNS--VGKSTTTPLAP---PDVQQQYLSS  166

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GL  LI+  + A    L    LK+ +S   L   +  I    +   S      
Sbjct  167   IQHLLGDGLAELITVVKKAVQSSLGSVSLKETWSLLELEQQLNWIRAE-VEASSRRSLSW  225

Query  997   YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK----TV  1164
             YL+ +D  + +  A   ++N  +       +L+ ETR +L S +F  V+ V L      +
Sbjct  226   YLLADDENVLADQACGLTENDIMTI-----KLLNETRDMLDSPDFTTVLKVCLNRGFSRL  280

Query  1165  VDAMVE-------DIRVQCGETNL-MVGMPLAKLLP  1248
              D + E       D    C   +L  V +PLAK++P
Sbjct  281   CDNLAEFFRPPPSDSAPSCAPDSLSAVSLPLAKIIP  316



>ref|XP_010624910.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Fukomys 
damarensis]
Length=372

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 100/346 (29%), Positives = 166/346 (48%), Gaps = 49/346 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTVLL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTALAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRTLVEQHKSSSITKD  227

Query  973   GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVD  1146
             GS      Y+MP  E P        SS D T +       +L+ ETR +L S +F  V++
Sbjct  228   GSRSFLCHYMMPDEETPLAVQACGLSSRDITTI-------KLLNETRDMLESPDFSTVLN  280

Query  1147  VSLK----TVVDAMV-------EDIRVQCGETNL-MVGMPLAKLLP  1248
               L      ++D M        +D++     T+   V +PLAK++P
Sbjct  281   TCLNRGFSRLLDNMATFFRPTEQDLQPSNSITSYSSVSLPLAKIIP  326



>ref|XP_004628607.1| PREDICTED: peroxisomal biogenesis factor 3 [Octodon degus]
Length=373

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 100/352 (28%), Positives = 166/352 (47%), Gaps = 50/352 (14%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQ  801
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQ  162

Query  802   LFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM  972
              +L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   ++   S 
Sbjct  163   QYLSSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRTLVEEHKSS  222

Query  973   ------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAE  1128
                   GS      ++MP  E P        SS D T +       +L+ ETR +L S +
Sbjct  223   SWINKDGSKSFLCHFMMPDEETPLAVQACGLSSRDITTI-------KLLNETRDMLESPD  275

Query  1129  FGNVVDVSLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
             F  V++  L     +++D M    R        +N M     V +PLAK++P
Sbjct  276   FSTVLNTCLNRGFSSLLDNMATFFRPTEQDLQPSNSMASYSSVSLPLAKIIP  327



>ref|XP_007171383.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=368

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 170/348 (49%), Gaps = 57/348 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  + LGV       Y L    +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKC-IFLGV-------YILGKYGQKKIREIQEREAAEY----IAQARRQYHFES  55

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KL++W+ LKI+S
Sbjct  56    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLDIWEDLKIIS  106

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  107   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  162

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D  +    P  W+ 
Sbjct  163   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRD-LIEQHKPSSWIN  221

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  222   NDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  274

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  322



>ref|XP_004673964.1| PREDICTED: peroxisomal biogenesis factor 3 [Condylura cristata]
Length=373

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 164/351 (47%), Gaps = 58/351 (17%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTTLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH---  987
               +L   GLT LI+  + A  ++L    LK   S   L     Q L    S+   H    
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLE----QKLKEIRSLVEQHQPSS  223

Query  988   ----------WLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEF  1131
                          Y+MP  E P        S  D T +       +L+ ETR +L S +F
Sbjct  224   LINKDESRSLLCHYMMPDEETPLAAQACGLSPRDITTI-------KLLNETRDMLESPDF  276

Query  1132  GNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
               V++  L      ++D M E  R     +Q G++ N +  V +PLAK++P
Sbjct  277   STVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGDSMNSLSSVSLPLAKIIP  327



>ref|XP_003769558.1| PREDICTED: peroxisomal biogenesis factor 3 [Sarcophilus harrisii]
Length=373

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 100/354 (28%), Positives = 168/354 (47%), Gaps = 54/354 (15%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             K +  F +RHKKK      VLG  ++L K      R I E E         + + +A+ +
Sbjct  3     KSVWNFLKRHKKKCLFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLRDALMQQLNSENLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDD  795
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A   + G++       +   + 
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTL------LAPPEV  160

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDT---VVQILDRFM  966
             QQ +L+S  +L   GLT LI+  + A  ++L    LK   S   L      + +I ++  
Sbjct  161   QQQYLSSIQHLLGDGLTELITVVKQAVQKILGSVSLKHSLSLLELEQKLKEIRKITEQHA  220

Query  967   S------MGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSS  1122
             S       GS     +Y+MP  E P        ++ D T +       +L+ ETR +L S
Sbjct  221   SSSWTDKTGSKSLLCQYMMPDEETPLAIQACGLTAGDITTI-------KLLNETRDMLES  273

Query  1123  AEFGNVVDVSL----KTVVDAMVEDIRVQCGETN--------LMVGMPLAKLLP  1248
              +F  V++  L      ++D M E  R    + N          V +PLAK++P
Sbjct  274   PDFSTVLNTCLDRGFSRLLDNMAEFFRPTEQDLNHSDSMNSLSSVSLPLAKIIP  327



>ref|XP_004935736.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X4 [Gallus 
gallus]
Length=374

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 166/343 (48%), Gaps = 46/343 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  V    LG  +LL K     +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCLVLGTFLGGVYLLGKY---GQKKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNGTTPLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILD----RFMSMGSPH  984
               +L   GLT LI+  + A  +V     LK   S   L   + +I D    R     +P+
Sbjct  168   IQHLLGDGLTELITIVKQAVHKVFGSISLKHALSLLELEQKLKEIRDVVEHRDSDQVAPY  227

Query  985   HWL-RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
               L  YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+   L
Sbjct  228   SPLCHYLMPDEENPLATQACGLTERDTATI-------KLLNETRDMLESPDFSTVLSTCL  280

Query  1156  K----TVVDAMVEDIR------VQCG--ETNLMVGMPLAKLLP  1248
                   ++D M E  R       Q G   +   V +PLAK++P
Sbjct  281   NRGFSQLLDNMAEFFRPTEQDFSQNGSVNSLSSVSLPLAKIIP  323



>ref|XP_419708.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X3 [Gallus 
gallus]
Length=369

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 102/343 (30%), Positives = 161/343 (47%), Gaps = 46/343 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  V    LG  +LL K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCLVLGTFLGGVYLLGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNGTTPLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILD----RFMSMGSPH  984
               +L   GLT LI+  + A  +V     LK   S   L   + +I D    R     +P+
Sbjct  168   IQHLLGDGLTELITIVKQAVHKVFGSISLKHALSLLELEQKLKEIRDVVEHRDSDQVAPY  227

Query  985   HWL-RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
               L  YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+   L
Sbjct  228   SPLCHYLMPDEENPLATQACGLTERDTATI-------KLLNETRDMLESPDFSTVLSTCL  280

Query  1156  K----TVVDAMVEDIR------VQCG--ETNLMVGMPLAKLLP  1248
                   ++D M E  R       Q G   +   V +PLAK++P
Sbjct  281   NRGFSQLLDNMAEFFRPTEQDFSQNGSVNSLSSVSLPLAKIIP  323



>ref|XP_004935737.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X5 [Gallus 
gallus]
Length=327

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 93/316 (29%), Positives = 154/316 (49%), Gaps = 38/316 (12%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  V    LG  +LL K     +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCLVLGTFLGGVYLLGKY---GQKKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNGTTPLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILD----RFMSMGSPH  984
               +L   GLT LI+  + A  +V     LK   S   L   + +I D    R     +P+
Sbjct  168   IQHLLGDGLTELITIVKQAVHKVFGSISLKHALSLLELEQKLKEIRDVVEHRDSDQVAPY  227

Query  985   HWL-RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
               L  YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+   L
Sbjct  228   SPLCHYLMPDEENPLATQACGLTERDTATI-------KLLNETRDMLESPDFSTVLSTCL  280

Query  1156  K----TVVDAMVEDIR  1191
                   ++D M E  R
Sbjct  281   NRGFSQLLDNMAEFFR  296



>ref|NP_001039031.1| peroxisomal biogenesis factor 3 [Xenopus (Silurana) tropicalis]
 emb|CAJ83967.1| peroxisomal biogenesis factor 3 [Xenopus (Silurana) tropicalis]
 gb|AAI54856.1| peroxisomal biogenesis factor 3 [Xenopus (Silurana) tropicalis]
Length=369

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 96/344 (28%), Positives = 172/344 (50%), Gaps = 47/344 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK ++ +G +  G  L   Y   +R+I E+++   A+     + +A+ + HFE+
Sbjct  7     FLKRHKKK-FIFVGAVAGGVYLLGKYA--QRKIREIQEREAAEY----IAQARRQYHFES  59

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  60    NQRTCNMTVLS-MLPALREGLMQQLNSESLTSLL---KNKP-----SNKLEIWEDLKIIS  110

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDDQQLFL  810
             F+R +++++S   L + +RVQ+NI+G ++Y+D +   + G++ Q         + QQ +L
Sbjct  111   FSRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNSSLTKNGTTLQASP------EVQQQYL  164

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILD----RFMSMG-  975
             +S  +L   GL+ LI+  + A   VL    LK  FS T L   + +I      +  S+  
Sbjct  165   SSIQHLLGDGLSELITVVKQAVQGVLGSFSLKHCFSLTELEQKIKEIRSLVEKKKGSLNG  224

Query  976   ----SPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
                 S     +YLMP++    +  A   ++   L       +L+ ETR +L S +F  V+
Sbjct  225   EESDSKSKLCQYLMPDEENPLTTQAYGLTEKDVLTI-----RLLNETRDMLESEDFKTVL  279

Query  1144  DVSLK----TVVDAMVEDIRVQCGETNL-----MVGMPLAKLLP  1248
             +  L      ++D+  E  R    E N       + +PLAK++P
Sbjct  280   NSCLSRGFGRLLDSTAEFFRPTDREMNQDNTLHSISLPLAKIIP  323



>ref|XP_007946997.1| PREDICTED: peroxisomal biogenesis factor 3 [Orycteropus afer 
afer]
Length=373

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 164/349 (47%), Gaps = 54/349 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKFIFVGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P       KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----PNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDT---VVQILDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L      +  ++++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVHKILGNVSLKHSLSLLDLEQKLKGIRNLVEQHQSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------RLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR-----VQCGETNLM-----VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G  N M     V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMAEFFRPTEQDLQHG--NSMDSLSSVSLPLAKIIP  327



>ref|XP_002714902.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Oryctolagus 
cuniculus]
Length=373

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 98/350 (28%), Positives = 167/350 (48%), Gaps = 56/350 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K     +R+I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKY---GQRKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + K+E+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KNRP-----SNKVEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I +  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKQSLSLLDLEQKLEEIRN-LVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDESKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIRVQCGETNLM----------VGMPLAKLLP  1248
             ++  L      ++D M E  R    E +L           V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPT--EQDLQHDNSMNSLSSVSLPLAKIIP  327



>ref|XP_006084465.1| PREDICTED: peroxisomal biogenesis factor 3 [Myotis lucifugus]
Length=373

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 169/348 (49%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K     +++I E++++  A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKY---GQKKIREIQEKEAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW--  990
               +L   GLT LI+  + A  + L    LK   S   L   + +I +      S   W  
Sbjct  168   IQHLLGDGLTELITVIKQAVHKTLGSVSLKHSLSLLDLEQNLKEIRNLVEEHNSS-SWTN  226

Query  991   --------LRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   NNGYKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|NP_112640.1| peroxisomal biogenesis factor 3 [Rattus norvegicus]
 sp|Q9JJK4.1|PEX3_RAT RecName: Full=Peroxisomal biogenesis factor 3; AltName: Full=Peroxin-3; 
AltName: Full=Peroxisomal assembly protein PEX3 [Rattus 
norvegicus]
 dbj|BAA97992.1| Pex3p [Rattus norvegicus]
 gb|AAH62046.1| Peroxisomal biogenesis factor 3 [Rattus norvegicus]
 gb|EDL93733.1| peroxisomal biogenesis factor 3 [Rattus norvegicus]
Length=372

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 104/351 (30%), Positives = 167/351 (48%), Gaps = 59/351 (17%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKLREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDDQQLFL  810
             FTR +++++S   L + +RVQ+NI+G ++Y+D A   + G+S       +   D QQ +L
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNATVGKNGTSI------LAPPDVQQQYL  165

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL-----------D  957
             +S  +L   GLT L++  + A   +L    LK   S   L   + +I            D
Sbjct  166   SSIQHLLGDGLTELVTVIKQAVQRILGSISLKHSLSLLDLEQKLKEIRTLVEQHRSCWND  225

Query  958   RFMSMGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEF  1131
             +  S  S  H   Y+MP  E P        S  D T +       +L+ ETR +L S +F
Sbjct  226   KDASKSSLCH---YMMPDEETPLAAQAYGLSPRDITTI-------KLLNETRDMLESPDF  275

Query  1132  GNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
               V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  276   STVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  326



>ref|XP_005859142.1| PREDICTED: peroxisomal biogenesis factor 3 [Myotis brandtii]
 gb|EPQ03281.1| Peroxisomal biogenesis factor 3 [Myotis brandtii]
Length=373

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 169/348 (49%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K     +++I E++++  A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKY---GQKKIREIQEKEAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW--  990
               +L   GLT LI+  + A  + L    LK   S   L   + +I +      S   W  
Sbjct  168   IQHLLGDGLTELITVIKQAVRKTLGSVSLKHSLSLLDLEQNLKEIRNLVEEHNS-SSWTN  226

Query  991   --------LRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   NNGYKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_003499990.1| PREDICTED: peroxisomal biogenesis factor 3 [Cricetulus griseus]
 ref|XP_007637980.1| PREDICTED: peroxisomal biogenesis factor 3 [Cricetulus griseus]
 sp|Q9JJK3.1|PEX3_CRILO RecName: Full=Peroxisomal biogenesis factor 3; AltName: Full=Peroxin-3; 
AltName: Full=Peroxisomal assembly protein PEX3 [Cricetulus 
longicaudatus]
 dbj|BAA97994.1| Pex3p [Cricetulus longicaudatus]
 gb|EGW02524.1| Peroxisomal biogenesis factor 3 [Cricetulus griseus]
 gb|ERE84991.1| peroxisomal biogeneis factor 3-like isoform 1 [Cricetulus griseus]
Length=373

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 165/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL-  993
               +L   GLT L++  + A   +L    LK   S   L   + +I        SP  W+ 
Sbjct  168   IQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHRSP-SWID  226

Query  994   ---------RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                      +Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDVSKSSLCQYMMPDEETPLAAQAYGLSPRDITTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  327



>ref|XP_010624911.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Fukomys 
damarensis]
Length=315

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 90/303 (30%), Positives = 147/303 (49%), Gaps = 37/303 (12%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTVLL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTALAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRTLVEQHKSSSITKD  227

Query  973   GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVD  1146
             GS      Y+MP  E P        SS D T +       +L+ ETR +L S +F  V++
Sbjct  228   GSRSFLCHYMMPDEETPLAVQACGLSSRDITTI-------KLLNETRDMLESPDFSTVLN  280

Query  1147  VSL  1155
               L
Sbjct  281   TCL  283



>ref|XP_003800102.1| PREDICTED: peroxisomal biogenesis factor 3-like [Otolemur garnettii]
Length=373

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 98/345 (28%), Positives = 162/345 (47%), Gaps = 46/345 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P       KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----PNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSM--------  972
               +L   GLT LI+  + +  ++L    LK   S   L   + +I +             
Sbjct  168   IQHLLGDGLTELITVIKQSAQKILGSVSLKHSLSLLDLEQKLKEIRNLVEEHKSSSWINK  227

Query  973   -GSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDV  1149
              GS      Y+MP++    ++ A   S      RA    +L+ ETR +L S +F  V++ 
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSP-----RAIITIKLLNETRNMLESPDFSTVLNT  282

Query  1150  SLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
              L      ++D M E  R        +N M     V +PLAK++P
Sbjct  283   CLNRGFSRLLDNMAEFFRPTEQDLQHSNSMNSLSSVSLPLAKIIP  327



>ref|XP_005361054.1| PREDICTED: peroxisomal biogenesis factor 3 [Microtus ochrogaster]
Length=373

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 164/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW--  990
               +L   GLT L++  + A   +L    LK   S   L   + +I        SP  W  
Sbjct  168   IQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHRSP-SWTD  226

Query  991   --------LRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                      +Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDVSRSSLCQYMMPDEETPLAAQAYGLSPRDITTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  327



>ref|NP_001157667.1| peroxisomal biogenesis factor 3 isoform 2 [Mus musculus]
Length=359

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 163/348 (47%), Gaps = 53/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KSRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW--  990
               +L   GLT L++  + A   +L    LK   S   L   + +I  R +       W  
Sbjct  168   IQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEI--RILVEQHQSSWND  225

Query  991   --------LRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                      +Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  226   KDVSRSSLCQYMMPDEETPLAAQAYGLSHRDITTI-------KLLNETRDMLESPDFSTV  278

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  279   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  326



>ref|XP_003465693.1| PREDICTED: peroxisomal biogenesis factor 3 [Cavia porcellus]
Length=373

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 98/347 (28%), Positives = 165/347 (48%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + K+E+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKVEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  +VL    LK   S   L   + +I   ++  +       
Sbjct  168   IQHLLGDGLTELITVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRTLVEEHIPSSSANK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S+ D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSRSFLCHYMMPDEETPLAVQACGLSARDITTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMV-------EDIRVQCGETNL-MVGMPLAKLLP  1248
             +  L      ++D M        +D++     T+   V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMATFFRPTEQDLQPSNSMTSYSSVSLPLAKIIP  327



>ref|XP_006035374.1| PREDICTED: peroxisomal biogenesis factor 3 [Alligator sinensis]
Length=370

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 99/346 (29%), Positives = 165/346 (48%), Gaps = 51/346 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  +LL K     +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCLFLGTVLGGVYLLGKY---GQKKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDGLMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNGTMPLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFM------SMGS  978
               +L   GLT LI+  + A  +V     LK   S   L   + +I            +GS
Sbjct  168   IQHLLGDGLTELITVVKQAVQKVFGSISLKHTLSLLELEQKLKEIRKLVEQHKDSDKIGS  227

Query  979   PHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVS  1152
              +    Y+MP  E+P        +  D   +       +L+ ETR +L S +FG V+   
Sbjct  228   YYPLCYYMMPDEENPLASQACGLTEKDVATI-------KLLNETRDMLESPDFGTVLRTC  280

Query  1153  LK----TVVDAMVEDIRVQCGETNLM----------VGMPLAKLLP  1248
             L      ++D M E  R    E +L           V +PLAK++P
Sbjct  281   LNRGFSRLLDNMAEFFRPT--EQDLCQNSSVNSLSSVSLPLAKIIP  324



>gb|EDL03500.1| peroxisomal biogenesis factor 3, isoform CRA_b [Mus musculus]
Length=372

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 101/349 (29%), Positives = 164/349 (47%), Gaps = 55/349 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KSRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D QQ +L+
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----TVGKNGTTILAPPDVQQQYLS  166

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW-  990
             S  +L   GLT L++  + A   +L    LK   S   L   + +I  R +       W 
Sbjct  167   SIQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEI--RILVEQHQSSWN  224

Query  991   ---------LRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
                       +Y+MP  E P        S  D T +       +L+ ETR +L S +F  
Sbjct  225   DKDVSRSSLCQYMMPDEETPLAAQAYGLSHRDITTI-------KLLNETRDMLESPDFST  277

Query  1138  VVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             V++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  278   VLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  326



>ref|XP_006891726.1| PREDICTED: peroxisomal biogenesis factor 3 [Elephantulus edwardii]
Length=373

 Score = 98.2 bits (243),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 98/350 (28%), Positives = 161/350 (46%), Gaps = 56/350 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + K+E+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKVEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   +  I    +    P  W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKGI-RSLVEQHKPSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S +D T +       +L+ ETR +L S +F  V
Sbjct  227   KDGSKSFLCHYMMPDEETPLAVQACGLSPTDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIRVQCGETNLMVG----------MPLAKLLP  1248
             ++  L      ++  M E  R    E +L  G          +PLAK++P
Sbjct  280   LNTCLNRGFSRLLGNMAEFFRPT--EQDLQRGNSVDSLSSVSLPLAKIIP  327



>ref|XP_007096424.1| PREDICTED: peroxisomal biogenesis factor 3 [Panthera tigris altaica]
Length=373

 Score = 98.2 bits (243),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 149/320 (47%), Gaps = 42/320 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSM--------  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D             
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRDLVEQHKSSSWVNK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR  1191
             +  L      ++D M E  R
Sbjct  281   NTCLNRGFSRLLDNMAEFFR  300



>dbj|BAC35986.1| unnamed protein product [Mus musculus]
Length=372

 Score = 97.8 bits (242),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 164/348 (47%), Gaps = 53/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P++     KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KSRPSS-----KLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW--  990
               +L   GLT L++  + A   +L    LK   S   L   + +I  R +       W  
Sbjct  168   IQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEI--RILVEQHQSSWND  225

Query  991   --------LRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                      +Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  226   KDVSRSSLCQYMMPDEETPLAAQAYGLSHRDITTI-------KLLNETRDMLESPDFSTV  278

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  279   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  326



>ref|XP_001370565.1| PREDICTED: peroxisomal biogenesis factor 3 [Monodelphis domestica]
Length=373

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 171/355 (48%), Gaps = 56/355 (16%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             K +  F +RHKKK       LG  ++L K     +++I E++++  A+     + +A+ +
Sbjct  3     KSVWNFLKRHKKKCLFLGTFLGGVYILGKY---GQKKIREIQEKEAAEY----IAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLRDALMQQLNSENLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDD  795
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A   + G++       +   + 
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTL------LAPPEV  160

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMG  975
             QQ +L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I  +     
Sbjct  161   QQRYLSSIQHLLGDGLTELITVVKQAVQKILGSVSLKHSLSLLELEQKLKEI-RKISEQH  219

Query  976   SPHHWL----------RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLS  1119
             +   W+          +Y+MP  E P        +  D T +       +L+ ETR +L 
Sbjct  220   TSSSWIDKTGPKSLLCQYMMPDEETPLAIQACGLTEGDITTI-------KLLNETRDMLE  272

Query  1120  SAEFGNVVDVSLK----TVVDAMVEDIRVQCGETN--------LMVGMPLAKLLP  1248
             S +F  V++  L      ++D M E  R    + N          V +PLAK++P
Sbjct  273   SPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLNHSDSMNSLSSVSLPLAKIIP  327



>ref|NP_064345.1| peroxisomal biogenesis factor 3 isoform 1 [Mus musculus]
 sp|Q9QXY9.1|PEX3_MOUSE RecName: Full=Peroxisomal biogenesis factor 3; AltName: Full=Peroxin-3; 
AltName: Full=Peroxisomal assembly protein PEX3 [Mus 
musculus]
 gb|AAF14524.1|AF152996_1 peroxisomal assembly protein PEX3 [Mus musculus]
 gb|AAG24507.1| peroxisomal assembly protein PEX3P [Mus musculus]
 gb|AAH37606.1| Peroxisomal biogenesis factor 3 [Mus musculus]
 gb|AAH33415.1| Peroxisomal biogenesis factor 3 [Mus musculus]
 dbj|BAE27544.1| unnamed protein product [Mus musculus]
Length=372

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 100/348 (29%), Positives = 163/348 (47%), Gaps = 53/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KSRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHW--  990
               +L   GLT L++  + A   +L    LK   S   L   + +I  R +       W  
Sbjct  168   IQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEI--RILVEQHQSSWND  225

Query  991   --------LRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                      +Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  226   KDVSRSSLCQYMMPDEETPLAAQAYGLSHRDITTI-------KLLNETRDMLESPDFSTV  278

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  279   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  326



>ref|XP_004084984.1| PREDICTED: peroxisomal biogenesis factor 3-like isoform 1 [Oryzias 
latipes]
Length=362

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 98/340 (29%), Positives = 165/340 (49%), Gaps = 41/340 (12%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHK+K   T  V+   +LL K     ++++ E++++  A+     + +A+ + H
Sbjct  5     VGSFIKRHKRKFLFTGAVVAGVYLLGKY---AQKKLKEVQEKEAAEY----IAQARRQFH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   I   LD   LT  L   K +P     A KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPPLREAIMTHLDSESLTTLL---KTKP-----ANKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR +++++S   L + +RVQ+NI+G +LY+D      S+ +     +   D QQ +
Sbjct  109   IISFTRTIVAVYSSCMLVVLLRVQLNIIGGYLYLDN-----SAGRSPTTPLAPPDVQQQY  163

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+S  +L   GL  LIS  + A    L G  LK   S   +   +  I  R    G+  H
Sbjct  164   LSSIQHLLGDGLMELISVVKRAVHSSLGGVSLKQTLSLLDVEQQLSWI--RAEVEGASRH  221

Query  988   WLR-YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK--  1158
              L  YL+ +D    +  A   ++N  +       +L+ ETR +L S +F  V+   L   
Sbjct  222   PLSWYLLSDDESALADQACGLTENDVMTI-----RLLNETRDMLDSPDFSAVLAACLNRA  276

Query  1159  --TVVDAMVEDIRVQCG--------ETNLMVGMPLAKLLP  1248
                ++D + E  R   G        ++  +V +PLAK++P
Sbjct  277   FSRLLDNLAEFFRPPLGGSAPSSAPDSLSVVSLPLAKIVP  316



>ref|XP_006915420.1| PREDICTED: peroxisomal biogenesis factor 3 [Pteropus alecto]
 gb|ELK09661.1| Peroxisomal biogenesis factor 3 [Pteropus alecto]
Length=373

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 100/347 (29%), Positives = 171/347 (49%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F + HKKK      VLG  ++L K     +++I E++++  A+     + +A+ + HFE+
Sbjct  8     FLKHHKKKCIFLGTVLGGVYILGKY---GQKKIREMQEKEAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR  ++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSTVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQAYGLSPKDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             +  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIP  327



>ref|XP_010963962.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Camelus 
bactrianus]
Length=316

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 94/322 (29%), Positives = 150/322 (47%), Gaps = 46/322 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGIYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KSRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDDQQLFL  810
             FTR +++++S   L + +RVQ+NI+G ++Y+D A   R G++       +   D QQ +L
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGRNGTTV------LAPPDVQQQYL  165

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDR---------F  963
             +S  +L   GLT LI+  + A  ++L    LK   S   L   + ++ D           
Sbjct  166   SSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEVRDLVEQHKSSSWI  225

Query  964   MSMGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
              + GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  
Sbjct  226   NNDGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFST  278

Query  1138  VVDVSLK----TVVDAMVEDIR  1191
             V+   L      ++D M E  R
Sbjct  279   VLSTCLNRGFSRLLDNMAEFFR  300



>ref|XP_003971450.1| PREDICTED: peroxisomal biogenesis factor 3-like [Takifugu rubripes]
Length=361

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 93/338 (28%), Positives = 154/338 (46%), Gaps = 38/338 (11%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RH++K   T   +G  + L K      R + E E         + L +A+   H
Sbjct  5     VWNFVKRHRRKFIFTGAAVGGVYFLGKYAQKKLREMQEREAA-------EYLAQARRHIH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   I  +L+   LT   M  K +P     A KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPALKDAIVSQLNSESLT---MLLKTRP-----ANKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR ++ ++S   L + +RVQ+NI+G +LY+D     G   Q   A     D Q  +
Sbjct  109   IISFTRTIVGVYSTCMLVVLLRVQLNIIGGYLYLDLDTSAGHPGQTPRAP---PDVQHQY  165

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+S  +L   GL  L++  + A    L G  LK   S   L   +  +    +   SP  
Sbjct  166   LSSIQHLLGDGLAELMTAVKGAVRRSLGGISLKQNLSLVELEQQLSWV-RAVVESASPLS  224

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK---  1158
               RY++ +D    +  A   ++   +       +++ ETR +L S +F  V++  L    
Sbjct  225   --RYILADDENALAEQACGLTEEDTVTI-----KMLNETRDMLDSPDFSTVLNACLNRGF  277

Query  1159  -TVVDAMVEDIRVQCGETNLM-------VGMPLAKLLP  1248
               ++D + E  R   G+  L+       V +PLAK++P
Sbjct  278   SRLLDNLAEFFRPPPGDPALLGADSLSAVSLPLAKIIP  315



>ref|XP_004752801.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Mustela 
putorius furo]
 ref|XP_004789032.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Mustela 
putorius furo]
Length=316

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 152/320 (48%), Gaps = 42/320 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR  1191
             +  L      ++D M E  R
Sbjct  281   NTCLNRGFSRLLDNMAEFFR  300



>ref|XP_004441027.1| PREDICTED: peroxisomal biogenesis factor 3 [Ceratotherium simum 
simum]
Length=373

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 101/349 (29%), Positives = 165/349 (47%), Gaps = 54/349 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVRKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P     +  S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSRSLLCHYMMPDEETPLAVQASGLSPRDVTTI-------KLLNETRDMLESPDFSAVL  280

Query  1144  DVSL----KTVVDAMVEDIRVQCGETNLMVG----------MPLAKLLP  1248
             +  L      ++D M E  R    E +L  G          +PLAK++P
Sbjct  281   NTCLSRGFSGLLDNMSEFFRPT--EQDLQRGDSVNSLSSVSLPLAKIIP  327



>ref|XP_007636710.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
3-like isoform X2, partial [Cricetulus griseus]
Length=407

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 101/349 (29%), Positives = 164/349 (47%), Gaps = 54/349 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  23    FLKRHKKKCIFLGTVLGEVYILGKYGQKKXREIQEREAA-------EYIAQARRQYHFES  75

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  76    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  126

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +L+++S   L   +RVQ+NI+G ++Y++ A     +  +    ++   D QQ +L+
Sbjct  127   FTRSILAVYSTCMLVFLLRVQLNIIGGNIYLNNA-----TVGKNGTTVLSPPDVQQQYLS  181

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL  993
             S  +L   GLT L++  + A   +L    LK   S   L   + +I        SP  W+
Sbjct  182   SIQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHRSP-SWI  240

Query  994   ----------RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGN  1137
                       +Y+MP  E P        S  D T +       +L+ ETR +L S +F  
Sbjct  241   DKDVSKSSLCQYMMPDEETPLAAQAYGLSPRDITTI-------KLLNETRDMLESPDFST  293

Query  1138  VVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             V+   L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  294   VLKTCLNRGFSQLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIP  342



>ref|XP_007114377.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Physeter 
catodon]
Length=368

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 169/348 (49%), Gaps = 57/348 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  + LGV       Y L    +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKC-IFLGV-------YILGKYGQKKIREIQEREAAEY----IAQARRQYHFES  55

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KL++W+ LKI+S
Sbjct  56    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLDIWEDLKIIS  106

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  107   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  162

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I D  +       W+ 
Sbjct  163   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRD-LIEQHKSSSWIN  221

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  222   NDGSRSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  274

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  275   LNTCLNRGFSRLLDNMAEFFRPIEQDLQHGNSMNSLSSVSLPLAKIIP  322



>ref|XP_006265794.1| PREDICTED: peroxisomal biogenesis factor 3 [Alligator mississippiensis]
Length=370

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 96/344 (28%), Positives = 164/344 (48%), Gaps = 47/344 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  +LL K     +++I E+++   A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCLFLGTVLGGVYLLGKY---GQKKIREIQEREAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K +P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDGLMHQLNSESLTSLL---KSRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNGTMPLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFM------SMGS  978
               +L   GLT LI+  + A  +V     LK   S   L   + +I            +GS
Sbjct  168   IQHLLGDGLTELITVVKQAVQKVFGSISLKHALSLLELEQKLKEIRKLVEQHKDSDKIGS  227

Query  979   PHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVS  1152
              +    Y+MP  E+P        +  D   +       +L+ ETR +L S +FG V+   
Sbjct  228   YYPLCYYMMPDEENPLASQACGLTEKDVATI-------KLLNETRDMLESPDFGTVLRTC  280

Query  1153  LKTVVDAMVEDIR--VQCGETNLM----------VGMPLAKLLP  1248
             L      +++++    Q  E +L           V +PLAK++P
Sbjct  281   LNRGFSRLLDNMAEFFQPTEQDLCQNSSVNSLSSVSLPLAKIIP  324



>ref|XP_005065917.1| PREDICTED: peroxisomal biogenesis factor 3 [Mesocricetus auratus]
Length=373

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 98/348 (28%), Positives = 165/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWL-  993
               +L   GLT L++  + A   +L    LK   S   L   + +I    +    P  W+ 
Sbjct  168   IQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEI-RILVEQHRPPSWID  226

Query  994   ---------RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                      +Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDVSKSSLCQYMMPDEETPLAAQAYGLSPRDITTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     ++ G + N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLKHGNSINSLSSVSLPLAKIIP  327



>ref|NP_956522.1| peroxisomal biogenesis factor 3 [Danio rerio]
 gb|AAH46066.1| Peroxisomal biogenesis factor 3 [Danio rerio]
Length=364

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 160/337 (47%), Gaps = 39/337 (12%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHK+K   T   +G  +LL K     +R+I E+++   A+     + +A+ + HFE+
Sbjct  8     FIKRHKRKFIFTGVFVGGVYLLGKY---AQRKIQEMQEREAAEY----IAQARRQFHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   I   L+   LT  L+K K        A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREAIIHHLNSESLT-TLLKTK-------PANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G +LY+D      S  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYLYLD-----NSVTKNGMTPLAPPDVQQQYLSS  166

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GL  LI+  + A  EV     LK   S   L   + QI        S +  L 
Sbjct  167   IQHLLGEGLMELITVVKKAVQEVFGLVSLKQSLSLQELEQQLTQIRQLVEDDSSKYKGLS  226

Query  997   -YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK----T  1161
              Y+MP++    +  A   ++N D+       +L+ ETR +L S +F  V+   L      
Sbjct  227   WYMMPDEENTLASQACGLTEN-DVTTI----KLLNETRDMLESPDFNIVLHTCLNRGFVR  281

Query  1162  VVDAMVEDIRVQCGETNLM--------VGMPLAKLLP  1248
              +D M E  R    ++           V +PLAK++P
Sbjct  282   FLDNMAEFFRPPQRDSTPSSTPDQLSHVSLPLAKIIP  318



>ref|XP_003790322.1| PREDICTED: peroxisomal biogenesis factor 3 [Otolemur garnettii]
Length=373

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 98/347 (28%), Positives = 159/347 (46%), Gaps = 50/347 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREA-------TEYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P       KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----PNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSM--------  972
               +L   GLT LI+  + +  ++L    LK   S   L   + +I +             
Sbjct  168   IQHLLGDGLTELITVIKQSVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEEHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D   +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDIITI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
             +  L      ++D M E  R        +N M     V +PLAK++P
Sbjct  281   NTCLNRGFSRLLDNMAEFFRPTEQDLQHSNSMNSLSSVSLPLAKIIP  327



>ref|XP_008395275.1| PREDICTED: peroxisomal biogenesis factor 3 [Poecilia reticulata]
Length=360

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 101/339 (30%), Positives = 163/339 (48%), Gaps = 41/339 (12%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHKKK   T  V+G  +LL K      R + E E        ++ + +A+ + H
Sbjct  5     VWNFIKRHKKKFIFTGAVVGGVYLLGKYAQKKIREVQEKEA-------SEYIAQARRQFH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   I  +L+   LT  L   K +P     A KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPPLREAIVTQLNSESLTAML---KAKP-----ANKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR V++++S   L + +RVQ+NI+G +LY+D +  +G S     + +   D QQ +
Sbjct  109   IISFTRTVVAVYSTCMLVVLLRVQLNIIGGYLYLDNS--VGKS---AASPLTPPDVQQQY  163

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+S  +L   GL+ LIS  + A    L    LK   S   L   ++ I     S G P  
Sbjct  164   LSSIQHLLGDGLSELISRVKTAVQSSLGRVSLKQSLSLLELEQQLIWIRAEVDS-GRPLS  222

Query  988   WLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK---  1158
                Y++ +D  + +  A   ++  DL       +L+ ETR +L S +   V+   L    
Sbjct  223   --SYMLADDEDVLADQACGLTEK-DLVTI----RLLNETRDMLDSPDLSKVLSACLNRGF  275

Query  1159  -TVVDAMVEDIRV-------QCGETNL-MVGMPLAKLLP  1248
               ++D + E  R+        C   +L  V +PLAK++P
Sbjct  276   SRLLDNLAEFFRLPVSDSAPNCAPYSLSAVSLPLAKIIP  314



>ref|XP_004752800.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Mustela 
putorius furo]
 ref|XP_004789031.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Mustela 
putorius furo]
Length=373

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 152/320 (48%), Gaps = 42/320 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR  1191
             +  L      ++D M E  R
Sbjct  281   NTCLNRGFSRLLDNMAEFFR  300



>ref|XP_008693264.1| PREDICTED: peroxisomal biogenesis factor 3 [Ursus maritimus]
Length=373

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 152/320 (48%), Gaps = 42/320 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR  1191
             +  L      ++D M E  R
Sbjct  281   NTCLNRGFSRLLDNMAEFFR  300



>ref|XP_008828040.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Nannospalax 
galili]
Length=373

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 162/348 (47%), Gaps = 52/348 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR V++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSVVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----TVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT L++  + A  ++L    LK   S   L   + +I    +       W+ 
Sbjct  168   IQHLLGDGLTELVTVIKQAVQKILGSVSLKHSLSLLDLEQKLKEI-RILVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D   +       +L+ ETR +L S +F  V
Sbjct  227   KEESKSLLCHYMMPDEETPLAAQACGLSPRDIITI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
             ++  L      ++D M E  R     +Q G   N +  V +PLAK++P
Sbjct  280   LNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNAVNSLSSVSLPLAKIIP  327



>ref|XP_006834673.1| PREDICTED: peroxisomal biogenesis factor 3 [Chrysochloris asiatica]
Length=373

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 162/350 (46%), Gaps = 56/350 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK       LG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTALGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P       KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----TNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D QQ +L+
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQQQYLS  166

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM----  972
             S  +L   GLT LI+  + A  ++L    LK   S   L   V  I   +++  S     
Sbjct  167   SIQHLLGDGLTELITVSKQAVQKLLGSVSLKHSLSLLDLEQKVKGIRSLVEQHKSSSWIN  226

Query  973   --GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
               GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   RDGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFNTV  279

Query  1141  VDVSLK----TVVDAMVEDIRVQCGETNLMVG----------MPLAKLLP  1248
             ++  L      ++D M E  R    E +L  G          +PLAK++P
Sbjct  280   LNTCLNRGFSKLLDNMAEFFRPT--EQDLQHGNSVNSLSSVSLPLAKIIP  327



>ref|XP_007648428.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
3-like isoform X1 [Cricetulus griseus]
Length=452

 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 100/351 (28%), Positives = 166/351 (47%), Gaps = 58/351 (17%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  79    FLKRHKKKCIFLGTVLGEVYILGKYGQKKXREIQEREAA-------EYIAQARRQYHFES  131

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  132   NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  182

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +++++S   L   +RVQ+NI+G ++Y++ A     +  +    ++   D QQ +L+
Sbjct  183   FTRSIVAVYSTCMLVFLLRVQLNIIGGNIYLNNA-----TVGKNGTTVLSPPDVQQQYLS  237

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI------------LD  957
             S  +L   GLT L++  + A   +L    LK   S   L   + +I            +D
Sbjct  238   SIQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHRSPSWID  297

Query  958   RFMSMGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEF  1131
             + +S  S     +Y+MP  E P        S  D T +       +L+ ETR +L S +F
Sbjct  298   KDVSKSS---LCQYMMPDEETPLAAQAYGLSPRDITTI-------KLLNETRDMLESPDF  347

Query  1132  GNVVDVSLK----TVVDAMVEDIR-----VQCGET-NLM--VGMPLAKLLP  1248
               V+   L      ++D M E  R     +Q G + N +  V +PLAK++P
Sbjct  348   STVLKTCLNRGFSQLLDNMAEFFRPXEQDLQHGNSINSLSSVSLPLAKIIP  398



>gb|ETE64214.1| Peroxisomal biogenesis factor 3, partial [Ophiophagus hannah]
Length=372

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 94/346 (27%), Positives = 157/346 (45%), Gaps = 49/346 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK +     LG  ++L K   G ++      KE++     + + +A+ + HFE+
Sbjct  8     FLKRHKKKCFFLGAFLGGVYVLGKY--GQKKM-----KEIQEREAAEYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDTLMYQLNSESLTSLL---KNKP-----ANKLEIWEELKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +         + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNGTTLFAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMS--------M  972
               +L   GLT LIS  +     V +   LK   S   L   + +I               
Sbjct  168   IQHLLGDGLTELISVIKKTVQNVFESVSLKHALSLLQLEQKLREIRKVIEQPEDSASEET  227

Query  973   GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVD  1146
              S      Y+MP  E+P  +     +  D   +       +L+ ETR +L S +F  V+ 
Sbjct  228   ASQSQLCHYMMPDEENPLAFQANELTEKDVATI-------KLLNETRDMLESPDFNRVLS  280

Query  1147  VSLK----TVVDAMVEDIRV------QCGETNLM--VGMPLAKLLP  1248
               L      ++D M E  R         G  N +    +PLAK++P
Sbjct  281   SCLNRGFSRLLDNMAEFFRPTELDIHHIGSVNSLSSASLPLAKIIP  326



>ref|XP_004702025.1| PREDICTED: peroxisomal biogenesis factor 3 [Echinops telfairi]
Length=373

 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 164/350 (47%), Gaps = 56/350 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRESLMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-QQLFLA  813
             FTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D QQ +L+
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQQQYLS  166

Query  814   SADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDT---VVQILDRFMSM----  972
             S  +L   GLT LI+  + A  ++L    LK   S   L      +  ++++  S     
Sbjct  167   SIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKGIRNLVEQHKSSSWIN  226

Query  973   --GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
               GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDGSKSLLCPYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLDSPDFSVV  279

Query  1141  VDVSLK----TVVDAMVEDIRVQCGETNL----------MVGMPLAKLLP  1248
             +D  L      ++D M E  R    E +L           V +PLAK++P
Sbjct  280   LDTCLNRGFSRLLDNMAEFFRPT--EQDLQHSSSVNSLSSVSLPLAKIIP  327



>ref|XP_007422975.1| PREDICTED: peroxisomal biogenesis factor 3 [Python bivittatus]
Length=372

 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 96/353 (27%), Positives = 164/353 (46%), Gaps = 52/353 (15%)
 Frame = +1

Query  265   MIMQFW---RRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQ  435
             M+M  W   +RHKKK +     LG  ++L K   G ++      KE++     + + +A+
Sbjct  1     MLMAVWGFLKRHKKKCFFLGAFLGGVYVLGKY--GQKKM-----KEIQEKEAAEYIAQAR  53

Query  436   MKEHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELW  615
              + HFE+ Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W
Sbjct  54    RQYHFESNQRTCNMTVL-SMLPTLRDTLMYQLNSENLTSLL---KNKP-----ANKLEIW  104

Query  616   DRLKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD  795
             + LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + 
Sbjct  105   EDLKIMSFTRTIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVCKNGTTLLAPPEV  160

Query  796   QQLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHD------TVVQILD  957
             QQ +L+S  +L   GLT LIS  +     V +   LK   S   L         V++  +
Sbjct  161   QQQYLSSIQHLLGDGLTELISVVKKTVQNVFESVSLKHALSLLDLEQKLREIRKVIEQPE  220

Query  958   RFMSMGSP--HHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
              F S  +        Y+MP  E+P  +     +  D   +       +L+ ETR +L S 
Sbjct  221   DFASEETALQSQLCHYMMPDEENPLAFQANELTEKDVATI-------KLLNETRDMLESP  273

Query  1126  EFGNVVDVSLK----TVVDAMVEDIRVQ----CGETNL----MVGMPLAKLLP  1248
             +F  V+   L      ++D M E  R      C   ++       +PLAK++P
Sbjct  274   DFNRVLSTCLNRGFSRLLDNMAEFFRPTEQDICHTDSVNSFSSASLPLAKIIP  326



>ref|XP_541132.3| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Canis 
lupus familiaris]
Length=373

 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 150/321 (47%), Gaps = 44/321 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHHWLR  996
               +L   GLT LI+  + A  ++L    LK   S   L   + +I +  +       W+ 
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRN-LVEQHKSSSWIN  226

Query  997   ----------YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV  1140
                       Y+MP  E P        S  D T +       +L+ ETR +L S +F  V
Sbjct  227   KDESKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTV  279

Query  1141  VDVSLK----TVVDAMVEDIR  1191
             ++  L      ++D M E  R
Sbjct  280   LNTCLNRGFSRLLDNMAEFFR  300



>ref|XP_005518498.1| PREDICTED: peroxisomal biogenesis factor 3 [Pseudopodoces humilis]
Length=369

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 103/345 (30%), Positives = 158/345 (46%), Gaps = 50/345 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  V    LG  +LL K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCLVLGTFLGGVYLLGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A  LG +     A     + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-ALGKNGTTPLAP---PEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRF-----MSMGSP  981
               +L   GLT LI+  + A  EV     LK   S   L   +  I +         + S 
Sbjct  168   IQHLLGDGLTELITIVKQAVHEVFGSISLKQTLSLLELEQKLKDIREVVEHRDSEQIASY  227

Query  982   HHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
                  YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+   L
Sbjct  228   SPLCHYLMPDEENPLASQACGLTERDIATI-------KLLNETRDMLESPDFSTVLSTCL  280

Query  1156  K----TVVDAMVEDIRVQCGETNL----------MVGMPLAKLLP  1248
                   ++D M E  R    E +L           V +PLAK++P
Sbjct  281   NRGFSRLLDNMAEFFRPT--EKDLSQNSSVNSLSSVSLPLAKIIP  323



>ref|XP_004345008.1| hypothetical protein CAOG_06259 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW41127.1| hypothetical protein CAOG_06259 [Capsaspora owczarzaki ATCC 30864]
Length=466

 Score = 97.1 bits (240),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 120/244 (49%), Gaps = 56/244 (23%)
 Frame = +1

Query  277  FWRRHKKKVYVTLGVLGSGF-----LLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
            F+RRH++K+ +T GVLG  +     LL +L D       E +KEL      + L  A+MK
Sbjct  8    FFRRHRRKLLITAGVLGGVYFAGRHLLSRLAD-------ERDKELA-----ERLAHARMK  55

Query  442  EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
            +HFE+ Q    +T L  ++  L  R+   LD  +LT +L +G        + +KL LW+R
Sbjct  56   QHFESNQKTCTTTAL-SLITTLRERLLLALDTDELTAQLRRG--------SPDKLALWER  106

Query  622  LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTA----RRLGSSYQEEEADIIYR  789
            LK++SFTR V +++++  L   +RVQ+N++GR++Y+D+     R  GS      A     
Sbjct  107  LKVVSFTRAVAAIYAVCCLVALLRVQLNVMGRYMYLDSVDKQNRANGSGNGNANAGGTGA  166

Query  790  DD----------------------QQLFLASADYLANYGLTTLISDFE----AATSEVLK  891
            D                       Q+L+L    +L + GL  LI+D E    A   E+  
Sbjct  167  DPTNQANNGARAAGASAMHVSPYVQRLYLCLVHFLLSDGLELLIADVERCVQAQIGEIPL  226

Query  892  GKQL  903
             KQL
Sbjct  227  KKQL  230



>ref|XP_010572891.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Haliaeetus 
leucocephalus]
Length=369

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 157/343 (46%), Gaps = 46/343 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  V    LG  +LL K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCLVLGTFLGGVYLLGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----ALCKNGTTPLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFM-----SMGSP  981
               +L   GLT LI+  + A  +V     LK   S   L   V  I +         + S 
Sbjct  168   IQHLLGDGLTELITIVKQAVHKVFGSISLKHTLSLLELEQKVKDIREVVEHKDSDQIASH  227

Query  982   HHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
                  YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+   L
Sbjct  228   SPLCHYLMPDEENPLATQACGLTERDIATI-------KLLNETRDMLESPDFSTVLSTCL  280

Query  1156  K----TVVDAMVEDIR------VQCG--ETNLMVGMPLAKLLP  1248
                   ++D M E  R       Q G   +   V +PLAK++P
Sbjct  281   NRGFSRLLDNMAEFFRPTEKDLSQNGSVNSLSSVSLPLAKIIP  323



>ref|XP_004397084.1| PREDICTED: peroxisomal biogenesis factor 3 [Odobenus rosmarus 
divergens]
Length=372

 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 151/320 (47%), Gaps = 42/320 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSISLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNV-  1140
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V 
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1141  ---VDVSLKTVVDAMVEDIR  1191
                V+     ++D M E  R
Sbjct  281   NTCVNRGFSRLLDNMAEFFR  300



>ref|NP_001188055.1| peroxisomal biogenesis factor 3 [Ictalurus punctatus]
 gb|ADO29487.1| peroxisomal biogenesis factor 3 [Ictalurus punctatus]
Length=366

 Score = 95.1 bits (235),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 95/341 (28%), Positives = 162/341 (48%), Gaps = 45/341 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHK+K ++  G    G  L   Y   +R++ E+++   A+     + +A+ + HFE+
Sbjct  8     FIKRHKRK-FIIAGAFAGGVYLLGKYA--QRKLQEMQERETAEY----IAQARRQFHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   I   L+   LTE L   K +P     A K+E+W+ LK +S
Sbjct  61    NQRTCNMTVL-SLLPTLREAIIHHLNSESLTELL---KSRP-----ANKIEIWEDLKTIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G +LY+D +     +      ++     QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYLYLDNSVTKNGTMPLAPPEV-----QQKYLSS  166

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI--LDRFMSMGSPHHW  990
               +L   GL  L++  + A  E+L    LK   S   L   ++QI  L    S+ S    
Sbjct  167   IQHLLGDGLVELVTVVKKAVQEILGPISLKQSLSLQELEQHIIQIRQLVEENSVSSKFRT  226

Query  991   LR-YLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK-  1158
             L  Y+M   EDP        + +D T +       +L+ ETR +L + +F  ++   L  
Sbjct  227   LTCYMMADEEDPLADQACGLTENDVTTI-------KLLNETRDMLENPDFSTILGACLNR  279

Query  1159  ---TVVDAMVEDIRVQCGETN--------LMVGMPLAKLLP  1248
                  +D M E      G++         L V +PLAK++P
Sbjct  280   GFSRFLDNMAEFFCPPQGDSTPSSTSDSLLHVSLPLAKIIP  320



>ref|XP_010572892.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X2 [Haliaeetus 
leucocephalus]
Length=346

 Score = 94.7 bits (234),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 93/324 (29%), Positives = 153/324 (47%), Gaps = 44/324 (14%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK  V    LG  +LL K     +++I E+++   A+     + +A+ +
Sbjct  3     RSLWSFLKRHKKKCLVLGTFLGGVYLLGKY---GQKKIREIQEREAAEY----IAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQ  801
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----ALCKNGTTPLAPPEVQQ  162

Query  802   LFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL--------D  957
              +L+S  +L   GLT LI+  + A  +V     LK   S   L   V  I         D
Sbjct  163   QYLSSIQHLLGDGLTELITIVKQAVHKVFGSISLKHTLSLLELEQKVKDIREVVEHKDSD  222

Query  958   RFMSMGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEF  1131
             +  S     H   YLMP  E+P        +  D   +       +L+ ETR +L S +F
Sbjct  223   QIASHSPLCH---YLMPDEENPLATQACGLTERDIATI-------KLLNETRDMLESPDF  272

Query  1132  GNVVDVSLK----TVVDAMVEDIR  1191
               V+   L      ++D M E  R
Sbjct  273   STVLSTCLNRGFSRLLDNMAEFFR  296



>ref|XP_001635320.1| predicted protein [Nematostella vectensis]
 gb|EDO43257.1| predicted protein [Nematostella vectensis]
Length=380

 Score = 95.1 bits (235),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 95/357 (27%), Positives = 166/357 (46%), Gaps = 54/357 (15%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             I  F+RRHK+K +V  G++ +G  +   Y   R   +   +ELE       + +A+ + H
Sbjct  5     IKGFFRRHKRK-FVVGGIVITGIYIVSRYARWRLDEWRANQELEY------IAQARKQHH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q    S TL  ++  L   + ++L+  ++T KL   +++P     A KLELW+ LK
Sbjct  58    FESNQRTC-SVTLYSLIPSLRDSLLDKLNTEEITAKL---REKP-----ANKLELWESLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYID---TARRLGSSYQEEEADIIYRDDQ  798
              LSF R V +++S   L +++RVQ+N++G ++Y+D   T    GS+ + +    +    Q
Sbjct  109   TLSFARTVTAVYSSCMLFVFLRVQLNVIGGYMYLDSLVTPVEGGSNGKRKH---VAEGMQ  165

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRF-----  963
             + +LA   YL + GL  +    + +T ++L    LKD  +   L   +  I   F     
Sbjct  166   KKYLALVKYLLSEGLDKMTDTIKRSTEDILSDISLKDKLTHAELQRLINHIRQTFEFSQQ  225

Query  964   ------------MSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDL--CRASNFEQLMQE  1101
                           + S   + ++++PED     +AA      T +       F +L++E
Sbjct  226   TSSSMRSSQTGSTPLSSTRPFCQFMVPED-----MAALDGRGETAVGGVEGEEFMRLVEE  280

Query  1102  TRAVLSSAEFGNVVDVSLKTVVDAMVEDIR--VQCGETN------LMVGMPLAKLLP  1248
             T  VL S +   V+   L      ++ +I    Q  E        L V +PLAK++P
Sbjct  281   TLDVLESEDCSAVLQGCLDVAFAHILGNIAPFFQAEELGMSFKYLLAVSLPLAKIIP  337



>ref|NP_001085641.1| peroxisomal biogenesis factor 3 [Xenopus laevis]
 gb|AAH73069.1| MGC82731 protein [Xenopus laevis]
Length=372

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 98/350 (28%), Positives = 170/350 (49%), Gaps = 56/350 (16%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK        GS +LL K     +R+I E+++   A+     + +A+ + HFE+
Sbjct  7     FLKRHKKKFIFVGAFAGSVYLLGKY---AQRKIREIQEREAAEY----IAQARRQYHFES  59

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + KL++W+ LKI+S
Sbjct  60    NQRTCNMTVLS-MLPALREALMQQLNSESLTSLL---KNKP-----SNKLDIWEDLKIIS  110

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTAR--RLGSSYQEEEADIIYRDDQQLFL  810
             F+R +++++S   L + +RVQ+NI+G ++Y+D +   + G++ Q         + QQ +L
Sbjct  111   FSRSIVAIYSTCMLVVLLRVQLNIIGGYIYLDNSSVTKNGTALQASP------EVQQQYL  164

Query  811   ASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI----------LDR  960
             +S  +L   GLT LI+  + A  EVL    LK  FS   L   + +I          L+ 
Sbjct  165   SSIQHLLGDGLTELITVVKQAVQEVLGSFSLKHSFSLIELEQKIKEIRSLVEKKRGSLNG  224

Query  961   FMSMGSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFG  1134
               S G      +YLM   E+P        +  D   +       +L+ ETR +L S +F 
Sbjct  225   EESDGKV-RLCQYLMSDEENPLTTQAYGLTEKDVKTI-------RLLNETRDMLESEDFN  276

Query  1135  NVVDVSLK----TVVDAMVEDIRV---QCGETNLM-----VGMPLAKLLP  1248
              V++  L      ++D+  E  R    +  + N M     + +PLAK++P
Sbjct  277   TVLNSCLSRGFGRLLDSTAEFFRPADQELKQHNTMHSLSSISLPLAKIIP  326



>ref|XP_002912676.1| PREDICTED: peroxisomal biogenesis factor 3-like [Ailuropoda melanoleuca]
 gb|EFB26612.1| hypothetical protein PANDA_000407 [Ailuropoda melanoleuca]
Length=373

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/320 (29%), Positives = 150/320 (47%), Gaps = 42/320 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K +P     + KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KSRP-----SNKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   D QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----AVGKNGTTVLAPPDVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSISLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D   +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVITI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR  1191
             +  L      ++D M E  R
Sbjct  281   NTCLNRGFSRLLDNMAEFFR  300



>ref|XP_010880897.1| PREDICTED: peroxisomal biogenesis factor 3 isoform X1 [Esox lucius]
Length=369

 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 99/345 (29%), Positives = 165/345 (48%), Gaps = 50/345 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHK+K       +G  + L K     +++I E++ E EA +  ++   A+ + HFE+
Sbjct  8     FLKRHKRKFVFAGAFVGGVYFLGKYA---QKKIREMQ-EHEASVYINQ---ARRQFHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   I   L+   LT  L   K +P     A +LE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREAIIHHLNSENLTTLL---KTKP-----ANRLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L L +RVQ+NI+G +LY+D      S  +     +   D QQ +L+S
Sbjct  112   FTRTIVAVYSTCMLVLLLRVQLNIIGGYLYLDN-----SVTKNGMLPLAPPDVQQQYLSS  166

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMS--MGSPHHW  990
               +L   GL+ +I+  + A    L    LK   S   L   + QI  +      GS H  
Sbjct  167   MQHLLGDGLSEMITAVKKAVQNTLGRLSLKQSLSLQDLEQHLNQIRAQVEKGVGGSVHRP  226

Query  991   LRYLMPEDPKIYSLAAP----SSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK  1158
             L + M  D +  +LAA     +++D T +       +L+ ETR +L S +FG V++    
Sbjct  227   LSWYMMADEE-NTLAAQACGLTANDVTTI-------KLLNETRDMLESPDFGTVLNTCFN  278

Query  1159  T----VVDAMVEDIRVQCG-----------ETNLMVGMPLAKLLP  1248
             +     +D M E  R   G           ++   V +P+AK++P
Sbjct  279   SGFNRFLDNMAEFFRPPPGAQGDSAPGTTPDSLSHVSLPVAKIIP  323



>ref|XP_005815436.1| PREDICTED: peroxisomal biogenesis factor 3-like isoform X1 [Xiphophorus 
maculatus]
Length=382

 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 104/361 (29%), Positives = 170/361 (47%), Gaps = 63/361 (17%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHKKK   T  V+G  +LL K     +++I    KE++    ++ + +A+ + H
Sbjct  5     VWNFIKRHKKKFIFTGAVVGGVYLLGKY---AQKKI----KEVQEKEASEYIAQARRQFH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   I  +L+   LT  L   K +P     A KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPPLREAIVTQLNSESLTVML---KTKP-----ANKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR V++++S   L + +RVQ+NI+G +LY+D +  +G S     + +   D QQ +
Sbjct  109   IISFTRTVVAVYSTCMLVVLLRVQLNIIGGYLYLDNS--VGKS---AASPLTPPDVQQQY  163

Query  808   LASADYL----------------------ANYGLTTLISDFEAATSEVLKGKQLKDVFST  921
             L+S  +L                       + GLT LIS  + A    L G  LK   S 
Sbjct  164   LSSIQHLLGDGREYPPRSLSFVCPLIHPCVSPGLTELISRVKTAVQSSLGGVSLKQSLSL  223

Query  922   TILHDTVVQILDRFMSMGSPHHWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQE  1101
               L   ++ I     S G P     Y++ +D  + +  A   ++N DL       +L+ E
Sbjct  224   LELEQQLIWIRAEVDS-GRPLS--SYMLADDEDVLADQACGLTEN-DLVTI----RLLNE  275

Query  1102  TRAVLSSAEFGNVVDVSLK----TVVDAMVEDIRV-------QCGETNL-MVGMPLAKLL  1245
             TR +L S +   V+   L      ++D + E  R+        C   +L  V +PLAK++
Sbjct  276   TRDMLDSPDLSKVLSACLNRGFSRLLDNLAEFFRLPVSDSAPNCAPDSLSAVSLPLAKII  335

Query  1246  P  1248
             P
Sbjct  336   P  336



>ref|XP_009899674.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
3 [Picoides pubescens]
Length=369

 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 98/346 (28%), Positives = 164/346 (47%), Gaps = 52/346 (15%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK +   G L +G  L   Y   +++I E++++  A+     + +A+ + HFE+
Sbjct  8     FLKRHKKKCF-XYGNLSAGVYLLGKYG--QKKIREIQEQEAAEY----IAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P       KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLKDALMHQLNSESLTSLL---KNRPKN-----KLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----ALCKNGTTPLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL--------DRFMSM  972
               +L   GLT LI+  + A  +V     LK   S   L   +  I         D+ +S 
Sbjct  168   IQHLLGDGLTELITIVKQAVHKVFGSISLKHTLSLLELEQKLKDIREAVEHKNSDQIVSY  227

Query  973   GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVD  1146
                 H   YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+ 
Sbjct  228   SPLCH---YLMPDEENPLATQACGLTERDVATI-------KLLNETRDMLESPDFSTVLS  277

Query  1147  VSLK----TVVDAMVEDIR------VQCG--ETNLMVGMPLAKLLP  1248
               L      ++D M E  R       Q G   +   V +PLAK++P
Sbjct  278   TCLNRGFSRLLDNMAEFFRPSEQDLSQNGSVNSLSSVSLPLAKIIP  323



>ref|XP_004084985.1| PREDICTED: peroxisomal biogenesis factor 3-like isoform 2 [Oryzias 
latipes]
Length=366

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 98/344 (28%), Positives = 164/344 (48%), Gaps = 45/344 (13%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHK+K   T  V+   +LL K     ++++ E++++  A+     + +A+ + H
Sbjct  5     VGSFIKRHKRKFLFTGAVVAGVYLLGKY---AQKKLKEVQEKEAAEY----IAQARRQFH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+ Q   + T L  ++  L   I   LD   LT  L   K +P     A KLE+W+ LK
Sbjct  58    FESNQRTCNMTVL-SMLPPLREAIMTHLDSESLTTLL---KTKP-----ANKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR +++++S   L + +RVQ+NI+G +LY+D      S+ +     +   D QQ +
Sbjct  109   IISFTRTIVAVYSSCMLVVLLRVQLNIIGGYLYLD-----NSAGRSPTTPLAPPDVQQQY  163

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRFMSMGSPHH  987
             L+S  +L   GL  LIS  + A    L G  LK   S   +   +  I  R    G+  H
Sbjct  164   LSSIQHLLGDGLMELISVVKRAVHSSLGGVSLKQTLSLLDVEQQLSWI--RAEVEGASRH  221

Query  988   WLR-YLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK--  1158
              L  YL+ +D    +  A   ++N  +       +L+ ETR +L S +F  V+   L   
Sbjct  222   PLSWYLLSDDESALADQACGLTENDVMTI-----RLLNETRDMLDSPDFSAVLAACLNRA  276

Query  1159  --TVVDAMVEDIRVQCGE------------TNLMVGMPLAKLLP  1248
                ++D + E  R   G             +  +V +PLAK++P
Sbjct  277   FSRLLDNLAEFFRPPLGHLQSHSYLYLSLLSLSVVSLPLAKIVP  320



>ref|XP_009093585.1| PREDICTED: peroxisomal biogenesis factor 3, partial [Serinus 
canaria]
Length=361

 Score = 92.0 bits (227),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 102/346 (29%), Positives = 163/346 (47%), Gaps = 56/346 (16%)
 Frame = +1

Query  283   RRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFENIQ  462
             +RHKKK  V    LG  +LL K     +++I E+++   A+     + +A+ + HFE+ Q
Sbjct  2     KRHKKKCLVLGTFLGGVYLLGKY---GQKKIREIQEREAAEY----IAQARRQYHFESNQ  54

Query  463   IIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILSFT  642
                + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+SFT
Sbjct  55    RTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIISFT  105

Query  643   RMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLASAD  822
             R +++++S   L + +RVQ+NI+G ++Y+D A  LG +     A     + QQ +L+S  
Sbjct  106   RSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-ALGKNGTTPLAP---PEVQQQYLSSIQ  161

Query  823   YLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQIL--------DRFMSMGS  978
             +L   GLT LI+  + A  +V     LK   S   L   +  I         D+  S   
Sbjct  162   HLLGDGLTELITIVKQAVHKVFGSISLKQTLSLLELEQKLKDIREVVEHKDSDQIASYSP  221

Query  979   PHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVS  1152
               H   YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+   
Sbjct  222   LCH---YLMPDEENPLASQACGLTERDIATI-------KLLNETRDMLESPDFSTVLSTC  271

Query  1153  LK----TVVDAMVEDIRVQCGETNL----------MVGMPLAKLLP  1248
             L      ++D M E  R    E +L           V +PLAK++P
Sbjct  272   LNRGFSRLLDNMAEFFRPT--EKDLSQNSSVNSLSSVSLPLAKIIP  315



>ref|XP_005150108.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
3 [Melopsittacus undulatus]
Length=369

 Score = 92.0 bits (227),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 100/345 (29%), Positives = 159/345 (46%), Gaps = 50/345 (14%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK  V    LG  +LL K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCLVLGTFLGGVYLLGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   +  +L+   LT  L   K++P     A KLE+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLRDALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G ++Y+D A    +  +     +   + QQ +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA----ALCKNGTTLLAPPEVQQQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILD----RFMSMGSPH  984
               +L   GLT LI+  + A  +V     LK   S   L      I +    +     +P+
Sbjct  168   IQHLLGDGLTELITIVKQAVHKVFGSISLKHTLSLLELEQKFKDIRNIVEHKDSDPTAPY  227

Query  985   HWL-RYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSL  1155
               L  YLMP  E+P        +  D   +       +L+ ETR +L S +F  V+   L
Sbjct  228   SPLCHYLMPDEENPLATQACGLTERDVATI-------KLLNETRDMLESPDFSTVLSTCL  280

Query  1156  K----TVVDAMVEDIRVQCGETNL----------MVGMPLAKLLP  1248
                   ++D M E  R    E +L           V +PLAK++P
Sbjct  281   NRGFSRLLDNMAEFFRPT--EQDLSQSGSVNSLSSVSLPLAKIIP  323



>ref|XP_005552064.1| PREDICTED: uncharacterized LOC101865844 isoform X2 [Macaca fascicularis]
Length=319

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 154/320 (48%), Gaps = 42/320 (13%)
 Frame = +1

Query  262   KMIMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMK  441
             + +  F +RHKKK      VLG  ++L K     +++I E+++   A+     + +A+ +
Sbjct  3     RSVWNFLKRHKKKCIFLGTVLGGVYILGKY---GQKKIREIQEREAAEY----IAQARRQ  55

Query  442   EHFENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDR  621
              HFE+ Q   + T L  ++  L   + ++L+   LT  L   K++P     + KLE+W+ 
Sbjct  56    YHFESNQRTCNMTVLS-MLPTLREALMQQLNSESLTALL---KNRP-----SNKLEIWED  106

Query  622   LKILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDD-Q  798
             LKI+SFTR +++++S   L + +RVQ+NI+G ++Y+D A     +  +    I+   D Q
Sbjct  107   LKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNA-----AVGKNGTTILAPPDVQ  161

Query  799   QLFLASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMS  969
             Q +L+S  +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S
Sbjct  162   QQYLSSIQHLLGDGLTELITVIKQAVQKILGSVSLKHSLSLLDLEQKLKEIRNLVEQHKS  221

Query  970   M------GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSA  1125
                    GS      Y+MP  E P        S  D T +       +L+ ETR +L S 
Sbjct  222   SSWINKDGSKSLLCHYMMPDEETPLAVQACGLSPRDITTI-------KLLNETRDMLES-  273

Query  1126  EFGNVVDVSLKTVVDAMVED  1185
               G  +D+       A   D
Sbjct  274   -LGKFLDIGKSACSQANTLD  292



>ref|XP_006731037.1| PREDICTED: peroxisomal biogenesis factor 3-like isoform X2 [Leptonychotes 
weddellii]
Length=372

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 91/320 (28%), Positives = 150/320 (47%), Gaps = 42/320 (13%)
 Frame = +1

Query  277   FWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFEN  456
             F +RHKKK      VLG  ++L K      R I E E         + + +A+ + HFE+
Sbjct  8     FLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAA-------EYIAQARRQYHFES  60

Query  457   IQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILS  636
              Q   + T L  ++  L   + ++L+   LT  L   K++P     + K+E+W+ LKI+S
Sbjct  61    NQRTCNMTVL-SMLPTLREALMQQLNSESLTALL---KNRP-----SNKVEIWEDLKIIS  111

Query  637   FTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLAS  816
             FTR +++++S   L + +RVQ+NI+G + Y+D A    +  +     +   D Q  +L+S
Sbjct  112   FTRSIVAVYSTCMLVVLLRVQLNIIGGYTYLDNA----AVGKNGTTVLAPPDVQPQYLSS  167

Query  817   ADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQI---LDRFMSM-----  972
               +L   GLT LI+  + A  ++L    LK   S   L   + +I   +++  S      
Sbjct  168   IQHLLGDGLTELITVIKQAVQKILGSISLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINK  227

Query  973   -GSPHHWLRYLMP--EDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVV  1143
              GS      Y+MP  E P        S  D T +       +L+ ETR +L S +F  V+
Sbjct  228   DGSKSLLCHYMMPDEETPLAVQACGLSPRDVTTI-------KLLNETRDMLESPDFSTVL  280

Query  1144  DVSLK----TVVDAMVEDIR  1191
             +  L      ++D M E  R
Sbjct  281   NTCLNRGFSRLLDNMAEFFR  300



>ref|XP_010754546.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
3 [Larimichthys crocea]
Length=361

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 147/319 (46%), Gaps = 33/319 (10%)
 Frame = +1

Query  268   IMQFWRRHKKKVYVTLGVLGSGFLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEH  447
             +  F +RHK+K   T  V+G  + L K      R I E E         + + +A+ + H
Sbjct  5     VWNFIKRHKRKFIFTGAVVGGVYFLGKYAQKKIREIQEKEA-------TEYIAQARRQFH  57

Query  448   FENIQIIADSTTLPHVMQYLSSRISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLK  627
             FE+     + T L  ++  L   I  +L+   LT  L   K +P     A KLE+W+ LK
Sbjct  58    FESNLRTCNMTVL-SMLPPLKEAIVSQLNSESLTALL---KTKP-----ANKLEIWEDLK  108

Query  628   ILSFTRMVLSLWSMTTLNLYIRVQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLF  807
             I+SFTR ++ ++S   L + +RVQ+NI+G +LY+D      S  +   A +   D QQ +
Sbjct  109   IISFTRTIVGVYSTCMLVVLLRVQLNIIGGYLYLDN-----SVGKNTTAPLAPPDVQQQY  163

Query  808   LASADYLANYGLTTLISDFEAATSEVLKGKQLKDVFSTTILHDTVVQILDRF-MSMGSPH  984
             L+S  +L   GLT L++  +      L G  LK   S   L   +  I        G P 
Sbjct  164   LSSIQHLLGDGLTELMTVVKKVVQNSLGGMSLKQSLSLLELEQQLSWIRAEVEAGSGRPL  223

Query  985   HWLRYLMPEDPKIYSLAAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK--  1158
              W  Y++ +D    +  A   ++N  +       +L+ ETR +L S +F  V++  L   
Sbjct  224   SW--YMLADDQNALADQACGLTENDAVTI-----RLLNETRDMLDSPDFTTVLNACLNRG  276

Query  1159  --TVVDAMVEDIRVQCGET  1209
                ++D + E  R   G++
Sbjct  277   FSRLLDNLAEFFRPPPGDS  295



>ref|XP_010221750.1| PREDICTED: peroxisomal biogenesis factor 3 [Tinamus guttatus]
Length=371

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 154/324 (48%), Gaps = 43/324 (13%)
 Frame = +1

Query  334   FLLYKLYDGHRRRIFELEKELEADMKNDELIKAQMKEHFENIQIIADSTTLPHVMQYLSS  513
             F +Y L    +++I E+++   A+     + +A+ + HFE+ Q   + T L  ++  L  
Sbjct  26    FCVYLLGKYGQKKIREIQEREAAEY----IAQARRQYHFESNQRTCNMTVL-SMLPTLRD  80

Query  514   RISEELDLMQLTEKLMKGKDQPNTLTAAEKLELWDRLKILSFTRMVLSLWSMTTLNLYIR  693
              +  +L+   LT  L   K++P     A KLE+W+ LKI+SFTR +++++S   L + +R
Sbjct  81    ALMHQLNSESLTSLL---KNRP-----ANKLEIWEDLKIISFTRSIVAVYSTCMLVVLLR  132

Query  694   VQVNILGRHLYIDTARRLGSSYQEEEADIIYRDDQQLFLASADYLANYGLTTLISDFEAA  873
             VQ+NI+G ++Y+D A    +  + +   +   + QQ +L+S  +L   GLT LI+  + A
Sbjct  133   VQLNIIGGYIYLDNA----AVCKNDTTPLAPPEVQQQYLSSIQHLLGDGLTELITVVKQA  188

Query  874   TSEVLKGKQLKDVFSTTILHDTVVQI-----LDRFMSMGSPHHWLRYLMP--EDPKIYSL  1032
               +V     LK   S   L   +  I           + S +    YLMP  E+P     
Sbjct  189   VHKVFGSVSLKQTLSLLELEQKLKDIRKVVECKESDKITSYYPLCHYLMPDEENPLASQA  248

Query  1033  AAPSSSDNTDLCRASNFEQLMQETRAVLSSAEFGNVVDVSLK----TVVDAMVEDIR---  1191
                +  D   +       +L+ ETR +L S +F  V+   L      ++D + E  R   
Sbjct  249   CGLTERDTATI-------KLLNETRDMLESPDFVTVLSTCLNRGFSRLLDNVAEFFRPTE  301

Query  1192  ---VQCGETNLM--VGMPLAKLLP  1248
                 Q G  N +  V +PLAK++P
Sbjct  302   QDLCQNGSVNSLCSVSLPLAKIIP  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4614068855760