BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7750_g1_i1 len=2118 path=[2096:0-2117]

Length=2118
                                                                      Score     E

emb|CDP17231.1|  unnamed protein product                                764   0.0      
ref|XP_006344721.1|  PREDICTED: protein misato homolog 1-like iso...    737   0.0      
ref|XP_006344722.1|  PREDICTED: protein misato homolog 1-like iso...    732   0.0      
ref|XP_011092123.1|  PREDICTED: protein misato homolog 1 isoform X1     728   0.0      
ref|XP_009623983.1|  PREDICTED: protein misato homolog 1 isoform X1     723   0.0      
ref|XP_007047164.1|  Plasma membrane, autoregulation binding site...    718   0.0      
ref|XP_007047165.1|  Plasma membrane, autoregulation binding site...    712   0.0      
ref|XP_004230280.1|  PREDICTED: protein misato homolog 1 isoform X2     711   0.0      
ref|XP_010313331.1|  PREDICTED: protein misato homolog 1 isoform X1     710   0.0      
ref|XP_007047167.1|  Plasma membrane, autoregulation binding site...    707   0.0      
ref|XP_002263195.2|  PREDICTED: protein misato homolog 1 isoform X1     706   0.0      Vitis vinifera
ref|XP_009366789.1|  PREDICTED: protein misato homolog 1-like iso...    702   0.0      
ref|XP_008241539.1|  PREDICTED: protein misato homolog 1                700   0.0      
ref|XP_007204205.1|  hypothetical protein PRUPE_ppa003427mg             699   0.0      
ref|XP_008339777.1|  PREDICTED: protein misato homolog 1-like iso...    695   0.0      
ref|XP_009366702.1|  PREDICTED: protein misato homolog 1-like           694   0.0      
ref|XP_008338272.1|  PREDICTED: protein misato homolog 1-like iso...    693   0.0      
ref|XP_007047163.1|  Plasma membrane, autoregulation binding site...    696   0.0      
ref|XP_002300359.2|  hypothetical protein POPTR_0001s37290g             691   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009366791.1|  PREDICTED: protein misato homolog 1-like iso...    689   0.0      
ref|XP_011002490.1|  PREDICTED: protein misato homolog 1                686   0.0      
ref|XP_006425833.1|  hypothetical protein CICLE_v10025258mg             685   0.0      
ref|XP_002522327.1|  conserved hypothetical protein                     680   0.0      Ricinus communis
gb|KHG26277.1|  Protein misato                                          669   0.0      
ref|XP_004288066.1|  PREDICTED: protein misato homolog 1-like           669   0.0      
ref|XP_004511967.1|  PREDICTED: protein misato homolog 1-like iso...    664   0.0      
ref|XP_010109895.1|  hypothetical protein L484_013230                   669   0.0      
ref|XP_004511966.1|  PREDICTED: protein misato homolog 1-like iso...    659   0.0      
ref|XP_010680443.1|  PREDICTED: protein misato homolog 1                656   0.0      
ref|XP_003517285.1|  PREDICTED: protein misato homolog 1-like iso...    655   0.0      
ref|XP_007047166.1|  Plasma membrane, myosin-like, Tubulin/FtsZ, ...    652   0.0      
ref|XP_008440245.1|  PREDICTED: protein misato homolog 1 isoform X1     653   0.0      
ref|XP_010028287.1|  PREDICTED: protein misato homolog 1 isoform X1     652   0.0      
ref|XP_003537356.1|  PREDICTED: protein misato homolog 1-like           651   0.0      
ref|XP_010263736.1|  PREDICTED: protein misato homolog 1 isoform X2     651   0.0      
ref|XP_010263735.1|  PREDICTED: protein misato homolog 1 isoform X1     643   0.0      
ref|XP_004141925.1|  PREDICTED: protein misato homolog 1-like           640   0.0      
gb|KHN36205.1|  Protein misato like 1                                   639   0.0      
ref|XP_003611798.1|  Misato-like protein                                637   0.0      
ref|XP_007156832.1|  hypothetical protein PHAVU_002G021300g             637   0.0      
ref|XP_010531225.1|  PREDICTED: protein misato homolog 1 isoform X1     630   0.0      
ref|XP_008792583.1|  PREDICTED: protein misato homolog 1 isoform X1     620   0.0      
ref|XP_009381223.1|  PREDICTED: protein misato homolog 1                613   0.0      
gb|KFK30343.1|  hypothetical protein AALP_AA7G249200                    608   0.0      
ref|XP_007047168.1|  Plasma membrane, myosin-like, Tubulin/FtsZ, ...    600   0.0      
ref|XP_009623984.1|  PREDICTED: protein misato homolog 1 isoform X2     599   0.0      
gb|KDP31886.1|  hypothetical protein JCGZ_12347                         594   0.0      
ref|NP_195436.1|  uncharacterized protein                               594   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905634.1|  PREDICTED: protein misato homolog 1                594   0.0      
ref|XP_002866980.1|  hypothetical protein ARALYDRAFT_912663             593   0.0      
dbj|BAF01517.1|  tubulin-like protein                                   591   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432114.1|  PREDICTED: protein misato homolog 1-like           590   0.0      
ref|XP_006411946.1|  hypothetical protein EUTSA_v10024834mg             589   0.0      
ref|XP_010446724.1|  PREDICTED: protein misato homolog 1-like           589   0.0      
ref|XP_010531227.1|  PREDICTED: protein misato homolog 1 isoform X2     588   0.0      
ref|XP_006283453.1|  hypothetical protein CARUB_v10004498mg             588   0.0      
ref|XP_009366792.1|  PREDICTED: protein misato homolog 1-like iso...    580   0.0      
ref|XP_011092125.1|  PREDICTED: protein misato homolog 1 isoform X2     579   0.0      
emb|CDY42711.1|  BnaA03g53640D                                          580   0.0      
ref|XP_010437289.1|  PREDICTED: protein misato homolog 1-like           580   0.0      
ref|XP_008339786.1|  PREDICTED: protein misato homolog 1-like iso...    577   0.0      
ref|XP_009138460.1|  PREDICTED: protein misato homolog 1                578   0.0      
ref|XP_010652652.1|  PREDICTED: protein misato homolog 1 isoform X2     572   0.0      
ref|XP_008338273.1|  PREDICTED: protein misato homolog 1-like iso...    570   0.0      
ref|XP_008440247.1|  PREDICTED: protein misato homolog 1 isoform X2     570   0.0      
ref|XP_010028288.1|  PREDICTED: protein misato homolog 1 isoform X2     568   0.0      
gb|EPS62835.1|  hypothetical protein M569_11949                         569   0.0      
ref|XP_006573621.1|  PREDICTED: protein misato homolog 1-like iso...    568   0.0      
gb|KDO37718.1|  hypothetical protein CISIN_1g040160mg                   563   0.0      
ref|XP_008344323.1|  PREDICTED: protein misato homolog 1-like           565   0.0      
ref|NP_001049512.1|  Os03g0240900                                       564   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963027.1|  PREDICTED: protein misato homolog 1-like           560   0.0      
ref|NP_001141510.1|  uncharacterized protein LOC100273622               558   0.0      Zea mays [maize]
gb|EEC74843.1|  hypothetical protein OsI_10699                          556   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007156834.1|  hypothetical protein PHAVU_002G021300g             550   0.0      
gb|EAY83695.1|  hypothetical protein OsI_38918                          550   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMS56543.1|  Protein misato-like protein 1                           549   0.0      
ref|XP_006852952.1|  hypothetical protein AMTR_s00033p00240560          547   0.0      
gb|ABA99735.1|  expressed protein                                       546   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204204.1|  hypothetical protein PRUPE_ppa003427mg             540   0.0      
ref|XP_002442421.1|  hypothetical protein SORBIDRAFT_08g019730          545   0.0      Sorghum bicolor [broomcorn]
ref|XP_006664689.1|  PREDICTED: protein misato homolog 1-like           544   0.0      
gb|ACG28797.1|  hypothetical protein                                    535   5e-179   Zea mays [maize]
ref|XP_008792587.1|  PREDICTED: protein misato homolog 1 isoform X3     535   8e-179   
ref|XP_010263737.1|  PREDICTED: protein misato homolog 1 isoform X3     529   5e-178   
emb|CDX72616.1|  BnaC07g46380D                                          540   6e-177   
ref|XP_003578235.1|  PREDICTED: protein misato homolog 1                527   5e-176   
ref|NP_001031800.1|  uncharacterized protein                            525   8e-176   Arabidopsis thaliana [mouse-ear cress]
gb|EMT07279.1|  hypothetical protein F775_02253                         524   3e-174   
tpg|DAA47291.1|  TPA: hypothetical protein ZEAMMB73_753758              517   7e-172   
gb|KDO79315.1|  hypothetical protein CISIN_1g0109571mg                  508   3e-171   
gb|EAZ26222.1|  hypothetical protein OsJ_10090                          503   7e-167   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792586.1|  PREDICTED: protein misato homolog 1 isoform X2     505   7e-167   
gb|KHN42060.1|  Protein misato like 1                                   469   4e-155   
gb|KDO79314.1|  hypothetical protein CISIN_1g0109571mg                  461   4e-153   
dbj|BAC84426.1|  tubulin-related protein-like                           462   1e-151   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67107.1|  hypothetical protein OsJ_24116                          460   4e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009759816.1|  PREDICTED: protein misato homolog 1-like           399   2e-129   
ref|XP_008344324.1|  PREDICTED: protein misato homolog 1-like           396   4e-128   
gb|EEC77882.1|  hypothetical protein OsI_17172                          405   7e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_002963360.1|  hypothetical protein SELMODRAFT_79429              366   7e-114   
ref|XP_002974649.1|  hypothetical protein SELMODRAFT_101569             365   1e-113   
ref|XP_001758033.1|  predicted protein                                  364   5e-113   
ref|XP_009774711.1|  PREDICTED: uncharacterized protein LOC104224720    302   1e-93    
dbj|BAK06655.1|  predicted protein                                      280   4e-84    
gb|ACR35312.1|  unknown                                                 251   7e-73    Zea mays [maize]
ref|XP_005644159.1|  tubulin nucleotide-binding domain-like protein     188   2e-48    
emb|CEG67125.1|  hypothetical protein RMATCC62417_03593                 182   2e-46    
ref|XP_004693702.1|  PREDICTED: protein misato homolog 1-like           182   4e-46    
gb|ERZ97993.1|  hypothetical protein GLOINDRAFT_88712                   182   6e-46    
ref|XP_792803.3|  PREDICTED: protein misato homolog 1-like              181   1e-45    Strongylocentrotus purpuratus [purple urchin]
ref|XP_001624271.1|  predicted protein                                  181   2e-45    Nematostella vectensis
gb|EPB90735.1|  hypothetical protein HMPREF1544_02480                   178   8e-45    
ref|XP_005331418.1|  PREDICTED: protein misato homolog 1-like iso...    179   9e-45    
ref|XP_005541579.1|  PREDICTED: protein misato homolog 1-like iso...    178   1e-44    
ref|XP_005331419.1|  PREDICTED: protein misato homolog 1-like iso...    178   1e-44    
ref|XP_005331421.1|  PREDICTED: protein misato homolog 1-like iso...    178   1e-44    
ref|XP_001116160.1|  PREDICTED: protein misato homolog 1-like iso...    178   1e-44    Macaca mulatta [rhesus macaque]
gb|EHH50349.1|  hypothetical protein EGM_01163                          175   2e-44    
ref|XP_009431823.1|  PREDICTED: protein misato homolog 1 isoform X3     177   2e-44    
ref|XP_006923716.1|  PREDICTED: protein misato homolog 1                177   3e-44    
ref|XP_001116222.1|  PREDICTED: protein misato homolog 1-like iso...    177   3e-44    Macaca mulatta [rhesus macaque]
ref|XP_006219703.1|  PREDICTED: protein misato homolog 1-like iso...    176   5e-44    
ref|XP_006219702.1|  PREDICTED: protein misato homolog 1-like iso...    176   5e-44    
ref|XP_005541580.1|  PREDICTED: protein misato homolog 1-like iso...    176   5e-44    
gb|EKC42612.1|  misato-like protein 1                                   176   5e-44    
ref|XP_007979298.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    173   5e-44    
ref|XP_006219704.1|  PREDICTED: protein misato homolog 1-like iso...    176   5e-44    
gb|EXX51497.1|  Dml1p                                                   176   5e-44    
ref|XP_004089908.1|  PREDICTED: protein misato homolog 1 isoform 2      175   1e-43    
ref|XP_005541578.1|  PREDICTED: protein misato homolog 1-like iso...    175   1e-43    
ref|NP_001243462.1|  protein misato homolog 1 isoform c                 175   1e-43    
ref|XP_006174639.1|  PREDICTED: protein misato homolog 1-like iso...    175   1e-43    
ref|XP_006174640.1|  PREDICTED: protein misato homolog 1-like iso...    175   1e-43    
ref|XP_005541577.1|  PREDICTED: protein misato homolog 1-like iso...    175   1e-43    
ref|XP_010366410.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    175   1e-43    
ref|XP_003259482.1|  PREDICTED: protein misato homolog 1 isoform 1      175   2e-43    
gb|ELU05985.1|  hypothetical protein CAPTEDRAFT_160708                  174   2e-43    
ref|XP_006174641.1|  PREDICTED: protein misato homolog 1-like iso...    175   2e-43    
ref|XP_009431940.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    172   2e-43    
ref|XP_001161939.2|  PREDICTED: protein misato homolog 1 isoform X4     174   2e-43    Pan troglodytes
ref|XP_004026980.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    175   2e-43    
ref|XP_003415182.1|  PREDICTED: protein misato homolog 1 isoform X2     174   2e-43    
ref|XP_010998537.1|  PREDICTED: protein misato homolog 1 isoform X2     174   2e-43    
emb|CAI59784.1|  hypothetical protein                                   174   2e-43    Homo sapiens [man]
dbj|BAF83299.1|  unnamed protein product                                174   2e-43    Homo sapiens [man]
ref|NP_001243461.1|  protein misato homolog 1 isoform b                 174   2e-43    
ref|XP_008982827.1|  PREDICTED: protein misato homolog 1                174   3e-43    
ref|NP_060586.2|  protein misato homolog 1 isoform a                    174   3e-43    Homo sapiens [man]
ref|XP_009431818.1|  PREDICTED: protein misato homolog 1 isoform X2     174   3e-43    
ref|XP_010593120.1|  PREDICTED: protein misato homolog 1 isoform X4     174   3e-43    
ref|XP_513863.2|  PREDICTED: protein misato homolog 1 isoform X1        174   4e-43    Pan troglodytes
ref|XP_010593118.1|  PREDICTED: protein misato homolog 1 isoform X1     174   4e-43    
dbj|BAA91651.1|  unnamed protein product                                174   4e-43    Homo sapiens [man]
ref|XP_004315243.1|  PREDICTED: protein misato homolog 1-like iso...    173   5e-43    
ref|XP_004284639.1|  PREDICTED: protein misato homolog 1-like iso...    173   6e-43    
ref|XP_004315244.1|  PREDICTED: protein misato homolog 1-like iso...    173   6e-43    
ref|XP_004436236.1|  PREDICTED: protein misato homolog 1 isoform 2      173   6e-43    
ref|XP_004436235.1|  PREDICTED: protein misato homolog 1 isoform 1      173   7e-43    
ref|XP_010593119.1|  PREDICTED: protein misato homolog 1 isoform X3     173   7e-43    
ref|XP_004284640.1|  PREDICTED: protein misato homolog 1-like iso...    173   7e-43    
ref|NP_001153266.1|  protein misato homolog 1                           172   8e-43    Pongo abelii [orang utan]
gb|EDM00680.1|  misato homolog 1 (Drosophila) (predicted), isofor...    172   9e-43    
ref|XP_007171958.1|  PREDICTED: protein misato homolog 1                172   9e-43    
ref|NP_001099913.1|  protein misato homolog 1                           172   1e-42    Rattus norvegicus [brown rat]
ref|XP_005331420.1|  PREDICTED: protein misato homolog 1-like iso...    172   1e-42    
ref|XP_002928326.1|  PREDICTED: protein misato homolog 1-like           172   1e-42    
sp|Q4R681.2|MSTO1_MACFA  RecName: Full=Protein misato homolog 1         172   1e-42    Macaca fascicularis [crab eating macaque]
ref|XP_005898765.1|  PREDICTED: protein misato homolog 1-like iso...    172   1e-42    
ref|XP_005103386.1|  PREDICTED: protein misato homolog 1-like           172   2e-42    
ref|XP_004402995.1|  PREDICTED: protein misato homolog 1                172   2e-42    
ref|XP_007457985.1|  PREDICTED: protein misato homolog 1-like iso...    172   2e-42    
ref|XP_007457986.1|  PREDICTED: protein misato homolog 1-like iso...    172   2e-42    
ref|XP_006736806.1|  PREDICTED: protein misato homolog 1-like           172   2e-42    
ref|XP_005541562.1|  PREDICTED: protein misato homolog 1 isoform X3     171   2e-42    
ref|XP_007457987.1|  PREDICTED: protein misato homolog 1-like iso...    171   2e-42    
ref|NP_001039873.1|  protein misato homolog 1                           171   2e-42    Bos taurus [bovine]
ref|XP_008569063.1|  PREDICTED: protein misato homolog 1 isoform X1     171   2e-42    
ref|XP_006153501.1|  PREDICTED: protein misato homolog 1-like           172   2e-42    
ref|XP_005898764.1|  PREDICTED: protein misato homolog 1-like iso...    171   2e-42    
ref|XP_003795324.1|  PREDICTED: protein misato homolog 1                171   3e-42    
ref|XP_010836570.1|  PREDICTED: protein misato homolog 1 isoform X1     171   3e-42    
gb|ABQ12993.1|  misato                                                  171   3e-42    Bos taurus [bovine]
ref|XP_009181328.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    171   3e-42    
ref|XP_006895845.1|  PREDICTED: protein misato homolog 1-like           171   3e-42    
ref|XP_004002642.1|  PREDICTED: protein misato homolog 1 isoform 1      171   3e-42    
ref|XP_004002643.1|  PREDICTED: protein misato homolog 1 isoform 2      171   3e-42    
ref|XP_007110459.1|  PREDICTED: protein misato homolog 1-like           171   3e-42    
ref|XP_005080198.1|  PREDICTED: protein misato homolog 1                171   4e-42    
ref|XP_006861623.1|  PREDICTED: protein misato homolog 1 isoform X1     171   4e-42    
ref|XP_006861625.1|  PREDICTED: protein misato homolog 1 isoform X3     171   4e-42    
ref|XP_004448654.1|  PREDICTED: protein misato homolog 1-like iso...    171   4e-42    
ref|XP_006861624.1|  PREDICTED: protein misato homolog 1 isoform X2     171   4e-42    
ref|XP_004448653.1|  PREDICTED: protein misato homolog 1-like iso...    171   5e-42    
ref|XP_005541560.1|  PREDICTED: protein misato homolog 1 isoform X1     171   5e-42    
ref|XP_004714815.1|  PREDICTED: protein misato homolog 1                171   5e-42    
ref|XP_005541561.1|  PREDICTED: protein misato homolog 1 isoform X2     170   5e-42    
ref|XP_004448655.1|  PREDICTED: protein misato homolog 1-like iso...    170   6e-42    
ref|XP_005975168.1|  PREDICTED: protein misato homolog 1 isoform X1     170   6e-42    
ref|XP_005975169.1|  PREDICTED: protein misato homolog 1 isoform X2     170   7e-42    
ref|XP_009056694.1|  hypothetical protein LOTGIDRAFT_120630             169   7e-42    
ref|XP_010836571.1|  PREDICTED: protein misato homolog 1 isoform X2     170   7e-42    
ref|XP_005677432.1|  PREDICTED: protein misato homolog 1 isoform X2     169   9e-42    
ref|XP_006052085.1|  PREDICTED: protein misato homolog 1 isoform X2     169   9e-42    
ref|XP_005677431.1|  PREDICTED: protein misato homolog 1 isoform X1     169   9e-42    
ref|XP_006052084.1|  PREDICTED: protein misato homolog 1 isoform X1     169   1e-41    
ref|XP_003768168.1|  PREDICTED: protein misato homolog 1                169   1e-41    
ref|XP_008972841.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    169   1e-41    
emb|CAH93412.1|  hypothetical protein                                   169   1e-41    Pongo pygmaeus [orang utan]
dbj|BAE39645.1|  unnamed protein product                                167   1e-41    Mus musculus [mouse]
ref|XP_008852203.1|  PREDICTED: protein misato homolog 1 isoform X1     169   1e-41    
ref|XP_001374376.2|  PREDICTED: protein misato homolog 1-like           169   1e-41    Monodelphis domestica
ref|XP_004589070.1|  PREDICTED: protein misato homolog 1                169   2e-41    
gb|EDL15244.1|  misato homolog 1 (Drosophila), isoform CRA_a            168   2e-41    
ref|NP_659147.2|  protein misato homolog 1                              168   2e-41    Mus musculus [mouse]
gb|AAH08103.1|  Misato homolog 1 (Drosophila)                           168   2e-41    Mus musculus [mouse]
ref|XP_005367183.1|  PREDICTED: protein misato homolog 1-like iso...    168   2e-41    
sp|Q2YDW2.1|MSTO1_MOUSE  RecName: Full=Protein misato homolog 1         168   2e-41    Mus musculus [mouse]
ref|XP_005411667.1|  PREDICTED: protein misato homolog 1 isoform X1     168   3e-41    
dbj|BAE38651.1|  unnamed protein product                                167   4e-41    Mus musculus [mouse]
ref|XP_007946803.1|  PREDICTED: protein misato homolog 1                167   4e-41    
ref|XP_008695223.1|  PREDICTED: protein misato homolog 1                167   5e-41    
ref|XP_005610090.1|  PREDICTED: protein misato homolog 1 isoform X4     167   5e-41    
ref|XP_001494865.1|  PREDICTED: protein misato homolog 1 isoform X1     167   5e-41    Equus caballus [domestic horse]
ref|XP_005610089.1|  PREDICTED: protein misato homolog 1 isoform X3     167   5e-41    
ref|XP_008515003.1|  PREDICTED: protein misato homolog 1 isoform X2     167   6e-41    
ref|XP_008515005.1|  PREDICTED: protein misato homolog 1 isoform X4     167   6e-41    
ref|XP_008515006.1|  PREDICTED: protein misato homolog 1 isoform X5     167   8e-41    
ref|XP_006001695.1|  PREDICTED: protein misato homolog 1                166   1e-40    
ref|XP_005367184.1|  PREDICTED: protein misato homolog 1-like iso...    166   1e-40    
gb|EPY88673.1|  protein misato 1-like protein                           166   1e-40    
ref|XP_005367182.1|  PREDICTED: protein misato homolog 1-like iso...    166   1e-40    
ref|NP_001231563.1|  uncharacterized protein LOC100525162               166   2e-40    
ref|XP_005610088.1|  PREDICTED: protein misato homolog 1 isoform X2     166   2e-40    
ref|XP_005663349.1|  PREDICTED: uncharacterized protein LOC100525...    166   2e-40    
ref|XP_008515002.1|  PREDICTED: protein misato homolog 1 isoform X1     166   2e-40    
ref|XP_005411670.1|  PREDICTED: protein misato homolog 1 isoform X4     166   2e-40    
ref|XP_005663350.1|  PREDICTED: uncharacterized protein LOC100525...    165   2e-40    
ref|XP_008170172.1|  PREDICTED: protein misato homolog 1 isoform X3     165   3e-40    
ref|XP_008071434.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    159   4e-40    
gb|ERE92242.1|  putative protein misato isoform 1                       164   4e-40    
ref|XP_003501626.2|  PREDICTED: protein misato homolog 1                164   4e-40    
ref|XP_008153905.1|  PREDICTED: protein misato homolog 1 isoform X1     164   4e-40    
ref|XP_005622772.1|  PREDICTED: protein misato homolog 1 isoform X1     164   5e-40    
ref|XP_008153906.1|  PREDICTED: protein misato homolog 1 isoform X2     164   5e-40    
ref|XP_547545.3|  PREDICTED: protein misato homolog 1 isoform X2        164   5e-40    Canis lupus familiaris [dogs]
ref|XP_010346720.1|  PREDICTED: protein misato homolog 1 isoform X2     164   5e-40    
ref|XP_003937860.1|  PREDICTED: protein misato homolog 1 isoform X1     164   6e-40    
ref|XP_005411668.1|  PREDICTED: protein misato homolog 1 isoform X2     164   7e-40    
ref|XP_003475428.1|  PREDICTED: protein misato homolog 1 isoform X1     164   7e-40    
ref|XP_005006219.1|  PREDICTED: protein misato homolog 1 isoform X4     163   1e-39    
ref|XP_005411669.1|  PREDICTED: protein misato homolog 1 isoform X3     163   1e-39    
ref|XP_006711477.1|  PREDICTED: protein misato homolog 1 isoform X3     163   1e-39    
ref|XP_007883642.1|  PREDICTED: protein misato homolog 1-like           161   2e-39    
gb|EPQ08590.1|  Protein misato like protein 1                           163   2e-39    
ref|XP_006097892.1|  PREDICTED: protein misato homolog 1-like iso...    163   2e-39    
ref|XP_005867610.1|  PREDICTED: protein misato homolog 1 isoform X3     163   2e-39    
gb|EAW53038.1|  misato homolog 1 (Drosophila), isoform CRA_a            157   2e-39    Homo sapiens [man]
ref|XP_006097891.1|  PREDICTED: protein misato homolog 1-like iso...    162   2e-39    
ref|XP_005867609.1|  PREDICTED: protein misato homolog 1 isoform X2     162   2e-39    
ref|XP_004619351.1|  PREDICTED: protein misato homolog 1 isoform X2     162   2e-39    
ref|XP_006097890.1|  PREDICTED: protein misato homolog 1-like iso...    162   3e-39    
ref|XP_005867608.1|  PREDICTED: protein misato homolog 1 isoform X1     162   3e-39    
gb|EZA51335.1|  Protein misato                                          162   3e-39    
ref|XP_006775766.1|  PREDICTED: protein misato homolog 1 isoform X2     162   3e-39    
ref|XP_004619350.1|  PREDICTED: protein misato homolog 1 isoform X1     162   3e-39    
ref|XP_005006217.1|  PREDICTED: protein misato homolog 1 isoform X2     162   4e-39    
ref|XP_006775765.1|  PREDICTED: protein misato homolog 1 isoform X1     162   4e-39    
ref|NP_956181.1|  protein misato homolog 1                              162   5e-39    Danio rerio [leopard danio]
sp|Q1L908.1|MSTO1_DANRE  RecName: Full=Protein misato homolog 1         162   5e-39    Danio rerio [leopard danio]
ref|XP_010642139.1|  PREDICTED: protein misato homolog 1 isoform X7     160   5e-39    
gb|AFK11355.1|  protein misato-like protein 1-like protein              161   6e-39    
gb|AAF81794.1|AF272833_1  misato                                        161   6e-39    Homo sapiens [man]
ref|XP_004879237.1|  PREDICTED: protein misato homolog 1 isoform X2     161   7e-39    
ref|XP_004879238.1|  PREDICTED: protein misato homolog 1 isoform X3     161   8e-39    
ref|XP_004629812.1|  PREDICTED: protein misato homolog 1                160   8e-39    
ref|XP_004879240.1|  PREDICTED: protein misato homolog 1 isoform X5     160   8e-39    
ref|XP_007068149.1|  PREDICTED: protein misato homolog 1                160   1e-38    
ref|XP_005006218.1|  PREDICTED: protein misato homolog 1 isoform X3     160   1e-38    
ref|XP_006711479.1|  PREDICTED: protein misato homolog 1 isoform X5     160   2e-38    
ref|XP_008551762.1|  PREDICTED: protein misato                          159   2e-38    
ref|XP_007538813.1|  PREDICTED: protein misato homolog 1 isoform X1     160   2e-38    
ref|XP_007538814.1|  PREDICTED: protein misato homolog 1 isoform X2     160   2e-38    
ref|XP_008170171.1|  PREDICTED: protein misato homolog 1 isoform X2     160   2e-38    
ref|XP_005280798.1|  PREDICTED: protein misato homolog 1 isoform X1     160   2e-38    
ref|XP_007538816.1|  PREDICTED: protein misato homolog 1 isoform X3     159   2e-38    
ref|XP_010642140.1|  PREDICTED: protein misato homolog 1 isoform X8     160   2e-38    
ref|XP_004074181.1|  PREDICTED: protein misato homolog 1-like           160   2e-38    
ref|XP_008262560.1|  PREDICTED: protein misato homolog 1 isoform X2     159   2e-38    
ref|XP_004879241.1|  PREDICTED: protein misato homolog 1 isoform X6     159   2e-38    
ref|XP_010642133.1|  PREDICTED: protein misato homolog 1 isoform X1     159   2e-38    
ref|XP_008262559.1|  PREDICTED: protein misato homolog 1 isoform X1     159   2e-38    
ref|XP_006711476.1|  PREDICTED: protein misato homolog 1 isoform X2     159   3e-38    
ref|XP_006711475.1|  PREDICTED: protein misato homolog 1 isoform X1     159   3e-38    
ref|XP_004879239.1|  PREDICTED: protein misato homolog 1 isoform X4     159   3e-38    
ref|XP_006711482.1|  PREDICTED: protein misato homolog 1 isoform X8     159   3e-38    
ref|XP_006711481.1|  PREDICTED: protein misato homolog 1 isoform X7     159   3e-38    
ref|XP_011052971.1|  PREDICTED: protein misato                          159   3e-38    
ref|XP_006711480.1|  PREDICTED: protein misato homolog 1 isoform X6     159   4e-38    
ref|XP_006976425.1|  PREDICTED: protein misato homolog 1                158   5e-38    
ref|XP_006711478.1|  PREDICTED: protein misato homolog 1 isoform X4     159   5e-38    
gb|EFN64238.1|  Protein misato                                          158   5e-38    
ref|XP_010642136.1|  PREDICTED: protein misato homolog 1 isoform X4     157   8e-38    
ref|XP_003707902.1|  PREDICTED: protein misato-like                     156   2e-37    
ref|XP_004879236.1|  PREDICTED: protein misato homolog 1 isoform X1     156   3e-37    
ref|XP_005658413.1|  PREDICTED: protein misato homolog 1-like iso...    155   4e-37    
ref|XP_003125759.2|  PREDICTED: protein misato homolog 1-like iso...    156   4e-37    
ref|XP_005658412.1|  PREDICTED: protein misato homolog 1-like iso...    156   4e-37    
ref|XP_010642137.1|  PREDICTED: protein misato homolog 1 isoform X5     153   1e-36    
ref|XP_006671006.1|  mtDNA inheritance protein Dml1, putative           152   2e-36    
ref|XP_004667316.1|  PREDICTED: protein misato homolog 1                153   3e-36    
gb|KEY64316.1|  hypothetical protein S7711_06360                        152   5e-36    
gb|KFA52882.1|  hypothetical protein S40293_00992                       151   6e-36    
emb|CDS11095.1|  hypothetical protein LRAMOSA03359                      152   6e-36    
ref|XP_008601661.1|  misato Segment II myosin-like domain-contain...    151   7e-36    
gb|KGQ08080.1|  Protein DML1                                            149   4e-35    
gb|KDR19639.1|  Misato-like protein 1                                   150   4e-35    
gb|KFA65378.1|  hypothetical protein S40285_00415                       148   8e-35    
ref|XP_005943641.1|  PREDICTED: protein misato homolog 1-like iso...    149   9e-35    
ref|XP_003735188.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    149   1e-34    
ref|XP_005739792.1|  PREDICTED: protein misato homolog 1-like iso...    149   1e-34    
gb|KFH64971.1|  hypothetical protein MVEG_09699                         148   1e-34    
ref|XP_003393125.1|  PREDICTED: protein misato-like                     147   2e-34    
emb|CAF94151.1|  unnamed protein product                                148   2e-34    
ref|XP_004569340.1|  PREDICTED: protein misato homolog 1-like           147   3e-34    
gb|ENN78262.1|  hypothetical protein YQE_05413                          147   3e-34    
ref|XP_003694930.1|  PREDICTED: protein misato-like                     147   4e-34    
ref|XP_006794449.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    147   5e-34    
ref|XP_005943642.1|  PREDICTED: protein misato homolog 1-like iso...    147   5e-34    
emb|CDH58589.1|  protein dml1                                           147   5e-34    
ref|XP_005739791.1|  PREDICTED: protein misato homolog 1-like iso...    147   7e-34    
gb|AEE62350.1|  unknown                                                 146   7e-34    
ref|XP_005739793.1|  PREDICTED: protein misato homolog 1-like iso...    147   7e-34    
ref|XP_003492152.1|  PREDICTED: protein misato-like                     145   8e-34    
ref|XP_006969702.1|  Hypothetical protein TRIREDRAFT_124181             145   8e-34    
gb|AGM32520.1|  protein misato-like protein                             141   1e-33    
ref|XP_007832028.1|  Protein dml-1                                      145   1e-33    
ref|XP_008852212.1|  PREDICTED: protein misato homolog 1 isoform X2     145   1e-33    
ref|XP_001945861.2|  PREDICTED: protein misato-like isoform X1          145   2e-33    
ref|XP_005452848.1|  PREDICTED: protein misato homolog 1-like iso...    145   2e-33    
ref|XP_005452849.1|  PREDICTED: protein misato homolog 1-like iso...    145   2e-33    
dbj|BAE37273.1|  unnamed protein product                                144   3e-33    
ref|XP_007541840.1|  PREDICTED: protein misato homolog 1                145   3e-33    
ref|XP_008119256.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    144   3e-33    
emb|CDQ57336.1|  unnamed protein product                                145   7e-33    
ref|XP_007398764.1|  hypothetical protein PHACADRAFT_211670             143   7e-33    
ref|XP_972672.1|  PREDICTED: protein misato                             142   9e-33    
gb|ERL92694.1|  hypothetical protein D910_10005                         144   1e-32    
gb|AAI61200.1|  msto1 protein                                           142   2e-32    
ref|XP_006616992.1|  PREDICTED: protein misato-like                     141   3e-32    
ref|XP_006711483.1|  PREDICTED: protein misato homolog 1 isoform X9     141   3e-32    
ref|XP_004778704.1|  PREDICTED: protein misato homolog 1                140   5e-32    
ref|XP_008421217.1|  PREDICTED: protein misato homolog 1                141   6e-32    
ref|XP_006571338.1|  PREDICTED: protein misato-like isoform X1          140   6e-32    
gb|EMD35050.1|  hypothetical protein CERSUDRAFT_107070                  140   7e-32    
ref|XP_312145.4|  AGAP002778-PA                                         140   8e-32    
ref|XP_004519976.1|  PREDICTED: protein misato-like                     140   8e-32    
dbj|BAG57308.1|  unnamed protein product                                136   8e-32    
ref|XP_009225649.1|  hypothetical protein GGTG_09534                    139   1e-31    
gb|KFB44643.1|  AGAP002778-PA-like protein                              140   1e-31    
ref|XP_005846344.1|  hypothetical protein CHLNCDRAFT_135767             141   2e-31    
ref|XP_007790830.1|  putative misato segment ii myosin-like domai...    139   2e-31    
ref|XP_009260695.1|  hypothetical protein FPSE_09303                    137   3e-31    
ref|XP_005663063.1|  PREDICTED: protein misato homolog 1-like           139   3e-31    
gb|EHH15323.1|  hypothetical protein EGK_01395                          137   7e-31    
ref|XP_007865661.1|  tubulin nucleotide-binding domain-like protein     135   3e-30    
gb|KFZ18850.1|  hypothetical protein V502_03925                         134   4e-30    
gb|KFY61945.1|  hypothetical protein V497_02683                         134   4e-30    
ref|XP_001862732.1|  misato                                             135   5e-30    
ref|XP_006132123.1|  PREDICTED: protein misato homolog 1                134   6e-30    
ref|XP_006943189.1|  PREDICTED: protein misato homolog 1                134   6e-30    
gb|ELR05142.1|  hypothetical protein GMDG_07184                         132   7e-30    
ref|XP_005814698.1|  PREDICTED: LOW QUALITY PROTEIN: protein misa...    135   8e-30    
gb|KDQ54693.1|  hypothetical protein JAAARDRAFT_182189                  133   1e-29    
ref|XP_003717337.1|  hypothetical protein MGG_06256                     133   2e-29    
gb|ACO10413.1|  misato homolog 1                                        132   2e-29    
gb|ELQ34703.1|  hypothetical protein OOU_Y34scaffold00748g22            133   2e-29    
ref|XP_010642134.1|  PREDICTED: protein misato homolog 1 isoform X2     133   2e-29    
ref|XP_003969278.1|  PREDICTED: protein misato homolog 1-like           133   2e-29    
ref|XP_009553299.1|  hypothetical protein HETIRDRAFT_237753             132   3e-29    
ref|XP_002101991.1|  GE17927                                            132   3e-29    
ref|XP_001978694.1|  GG19729                                            132   4e-29    
ref|XP_006678503.1|  hypothetical protein BATDEDRAFT_24635              131   5e-29    
ref|XP_002107553.1|  GD17537                                            132   5e-29    
ref|XP_002127435.1|  PREDICTED: protein misato homolog 1                132   6e-29    
gb|ERS99673.1|  hypothetical protein HMPREF1624_03036                   131   8e-29    
ref|XP_007721416.1|  hypothetical protein A1O1_02315                    129   1e-28    
ref|XP_009851272.1|  hypothetical protein NEUTE1DRAFT_122493            130   1e-28    
gb|KEF59284.1|  hypothetical protein A1O9_04128                         130   1e-28    
ref|XP_002428242.1|  conserved hypothetical protein                     130   2e-28    
gb|EHJ72152.1|  hypothetical protein KGM_21936                          130   2e-28    
ref|XP_008284016.1|  PREDICTED: protein misato homolog 1                130   2e-28    
ref|XP_002479153.1|  mtDNA inheritance protein Dml1, putative           129   2e-28    
emb|CCE32285.1|  related to beta tubulins                               129   2e-28    
gb|EWG46834.1|  protein DML1                                            129   3e-28    
ref|XP_959009.2|  hypothetical protein NCU11398                         129   3e-28    
gb|KFY74054.1|  hypothetical protein V499_05905                         129   4e-28    
ref|XP_001653622.1|  hypothetical protein AaeL_AAEL008947               129   5e-28    
emb|CCU81813.1|  tubulin-like protein                                   129   6e-28    
ref|XP_008076025.1|  Tubulin nucleotide-binding protein                 128   7e-28    
gb|EWY86586.1|  protein DML1                                            127   7e-28    
gb|EXK37750.1|  protein DML1                                            127   7e-28    
dbj|GAM35469.1|  hypothetical protein TCE0_017r03829                    127   8e-28    
gb|KDO79312.1|  hypothetical protein CISIN_1g0109572mg                  118   1e-27    
gb|KFZ18540.1|  hypothetical protein V501_01166                         127   1e-27    
ref|XP_003079486.1|  tubulin-like protein (ISS)                         127   1e-27    
gb|KFY34757.1|  hypothetical protein V494_06511                         127   1e-27    
ref|XP_007777563.1|  hypothetical protein W97_01467                     127   1e-27    
gb|EWZ94802.1|  protein DML1                                            127   1e-27    
gb|EWZ35107.1|  protein DML1                                            126   2e-27    
ref|XP_007296714.1|  misato                                             127   2e-27    
gb|EFQ33261.1|  misato Segment II myosin-like domain-containing p...    127   2e-27    
ref|XP_007729054.1|  hypothetical protein A1O3_00714                    126   2e-27    
ref|XP_009154752.1|  hypothetical protein HMPREF1120_02461              126   2e-27    
gb|EFN83530.1|  Protein misato                                          127   2e-27    
ref|XP_001964060.1|  GF20926                                            127   2e-27    
gb|EHK21018.1|  hypothetical protein TRIVIDRAFT_180778                  126   2e-27    
gb|KFY17912.1|  hypothetical protein V492_00292                         126   2e-27    
gb|EMT70353.1|  Protein DML1                                            126   2e-27    
gb|EPS95486.1|  hypothetical protein FOMPIDRAFT_1132351                 126   3e-27    
gb|EXA39066.1|  protein DML1                                            125   3e-27    
emb|CCT71415.1|  related to beta tubulins                               125   3e-27    
gb|EXK94776.1|  protein DML1                                            125   4e-27    
gb|EGU73418.1|  hypothetical protein FOXB_16056                         125   4e-27    
gb|EXM30853.1|  protein DML1                                            125   4e-27    
gb|KIE00394.1|  Tubulin FtsZ                                            125   4e-27    
gb|ENH73057.1|  Protein DML1                                            125   4e-27    
gb|ETN65176.1|  misato                                                  126   5e-27    
gb|KEZ42951.1|  putative MtDNA inheritance protein Dml1                 125   5e-27    
ref|XP_007819813.1|  Tubulin FtsZ                                       124   6e-27    
ref|XP_007514210.1|  predicted protein                                  126   7e-27    
ref|XP_001268748.1|  conserved hypothetical protein                     124   7e-27    
gb|KFX48596.1|  Protein dml1                                            124   9e-27    
gb|EHK51048.1|  hypothetical protein TRIATDRAFT_210484                  124   9e-27    
ref|XP_001886252.1|  mtDNA inheritance protein Dml1                     124   1e-26    
ref|XP_007757551.1|  hypothetical protein A1O7_05351                    124   1e-26    
ref|XP_005182715.1|  PREDICTED: protein misato-like isoform X1          125   1e-26    
gb|EFZ01028.2|  Tubulin/FtsZ, GTPase domain protein                     124   1e-26    
gb|KID89130.1|  Tubulin FtsZ                                            124   1e-26    
ref|XP_004931970.1|  PREDICTED: protein misato-like isoform X1          124   1e-26    
gb|EGN92592.1|  hypothetical protein SERLA73DRAFT_79412                 124   2e-26    
ref|XP_004343554.1|  hypothetical protein CAOG_07680                    124   2e-26    
sp|Q0V254.2|DML1_PHANO  RecName: Full=Protein DML1                      124   2e-26    
ref|XP_007774968.1|  tubulin nucleotide-binding domain-like protein     123   2e-26    
ref|XP_001606064.1|  PREDICTED: protein misato                          123   2e-26    
ref|XP_009657619.1|  dml-1                                              123   2e-26    
ref|XP_007603293.1|  misato Segment II myosin-like domain-contain...    123   3e-26    
gb|EPS25482.1|  hypothetical protein PDE_00415                          122   3e-26    
gb|EQB50326.1|  misato Segment II myosin-like domain-containing p...    123   3e-26    
gb|EFX05416.1|  mtDNA inheritance protein                               123   3e-26    
emb|CEJ81349.1|  hypothetical protein VHEMI01482                        122   3e-26    
ref|NP_523435.1|  misato, isoform A                                     123   4e-26    
ref|XP_002146858.1|  mtDNA inheritance protein Dml1, putative           122   4e-26    
ref|XP_007314974.1|  hypothetical protein SERLADRAFT_434675             122   4e-26    
gb|EDP56743.1|  conserved hypothetical protein                          122   4e-26    
emb|CEJ81350.1|  hypothetical protein VHEMI01482                        122   5e-26    
ref|XP_752876.1|  mtDNA inheritance protein Dml1                        122   5e-26    
ref|XP_002070876.1|  GK25434                                            123   5e-26    
gb|ELK02774.1|  Protein misato like protein 1                           121   8e-26    
ref|XP_002796235.1|  conserved hypothetical protein                     121   9e-26    
ref|XP_010755971.1|  hypothetical protein PADG_00770                    121   1e-25    
emb|CCF47225.1|  misato Segment II myosin-like domain-containing ...    121   1e-25    
ref|XP_001355296.1|  GA12852                                            122   1e-25    
emb|CCX08018.1|  Similar to Protein dml1; acc. no. A2QAY5               121   1e-25    
gb|EMD94946.1|  hypothetical protein COCHEDRAFT_1128954                 121   1e-25    
gb|KEQ81564.1|  tubulin nucleotide-binding domain-like protein          121   1e-25    
ref|XP_003655489.1|  hypothetical protein THITE_43951                   121   1e-25    
ref|XP_003048833.1|  predicted protein                                  120   1e-25    
gb|KFG83335.1|  Tubulin FtsZ                                            120   2e-25    
gb|EEH20108.2|  hypothetical protein PABG_02367                         120   2e-25    
gb|KID73077.1|  Tubulin FtsZ                                            120   2e-25    
ref|XP_001389724.2|  protein dml1                                       120   2e-25    
gb|ACO14966.1|  misato homolog 1                                        120   2e-25    
gb|EHA27056.1|  hypothetical protein ASPNIDRAFT_46311                   120   2e-25    
sp|A2QAY5.1|DML1_ASPNC  RecName: Full=Protein dml1                      120   2e-25    
gb|KHJ32198.1|  putative protein dml1 protein                           120   3e-25    
ref|XP_007367067.1|  tubulin nucleotide-binding domain-like protein     120   3e-25    
gb|KID69779.1|  Tubulin FtsZ                                            119   3e-25    
gb|EXX79907.1|  Dml1p                                                   115   4e-25    
ref|XP_002058305.1|  GJ16019                                            120   5e-25    
ref|XP_001264251.1|  hypothetical protein NFIA_010350                   119   5e-25    
ref|XP_002626914.1|  protein DML1                                       119   5e-25    
gb|KEY79856.1|  hypothetical protein BA78_2948                          119   5e-25    
gb|EGE79948.1|  DML1                                                    119   5e-25    
gb|EEQ84125.1|  protein DML1                                            119   6e-25    
ref|XP_008714272.1|  hypothetical protein HMPREF1541_01693              119   6e-25    
emb|CDX69258.1|  BnaC01g01950D                                          112   6e-25    
ref|XP_001116195.2|  PREDICTED: protein misato homolog 1-like iso...    119   6e-25    
ref|XP_007283582.1|  protein dml1                                       119   8e-25    
ref|XP_002835541.1|  hypothetical protein                               118   1e-24    
ref|XP_007812820.1|  Tubulin FtsZ                                       117   2e-24    
ref|XP_008723734.1|  hypothetical protein G647_09518                    117   2e-24    
gb|KEQ67524.1|  tubulin nucleotide-binding domain-like protein          117   2e-24    
emb|CCG81272.1|  Protein dml-1                                          116   2e-24    
gb|KIH91930.1|  mtDNA inheritance protein                               117   3e-24    
ref|XP_009017239.1|  hypothetical protein HELRODRAFT_172326             117   3e-24    
dbj|GAM28431.1|  hypothetical protein SAMD00019534_116070               117   3e-24    
ref|XP_007751591.1|  hypothetical protein A1O5_12832                    116   4e-24    
ref|XP_008060700.1|  PREDICTED: protein misato homolog 1-like           112   4e-24    
emb|CDW58769.1|  Tubulin 3 and Misat Tub SegII domain containing ...    116   4e-24    



>emb|CDP17231.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/566 (70%), Positives = 477/566 (84%), Gaps = 5/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDE---VFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG Y+NFIGSHFWNFQDEL GLAE+ E    FKNH LN DVLYR+GETQQG+
Sbjct  1     MREIVTIQVGGYANFIGSHFWNFQDELLGLAETSETNPAFKNHGLNMDVLYRTGETQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSV FQGSLGSMSS G LY+E PS+  DV++W+GKVTTQAS PLK+NLFLQSL
Sbjct  61    LTYTPRLVSVDFQGSLGSMSSRGTLYNEAPSRPMDVVSWSGKVTTQASAPLKKNLFLQSL  120

Query  1628  YMEEK-NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             Y EE+  M+ V+G D  +++S NEIQDKDIVECLENGVQYWTDFSKV +HPQSLY+L+GL
Sbjct  121   YQEEQEKMDTVNGFDSGKNESQNEIQDKDIVECLENGVQYWTDFSKVHYHPQSLYELNGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD + F NYGIGRD F   + GEE+N+RLRFFIEECDHIQG+QF+VDDSGGFSG+AAEF
Sbjct  181   WMDGEGFDNYGIGRDAFVGARHGEEINDRLRFFIEECDHIQGIQFVVDDSGGFSGVAAEF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIADDY+N+PVLLY+ R+P     TKSQK +IS SLH+A+SFSRL++F KLIVP+GL 
Sbjct  241   LENIADDYTNIPVLLYSARNPRLHMTTKSQKQSISSSLHDAISFSRLSTFCKLIVPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS SKASR LC+ DE+PY++SAVYAS +HS+SLPFRME  GPT +   ASGAL+M E+I
Sbjct  301   SLSKSKASRYLCMDDEKPYHSSAVYASGMHSISLPFRMEPIGPTTDLTCASGALDMNEII  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
             H+LA QARQNMV+ LDV+MPAPSL GNQ++ SLL+N   LTPE+ ++ ED+ A+E M++H
Sbjct  361   HMLAGQARQNMVTILDVAMPAPSLIGNQLEQSLLENLEPLTPEIAENFEDLQAVEAMSVH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             GVLG+G   A V EVK  VQ+AYEKA+ RP+FS LSVS CPLPIPLPFP+IFGN +GQHG
Sbjct  421   GVLGTGLHEATVSEVKSAVQNAYEKALQRPRFSQLSVSRCPLPIPLPFPSIFGNLVGQHG  480

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             ELL TPI  +PSRG L+VHSIPMA+RLRSS+AILPFLESRL NL++ GIQRGA+GA++L 
Sbjct  481   ELLGTPILGSPSRGSLDVHSIPMAARLRSSSAILPFLESRLHNLQRFGIQRGALGAELLR  540

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             SWGFG++E+ D GE LS +V TL PY
Sbjct  541   SWGFGKEELVDAGEALSNMVRTLSPY  566



>ref|XP_006344721.1| PREDICTED: protein misato homolog 1-like isoform X1 [Solanum 
tuberosum]
Length=573

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/566 (65%), Positives = 465/566 (82%), Gaps = 5/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQ+G+Y+NFIGSHFWNFQDEL GLAES   D+VFKNHSL+ DVLYR+GETQQGL
Sbjct  1     MREIVTIQIGNYANFIGSHFWNFQDELLGLAESPESDQVFKNHSLDMDVLYRTGETQQGL  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPR+VSV FQGSLGS+SS G+LY++  +++ DV+TW G+VTT ASEPL+RNLFLQSL
Sbjct  61    LTYTPRMVSVNFQGSLGSVSSRGSLYNQIQAKNMDVMTWKGRVTTHASEPLRRNLFLQSL  120

Query  1628  YMEEKNM-NMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
               EE+ +    +  D   ++S  EIQDKDIVECLE+ VQYWTDFSKV +HPQSLY+LSGL
Sbjct  121   SEEEQEIVGKANDLDNVNNNSPAEIQDKDIVECLESDVQYWTDFSKVHYHPQSLYELSGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D QEF NYG+G++ F  HQ GEE+++RLRFF+EECDHIQG+Q +VDD+GGFSG++A F
Sbjct  181   WADIQEFDNYGLGKEAFCGHQHGEEIDDRLRFFVEECDHIQGIQCVVDDAGGFSGVSAMF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++IAD+Y NVPVLLY  R+P    +++ +K  IS  LH+AVSFSRL+   KLI+P+GL 
Sbjct  241   LESIADEYPNVPVLLYNARNPSLHMDSEGRKQAISHYLHDAVSFSRLSELCKLIIPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS S+AS+ LCIKDE+PY++SAVYASA+HS +LPFRM+  GP+AES++ SGAL+MY  +
Sbjct  301   SLSGSRASQFLCIKDEKPYHSSAVYASAMHSFTLPFRMKQSGPSAESLFTSGALDMYGTV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA Q RQNMV+ LDV+MPAPSL+ ++ Q S L N   L P++ +D ED HA+E M IH
Sbjct  361   QMLAGQMRQNMVTILDVAMPAPSLSADRAQHSFLGNLQPLIPDISEDVEDFHAVETMNIH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G + SG++RA + EVK  V+ AY+ +++RPKFSHLS S CPLPIPLPFP IFGN +GQHG
Sbjct  421   GAVTSGNQRASINEVKDAVESAYDNSVTRPKFSHLSASTCPLPIPLPFPLIFGNMVGQHG  480

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             ELLETPI+ + SRG LEVHSIPMA+RLRSSTA+LP LE +L NLR+ GI+RGA+GA +L+
Sbjct  481   ELLETPISGSSSRGSLEVHSIPMATRLRSSTAVLPLLERKLGNLRRFGIERGALGAPLLQ  540

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             SWGFG+DEVED+GE LSK+V TLKPY
Sbjct  541   SWGFGKDEVEDMGEVLSKMVTTLKPY  566



>ref|XP_006344722.1| PREDICTED: protein misato homolog 1-like isoform X2 [Solanum 
tuberosum]
Length=572

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/566 (65%), Positives = 465/566 (82%), Gaps = 6/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQ+G+Y+NFIGSHFWNFQDEL GLAES   D+VFKNHSL+ DVLYR+GETQQGL
Sbjct  1     MREIVTIQIGNYANFIGSHFWNFQDELLGLAESPESDQVFKNHSLDMDVLYRTGETQQGL  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPR+VSV FQGSLGS+SS G+LY++  +++ DV+TW G+VTT ASEPL+RNLFLQSL
Sbjct  61    LTYTPRMVSVNFQGSLGSVSSRGSLYNQIQAKNMDVMTWKGRVTTHASEPLRRNLFLQSL  120

Query  1628  YMEEKNM-NMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
               EE+ +    +  D   ++S  EIQDKDIVECLE+ VQYWTDFSKV +HPQSLY+LSGL
Sbjct  121   SEEEQEIVGKANDLDNVNNNSPAEIQDKDIVECLESDVQYWTDFSKVHYHPQSLYELSGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D QEF NYG+G++ F  HQ GEE+++RLRFF+EECDHIQG+Q +VDD+GGFSG++A F
Sbjct  181   WADIQEFDNYGLGKEAFCGHQHGEEIDDRLRFFVEECDHIQGIQCVVDDAGGFSGVSAMF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++IAD+Y NVPVLLY  R+P    +++ +K  IS  LH+AVSFSRL+   KLI+P+GL 
Sbjct  241   LESIADEYPNVPVLLYNARNPSLHMDSEGRKQAISHYLHDAVSFSRLSELCKLIIPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS S+AS+ LCIKDE+PY++SAVYASA+HS +LPFRM+  GP+AES++ SGAL+MY  +
Sbjct  301   SLSGSRASQFLCIKDEKPYHSSAVYASAMHSFTLPFRMKQSGPSAESLFTSGALDMYGTV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA Q RQNMV+ LDV+MPAPSL+ ++ Q S L N   L P++ +D ED HA+E M IH
Sbjct  361   QMLAGQMRQNMVTILDVAMPAPSLS-DRAQHSFLGNLQPLIPDISEDVEDFHAVETMNIH  419

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G + SG++RA + EVK  V+ AY+ +++RPKFSHLS S CPLPIPLPFP IFGN +GQHG
Sbjct  420   GAVTSGNQRASINEVKDAVESAYDNSVTRPKFSHLSASTCPLPIPLPFPLIFGNMVGQHG  479

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             ELLETPI+ + SRG LEVHSIPMA+RLRSSTA+LP LE +L NLR+ GI+RGA+GA +L+
Sbjct  480   ELLETPISGSSSRGSLEVHSIPMATRLRSSTAVLPLLERKLGNLRRFGIERGALGAPLLQ  539

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             SWGFG+DEVED+GE LSK+V TLKPY
Sbjct  540   SWGFGKDEVEDMGEVLSKMVTTLKPY  565



>ref|XP_011092123.1| PREDICTED: protein misato homolog 1 isoform X1 [Sesamum indicum]
 ref|XP_011092124.1| PREDICTED: protein misato homolog 1 isoform X1 [Sesamum indicum]
Length=574

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/565 (65%), Positives = 461/565 (82%), Gaps = 5/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVTIQVGSY+NF+GSHFWNFQDEL GLA+S   D++F++H LN DVLYR+GETQQG+
Sbjct  1     MKEIVTIQVGSYANFVGSHFWNFQDELLGLADSPTGDQIFRSHGLNMDVLYRTGETQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSV FQGSLGS+S+ G LY+E P  S D LTW G VTT  S+PLK+NLFLQSL
Sbjct  61    LTYTPRLVSVDFQGSLGSVSTRGTLYNEVPESSVDTLTWTGPVTTHTSQPLKKNLFLQSL  120

Query  1628  YMEE-KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             Y+EE +N+        R  D   E+QDKDIVECLEN VQYWTDFSKV +HPQSLY+LSGL
Sbjct  121   YLEETENVGTSRDCGSRNGDFCPEVQDKDIVECLENEVQYWTDFSKVHYHPQSLYELSGL  180

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D ++FN YGIGR+ F      EE+NERLRFF+EECD  QG+QFI+DDSGGFSG+A EF
Sbjct  181   WCDIKDFNNYGIGREAFFGGLHAEEINERLRFFVEECDLPQGIQFIIDDSGGFSGVAGEF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+Y+N+PVLLY+VRSP S  ++ ++KL +S+ LH+AVSFS+L++FSKLIVP+GL 
Sbjct  241   LENIADEYTNIPVLLYSVRSPYSSLDSTNRKLTLSRKLHDAVSFSKLSTFSKLIVPMGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SL  S+ S+ LC++D++PY+ SAVYASA+HS+SLPFRM+  GP+A+  Y  GA+++ E++
Sbjct  301   SLRTSRMSKYLCLEDQKPYHNSAVYASAIHSISLPFRMQPLGPSAQLSYTCGAVDVNELV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA QA+QN V  LD+ MPAP+L+  Q + SLL+N   LTPEV ++ EDMHA+E MTIH
Sbjct  361   QMLAGQAQQNKVMALDIVMPAPALSDIQCRQSLLENLHPLTPEVAENVEDMHALESMTIH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             GV GSG +RA V EVK  VQ AY  A  RP+FSHLSV+ CPLPIPLPFP+IFGN +G+HG
Sbjct  421   GVFGSGCKRASVSEVKDAVQTAYSTAAERPRFSHLSVAQCPLPIPLPFPSIFGNLVGRHG  480

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             ELL+TPI+E+ SRG LEVHSIPMA+RLRSS+ ILPFLE+RLENLRK GI RGA+G+++L 
Sbjct  481   ELLDTPISESASRGSLEVHSIPMAARLRSSSCILPFLENRLENLRKFGIARGALGSELLA  540

Query  374   SWGFGRDEVEDLGETLSKLVNTLKP  300
             SWGFG+D+VED+GETLS +V TL P
Sbjct  541   SWGFGKDDVEDMGETLSNMVRTLNP  565



>ref|XP_009623983.1| PREDICTED: protein misato homolog 1 isoform X1 [Nicotiana tomentosiformis]
Length=571

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/564 (67%), Positives = 464/564 (82%), Gaps = 4/564 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG+Y+NFIGSHFWNFQDEL GLAES   D+VF NH L+ DVLYR+GETQQG+
Sbjct  1     MREIVTVQVGNYANFIGSHFWNFQDELLGLAESPESDQVFINHGLDMDVLYRTGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPR+VSV FQGSLGS+SS G+LYS+ P++S DV+TW G+V T ASEPL+RNLFLQSL
Sbjct  61    LTYTPRMVSVNFQGSLGSLSSRGSLYSQIPAKSLDVMTWKGRVATHASEPLRRNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
               EE+        D R   S  EIQDKDIVECLE+ VQYWTDFSKV +HPQSLY+LSGLW
Sbjct  121   SEEEQESMDKAALDNRNGSSPGEIQDKDIVECLESDVQYWTDFSKVHYHPQSLYELSGLW  180

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             ++ Q+F NY +G+D F  HQ GEE+++RLRFFIEECDHIQG+Q +VDDSGGFSG+AA FL
Sbjct  181   VEIQDFDNYALGKDAFCGHQHGEEIDDRLRFFIEECDHIQGIQCVVDDSGGFSGVAAAFL  240

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NIAD+Y NVPVLLY  R+P    ++K +K  IS++LH+AVSFSRL+   KLI+P+GL S
Sbjct  241   ENIADEYPNVPVLLYNARNPSLNMDSKGRKQAISRNLHDAVSFSRLSELCKLIIPVGLPS  300

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS S+AS+ LCIKDE+PY++SAVYASA+HS SLPFRM+  GP+AESI  SGAL+MY ++ 
Sbjct  301   LSGSRASQFLCIKDEKPYHSSAVYASAMHSFSLPFRMKQSGPSAESICTSGALDMYGIVQ  360

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +LA Q RQNMV+ LD +MPAPSL+ NQ Q SLL +   LTP+V +D ED+HA+E M IHG
Sbjct  361   MLAGQMRQNMVTVLDFAMPAPSLSVNQAQQSLLRSLQPLTPDVAEDVEDLHAVETMNIHG  420

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
              + SG++RA +YEVK  VQ AY+ +++ PKFSHLSV+ CPLPIPLPFP+IFGN +GQHGE
Sbjct  421   AVTSGNQRASIYEVKDAVQAAYDSSMTMPKFSHLSVATCPLPIPLPFPSIFGNMVGQHGE  480

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             LLETPI+ + SRG LEV SIPM +RLRSSTA+LPFLES+L NL K GI RGA+GA +L+S
Sbjct  481   LLETPISGSSSRGSLEVQSIPMVTRLRSSTAVLPFLESKLGNLHKFGIDRGALGAPLLQS  540

Query  371   WGFGRDEVEDLGETLSKLVNTLKP  300
             WGFG+DEVED+GETLSKLV TLKP
Sbjct  541   WGFGKDEVEDMGETLSKLVVTLKP  564



>ref|XP_007047164.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal, putative isoform 
2 [Theobroma cacao]
 gb|EOX91321.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal, putative isoform 
2 [Theobroma cacao]
Length=691

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/567 (65%), Positives = 451/567 (80%), Gaps = 4/567 (1%)
 Frame = -2

Query  1985  TDMREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQ  1815
             T MREIVTIQVGS++NFIGSHFWNFQDE+ GLA     D +FK   LN DVLYR+GETQQ
Sbjct  117   TTMREIVTIQVGSFANFIGSHFWNFQDEMLGLAADPYGDPLFKTDGLNMDVLYRTGETQQ  176

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G LTYTPRL+S+ FQGSLG MSS G LY+E  +  S+V+TW G V+T ASEP K+NLFLQ
Sbjct  177   GTLTYTPRLLSIDFQGSLGPMSSRGTLYNEGSNAPSEVVTWEGNVSTHASEPQKKNLFLQ  236

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             SLY EE+++ +V+G +G + D  NEIQD DIV+CL+ GVQ+WTDFSKV +HPQSLY+++G
Sbjct  237   SLYQEEQDVPLVNGINGGKKDLQNEIQDTDIVKCLDRGVQFWTDFSKVHYHPQSLYEVNG  296

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LWMDAQEF NYGIGRD F  + +GEE+ ERLRFF+EECDHIQG +FI DDSGGFS +AA+
Sbjct  297   LWMDAQEFDNYGIGRDVFTENLQGEEVCERLRFFVEECDHIQGFKFIADDSGGFSPIAAD  356

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
             FL+NIAD+YSN PVLLY VR PGS  N +S+K  + + LH+AVSFSRL+SF K+IVP+GL
Sbjct  357   FLENIADEYSNTPVLLYAVRGPGSHMNLRSRKQTVVRDLHDAVSFSRLSSFCKMIVPVGL  416

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
               LS SKAS  L I+DE PY+ SAVYA+ALHS SLPFRME PGP+A+S    GAL++  +
Sbjct  417   PFLSMSKASTYLNIEDENPYHCSAVYAAALHSASLPFRMEAPGPSADSSDTVGALDVNGI  476

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +LA Q+RQNMV+ LD++MPAP +TG Q + SLL N   LTPEV +D +D+ A+E MT+
Sbjct  477   VQMLAGQSRQNMVAILDIAMPAPGMTGRQDEKSLLGNLHPLTPEVAEDMDDLQAVESMTV  536

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG +GS   RA V EVK  +   YE AI RP F HLSV+ CPLPIPLPFP+IFGN +GQH
Sbjct  537   HGAIGSEDHRASVSEVKNAINAEYEHAIIRPMFCHLSVARCPLPIPLPFPSIFGNLVGQH  596

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELL +PI  + SRG L+VHSIPMA+RLRSS AILPFLE+RL NLRK GI+RG++G ++L
Sbjct  597   GELLGSPILGSSSRGSLDVHSIPMAARLRSSCAILPFLENRLANLRKFGIERGSLGTELL  656

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKPY  297
              SWGFGRDEVED+GETLSK+V  + P+
Sbjct  657   RSWGFGRDEVEDIGETLSKMVKAVNPH  683



>ref|XP_007047165.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal isoform 3 [Theobroma 
cacao]
 gb|EOX91322.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal isoform 3 [Theobroma 
cacao]
Length=572

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/565 (65%), Positives = 450/565 (80%), Gaps = 5/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVGS++NFIGSHFWNFQDE+ GLA     D +FK   LN DVLYR+GETQQG 
Sbjct  1     MREIVTIQVGSFANFIGSHFWNFQDEMLGLAADPYGDPLFKTDGLNMDVLYRTGETQQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRL+S+ FQGSLG MSS G LY+E  +  S+V+TW G V+T ASEP K+NLFLQSL
Sbjct  61    LTYTPRLLSIDFQGSLGPMSSRGTLYNEGSNAPSEVVTWEGNVSTHASEPQKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+++ +V+G +G + D  NEIQD DIV+CL+ GVQ+WTDFSKV +HPQSLY+++GLW
Sbjct  121   YQEEQDVPLVNGINGGKKDLQNEIQDTDIVKCLDRGVQFWTDFSKVHYHPQSLYEVNGLW  180

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             MDAQEF NYGIGRD F  + +GEE+ ERLRFF+EECDHIQG +FI DDSGGFS +AA+FL
Sbjct  181   MDAQEFDNYGIGRDVFTENLQGEEVCERLRFFVEECDHIQGFKFIADDSGGFSPIAADFL  240

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NIAD+YSN PVLLY VR PGS  N +S+K  + + LH+AVSFSRL+SF K+IVP+GL  
Sbjct  241   ENIADEYSNTPVLLYAVRGPGSHMNLRSRKQTVVRDLHDAVSFSRLSSFCKMIVPVGLPF  300

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS SKAS  L I+DE PY+ SAVYA+ALHS SLPFRME PGP+A+S    GAL++  ++ 
Sbjct  301   LSMSKASTYLNIEDENPYHCSAVYAAALHSASLPFRMEAPGPSADSSDTVGALDVNGIVQ  360

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +LA Q+RQNMV+ LD++MPAP +TG Q + SLL N   LTPEV +D +D+ A+E MT+HG
Sbjct  361   MLAGQSRQNMVAILDIAMPAPGMTGRQDEKSLLGNLHPLTPEVAEDMDDLQAVESMTVHG  420

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
              +GS   RA V EVK  +   YE AI RP F HLSV+ CPLPIPLPFP+IFGN +GQHGE
Sbjct  421   AIGS-DHRASVSEVKNAINAEYEHAIIRPMFCHLSVARCPLPIPLPFPSIFGNLVGQHGE  479

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             LL +PI  + SRG L+VHSIPMA+RLRSS AILPFLE+RL NLRK GI+RG++G ++L S
Sbjct  480   LLGSPILGSSSRGSLDVHSIPMAARLRSSCAILPFLENRLANLRKFGIERGSLGTELLRS  539

Query  371   WGFGRDEVEDLGETLSKLVNTLKPY  297
             WGFGRDEVED+GETLSK+V  + P+
Sbjct  540   WGFGRDEVEDIGETLSKMVKAVNPH  564



>ref|XP_004230280.1| PREDICTED: protein misato homolog 1 isoform X2 [Solanum lycopersicum]
Length=574

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/566 (65%), Positives = 460/566 (81%), Gaps = 5/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVGSY+N+IGSHFWNFQDEL GLAES   DEVFKNHSL+ DVLYR+GETQQGL
Sbjct  1     MREIVTIQVGSYANYIGSHFWNFQDELLGLAESPESDEVFKNHSLDMDVLYRTGETQQGL  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPR+VSV FQGSLGS+SS G+LY + P+++ DV+TW G+V T  SEPL+RNLFLQSL
Sbjct  61    LTYTPRVVSVNFQGSLGSVSSRGSLYDQIPAKNMDVMTWTGRVITHESEPLRRNLFLQSL  120

Query  1628  YME-EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
               + ++++   +  D   ++   EIQDKDIVECLE+ VQYWTDFSKV +HPQSLY+LSGL
Sbjct  121   SEDGQESVGKANDLDNVNNNPPAEIQDKDIVECLESDVQYWTDFSKVHYHPQSLYELSGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D QEF NYG+G++ F  HQ GEE+++RLRFF+E+CDHIQG+Q IVDDSGGFSG++A F
Sbjct  181   WADIQEFDNYGLGKEAFCGHQHGEEIDDRLRFFVEDCDHIQGIQCIVDDSGGFSGVSAMF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++IAD+Y NVPVLLY  R+P    ++K +K  IS +LH+AVSFSRL+   KLI+P+GL 
Sbjct  241   LESIADEYPNVPVLLYNARNPSLHMDSKGRKQAISHNLHDAVSFSRLSELCKLIIPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS S+AS+ L IKDE+PY++SAVYASA+HS SLPFRM+  GP+AESIY SGAL+MY  +
Sbjct  301   SLSGSRASQFLRIKDEKPYHSSAVYASAMHSFSLPFRMKQSGPSAESIYTSGALDMYGTV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA Q RQNMV+ LDV+MPAPSL+    Q S L N   L P++ +D ED HA+E M IH
Sbjct  361   QILAGQMRQNMVTILDVAMPAPSLSDRAQQQSFLGNLQPLIPDIAEDVEDFHAVETMNIH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G + SG++RA + EVK  V+ AY  +++RPKFSHLS S CPLPIPLPFP IF + +GQHG
Sbjct  421   GAVTSGNQRASIDEVKDAVESAYNNSVTRPKFSHLSASTCPLPIPLPFPMIFRDMVGQHG  480

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             ELLETPI+ + SRG +EVHSIPMA+RLRSSTA+LPFLE +L NLR+ GI+RGAIGA +L+
Sbjct  481   ELLETPISGSSSRGSIEVHSIPMATRLRSSTAVLPFLERKLGNLRRFGIERGAIGAPLLQ  540

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             SWGFG++EVED+GE LSK+V TLKPY
Sbjct  541   SWGFGKEEVEDMGEVLSKMVTTLKPY  566



>ref|XP_010313331.1| PREDICTED: protein misato homolog 1 isoform X1 [Solanum lycopersicum]
Length=575

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/567 (65%), Positives = 462/567 (81%), Gaps = 6/567 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVGSY+N+IGSHFWNFQDEL GLAES   DEVFKNHSL+ DVLYR+GETQQGL
Sbjct  1     MREIVTIQVGSYANYIGSHFWNFQDELLGLAESPESDEVFKNHSLDMDVLYRTGETQQGL  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPR+VSV FQGSLGS+SS G+LY + P+++ DV+TW G+V T  SEPL+RNLFLQSL
Sbjct  61    LTYTPRVVSVNFQGSLGSVSSRGSLYDQIPAKNMDVMTWTGRVITHESEPLRRNLFLQSL  120

Query  1628  YME-EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
               + ++++   +  D   ++   EIQDKDIVECLE+ VQYWTDFSKV +HPQSLY+LSGL
Sbjct  121   SEDGQESVGKANDLDNVNNNPPAEIQDKDIVECLESDVQYWTDFSKVHYHPQSLYELSGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D QEF NYG+G++ F  HQ GEE+++RLRFF+E+CDHIQG+Q IVDDSGGFSG++A F
Sbjct  181   WADIQEFDNYGLGKEAFCGHQHGEEIDDRLRFFVEDCDHIQGIQCIVDDSGGFSGVSAMF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++IAD+Y NVPVLLY  R+P    ++K +K  IS +LH+AVSFSRL+   KLI+P+GL 
Sbjct  241   LESIADEYPNVPVLLYNARNPSLHMDSKGRKQAISHNLHDAVSFSRLSELCKLIIPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS S+AS+ L IKDE+PY++SAVYASA+HS SLPFRM+  GP+AESIY SGAL+MY  +
Sbjct  301   SLSGSRASQFLRIKDEKPYHSSAVYASAMHSFSLPFRMKQSGPSAESIYTSGALDMYGTV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQV-QGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
              +LA Q RQNMV+ LDV+MPAPSL+ ++  Q S L N   L P++ +D ED HA+E M I
Sbjct  361   QILAGQMRQNMVTILDVAMPAPSLSADRAQQQSFLGNLQPLIPDIAEDVEDFHAVETMNI  420

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG + SG++RA + EVK  V+ AY  +++RPKFSHLS S CPLPIPLPFP IF + +GQH
Sbjct  421   HGAVTSGNQRASIDEVKDAVESAYNNSVTRPKFSHLSASTCPLPIPLPFPMIFRDMVGQH  480

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELLETPI+ + SRG +EVHSIPMA+RLRSSTA+LPFLE +L NLR+ GI+RGAIGA +L
Sbjct  481   GELLETPISGSSSRGSIEVHSIPMATRLRSSTAVLPFLERKLGNLRRFGIERGAIGAPLL  540

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKPY  297
             +SWGFG++EVED+GE LSK+V TLKPY
Sbjct  541   QSWGFGKEEVEDMGEVLSKMVTTLKPY  567



>ref|XP_007047167.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal isoform 5 [Theobroma 
cacao]
 gb|EOX91324.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal isoform 5 [Theobroma 
cacao]
Length=573

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/566 (65%), Positives = 450/566 (80%), Gaps = 6/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVGS++NFIGSHFWNFQDE+ GLA     D +FK   LN DVLYR+GETQQG 
Sbjct  1     MREIVTIQVGSFANFIGSHFWNFQDEMLGLAADPYGDPLFKTDGLNMDVLYRTGETQQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRL+S+ FQGSLG MSS G LY+E  +  S+V+TW G V+T ASEP K+NLFLQSL
Sbjct  61    LTYTPRLLSIDFQGSLGPMSSRGTLYNEGSNAPSEVVTWEGNVSTHASEPQKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+++ +V+G +G + D  NEIQD DIV+CL+ GVQ+WTDFSKV +HPQSLY+++GLW
Sbjct  121   YQEEQDVPLVNGINGGKKDLQNEIQDTDIVKCLDRGVQFWTDFSKVHYHPQSLYEVNGLW  180

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHI-QGVQFIVDDSGGFSGLAAEF  1275
             MDAQEF NYGIGRD F  + +GEE+ ERLRFF+EECDHI QG +FI DDSGGFS +AA+F
Sbjct  181   MDAQEFDNYGIGRDVFTENLQGEEVCERLRFFVEECDHIQQGFKFIADDSGGFSPIAADF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+YSN PVLLY VR PGS  N +S+K  + + LH+AVSFSRL+SF K+IVP+GL 
Sbjct  241   LENIADEYSNTPVLLYAVRGPGSHMNLRSRKQTVVRDLHDAVSFSRLSSFCKMIVPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
              LS SKAS  L I+DE PY+ SAVYA+ALHS SLPFRME PGP+A+S    GAL++  ++
Sbjct  301   FLSMSKASTYLNIEDENPYHCSAVYAAALHSASLPFRMEAPGPSADSSDTVGALDVNGIV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA Q+RQNMV+ LD++MPAP +TG Q + SLL N   LTPEV +D +D+ A+E MT+H
Sbjct  361   QMLAGQSRQNMVAILDIAMPAPGMTGRQDEKSLLGNLHPLTPEVAEDMDDLQAVESMTVH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G +GS   RA V EVK  +   YE AI RP F HLSV+ CPLPIPLPFP+IFGN +GQHG
Sbjct  421   GAIGS-DHRASVSEVKNAINAEYEHAIIRPMFCHLSVARCPLPIPLPFPSIFGNLVGQHG  479

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             ELL +PI  + SRG L+VHSIPMA+RLRSS AILPFLE+RL NLRK GI+RG++G ++L 
Sbjct  480   ELLGSPILGSSSRGSLDVHSIPMAARLRSSCAILPFLENRLANLRKFGIERGSLGTELLR  539

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             SWGFGRDEVED+GETLSK+V  + P+
Sbjct  540   SWGFGRDEVEDIGETLSKMVKAVNPH  565



>ref|XP_002263195.2| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652644.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652645.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652646.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652647.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652648.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652649.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652650.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 ref|XP_010652651.1| PREDICTED: protein misato homolog 1 isoform X1 [Vitis vinifera]
 emb|CBI23282.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/567 (64%), Positives = 447/567 (79%), Gaps = 6/567 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NFIGSHFWNFQDEL GLA     D +FKN  L+ DVLYR+GET QG+
Sbjct  1     MREIVTIQVGGFANFIGSHFWNFQDELLGLAGDPNGDPIFKNQHLDMDVLYRTGETLQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TYTPRLVSV FQGSLGSMSS G LY   P   S V+TW G V+T  SEP K+NLFLQSL
Sbjct  61    ATYTPRLVSVNFQGSLGSMSSHGTLYDHNPPVPSHVVTWPGNVSTHLSEPHKKNLFLQSL  120

Query  1628  YMEEK-NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             Y EE+ N+  +DG +  ++D  +EIQDKDIVE LENGVQ+WTDFSKV +HPQSLY+L+GL
Sbjct  121   YEEEQENLAPMDGINSGKNDCESEIQDKDIVESLENGVQFWTDFSKVHYHPQSLYELNGL  180

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMDAQ+FN YGIG D F    RGEE+NERLRFF+EECDHIQG+QF+VDDSGGFS +AA+F
Sbjct  181   WMDAQDFNNYGIGMDVFSEGLRGEEMNERLRFFVEECDHIQGIQFVVDDSGGFSSVAADF  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+Y+N P+LLYTVR P S+ N +S++  ++  LH+A+SFSRL+SF KLIVPIGL 
Sbjct  241   LENIADEYTNTPILLYTVRGPESYMNRRSRRQTMASDLHDAISFSRLSSFCKLIVPIGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
              L  SK S  LC++DE+PY+ SAVYA+ALHS+SLPFRME  GP  +S Y SGA+++Y +I
Sbjct  301   LLGRSKVSSYLCLEDEKPYHCSAVYAAALHSISLPFRMETLGPAMDSCYVSGAVDVYGLI  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA QARQN+V+TLD  MPAPSLTG QV+ SLL +    TPE+ +D ED+  +E +TIH
Sbjct  361   QMLAGQARQNIVATLDAVMPAPSLTGKQVEQSLLGSLHPFTPEIAEDVEDLQEVESLTIH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G  GSG  RA V EV+ TV  AYE A ++P FSHLSV+ CPLPIPLPFP+IFGN +GQHG
Sbjct  421   GAFGSGGYRASVSEVEDTVHAAYENATTKPLFSHLSVAHCPLPIPLPFPSIFGNLVGQHG  480

Query  554   ELLETPIT-ETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             ELL +P+    PSRG L+VHSIPMA+RLRS+TAILPFLE+RL NL++ GI RGA G ++L
Sbjct  481   ELLGSPVMGGRPSRGSLDVHSIPMAARLRSTTAILPFLENRLGNLQRFGIARGASGTELL  540

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKPY  297
              SWGF +DE+ED  E LSK++ TL P+
Sbjct  541   RSWGFAKDELEDTAERLSKMIMTLDPH  567



>ref|XP_009366789.1| PREDICTED: protein misato homolog 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009366790.1| PREDICTED: protein misato homolog 1-like isoform X1 [Pyrus x 
bretschneideri]
Length=575

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/567 (65%), Positives = 447/567 (79%), Gaps = 8/567 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVGS++NF+GSHFWNFQDEL GLAE   SD VFKN SLN DVLYRSGET QG 
Sbjct  1     MRELVTLQVGSFANFVGSHFWNFQDELLGLAEDPYSDPVFKNQSLNMDVLYRSGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             +TYTPRLVSV  QGSLGSMS+ G LY E  S SS++ TW G VTTQ +EP K+NLFLQSL
Sbjct  61    VTYTPRLVSVDLQGSLGSMSTRGTLYDESSSASSNIYTWGGNVTTQVAEPHKKNLFLQSL  120

Query  1628  YMEEKNMNMV---DGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             Y EE+ +N++   +G +  E     EI D D VE LENGVQYWTDFSKV +HPQSLY+LS
Sbjct  121   Y-EEEQVNLLTLGNGVNAGEKSCRREIHDSDKVESLENGVQYWTDFSKVHYHPQSLYELS  179

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             GLW+D Q+F NYGIGR++     +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA 
Sbjct  180   GLWVDPQKFDNYGIGRESLSAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAV  239

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             + L++IAD+Y+N PVLLY VR PGS  + +SQK  +S+ LH+AVSFS+L+S  KLIVP+G
Sbjct  240   DVLESIADEYTNAPVLLYAVRGPGSSMDPRSQKQRVSRKLHDAVSFSKLSSLCKLIVPVG  299

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L SLS SKASR L I DE+PY+ SA YA+ LHS+SLPFRME  GPTA+S YASGA+ + E
Sbjct  300   LPSLSTSKASRFLSINDEKPYHCSAAYAATLHSISLPFRMEPLGPTADSSYASGAVTISE  359

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             V+ +L+ QARQNMV+ LD +MP+PSLTGNQV  +L  N   LTPE+ +D ED+ ++E M 
Sbjct  360   VVQILSGQARQNMVAILDAAMPSPSLTGNQVGQNLTGNLQPLTPEIAEDVEDLQSVESMI  419

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             +HG LGSG  RA + EVK TV  AYE AI+RP F HLSV+ CPLPIPLPFP+IFGN +GQ
Sbjct  420   VHGALGSGGHRASISEVKDTVHAAYEHAITRPMFCHLSVAQCPLPIPLPFPSIFGNLVGQ  479

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGELL TPI  +PSRG L+VH IPMA+RLRSS+A+LPFL++RL  LR  GI RGA GA++
Sbjct  480   HGELLSTPIVGSPSRGSLDVHFIPMAARLRSSSAVLPFLQNRLSGLRSSGIARGAPGAEL  539

Query  380   LESWGFGRDEVEDLGETLSKLVNTLKP  300
             + SWGF +DE+ED+GE LSK++ TL P
Sbjct  540   VRSWGFAKDELEDMGEMLSKMIATLDP  566



>ref|XP_008241539.1| PREDICTED: protein misato homolog 1 [Prunus mume]
Length=574

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 450/566 (80%), Gaps = 7/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVGS++NF+GSHFWNFQDEL+GLAE   +D VFKN SLN DVLYRSGET QG 
Sbjct  1     MRELVTLQVGSFANFVGSHFWNFQDELNGLAEDPYADPVFKNQSLNMDVLYRSGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSV  QGSLGSMSS G LY E  S SS++LTW G V+T A+EP K+NLFLQSL
Sbjct  61    LTYTPRLVSVDLQGSLGSMSSRGTLYDEGSSASSNILTWGGNVSTHAAEPHKKNLFLQSL  120

Query  1628  YMEEK--NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             Y EE+  ++   +G  G E +   EI D+D VE LENGVQYWTDFSKV++HPQSLY+LSG
Sbjct  121   YGEEQENSLTFENGVTGGE-NPRTEIHDRDKVESLENGVQYWTDFSKVEYHPQSLYELSG  179

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LW+D Q+F NYGIGR++     +GEE+++RLRFF+EECDHIQG QFIVDDSGGFS LA +
Sbjct  180   LWVDPQKFDNYGIGRESLSGGLQGEEISQRLRFFVEECDHIQGFQFIVDDSGGFSPLAVD  239

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L++IAD+Y+NVPVLLY VR PGS  + +SQK  +S+ LH+AVSFSRL+S  KLIVP+GL
Sbjct  240   VLESIADEYTNVPVLLYAVRGPGSSVDPRSQKQRVSRKLHDAVSFSRLSSLCKLIVPVGL  299

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKAS  LCI DE+PY+ SA YA+ALHSLSLPFRME  GPTA+S YASGA  + EV
Sbjct  300   PSLSRSKASTFLCINDEKPYHCSAAYAAALHSLSLPFRMEPLGPTADSSYASGAATVNEV  359

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ Q RQNMV+ LD +MP PSLTGNQ++ +LL +   LTPE+ +D ED+ ++E +++
Sbjct  360   VQILSGQTRQNMVAILDAAMPVPSLTGNQLEQTLLRHLQPLTPEIAKDIEDLQSVESISV  419

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG LG G+    + EVK  V  AYE A +RP F HLSV+ CPLPIPLPFP+IFGN +GQH
Sbjct  420   HGALGPGTTGWVISEVKDMVHAAYEHATTRPMFCHLSVAQCPLPIPLPFPSIFGNRVGQH  479

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELL TPI ++ SRG L+VHSIPMA+RLRSS+A+LPFLE+RL +LR  GI RGA GA+++
Sbjct  480   GELLSTPIIDSSSRGSLDVHSIPMAARLRSSSAVLPFLENRLGSLRSFGIARGAPGAELV  539

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKP  300
              SWGF +DE+ED+GE LSK++ TL P
Sbjct  540   RSWGFAKDELEDMGEVLSKMITTLDP  565



>ref|XP_007204205.1| hypothetical protein PRUPE_ppa003427mg [Prunus persica]
 gb|EMJ05404.1| hypothetical protein PRUPE_ppa003427mg [Prunus persica]
Length=575

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/567 (65%), Positives = 450/567 (79%), Gaps = 8/567 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVGS++NF+GSHFWNFQDEL+GLAE   +D VFKN SLN DVLYRSGET QG 
Sbjct  1     MRELVTLQVGSFANFVGSHFWNFQDELNGLAEDPYADPVFKNQSLNMDVLYRSGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSV  QGSLGSMSS G LY E  S SS++LTW G V+T A+EP K+NLFLQSL
Sbjct  61    LTYTPRLVSVDLQGSLGSMSSRGTLYDEGSSASSNILTWGGNVSTHAAEPHKKNLFLQSL  120

Query  1628  YMEEK--NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             Y EE+  ++   +G  G E +   EI D+D VE LENGVQYWTDFSKV++HPQSLY+LSG
Sbjct  121   YGEEQENSLTFENGVTGGE-NPRTEIHDRDKVESLENGVQYWTDFSKVEYHPQSLYELSG  179

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LW+D Q+F NYGIGR++     +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA +
Sbjct  180   LWVDPQKFDNYGIGRESLSGGLQGEEISERLRFFVEECDHIQGFQFIVDDSGGFSPLAVD  239

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L++IAD+Y+N PVLLY VR PGS  + +SQK  +S+ LH+AVSFSRL+S  KLIVP+GL
Sbjct  240   VLESIADEYTNAPVLLYAVRGPGSSVDPRSQKQRVSRKLHDAVSFSRLSSLCKLIVPVGL  299

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKAS  L I DE+PY+ SA YA+ LHSLSLPFRME  GPTA+S YASGA+ + EV
Sbjct  300   PSLSRSKASTFLWINDEKPYHCSAAYAATLHSLSLPFRMEPLGPTADSSYASGAVTVNEV  359

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ Q RQNMV+ LD +MPAPSL GNQV+ +LL +   LTPE+ +D ED+ ++E +++
Sbjct  360   VEILSGQTRQNMVAILDAAMPAPSLIGNQVEQTLLRHLQPLTPEIAKDIEDLQSVESISV  419

Query  737   HGVLGSG-SRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             HG LG    +RA V EVK  V  AYE A +RP F HLSV+ CPLPIPLPFP+IFGN +GQ
Sbjct  420   HGALGPARGQRASVSEVKDMVHAAYEHATTRPMFCHLSVAQCPLPIPLPFPSIFGNRVGQ  479

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGELL TPI ++PSRG L+VHSIPMA+RLRSS+A+LPFLE+RL +LR  GI RGA GA++
Sbjct  480   HGELLSTPIIDSPSRGSLDVHSIPMAARLRSSSAVLPFLENRLGSLRSFGIARGAPGAEL  539

Query  380   LESWGFGRDEVEDLGETLSKLVNTLKP  300
             + SWGF +DE+ED+GE LSK++ TL P
Sbjct  540   VRSWGFAKDELEDMGEVLSKMITTLDP  566



>ref|XP_008339777.1| PREDICTED: protein misato homolog 1-like isoform X1 [Malus domestica]
Length=575

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/567 (63%), Positives = 445/567 (78%), Gaps = 6/567 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVGS++N++GSHFWNFQDEL GLAE   +D VFK+ SLN DVLYRSGET QG 
Sbjct  1     MRELVTLQVGSFANYVGSHFWNFQDELLGLAEDAYADPVFKBQSLNMDVLYRSGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             +TYTPRLVSV  QGSLGSMSS G LY+E  S SS++ TW G V+TQA+EP K+NLFLQSL
Sbjct  61    VTYTPRLVSVDLQGSLGSMSSRGTLYNEGSSASSNIFTWGGNVSTQAAEPHKKNLFLQSL  120

Query  1628  YMEEKN--MNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             Y EE+   + +  G  G E  S  EI D +IVE LENGV+YWTDFSKV +HPQSLY+LSG
Sbjct  121   YEEEZGDFLTLQSGVSGGEESSQREIHDSEIVESLENGVRYWTDFSKVHYHPQSLYELSG  180

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LW+D Q+F NYGIGR++     +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA +
Sbjct  181   LWVDPQKFDNYGIGRESLSAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAVD  240

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L++IAD+Y+N PV+LY VR  GS  + +SQK  +S+ LH+AVSFS L+S  KLIVP+GL
Sbjct  241   VLESIADEYTNAPVMLYAVRGSGSSMDPRSQKQRVSRKLHDAVSFSMLSSLCKLIVPVGL  300

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKAS  L I +E+PY+ SA YA+ LHS+SLPFRME  GPT +S YASGA+ + EV
Sbjct  301   PSLSTSKASTFLSINBERPYHCSAAYAATLHSVSLPFRMEPLGPTGDSSYASGAVTVSEV  360

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ QARQNMV+ LD +MP+PSL GN +  +LL N   LTPE  +D ED+ ++E MT+
Sbjct  361   VQILSGQARQNMVAILDAAMPSPSLAGNSLGETLLXNLQPLTPETAEDVEDLQSVESMTV  420

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG LGSG  RA + EVK TV  AYE AI+RP + HLSV+ CPLPIPLPFP+IFGN +GQH
Sbjct  421   HGALGSGGHRASISEVKDTVHAAYEHAITRPIYCHLSVAQCPLPIPLPFPSIFGNLVGQH  480

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELL TPI  +P+RG L+VHSIPMA+RLRSS+A+LPFLE+RL  LR  GI RGA GA+++
Sbjct  481   GELLSTPIVGSPTRGSLDVHSIPMAARLRSSSAVLPFLENRLGGLRSCGIARGAPGAELV  540

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKPY  297
              SWGF +DE+ED+GE LSK++ TL P+
Sbjct  541   RSWGFAKDELEDMGEMLSKMIATLDPH  567



>ref|XP_009366702.1| PREDICTED: protein misato homolog 1-like [Pyrus x bretschneideri]
Length=575

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/567 (64%), Positives = 445/567 (78%), Gaps = 6/567 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVGS++N++GSHFWNFQDEL GLAE   +D VFKN SLN DVLYRSG+T+QG 
Sbjct  1     MRELVTLQVGSFANYVGSHFWNFQDELLGLAEDAYADPVFKNQSLNMDVLYRSGQTRQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             +TYTPRLVSV  QGSLGS+SS G LY+E  S SS++ TW G V+TQA+EP K+NLFLQSL
Sbjct  61    VTYTPRLVSVDLQGSLGSLSSRGTLYNEGSSASSNIFTWGGNVSTQAAEPHKKNLFLQSL  120

Query  1628  YMEEKN--MNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             Y EE+   + + +G +G E  S  EI D +IVE LENGVQYWTDFSKV +HPQSLY+LSG
Sbjct  121   YEEEQGDFLTLQNGVNGEEESSRREIHDSEIVESLENGVQYWTDFSKVHYHPQSLYELSG  180

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LW+D Q+F NYGIG+++     +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA +
Sbjct  181   LWVDPQKFDNYGIGKESLSAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAVD  240

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L++IAD+Y+N PV+LY VR  GS  + +SQK  +S+ LH+AVSFS L+S  KLIVP+GL
Sbjct  241   ILESIADEYTNAPVMLYAVRGSGSSMDPRSQKQRVSRKLHDAVSFSMLSSLCKLIVPVGL  300

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKAS  L I DE+PY+ SA YA+ LHS+SLPFRME  GPT +S YASGA  + EV
Sbjct  301   PSLSTSKASNFLSINDEKPYHCSAAYAATLHSVSLPFRMEPLGPTGDSSYASGAATVSEV  360

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ QARQNMV+ LD +MP+PSL  N +  +LL N   LTPE  +D ED+  +E MT+
Sbjct  361   VQILSGQARQNMVAILDAAMPSPSLAENSLGETLLRNLQPLTPETAEDVEDLQLLESMTV  420

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG LGSG  RA + EVK TV  AYE AI+RP F HLSV+ CPLPIPLPFP+IFGN +GQH
Sbjct  421   HGALGSGGHRASISEVKDTVHAAYEHAITRPMFCHLSVAQCPLPIPLPFPSIFGNLVGQH  480

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELL TPI  +PSRG L+VHSIPMA+RLRSS+AILPFLE+RL  LR  GI RGA GA+++
Sbjct  481   GELLSTPIVGSPSRGSLDVHSIPMAARLRSSSAILPFLENRLGGLRSCGIPRGAPGAELV  540

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKPY  297
              SWGF +DE+ED+GE LSK++ TL P+
Sbjct  541   RSWGFAKDELEDMGEMLSKMIATLDPH  567



>ref|XP_008338272.1| PREDICTED: protein misato homolog 1-like isoform X1 [Malus domestica]
Length=575

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/565 (64%), Positives = 444/565 (79%), Gaps = 8/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVGS++NF+GSHFWNFQDEL GLAE   SD VFKN SLN DVLYRSGET QG 
Sbjct  1     MREIVTLQVGSFANFVGSHFWNFQDELLGLAEDPNSDPVFKNQSLNMDVLYRSGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             +TYTPRLVSV  QGSLGSMS+ G LY E  S SS++ TW G VTTQ +EP K+NLFL SL
Sbjct  61    VTYTPRLVSVDLQGSLGSMSTRGTLYDESSSASSNIYTWGGNVTTQVAEPHKKNLFLXSL  120

Query  1628  YMEEKNMNMV---DGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             Y EE+ +N++   +G +        EI D D VE LENGVQYWTDFSKV +HPQSLY+LS
Sbjct  121   Y-EEEXVNLLTLGNGVNAGGKSCRGEIHDSDKVESLENGVQYWTDFSKVHYHPQSLYELS  179

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             GLW+D Q+F NYGIGR++     +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA 
Sbjct  180   GLWVDPQKFDNYGIGRESLSAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAV  239

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             + L++IAD+Y+N PVLLY VR PGS  + +SQK  +S+ LH+AVSFS+L+S  KLIVP+G
Sbjct  240   DVLESIADEYTNAPVLLYAVRGPGSSMDPRSQKQRVSRKLHDAVSFSKLSSLCKLIVPVG  299

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L SLS SKASR L I D++PY+ SA YA+ LHS+SLPFRME  GPTA+S YASGA+ + E
Sbjct  300   LPSLSTSKASRFLSINDKKPYHCSAAYAATLHSISLPFRMEPLGPTADSSYASGAVTISE  359

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             V+ +LA QARQNMV+ LD +MP+PSLTGN V  +L  N   LTPE+ +D ED+ ++E M 
Sbjct  360   VVQILAGQARQNMVAILDAAMPSPSLTGNWVGQNLTGNLQPLTPEIAEDVEDLQSLESMI  419

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             +HG LGSG  RA + EVK TV  AYE  I+RP F HLSV+ CPLPIPLPFP+IFGN +GQ
Sbjct  420   VHGALGSGGHRASISEVKDTVHAAYEHGITRPMFCHLSVAQCPLPIPLPFPSIFGNLVGQ  479

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGELL TPI  +PSRG L++HSIPMA+RLRSS+A+LPFLE+RL +LR  GI RGA GA++
Sbjct  480   HGELLSTPIVGSPSRGSLDIHSIPMAARLRSSSAVLPFLENRLGSLRSCGIARGAPGAEL  539

Query  380   LESWGFGRDEVEDLGETLSKLVNTL  306
             + +WGF +DE+ED+GE LSK++ TL
Sbjct  540   VRNWGFAKDELEDMGEMLSKMIATL  564



>ref|XP_007047163.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal, putative isoform 
1 [Theobroma cacao]
 gb|EOX91320.1| Plasma membrane, autoregulation binding site, Misato Segment 
II, myosin-like, Tubulin/FtsZ, N-terminal, putative isoform 
1 [Theobroma cacao]
Length=689

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/551 (65%), Positives = 438/551 (79%), Gaps = 4/551 (1%)
 Frame = -2

Query  1985  TDMREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQ  1815
             T MREIVTIQVGS++NFIGSHFWNFQDE+ GLA     D +FK   LN DVLYR+GETQQ
Sbjct  117   TTMREIVTIQVGSFANFIGSHFWNFQDEMLGLAADPYGDPLFKTDGLNMDVLYRTGETQQ  176

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G LTYTPRL+S+ FQGSLG MSS G LY+E  +  S+V+TW G V+T ASEP K+NLFLQ
Sbjct  177   GTLTYTPRLLSIDFQGSLGPMSSRGTLYNEGSNAPSEVVTWEGNVSTHASEPQKKNLFLQ  236

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             SLY EE+++ +V+G +G + D  NEIQD DIV+CL+ GVQ+WTDFSKV +HPQSLY+++G
Sbjct  237   SLYQEEQDVPLVNGINGGKKDLQNEIQDTDIVKCLDRGVQFWTDFSKVHYHPQSLYEVNG  296

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LWMDAQEF NYGIGRD F  + +GEE+ ERLRFF+EECDHIQG +FI DDSGGFS +AA+
Sbjct  297   LWMDAQEFDNYGIGRDVFTENLQGEEVCERLRFFVEECDHIQGFKFIADDSGGFSPIAAD  356

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
             FL+NIAD+YSN PVLLY VR PGS  N +S+K  + + LH+AVSFSRL+SF K+IVP+GL
Sbjct  357   FLENIADEYSNTPVLLYAVRGPGSHMNLRSRKQTVVRDLHDAVSFSRLSSFCKMIVPVGL  416

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
               LS SKAS  L I+DE PY+ SAVYA+ALHS SLPFRME PGP+A+S    GAL++  +
Sbjct  417   PFLSMSKASTYLNIEDENPYHCSAVYAAALHSASLPFRMEAPGPSADSSDTVGALDVNGI  476

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +LA Q+RQNMV+ LD++MPAP +TG Q + SLL N   LTPEV +D +D+ A+E MT+
Sbjct  477   VQMLAGQSRQNMVAILDIAMPAPGMTGRQDEKSLLGNLHPLTPEVAEDMDDLQAVESMTV  536

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG +GS   RA V EVK  +   YE AI RP F HLSV+ CPLPIPLPFP+IFGN +GQH
Sbjct  537   HGAIGSEDHRASVSEVKNAINAEYEHAIIRPMFCHLSVARCPLPIPLPFPSIFGNLVGQH  596

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELL +PI  + SRG L+VHSIPMA+RLRSS AILPFLE+RL NLRK GI+RG++G ++L
Sbjct  597   GELLGSPILGSSSRGSLDVHSIPMAARLRSSCAILPFLENRLANLRKFGIERGSLGTELL  656

Query  377   ESWGFGRDEVE  345
              SWGFGRDE++
Sbjct  657   RSWGFGRDEIK  667



>ref|XP_002300359.2| hypothetical protein POPTR_0001s37290g [Populus trichocarpa]
 gb|EEE85164.2| hypothetical protein POPTR_0001s37290g [Populus trichocarpa]
Length=574

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/565 (65%), Positives = 447/565 (79%), Gaps = 8/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHS--LNTDVLYRSGETQQ  1815
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA    SD VFKN S  LN D LYR+GET Q
Sbjct  1     MRELVTVQVGGFANFVGSHFWNFQDELLGLAGDPGSDPVFKNQSQYLNMDTLYRTGETNQ  60

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G+ TYTPRL+S+ +QGSLGSMSS G LY+E  S  S+V TW   V+T ASEPLK+NLFLQ
Sbjct  61    GVQTYTPRLLSIDYQGSLGSMSSRGTLYNESSSAPSNVCTWTSNVSTHASEPLKKNLFLQ  120

Query  1634  SLYMEE-KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             SLY EE +N+ +  G    ++D+  EIQ++DIV+CLE+ VQYWTDFSKV +HPQSLY+L+
Sbjct  121   SLYEEELENLRLSKGISNGKNDNPREIQNQDIVDCLESDVQYWTDFSKVHYHPQSLYELN  180

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             GLWM+  EF NYGIGRD F    RGEE++ERLRFFIEECDHIQG QFIVDDSGGFS +AA
Sbjct  181   GLWMNNVEFDNYGIGRDIFSGGLRGEEISERLRFFIEECDHIQGFQFIVDDSGGFSAIAA  240

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             +FL++IAD+Y+N PVLLYTVR PGS  N  SQK  +S+S+H+A+SFSRL+SF KLIVP+G
Sbjct  241   DFLESIADEYTNTPVLLYTVRGPGSHMNLTSQKQRLSRSIHDALSFSRLSSFCKLIVPVG  300

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L  LS SKAS  LCIKDE PY++SAVYA+ALHS+S+PFR+E  GP A S   SGA+++  
Sbjct  301   LPLLSTSKASMHLCIKDEMPYHSSAVYATALHSISVPFRIEPLGP-ANSHNFSGAVDVNG  359

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             VI +LA QARQNMV+ LDV+MPAP ++G  V+ SLL N   LTPE+ +D EDM A+E MT
Sbjct  360   VIQMLAGQARQNMVTILDVAMPAPPISGKHVEHSLLRNLQPLTPEIAEDVEDMQAVEFMT  419

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             +HG L SG   A + EV  +V  AYE + SRPKF HLSVS CPLPIPLPFP IF N +GQ
Sbjct  420   VHGALRSGGHHAFISEVTDSVNAAYENSSSRPKFCHLSVSSCPLPIPLPFPKIFCNLVGQ  479

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGELL +P+    SRG L+VHSIPMA+RLRSSTA+LPFLESRL NLR+LGIQ+GA G ++
Sbjct  480   HGELLSSPVPGCSSRGSLDVHSIPMAARLRSSTAVLPFLESRLANLRRLGIQQGAPGTEL  539

Query  380   LESWGFGRDEVEDLGETLSKLVNTL  306
             + SWGFG+DE+ED+ ETLSK+V TL
Sbjct  540   VRSWGFGKDELEDMEETLSKMVTTL  564



>ref|XP_009366791.1| PREDICTED: protein misato homolog 1-like isoform X2 [Pyrus x 
bretschneideri]
Length=566

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/567 (64%), Positives = 442/567 (78%), Gaps = 17/567 (3%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVGS++NF+GSHFWNFQDEL GLAE   SD VFKN SLN DVLYRSGET QG 
Sbjct  1     MRELVTLQVGSFANFVGSHFWNFQDELLGLAEDPYSDPVFKNQSLNMDVLYRSGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             +TYTPRLVSV  QGSLGSMS+ G LY E  S SS++ TW G VTTQ +EP K+NLFLQSL
Sbjct  61    VTYTPRLVSVDLQGSLGSMSTRGTLYDESSSASSNIYTWGGNVTTQVAEPHKKNLFLQSL  120

Query  1628  YMEEKNMNMV---DGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             Y EE+ +N++   +G +  E     EI D D VE LENGVQYWTDFSKV +HPQSLY+LS
Sbjct  121   Y-EEEQVNLLTLGNGVNAGEKSCRREIHDSDKVESLENGVQYWTDFSKVHYHPQSLYELS  179

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             GLW+D Q+F NYGIGR++     +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA 
Sbjct  180   GLWVDPQKFDNYGIGRESLSAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAV  239

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             + L++IAD+Y+N PVLLY VR PGS  + +SQK  +S+ LH+AVSFS+L+S  KLIVP+G
Sbjct  240   DVLESIADEYTNAPVLLYAVRGPGSSMDPRSQKQRVSRKLHDAVSFSKLSSLCKLIVPVG  299

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L SLS SKASR L I DE+PY+ SA YA+ LHS+SLPFRME  GPTA+S YASGA+ + E
Sbjct  300   LPSLSTSKASRFLSINDEKPYHCSAAYAATLHSISLPFRMEPLGPTADSSYASGAVTISE  359

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             V+ +L+ QARQNMV+ LD +MP+PSLTG         N   LTPE+ +D ED+ ++E M 
Sbjct  360   VVQILSGQARQNMVAILDAAMPSPSLTG---------NLQPLTPEIAEDVEDLQSVESMI  410

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             +HG LGSG  RA + EVK TV  AYE AI+RP F HLSV+ CPLPIPLPFP+IFGN +GQ
Sbjct  411   VHGALGSGGHRASISEVKDTVHAAYEHAITRPMFCHLSVAQCPLPIPLPFPSIFGNLVGQ  470

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGELL TPI  +PSRG L+VH IPMA+RLRSS+A+LPFL++RL  LR  GI RGA GA++
Sbjct  471   HGELLSTPIVGSPSRGSLDVHFIPMAARLRSSSAVLPFLQNRLSGLRSSGIARGAPGAEL  530

Query  380   LESWGFGRDEVEDLGETLSKLVNTLKP  300
             + SWGF +DE+ED+GE LSK++ TL P
Sbjct  531   VRSWGFAKDELEDMGEMLSKMIATLDP  557



>ref|XP_011002490.1| PREDICTED: protein misato homolog 1 [Populus euphratica]
 ref|XP_011002491.1| PREDICTED: protein misato homolog 1 [Populus euphratica]
Length=574

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/565 (65%), Positives = 444/565 (79%), Gaps = 8/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHS--LNTDVLYRSGETQQ  1815
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA   +SD VFKN S  LN D LYR+GET Q
Sbjct  1     MRELVTVQVGGFANFVGSHFWNFQDELLGLAGDPDSDPVFKNQSQYLNMDTLYRTGETNQ  60

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G+ TYTPRL+S+ +QGSLGSMSS G LY+E  S  S+V  W   V+T ASEPLK+NLFLQ
Sbjct  61    GVQTYTPRLLSIDYQGSLGSMSSRGTLYNESSSAPSNVCMWTSNVSTHASEPLKKNLFLQ  120

Query  1634  SLYMEE-KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             SLY EE +N+ +  G    ++D+  EIQ++DIV+CLE+ VQYWTDFSKV +HPQSLY+L+
Sbjct  121   SLYEEELENLRLSQGISNGKNDNPREIQNQDIVDCLESDVQYWTDFSKVHYHPQSLYELN  180

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             GLWM+  EF NYGIGRD F    RGEE++ERLRFFIEECDHIQG QFIVDDSGGFS +AA
Sbjct  181   GLWMNNVEFDNYGIGRDIFSGGLRGEEISERLRFFIEECDHIQGFQFIVDDSGGFSAIAA  240

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             +FL++IAD+Y+N PVLLYTVR PGS  N  SQK  +S+S+H+A+SFSRL+SF KLIVP+G
Sbjct  241   DFLESIADEYTNTPVLLYTVRGPGSHMNLTSQKQKLSRSIHDALSFSRLSSFCKLIVPVG  300

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L  LS SKAS  LCIKDE PY++SAVYA+ALHS+S+PFR+E  GP A S   SGA+++  
Sbjct  301   LPLLSTSKASMHLCIKDEMPYHSSAVYAAALHSISVPFRIEPLGP-ANSHNFSGAVDVNG  359

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             V  +LA QARQNMV+ LDVSMPAP ++G   + SLL N   LTPE+ QD EDM A+E MT
Sbjct  360   VTQLLAGQARQNMVTILDVSMPAPPISGKHAEHSLLRNLQPLTPEIAQDVEDMQAVEFMT  419

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             +HG L SG   A + EV  +V  AYE + SRPKF HLSVS CPLPIPLPFP IF N +GQ
Sbjct  420   VHGALRSGGHHAFISEVTDSVNAAYENSSSRPKFCHLSVSSCPLPIPLPFPKIFCNLVGQ  479

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGELL +P+    SRG L+VHSIP+A+RLRSSTA+LPFLESRL NLR+LGIQ+GA G Q+
Sbjct  480   HGELLSSPVPGCSSRGSLDVHSIPVAARLRSSTAVLPFLESRLANLRRLGIQQGAPGTQL  539

Query  380   LESWGFGRDEVEDLGETLSKLVNTL  306
             + SWGFG+DE+ED+ ETLSK+V  L
Sbjct  540   VRSWGFGKDELEDMEETLSKMVTKL  564



>ref|XP_006425833.1| hypothetical protein CICLE_v10025258mg [Citrus clementina]
 ref|XP_006466647.1| PREDICTED: protein misato homolog 1-like isoform X1 [Citrus sinensis]
 ref|XP_006466648.1| PREDICTED: protein misato homolog 1-like isoform X2 [Citrus sinensis]
 gb|ESR39073.1| hypothetical protein CICLE_v10025258mg [Citrus clementina]
Length=574

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/566 (63%), Positives = 442/566 (78%), Gaps = 5/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG ++NFIGSHFWNFQDEL GLA    +D VF+N  LN DVLYR+GETQQG+
Sbjct  1     MREIVTVQVGGFANFIGSHFWNFQDELLGLASDPNNDPVFRNQCLNMDVLYRTGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRL+SVGFQGSLGSMSS G LY+E     SDV+TW+G V+T AS P K+NLFLQ L
Sbjct  61    LTYTPRLLSVGFQGSLGSMSSRGLLYNESSPGPSDVVTWSGSVSTHASAPRKKNLFLQRL  120

Query  1628  YMEEK-NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             Y EE+ + +M++G    +SDS  EIQDKDIVE L+N V++WTDFSKV +HPQSLY+L GL
Sbjct  121   YEEEQESFSMINGTSSGKSDSQREIQDKDIVEFLDNHVEFWTDFSKVHYHPQSLYELGGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD QEF NYGIG+D F    RGEE+ ERLRFF+EE DHIQG QF+VDDSGGFS +AA+ 
Sbjct  181   WMDPQEFDNYGIGKDAFSEGFRGEEICERLRFFVEESDHIQGFQFVVDDSGGFSAVAADL  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+Y+N PVLL+ VRSP S  N +S+K  I + LH+ VSFSRLASF KLIVP+GL 
Sbjct  241   LENIADEYANTPVLLFAVRSPSSQMNLRSRKQTIFRELHDTVSFSRLASFGKLIVPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
              L+ SKAS  LCI++E+PY+ SAVYA+ALHS +LP+RME  GPTA+S    GA+++   +
Sbjct  301   FLNESKASTLLCIENEKPYHCSAVYAAALHSATLPYRMEPVGPTADSFDVFGAVDINGFV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA QARQN V+ LD +MPAP+L G Q + SLL N   LTPEV +D ED+ A+E M IH
Sbjct  361   QMLAGQARQNTVAILDAAMPAPALNGKQHEQSLLGNLQPLTPEVSEDVEDLQAVESMIIH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G L S  +RA + EVK TV   Y  AI+RP F HLSV+ CPLPIPLP+P++FGN +GQ+G
Sbjct  421   GALRSDGQRASISEVKETVNAIYGHAITRPMFCHLSVARCPLPIPLPYPSMFGNLVGQYG  480

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             ELL +P   +  RG LEVHSIPMA RLRSS+AILPFLE+RL NLR+ G+QRGA+GA++L 
Sbjct  481   ELLNSPFVGSSPRGSLEVHSIPMAVRLRSSSAILPFLENRLGNLRRYGLQRGALGAELLR  540

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             +WGF  DE+ D+GE LSK+V+T+KP+
Sbjct  541   NWGFADDELYDMGEMLSKMVSTMKPH  566



>ref|XP_002522327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40011.1| conserved hypothetical protein [Ricinus communis]
Length=574

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/564 (63%), Positives = 444/564 (79%), Gaps = 7/564 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHS--LNTDVLYRSGETQQ  1815
             MREIVT+QVG ++NFIGSHFWNFQDEL GLA   +SD VFK+ +  LN DVLYR+GETQQ
Sbjct  1     MREIVTVQVGGFANFIGSHFWNFQDELLGLATDPDSDPVFKHCADYLNMDVLYRNGETQQ  60

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G+ TYTPRL+S+  QGSLGSMSS G LY++  S SS+V+TW G ++T AS P K+NLFLQ
Sbjct  61    GIHTYTPRLISINGQGSLGSMSSHGTLYTDGSSTSSEVITWTGNISTHASGPSKKNLFLQ  120

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             SL  EE+ ++   G + R+S    EI+D+DIVECLEN V +WTDFSKV +HPQSLY+L G
Sbjct  121   SLSEEEQEISKPTGTNKRDSSIQREIRDEDIVECLENDVNFWTDFSKVHYHPQSLYELCG  180

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LWMD+QEF NYG GRD F    RGEE++ERLRFF+EECDHIQG QFIVDDSG FS LAA+
Sbjct  181   LWMDSQEFDNYGAGRDIFSEGLRGEEVSERLRFFVEECDHIQGFQFIVDDSGAFSALAAD  240

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
             FL+NIAD+Y+N PVLLY+V+ PGS  N +SQK +IS+ +H+AVSFSRL+SF ++IVP GL
Sbjct  241   FLENIADEYTNTPVLLYSVKGPGSHTNPRSQKQSISRKIHDAVSFSRLSSFCRMIVPAGL  300

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
               LS SKAS  LCI+DE+PY+ SAVYA+ALHS+SLPFRME  GP A+S Y SGA+N+YE+
Sbjct  301   PFLSRSKASTHLCIEDEKPYHCSAVYAAALHSISLPFRMESLGPAADSCYYSGAMNIYEL  360

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  Q RQN  + LDV+MPAP L+  Q + S L N   LTPE+ +  ED+ A+E +T+
Sbjct  361   VQMLTGQDRQNTATILDVAMPAPPLSWKQDELSFLWNLHPLTPELAE-VEDLQAVESLTV  419

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG LGSG  +A V EV  TV +AYE ++ RPKF HLSV  CPLPIPLPFP+IFGN + QH
Sbjct  420   HGALGSGGCQASVSEVTDTVNEAYEHSLVRPKFCHLSVDVCPLPIPLPFPSIFGNLVSQH  479

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELL +PI  + SRG L+VHS+PMA+RLRSS+AILPFLE+RL NLR+ GI+RGA+G ++L
Sbjct  480   GELLCSPIPGSSSRGSLDVHSLPMAARLRSSSAILPFLENRLLNLRRYGIERGALGTELL  539

Query  377   ESWGFGRDEVEDLGETLSKLVNTL  306
              SWGF +DE+ED+ E L K+V TL
Sbjct  540   RSWGFAKDELEDIEENLYKMVTTL  563



>gb|KHG26277.1| Protein misato [Gossypium arboreum]
Length=570

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 437/565 (77%), Gaps = 7/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVGS++NFIGSHFWNFQDE+ GLA     D VFK  SLN DV+YR+GET QG 
Sbjct  1     MREIVTVQVGSFANFIGSHFWNFQDEMLGLAADPYGDPVFKIQSLNMDVIYRTGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              +YTPRL+S+ FQGSLGS+SS G LYSE  ++ S+V+TWAG V+T ASEP  +NLFLQSL
Sbjct  61    TSYTPRLLSIDFQGSLGSVSSKGTLYSEGSNEPSEVVTWAGHVSTHASEPQNKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+++ + +G +G   DS +EIQD DIV CL+ GVQ+WTDFSKV +HPQSLY+++GLW
Sbjct  121   YQEEQDVALTNGNNGEAKDSQHEIQDTDIVRCLDEGVQFWTDFSKVHYHPQSLYEVNGLW  180

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             MD ++F NYGIGRD F  + RGEE+ ++LRFF+EECDHIQG QFIVDDSGGFS LAA+FL
Sbjct  181   MDVKQFDNYGIGRDVFMENLRGEEICDKLRFFVEECDHIQGFQFIVDDSGGFSPLAADFL  240

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             ++++D+Y+N PVLLY VR P S  +  S+K  + + LH+AVSFSRL+SF K+IVP+GL S
Sbjct  241   ESVSDEYTNTPVLLYAVRGPSSHMSLSSRKQTVVRDLHDAVSFSRLSSFCKMIVPVGLPS  300

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS SK S  L IKDE PY+ SAVYA+ALHS SLPFRME  GPTA+     GA+++   + 
Sbjct  301   LSRSKTSTFLNIKDENPYHCSAVYAAALHSTSLPFRMEPLGPTADLSDVFGAVDVSGFVQ  360

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +LA Q+RQNMV+ LDV+MP+P     Q + SLL N   LTPEV +D +D+ A+E M +HG
Sbjct  361   MLAGQSRQNMVAILDVAMPSP---WKQDKQSLLRNLQPLTPEVAEDVDDLQAVESMIVHG  417

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
              + SG  R  V EVK  +  AYE A +RP F HLS + CPLPIPLPFP+IFGN +GQHGE
Sbjct  418   AIESGGHRLSVSEVKNAIHGAYECATTRPMFCHLSAARCPLPIPLPFPSIFGNLVGQHGE  477

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             LL +PI  + SRG L+VHSIPMA+R+RSS AI+PFLE+RL NL K GI+RG  G ++L S
Sbjct  478   LLGSPILGSSSRGSLDVHSIPMAARMRSSRAIMPFLENRLANLHKFGIERGCPGTELLRS  537

Query  371   WGFGRDEVEDLGETLSKLVNTLKPY  297
             WGFG+DE+ED+GETLSK+V T+ P+
Sbjct  538   WGFGKDELEDMGETLSKMVRTVDPH  562



>ref|XP_004288066.1| PREDICTED: protein misato homolog 1-like [Fragaria vesca subsp. 
vesca]
Length=575

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/566 (63%), Positives = 446/566 (79%), Gaps = 6/566 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG ++NF+GSHFWNFQ+EL  LAE   +D VFKN +LN DV YR GET QG+
Sbjct  1     MREIVTLQVGGFANFVGSHFWNFQNELLELAEDPEADAVFKNQALNMDVFYRYGETHQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              +YTPRL+SV  QGSLGSMSS G LY+   S  S V+TW G V+TQASEP +RNLFLQSL
Sbjct  61    PSYTPRLLSVDLQGSLGSMSSSGTLYNGGSSVPSSVMTWDGNVSTQASEPRRRNLFLQSL  120

Query  1628  YMEEK--NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             Y EE+  +  + +G  G E+ S  E+ D DIVE LEN VQYWTD+SK  +HPQSLY+LSG
Sbjct  121   YQEEQENSFTVENGVSGAENGSQKEVSDGDIVEQLENDVQYWTDYSKAHYHPQSLYELSG  180

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LW+D  +F NYGIGRD+F     GEE++++LRFF+EECDHIQG QFIVDDSGGFS +A +
Sbjct  181   LWIDTHKFDNYGIGRDSFSGGLHGEEMSDKLRFFVEECDHIQGFQFIVDDSGGFSPIAVD  240

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
             FL++IAD+Y+NVPVLLY VR PGS  ++ SQK  +S+ LH+AVSFSRL+S  KLIVP+GL
Sbjct  241   FLESIADEYTNVPVLLYAVRGPGSAIDSISQKHRVSRKLHDAVSFSRLSSLCKLIVPVGL  300

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKASR LCIKDE+PY+ SA YA+ LHS+S+PFRME  GP+A+S YASGAL + EV
Sbjct  301   PSLSKSKASRLLCIKDEKPYHCSAAYAATLHSVSMPFRMEPVGPSADSTYASGALTVNEV  360

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ QARQNMV+ LD +MPAPSLTGNQ++ + L N   LTPEV +  ED+ ++E M +
Sbjct  361   VQILSGQARQNMVTILDAAMPAPSLTGNQIEQTFLRNLQPLTPEVSEHVEDLQSVESMIV  420

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
              G LG+G +RA ++EVK  V  AYE AI+RP FSHLSV+ CPLPIPLPFP+IFGN +GQH
Sbjct  421   LGTLGTGGQRASIHEVKSMVHAAYEHAITRPIFSHLSVAQCPLPIPLPFPSIFGNRVGQH  480

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELL TP+  + SRG L+VHSIP+A+RLRSS+A+LPFLE+RL +LRK GI RG  GA++L
Sbjct  481   GELLGTPVIGSSSRGSLDVHSIPVAARLRSSSAVLPFLENRLGDLRKFGIARGGPGAELL  540

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKP  300
              SWGF +DE ED+GETL K++  LKP
Sbjct  541   RSWGFTKDESEDMGETLCKMIMELKP  566



>ref|XP_004511967.1| PREDICTED: protein misato homolog 1-like isoform X2 [Cicer arietinum]
Length=569

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/564 (60%), Positives = 440/564 (78%), Gaps = 7/564 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVTIQVG Y+N++GSHFWNFQDEL GLA   ++D VFKN  +N DVLYR+GE QQG+
Sbjct  1     MKEIVTIQVGDYANYVGSHFWNFQDELIGLAGDPQADSVFKNQDINMDVLYRTGEIQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TYTPRLVS+  +GSLGSMSS G LY E  + +SDVLTW G V+TQASEP K+NLFLQSL
Sbjct  61    DTYTPRLVSINMRGSLGSMSSHGTLYKEAATTTSDVLTWTGGVSTQASEPHKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+N NMV+   G  S S +E Q+KDI E LE GVQYWTD+SKV FHP+SLY+L+G W
Sbjct  121   Y-EEENFNMVNTIGGSNSGSPSEYQNKDITEGLEKGVQYWTDYSKVHFHPKSLYELNGGW  179

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
              D ++F NYGIGRD+F    +GEE++ERLRFF+EECDHIQG QF+VDDSGGFS +AAEFL
Sbjct  180   TDVEDFDNYGIGRDSFDWASQGEEVSERLRFFVEECDHIQGFQFVVDDSGGFSAVAAEFL  239

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NI D+YSN+PV+LY VR PG+ A+ +S+K  I + LH+A+SFSRL+ + KLIVP+GL S
Sbjct  240   ENIVDEYSNIPVMLYAVRGPGTRASRQSRKRTILEELHDAISFSRLSPYCKLIVPVGLPS  299

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             L  +       I+DE+ Y++SAVYA+ALHS+SLPFR+   GPT ++  ASGA++ + +I 
Sbjct  300   LGKASKFLH--IEDEKHYHSSAVYAAALHSISLPFRLVPVGPTKDACSASGAVDFHGLIQ  357

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ Q RQNMVS LDV+MP P+LTG Q + SLL N  SLTP + +D ED+ A+E +T+HG
Sbjct  358   ILSGQGRQNMVSVLDVAMPTPALTGGQNELSLLGNLQSLTPHIAEDVEDIQAIEHLTVHG  417

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
                S  RRA V EVK TV  A+++A +RP F HLSV  CPLPIPLPFP+IFGN +G+HGE
Sbjct  418   AFASEGRRASVCEVKDTVDAAFQRANTRPLFYHLSVGLCPLPIPLPFPSIFGNQVGKHGE  477

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             ++ + +T + S+G L+VHSIPMA+RLRS++A+LP LES+L+NL + GI RGA GA++L S
Sbjct  478   MMSSKLTNSSSKGSLDVHSIPMAARLRSTSAVLPLLESKLQNLHRYGITRGAAGAELLRS  537

Query  371   WGFGRDEVEDLGETLSKLVNTLKP  300
             WGF ++E+ ++ ETLSK+V TL P
Sbjct  538   WGFDKEELNEMQETLSKMVATLCP  561



>ref|XP_010109895.1| hypothetical protein L484_013230 [Morus notabilis]
 gb|EXC24864.1| hypothetical protein L484_013230 [Morus notabilis]
Length=817

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/573 (61%), Positives = 442/573 (77%), Gaps = 13/573 (2%)
 Frame = -2

Query  1994  LSNTDMREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGE  1824
             L  T MREIV++QVG ++NF+GSHFWNFQDEL GLA    ++ VF+N   N DVLYR+GE
Sbjct  241   LHETTMREIVSVQVGGFANFVGSHFWNFQDELLGLASDPHAEPVFRNQHTNMDVLYRTGE  300

Query  1823  TQQGLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNL  1644
             T +G ++YTPR+VS+ FQGSLGSMS+CG LY+E     SDV+TW G V+T ASEP K+NL
Sbjct  301   TPRGDVSYTPRMVSLDFQGSLGSMSTCGTLYNESSPADSDVITWTGNVSTHASEPRKKNL  360

Query  1643  FLQSLYMEEKN----MNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQ  1476
             FLQ LY EE+     MN V+G  G +S S  EI D+D+VE LEN V+YWTDFSKV +HP+
Sbjct  361   FLQRLYEEEEESSTLMNGVNG--GGKSSSQREIHDRDVVENLENVVKYWTDFSKVHYHPR  418

Query  1475  SLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGG  1299
             SLY+ SGLWMD+QEF NYGIGRD F     GEE+NER+RFF+EECDHIQG QFIVDDSGG
Sbjct  419   SLYEFSGLWMDSQEFDNYGIGRDVFSG---GEEINERIRFFVEECDHIQGFQFIVDDSGG  475

Query  1298  FSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSK  1119
             FS +AA+ L+ IAD+Y N PVLLY+VRSP SF N  SQK  +S+ LH+AVSFS+L+SF K
Sbjct  476   FSAVAADLLETIADEYGNTPVLLYSVRSPVSFMNPISQKQTVSRDLHDAVSFSKLSSFCK  535

Query  1118  LIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASG  939
             LIVPIGL SLS SKA+  L +KDE+P++ SAVYA+ LHS+SLPFRME  GP A+S   SG
Sbjct  536   LIVPIGLPSLSTSKAATFLSVKDEKPHHCSAVYAATLHSVSLPFRMEQLGPAADSRDISG  595

Query  938   ALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMH  759
             ++++  ++ +LA Q+R+NMV+ +DV+MPAP LTG Q   +LL N   LTPE+ +D  D H
Sbjct  596   SMDVNGLVQMLAGQSRENMVAIMDVAMPAPPLTGAQGNQTLLGNLHPLTPEISEDVADFH  655

Query  758   AMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiF  579
             A+E +T  G   +G  RA V EV   V+ AY++A SRP F HLSV+ CPLPIPLPFP+IF
Sbjct  656   AVESITALGTFSAGVSRASVPEVNARVEAAYKRATSRPMFCHLSVAQCPLPIPLPFPSIF  715

Query  578   GNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRG  399
             G S+GQ GELL +PIT + SRG L+VHSIP+A+RLRSS+A+LPFLE+RL  L + GI+RG
Sbjct  716   GASVGQQGELLGSPITGSSSRGSLDVHSIPLAARLRSSSAVLPFLENRLGKLHRYGIERG  775

Query  398   AIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             A GAQ+L SWGFG+DE+ED+GE +SK+V  LKP
Sbjct  776   APGAQLLRSWGFGQDELEDMGEMMSKMVVQLKP  808



>ref|XP_004511966.1| PREDICTED: protein misato homolog 1-like isoform X1 [Cicer arietinum]
Length=570

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/565 (60%), Positives = 440/565 (78%), Gaps = 8/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVTIQVG Y+N++GSHFWNFQDEL GLA   ++D VFKN  +N DVLYR+GE QQG+
Sbjct  1     MKEIVTIQVGDYANYVGSHFWNFQDELIGLAGDPQADSVFKNQDINMDVLYRTGEIQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TYTPRLVS+  +GSLGSMSS G LY E  + +SDVLTW G V+TQASEP K+NLFLQSL
Sbjct  61    DTYTPRLVSINMRGSLGSMSSHGTLYKEAATTTSDVLTWTGGVSTQASEPHKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+N NMV+   G  S S +E Q+KDI E LE GVQYWTD+SKV FHP+SLY+L+G W
Sbjct  121   Y-EEENFNMVNTIGGSNSGSPSEYQNKDITEGLEKGVQYWTDYSKVHFHPKSLYELNGGW  179

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
              D ++F NYGIGRD+F    +GEE++ERLRFF+EECDHIQG QF+VDDSGGFS +AAEFL
Sbjct  180   TDVEDFDNYGIGRDSFDWASQGEEVSERLRFFVEECDHIQGFQFVVDDSGGFSAVAAEFL  239

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NI D+YSN+PV+LY VR PG+ A+ +S+K  I + LH+A+SFSRL+ + KLIVP+GL S
Sbjct  240   ENIVDEYSNIPVMLYAVRGPGTRASRQSRKRTILEELHDAISFSRLSPYCKLIVPVGLPS  299

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             L  +       I+DE+ Y++SAVYA+ALHS+SLPFR+   GPT ++  ASGA++ + +I 
Sbjct  300   LGKASKFLH--IEDEKHYHSSAVYAAALHSISLPFRLVPVGPTKDACSASGAVDFHGLIQ  357

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ Q RQNMVS LDV+MP P+LTG Q + SLL N  SLTP + +D ED+ A+E +T+HG
Sbjct  358   ILSGQGRQNMVSVLDVAMPTPALTGGQNELSLLGNLQSLTPHIAEDVEDIQAIEHLTVHG  417

Query  731   VLGS-GSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
                S   RRA V EVK TV  A+++A +RP F HLSV  CPLPIPLPFP+IFGN +G+HG
Sbjct  418   AFASVEGRRASVCEVKDTVDAAFQRANTRPLFYHLSVGLCPLPIPLPFPSIFGNQVGKHG  477

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E++ + +T + S+G L+VHSIPMA+RLRS++A+LP LES+L+NL + GI RGA GA++L 
Sbjct  478   EMMSSKLTNSSSKGSLDVHSIPMAARLRSTSAVLPLLESKLQNLHRYGITRGAAGAELLR  537

Query  374   SWGFGRDEVEDLGETLSKLVNTLKP  300
             SWGF ++E+ ++ ETLSK+V TL P
Sbjct  538   SWGFDKEELNEMQETLSKMVATLCP  562



>ref|XP_010680443.1| PREDICTED: protein misato homolog 1 [Beta vulgaris subsp. vulgaris]
Length=570

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/565 (59%), Positives = 432/565 (76%), Gaps = 7/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VTIQVG ++NFIGSHFWNFQDEL GLA   +SD VFK+H L+ DVLYR+GET +G+
Sbjct  1     MREVVTIQVGGFANFIGSHFWNFQDELLGLAGDPDSDPVFKSHGLDMDVLYRTGETLEGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSV +QGSLGSMSSCG LY+     SS V TW G ++TQ S+P KRNLFLQSL
Sbjct  61    LTYTPRLVSVNYQGSLGSMSSCGTLYNRTRELSSPVATWKGDISTQHSQPQKRNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
               EE+  +     +   ++S ++ QDKDIVECLEN V +WTDFSK  +HPQS+Y+L+GLW
Sbjct  121   REEEQKQSTR--IENIHANSQDDFQDKDIVECLENDVHFWTDFSKSHYHPQSIYELNGLW  178

Query  1448  MDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
              D ++FN YG+G+D F    RGEE++ERLRFF+EECDH+QG+QF+VDDSGGFS +AA+FL
Sbjct  179   TDVEDFNTYGMGKDVFSEGFRGEEMSERLRFFLEECDHVQGIQFVVDDSGGFSSVAADFL  238

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             QNIAD+Y+N PV+LYT R PGSF +++S K N+S+ LHNAVSF++L+S  KLIVP+GL  
Sbjct  239   QNIADEYTNTPVVLYTARDPGSFVSSRSLKRNVSRDLHNAVSFAKLSSLCKLIVPVGLPF  298

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             L  +KAS  L + DE+PY++SAVYA+ALHSLSLPFRM+  GPTA S   SGAL++  ++ 
Sbjct  299   LGGNKASTYLRVNDEKPYHSSAVYAAALHSLSLPFRMDLLGPTAVSECTSGALDINGIVQ  358

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+   RQNMV+ LD +MPA S  G  V+ S       LTPE+  D ED  ++E + +HG
Sbjct  359   MLSGNPRQNMVAILDATMPA-SAIGEPVEESFSSKLQPLTPEISDDLEDAQSVETLVLHG  417

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
                SG +RAP+ EV+R +  AY    SRP+F HLS + CPLPIPLPFP+IF  ++ Q G+
Sbjct  418   AFESGEQRAPISEVRRVISAAYGPTSSRPRFCHLSAATCPLPIPLPFPSIFSENVSQCGQ  477

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             LL +P T++ S+G L+VHSIPMA+RLRSS+A+LPFL  RLENLR+ GIQRGA+G  +L S
Sbjct  478   LLGSPSTDSASKGSLDVHSIPMAARLRSSSAVLPFLSKRLENLRRFGIQRGALGGDLLRS  537

Query  371   WGFGRDEVEDLGETLSKLVNTLKPY  297
             WGFG++EV+D+GETLS +V  L PY
Sbjct  538   WGFGKEEVDDMGETLSDMVKALDPY  562



>ref|XP_003517285.1| PREDICTED: protein misato homolog 1-like isoform X1 [Glycine 
max]
Length=572

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/564 (60%), Positives = 443/564 (79%), Gaps = 4/564 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVT+QVG ++NF+GSHFWNFQDEL GLA    +D VFKN  LN DVLYR+GETQQG+
Sbjct  1     MKEIVTVQVGDFANFVGSHFWNFQDELLGLAGNPSADSVFKNQDLNMDVLYRTGETQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              +YTPRL+S+  +GSLGSMSS G LY+E  S + DV+TW G+V+TQASEP KRNLFLQ L
Sbjct  61    PSYTPRLLSINLRGSLGSMSSRGTLYTEVASTTPDVVTWTGRVSTQASEPYKRNLFLQRL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+++NM++   G  + S +E +DKDI ECLENGVQ+WTD+SKV +HP+SLY+L+G+W
Sbjct  121   YEEEESLNMINEIRGSNNGSQSEYEDKDITECLENGVQFWTDYSKVHYHPRSLYELNGVW  180

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
                +EF NYGIGRD+F    +GEE+ +RLRFF+EECDHIQG QF+VDDSGGFS +A+EFL
Sbjct  181   AHVEEFDNYGIGRDSFAWAAQGEEIGDRLRFFVEECDHIQGFQFVVDDSGGFSAVASEFL  240

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NI D+Y+N+PVLLY V+  GS  N +S+K  + + LH+AVSFSRL+S+ KLIVP+GL S
Sbjct  241   ENIVDEYTNIPVLLYAVQGSGSRTNLQSRKRAVLEDLHDAVSFSRLSSYCKLIVPVGLPS  300

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS SKASR L I+D + Y++SAVYA+ALHS+SLPFRM   GPTA++   SGA++++ V+ 
Sbjct  301   LSKSKASRFLHIEDAKHYHSSAVYAAALHSISLPFRMVPVGPTADACSVSGAVDVHGVVQ  360

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ Q RQNMVS LDV+MPAP+LTG Q + SLL+    LTP++ +D EDM A+E MT+HG
Sbjct  361   MLSGQGRQNMVSVLDVAMPAPALTGEQNELSLLEILQPLTPQIAEDVEDMQAIEHMTVHG  420

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
              L S   RA V EVK TV  A+  A +RP F HLSV+  PLPIPLPFP+IFGN++GQHGE
Sbjct  421   ALASEGHRASVGEVKDTVDAAFRCANTRPMFCHLSVALSPLPIPLPFPSIFGNNVGQHGE  480

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             L+   IT +  +G L++HSIPMA+RLRSS+ +LP LES+L NL + GIQRGA GA++L S
Sbjct  481   LMSGQITNSSPKGSLDIHSIPMAARLRSSSIVLPLLESKLRNLHQFGIQRGAAGAELLRS  540

Query  371   WGFGRDEVEDLGETLSKLVNTLKP  300
             WGFG++E+ ++ E LSK+V  L P
Sbjct  541   WGFGQEELVEMEEMLSKMVAALHP  564



>ref|XP_007047166.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal, putative 
isoform 4 [Theobroma cacao]
 gb|EOX91323.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal, putative 
isoform 4 [Theobroma cacao]
Length=527

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/518 (64%), Positives = 414/518 (80%), Gaps = 1/518 (0%)
 Frame = -2

Query  1847  DVLYRSGETQQGLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQA  1668
             DVLYR+GETQQG LTYTPRL+S+ FQGSLG MSS G LY+E  +  S+V+TW G V+T A
Sbjct  2     DVLYRTGETQQGTLTYTPRLLSIDFQGSLGPMSSRGTLYNEGSNAPSEVVTWEGNVSTHA  61

Query  1667  SEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQ  1488
             SEP K+NLFLQSLY EE+++ +V+G +G + D  NEIQD DIV+CL+ GVQ+WTDFSKV 
Sbjct  62    SEPQKKNLFLQSLYQEEQDVPLVNGINGGKKDLQNEIQDTDIVKCLDRGVQFWTDFSKVH  121

Query  1487  FHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVD  1311
             +HPQSLY+++GLWMDAQEF NYGIGRD F  + +GEE+ ERLRFF+EECDHIQG +FI D
Sbjct  122   YHPQSLYEVNGLWMDAQEFDNYGIGRDVFTENLQGEEVCERLRFFVEECDHIQGFKFIAD  181

Query  1310  DSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLA  1131
             DSGGFS +AA+FL+NIAD+YSN PVLLY VR PGS  N +S+K  + + LH+AVSFSRL+
Sbjct  182   DSGGFSPIAADFLENIADEYSNTPVLLYAVRGPGSHMNLRSRKQTVVRDLHDAVSFSRLS  241

Query  1130  SFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESI  951
             SF K+IVP+GL  LS SKAS  L I+DE PY+ SAVYA+ALHS SLPFRME PGP+A+S 
Sbjct  242   SFCKMIVPVGLPFLSMSKASTYLNIEDENPYHCSAVYAAALHSASLPFRMEAPGPSADSS  301

Query  950   YASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDN  771
                GAL++  ++ +LA Q+RQNMV+ LD++MPAP +TG Q + SLL N   LTPEV +D 
Sbjct  302   DTVGALDVNGIVQMLAGQSRQNMVAILDIAMPAPGMTGRQDEKSLLGNLHPLTPEVAEDM  361

Query  770   EDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpf  591
             +D+ A+E MT+HG +GS   RA V EVK  +   YE AI RP F HLSV+ CPLPIPLPF
Sbjct  362   DDLQAVESMTVHGAIGSEDHRASVSEVKNAINAEYEHAIIRPMFCHLSVARCPLPIPLPF  421

Query  590   paiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLG  411
             P+IFGN +GQHGELL +PI  + SRG L+VHSIPMA+RLRSS AILPFLE+RL NLRK G
Sbjct  422   PSIFGNLVGQHGELLGSPILGSSSRGSLDVHSIPMAARLRSSCAILPFLENRLANLRKFG  481

Query  410   IQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             I+RG++G ++L SWGFGRDEVED+GETLSK+V  + P+
Sbjct  482   IERGSLGTELLRSWGFGRDEVEDIGETLSKMVKAVNPH  519



>ref|XP_008440245.1| PREDICTED: protein misato homolog 1 isoform X1 [Cucumis melo]
 ref|XP_008440246.1| PREDICTED: protein misato homolog 1 isoform X1 [Cucumis melo]
Length=568

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/565 (60%), Positives = 435/565 (77%), Gaps = 9/565 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA     D VFKN  LN DVLYRSGETQQG+
Sbjct  1     MRELVTVQVGEFANFVGSHFWNFQDELIGLAADPLGDAVFKNQHLNMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSVGF+G LGS+S+ G LY++     SD++TW G V T  +EP K+NLFLQSL
Sbjct  61    LTYTPRLVSVGFKGGLGSVSARGTLYNDDVDTPSDIVTWRGSVATHHTEPRKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
               EE+  N+VDG    E+ S  EI+DKDIV+CLEN V +WTDFSKV +HPQSLYQL+G W
Sbjct  121   SEEEQE-NLVDG----ENSSRGEIEDKDIVKCLENDVTFWTDFSKVHYHPQSLYQLAGSW  175

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             +DAQEF NYGIG+++F    +GE+++ERLRFF+EECDHIQG QFIV+DSGGFS +A +FL
Sbjct  176   VDAQEFDNYGIGKESFSWSLQGEDIDERLRFFVEECDHIQGFQFIVEDSGGFSAVAGDFL  235

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +++AD+YSN PVLLY+VRSP S    ++++  +S+ LH+A+SF+RL+SF +L VP+GL S
Sbjct  236   ESVADEYSNTPVLLYSVRSPSSNVLRENKRQIVSRDLHDAISFARLSSFCQLYVPVGLPS  295

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS SKA+  LCI D++PY+ SAVYA+ALHS+ LPFRME  GPT +S Y SGAL++ +++ 
Sbjct  296   LSRSKAATHLCIDDQKPYHCSAVYAAALHSIGLPFRMEAQGPTTDSCYVSGALHVNDMVR  355

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +LA Q RQNMV+ LDV+MPAP+L    +  SLL +   LTPEV++D ED+ A+E MT+HG
Sbjct  356   MLAGQGRQNMVAILDVAMPAPTLLEKHLGQSLLGSLQPLTPEVKEDAEDLLALESMTVHG  415

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
             V  SG  RA V E+K  +  AYE    RP   HLS + CPLP+PL FP+IFGN +GQHG+
Sbjct  416   VFESGGDRASVSELKDQISAAYEGETVRPMLCHLSAAQCPLPVPLSFPSIFGNLVGQHGQ  475

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             LL TPI+   SRG L+V+SIPMA+RLRSS A+LPF+E RL NL + G  +G+    +L S
Sbjct  476   LLATPISGVSSRGSLDVYSIPMAARLRSSNAVLPFIERRLTNLLRHGTVQGSSATPLLRS  535

Query  371   WGFGRDEVEDLGETLSKLVNTLKPY  297
             WGFGR+E+ED+GE+LSK+V  L P+
Sbjct  536   WGFGREELEDMGESLSKMVLALNPH  560



>ref|XP_010028287.1| PREDICTED: protein misato homolog 1 isoform X1 [Eucalyptus grandis]
 gb|KCW55003.1| hypothetical protein EUGRSUZ_I00976 [Eucalyptus grandis]
Length=565

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/565 (60%), Positives = 428/565 (76%), Gaps = 12/565 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVT+QVG ++NF+GSHFWNFQDEL GLAE   +D VFK   L+ DVLYR+GETQQG+
Sbjct  1     MKEIVTVQVGGFANFVGSHFWNFQDELLGLAEDPCADSVFKKQHLDMDVLYRTGETQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVS+ FQGSLGSMSS G LY+ +P+  SD+ TW   V+T  +E  K+NLFLQSL
Sbjct  61    LTYTPRLVSIDFQGSLGSMSSHGTLYNHEPTIPSDITTWTAGVSTHTAERHKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y E+       GP G       E QDKDIVE L  GV++WTDFSKV +HPQSLY+LSGLW
Sbjct  121   YEEQDRAVDKSGPQG-------EYQDKDIVESLGKGVKFWTDFSKVHYHPQSLYELSGLW  173

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             MDA+EF NYGIGRD   +  +GEE++ERLR F+EECD +QG QF+VDDSGGFS +A+E L
Sbjct  174   MDAREFDNYGIGRDALSHGLQGEEISERLRVFVEECDRVQGFQFMVDDSGGFSAVASELL  233

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NIAD+YSN PVLLY +R+P S+ N   +K  I +SLH+AVSFSRLAS+  L+VP+GL S
Sbjct  234   ENIADEYSNTPVLLYALRAPESYVNLGKRKQTILRSLHDAVSFSRLASYCHLVVPVGLPS  293

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS S+AS   CI+DE+PY+ SAVYA+ALHS+SLPFRM    PTA+  Y SGA+++ +V+ 
Sbjct  294   LSTSRASSFFCIEDERPYHCSAVYAAALHSISLPFRMGSLAPTADLHYVSGAVDVGDVVR  353

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ Q+R+  V+ LD++MPAPSLTG +    LL+N   +TPE+ +D ED+ A+E MTIHG
Sbjct  354   ILSGQSRRK-VAILDMAMPAPSLTGKESGERLLNNLHPVTPEITEDVEDLQAVETMTIHG  412

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
             VLG G   A   EVK T+  AYE   +RPKF HLS +  PLPIPLPFP+IF N +GQ GE
Sbjct  413   VLGPGGHPASASEVKDTIHAAYEHTSTRPKFCHLSAAHSPLPIPLPFPSIFKNVVGQRGE  472

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             LLE P      +G LEVHS+PMA RLRSS+AILP+LE+RL  LR+ G+ RGA GA+++ S
Sbjct  473   LLENPTASPLLKGSLEVHSVPMAVRLRSSSAILPYLENRLGYLRRYGVDRGAPGAELVRS  532

Query  371   WGFGRDEVEDLGETLSKLVNTLKPY  297
             WGFG+DE+ED GE LSK++N LKP+
Sbjct  533   WGFGKDELEDFGEALSKMINELKPH  557



>ref|XP_003537356.1| PREDICTED: protein misato homolog 1-like [Glycine max]
Length=572

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/562 (61%), Positives = 443/562 (79%), Gaps = 4/562 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVT+QVG ++NF+GSHFWNFQDEL GLAE   +D  FKN  LN DVLYR+GETQQG+
Sbjct  1     MKEIVTVQVGDFANFVGSHFWNFQDELLGLAEDPFADSFFKNQDLNMDVLYRTGETQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              +YTPRL+S+  +GSLGSMSS G LY+E  S + DV+TW G V+TQASEP KRNLFLQSL
Sbjct  61    PSYTPRLLSINLRGSLGSMSSRGTLYTEVASTTLDVVTWTGGVSTQASEPYKRNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+N+NM++   G  + S +E +DKDI ECLENGVQ+WTD+SKV +HP+SLY+L+G+W
Sbjct  121   YEEEENLNMINEIRGSNNGSQSEYEDKDITECLENGVQFWTDYSKVHYHPRSLYELNGVW  180

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
              D +EF NYGIGRD+F    +GEE+++RLRFF+EECDHIQG QF+VDDSGGFS +AAEFL
Sbjct  181   ADVEEFDNYGIGRDSFAWAAQGEEISDRLRFFVEECDHIQGFQFVVDDSGGFSAVAAEFL  240

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NI D+Y+N+PVLLY V+  GS  N +S+K  + + LH+AVSFSRL+SF KLIVP+GL S
Sbjct  241   ENIVDEYTNIPVLLYAVQGSGSRTNLQSRKHTVLEDLHDAVSFSRLSSFCKLIVPVGLPS  300

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS SKASR L I+D + Y++SAVYA+ALHS+SLPFRM   GPT+++   SGA++++ V+ 
Sbjct  301   LSKSKASRFLHIEDAKHYHSSAVYAAALHSISLPFRMVPVGPTSDACSVSGAVDVHGVVQ  360

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ Q RQNMVS LDV+MPAP+LTG Q + SLL+    LTP++ +D EDM A+E MT+HG
Sbjct  361   MLSGQGRQNMVSVLDVAMPAPALTGVQNELSLLEILQPLTPQIAEDVEDMQAIEHMTVHG  420

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
              L S   RA V +VK TV  A+  A +RP F HLSV+  PLPIPLPFP+IFGN++GQHGE
Sbjct  421   ALASEGHRASVGQVKDTVDAAFLCADTRPMFCHLSVALSPLPIPLPFPSIFGNNVGQHGE  480

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             L+   IT +  +G L +HSIPMA+RLRSS+ +LPFLES+L NL + GIQR A GA++L +
Sbjct  481   LMSGQITNSSPKGSLVIHSIPMAARLRSSSIVLPFLESKLRNLHQYGIQRRAAGAELLRT  540

Query  371   WGFGRDEVEDLGETLSKLVNTL  306
             WGFG++E+ ++ E LSK+V  L
Sbjct  541   WGFGQEELVEMEEVLSKMVAAL  562



>ref|XP_010263736.1| PREDICTED: protein misato homolog 1 isoform X2 [Nelumbo nucifera]
Length=567

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/567 (61%), Positives = 431/567 (76%), Gaps = 15/567 (3%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVGS++NFIGSHFWNFQDEL GL +    D VFKN SL+ DV YR+GE  QG+
Sbjct  1     MREIVTIQVGSFANFIGSHFWNFQDELLGLVDDPHGDPVFKNQSLDMDVFYRAGEMPQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TY+PRL+S+ FQG+LGS+SS G+LY E PS    V TW G VT   S+P K+NLFLQ L
Sbjct  61    PTYSPRLLSIDFQGTLGSLSSHGSLYHEIPSAPMHVRTWTGNVTKLVSDPQKKNLFLQRL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
               EE       G    E D H  IQDKDIVECLENGV +WTDFSKV +HPQSLY+L GLW
Sbjct  121   DEEEH------GKPSAEEDDH--IQDKDIVECLENGVHFWTDFSKVHYHPQSLYELKGLW  172

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             MDAQEF NYGIGRD F    RGEE+N+RLRFF+EECD IQG+QFIVDDSGGFS +AAEFL
Sbjct  173   MDAQEFDNYGIGRDIFSEALRGEEINDRLRFFVEECDQIQGIQFIVDDSGGFSSVAAEFL  232

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKS---QKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             +NIAD+Y+N PVLLY  R PG     K+   +K +IS++LH+AVSFSRL+SFSKLIVPIG
Sbjct  233   ENIADEYTNTPVLLYAARGPGPGTTNKNALGRKDSISKALHDAVSFSRLSSFSKLIVPIG  292

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L  LS SKAS  LCI+D + Y+ SAVYA+ALHS+SLPFRME  G   +S Y +GA+++  
Sbjct  293   LPFLSRSKASTFLCIEDSKAYHCSAVYAAALHSISLPFRMESIGSATDSHYVAGAIDVNG  352

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             ++ +LA QARQNMV+ LDV+MPAP LTG Q + S+     SLTPE+ +D ED  A+E  T
Sbjct  353   IVQMLAGQARQNMVAILDVAMPAPCLTGEQNKQSVQRGLHSLTPEIAEDVEDFRAIESTT  412

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             +HG+  SG   A + EV+ ++  +YE A++RP FSHLSV+ CPLPIPLPFP+IF N + +
Sbjct  413   VHGIHHSGGNPASISEVQDSIFASYESALTRPMFSHLSVALCPLPIPLPFPSIFSNLVRE  472

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
              GELL++PI  + SRG L+VHSIPMA+RLRSS AILP++E+RL NLR+ GI++GA G++V
Sbjct  473   RGELLDSPIYGSQSRGSLDVHSIPMAARLRSSNAILPYIETRLGNLRRFGIEKGAPGSEV  532

Query  380   LESWGFGRDEVEDLGETLSKLVNTLKP  300
             L SWGF +DE++D+GE LS++V  L P
Sbjct  533   LRSWGFEKDELQDMGEELSRMVMALDP  559



>ref|XP_010263735.1| PREDICTED: protein misato homolog 1 isoform X1 [Nelumbo nucifera]
Length=578

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/578 (60%), Positives = 431/578 (75%), Gaps = 26/578 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGET----  1821
             MREIVTIQVGS++NFIGSHFWNFQDEL GL +    D VFKN SL+ DV YR+GE     
Sbjct  1     MREIVTIQVGSFANFIGSHFWNFQDELLGLVDDPHGDPVFKNQSLDMDVFYRAGEMPQTS  60

Query  1820  -------QQGLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASE  1662
                     QG+ TY+PRL+S+ FQG+LGS+SS G+LY E PS    V TW G VT   S+
Sbjct  61    FAYTLKHMQGIPTYSPRLLSIDFQGTLGSLSSHGSLYHEIPSAPMHVRTWTGNVTKLVSD  120

Query  1661  PLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFH  1482
             P K+NLFLQ L  EE       G    E D H  IQDKDIVECLENGV +WTDFSKV +H
Sbjct  121   PQKKNLFLQRLDEEEH------GKPSAEEDDH--IQDKDIVECLENGVHFWTDFSKVHYH  172

Query  1481  PQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDS  1305
             PQSLY+L GLWMDAQEF NYGIGRD F    RGEE+N+RLRFF+EECD IQG+QFIVDDS
Sbjct  173   PQSLYELKGLWMDAQEFDNYGIGRDIFSEALRGEEINDRLRFFVEECDQIQGIQFIVDDS  232

Query  1304  GGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKS---QKLNISQSLHNAVSFSRL  1134
             GGFS +AAEFL+NIAD+Y+N PVLLY  R PG     K+   +K +IS++LH+AVSFSRL
Sbjct  233   GGFSSVAAEFLENIADEYTNTPVLLYAARGPGPGTTNKNALGRKDSISKALHDAVSFSRL  292

Query  1133  ASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAES  954
             +SFSKLIVPIGL  LS SKAS  LCI+D + Y+ SAVYA+ALHS+SLPFRME  G   +S
Sbjct  293   SSFSKLIVPIGLPFLSRSKASTFLCIEDSKAYHCSAVYAAALHSISLPFRMESIGSATDS  352

Query  953   IYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQD  774
              Y +GA+++  ++ +LA QARQNMV+ LDV+MPAP LTG Q + S+     SLTPE+ +D
Sbjct  353   HYVAGAIDVNGIVQMLAGQARQNMVAILDVAMPAPCLTGEQNKQSVQRGLHSLTPEIAED  412

Query  773   NEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplp  594
              ED  A+E  T+HG+  SG   A + EV+ ++  +YE A++RP FSHLSV+ CPLPIPLP
Sbjct  413   VEDFRAIESTTVHGIHHSGGNPASISEVQDSIFASYESALTRPMFSHLSVALCPLPIPLP  472

Query  593   fpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKL  414
             FP+IF N + + GELL++PI  + SRG L+VHSIPMA+RLRSS AILP++E+RL NLR+ 
Sbjct  473   FPSIFSNLVRERGELLDSPIYGSQSRGSLDVHSIPMAARLRSSNAILPYIETRLGNLRRF  532

Query  413   GIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             GI++GA G++VL SWGF +DE++D+GE LS++V  L P
Sbjct  533   GIEKGAPGSEVLRSWGFEKDELQDMGEELSRMVMALDP  570



>ref|XP_004141925.1| PREDICTED: protein misato homolog 1-like [Cucumis sativus]
 ref|XP_004171235.1| PREDICTED: protein misato homolog 1-like [Cucumis sativus]
 gb|KGN48506.1| hypothetical protein Csa_6G490200 [Cucumis sativus]
Length=568

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/567 (59%), Positives = 434/567 (77%), Gaps = 13/567 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA     D VFKN  LN DVLYRSGETQQG+
Sbjct  1     MRELVTVQVGEFANFVGSHFWNFQDELIGLAADPLGDAVFKNQHLNMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSVGF+G LGS+S+ G LY++     SD +TW G V T  +EP K+NLFLQSL
Sbjct  61    LTYTPRLVSVGFKGGLGSVSARGTLYNDDVDTPSDTVTWRGSVATHYTEPCKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
               EE+  N+VDG    ++    EI+DKDI+ECLE+ V +WTDFSKV +HPQSLYQ  G W
Sbjct  121   SEEEQE-NLVDG----KNSGRGEIEDKDIIECLESDVTFWTDFSKVHYHPQSLYQFVGSW  175

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             +DAQEF NYGIG+++F    +GE+++ERLRFF+EECDHIQG QFIVDDSGGFS +A +FL
Sbjct  176   VDAQEFDNYGIGKESFSWSLQGEDIDERLRFFVEECDHIQGFQFIVDDSGGFSAVAGDFL  235

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANT--KSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
             +++AD+YSN PVLLY+VRSP S +N   +++K  IS+ LH+A+SF+RL+SF +L VP+GL
Sbjct  236   ESVADEYSNTPVLLYSVRSPSS-SNVLRENKKQIISRDLHDAISFARLSSFCQLYVPVGL  294

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SL+ SKA+  LCI D++PY+ SAVYA+ALHS+ LPFRME  GPT +S Y SGA+++ ++
Sbjct  295   PSLNRSKAATHLCIDDQKPYHCSAVYAAALHSIGLPFRMEAQGPTTDSCYVSGAVHVNDM  354

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +LA Q RQNMV+ LDV+MPAP+L    +  SLL +   LTPEV++D ED+ A+E MT 
Sbjct  355   VRMLAGQGRQNMVAILDVAMPAPTLLEKHLGQSLLGSLQPLTPEVKEDAEDLLALESMTA  414

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HGV  SG  RA V E+K  +  AYE    RP   HLS + CPLP+PLPFP+IFGN +GQH
Sbjct  415   HGVFESGGDRASVSELKDQISAAYEGETVRPMLCHLSAAQCPLPVPLPFPSIFGNLVGQH  474

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             G+LL TPI+   +RG L+V+SIPMA+RLRSS A+LPF+E RL NL + G+Q G+    +L
Sbjct  475   GQLLATPISGVSTRGSLDVYSIPMAARLRSSNAVLPFIERRLTNLLRHGVQ-GSSATPLL  533

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKPY  297
              SWGFGR+E+ED+GE+LSK+V  L P+
Sbjct  534   RSWGFGREELEDMGESLSKMVLALNPH  560



>gb|KHN36205.1| Protein misato like 1 [Glycine soja]
Length=589

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/583 (57%), Positives = 438/583 (75%), Gaps = 25/583 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQ--  1815
             M+EIVT+QVG ++NF+GSHFWNFQDEL GLA    +D VFKN  LN DVLYR+GETQQ  
Sbjct  1     MKEIVTVQVGDFANFVGSHFWNFQDELLGLAGNPSADSVFKNQDLNMDVLYRTGETQQCL  60

Query  1814  -----------------GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAG  1686
                              G+ +YTPRL+S+  +GSLGSMSS G LY+E  S + DV+TW G
Sbjct  61    HFMCHFHITYCTSSNIKGIPSYTPRLLSINIRGSLGSMSSRGTLYTEVASTTPDVVTWTG  120

Query  1685  KVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWT  1506
             +V+TQASEP KRNLFLQ LY EE+++NM++   G  + S +E +DKDI ECLENGVQ+WT
Sbjct  121   RVSTQASEPYKRNLFLQRLYEEEESLNMINEIRGSNNGSQSEYEDKDITECLENGVQFWT  180

Query  1505  DFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQG  1329
             D+SKV +HP+SLY+L+G+W   +EF NYGIGRD+F    +GEE+ +RLRFF+EECDHIQG
Sbjct  181   DYSKVHYHPRSLYELNGVWAHVEEFDNYGIGRDSFAWAAQGEEIGDRLRFFVEECDHIQG  240

Query  1328  VQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAV  1149
              QF+VDDSGGFS +A+EFL+NI D+Y+N+PVLLY V+  GS  N +S+K  + + LH+AV
Sbjct  241   FQFVVDDSGGFSAVASEFLENIVDEYTNIPVLLYAVQGSGSRTNLQSRKRAVLEDLHDAV  300

Query  1148  SFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPG  969
             SFSRL+S+ KLIVP+GL SLS +       I+D + Y++SAVYA+ALHS+SLPFRM   G
Sbjct  301   SFSRLSSYCKLIVPVGLPSLSKASRFLH--IEDAKHYHSSAVYAAALHSISLPFRMVPVG  358

Query  968   PTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
             PTA++   SGA++++ V+ +L+ Q RQNMVS LDV+MPAP+LTG Q + SLL+    LTP
Sbjct  359   PTADACSVSGAVDVHGVVQMLSGQGRQNMVSVLDVAMPAPALTGEQNELSLLEILQPLTP  418

Query  788   EVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccpl  609
             ++ +D EDM A+E MT+HG L S   RA V EVK TV  A+  A +RP F HLSV+  PL
Sbjct  419   QIAEDVEDMQAIEHMTVHGALASEGHRASVGEVKDTVDAAFRCANTRPMFCHLSVALSPL  478

Query  608   piplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLE  429
             PIPLPFP+IFGN++GQHGEL+   IT +  +G L++HSIPMA+RLRSS+ +LP LES+L 
Sbjct  479   PIPLPFPSIFGNNVGQHGELMSGQITNSSPKGSLDIHSIPMAARLRSSSIVLPLLESKLR  538

Query  428   NLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             NL + GIQRGA GA++L SWGFG++E+ ++ E LSK+V  L P
Sbjct  539   NLHQFGIQRGAAGAELLRSWGFGQEELVEMEEMLSKMVAALHP  581



>ref|XP_003611798.1| Misato-like protein [Medicago truncatula]
 gb|AES94756.1| misato segment II myosin-like domain protein [Medicago truncatula]
Length=566

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/565 (59%), Positives = 432/565 (76%), Gaps = 12/565 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVTIQVG Y+N++GSHFWNFQDEL GLA   ++D VFKNH LN DV YR+G T QG+
Sbjct  1     MKEIVTIQVGDYANYVGSHFWNFQDELLGLAGDPQADSVFKNHDLNMDVFYRTGHTLQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TYTPRL+S+  +GSLGSMSS G +Y E    +S+V TW G V+TQASEP K+NLFLQSL
Sbjct  61    DTYTPRLLSINMRGSLGSMSSRGTMYKEAAPATSNVFTWTGGVSTQASEPQKKNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+N NMV+   G    S +E QD+DI E LENGVQ+WTD+SKV FHPQSLY+L+G+W
Sbjct  121   Y-EEENQNMVNETSG----SPSEYQDRDITESLENGVQFWTDYSKVHFHPQSLYELNGVW  175

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
              D  +F NYGIGRD+F    +GEE+++RLRFF+EECDH+QG QF+VDDSGGFS +A+EFL
Sbjct  176   TDVGDFDNYGIGRDSFAWASQGEEISDRLRFFVEECDHVQGFQFVVDDSGGFSSVASEFL  235

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NI D+Y+N PV+LYTVR  G  A  +S+   I + LH+A+SFSRL+S+ KLIVP+GL S
Sbjct  236   ENIVDEYTNTPVMLYTVRGSGPKARLQSRNHKILEDLHDAISFSRLSSYCKLIVPVGLPS  295

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS +       I+DE+ Y++SAVYA+ALHS+SLPFRM   GPTA++   SGA++ + +I 
Sbjct  296   LSKASKFLH--IEDEKHYHSSAVYAAALHSISLPFRMAPVGPTADACSVSGAVDFHGLIQ  353

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ Q RQNMVS LDV+MP P+LTG + +  LL+NF  LTP + +D ED+ A+E +T+HG
Sbjct  354   MLSGQGRQNMVSILDVAMPTPALTGGKKELCLLENFQPLTPMISEDGEDLQAIEHLTVHG  413

Query  731   VLGS-GSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             +L S    RA V EVK  V  AY++A +RP FSHLSV+ CPLPIPLPFP+IFGN IG++G
Sbjct  414   ILASVEGLRASVCEVKDAVDAAYQRANTRPLFSHLSVARCPLPIPLPFPSIFGNQIGKYG  473

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             EL+   +T +PS+G L+VHSIPMA+RLRSS+ +LP LE  L+NL + GI RGA GA++L 
Sbjct  474   ELMSDQLTNSPSKGSLDVHSIPMAARLRSSSTVLPLLEYNLQNLHRYGITRGAAGAELLR  533

Query  374   SWGFGRDEVEDLGETLSKLVNTLKP  300
              WGF ++E+ ++ E LSK+V TL P
Sbjct  534   GWGFEKEELVEMQEMLSKMVATLCP  558



>ref|XP_007156832.1| hypothetical protein PHAVU_002G021300g [Phaseolus vulgaris]
 ref|XP_007156833.1| hypothetical protein PHAVU_002G021300g [Phaseolus vulgaris]
 gb|ESW28826.1| hypothetical protein PHAVU_002G021300g [Phaseolus vulgaris]
 gb|ESW28827.1| hypothetical protein PHAVU_002G021300g [Phaseolus vulgaris]
Length=572

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/564 (59%), Positives = 442/564 (78%), Gaps = 4/564 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             M+EIVT+QVG ++NF+GSHFWNFQDEL GLA    +D VFKN  LN DVLYR+GETQQG+
Sbjct  1     MKEIVTLQVGDFANFVGSHFWNFQDELLGLAGDPSADSVFKNQDLNMDVLYRTGETQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              +YTPRLVS+  +GSLGSM+S G LY+E  S S DV+TW GKV+TQASEP KRNLFLQ L
Sbjct  61    PSYTPRLVSINLRGSLGSMNSHGTLYTEVASTSPDVVTWTGKVSTQASEPFKRNLFLQRL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+N NM++   G ++ S +E +DK+I+ECLENGVQ+W+D+SKV +HP+SLY+L G+W
Sbjct  121   YEEEENSNMLNEIPGSKNGSPSEYEDKEIIECLENGVQFWSDYSKVHYHPRSLYELDGVW  180

Query  1448  MDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
                +EFN YGIGRD F    +GEE+++RLRFF+EECD+IQG QFIVDDSGGFS +AAEFL
Sbjct  181   PVVEEFNNYGIGRDCFAWAAQGEEISDRLRFFVEECDNIQGFQFIVDDSGGFSAVAAEFL  240

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NI D+Y+N+PVLLY V+  G   N +S+K  +S+ LH+++SFSRL+S+ KLIVP+GL S
Sbjct  241   ENIVDEYTNIPVLLYAVQGSGPRTNLQSRKRTVSEVLHDSISFSRLSSYCKLIVPVGLPS  300

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS SKASR L I+D + +++SAVYA+ALHS+SLPFRM   GPTA++  +SGA++++ V+ 
Sbjct  301   LSKSKASRFLHIEDAKHFHSSAVYAAALHSISLPFRMVPVGPTADACSSSGAVDIHGVVQ  360

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ Q RQNMVS LDV+MPAP+LTG Q   SLL+    LTP+   D EDM A+E MT+HG
Sbjct  361   MLSGQGRQNMVSVLDVAMPAPALTGGQNDLSLLEMLQPLTPQTADDVEDMLAIEHMTVHG  420

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGE  552
              L S   RA V EVK TV+ A+  A +RP   HLSV+ CPLPIPLPFP+IFGN++G+ GE
Sbjct  421   ALASEGHRASVGEVKDTVEGAFRCANTRPMSCHLSVALCPLPIPLPFPSIFGNNVGKQGE  480

Query  551   LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
             L+ +    +  +G LE+HS+PMA+RLRSS+ +LP LE++L+NL++ GIQRGA GA++L S
Sbjct  481   LMGSQTINSSPKGSLEIHSVPMAARLRSSSVVLPLLENKLQNLQRFGIQRGAAGAELLRS  540

Query  371   WGFGRDEVEDLGETLSKLVNTLKP  300
             WGFG +E+ ++ E LSK+V  L+P
Sbjct  541   WGFGMEELMEMDEMLSKMVAALRP  564



>ref|XP_010531225.1| PREDICTED: protein misato homolog 1 isoform X1 [Tarenaya hassleriana]
Length=569

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/565 (60%), Positives = 441/565 (78%), Gaps = 10/565 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG ++NF+GSHFWNFQDEL GLA   ESD +FKN  LN DVLYR+GETQ G+
Sbjct  1     MREIVTVQVGGFANFVGSHFWNFQDELLGLADDPESDPIFKNQRLNMDVLYRAGETQMGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TYTPR+VSV FQGSLGSMSS G +YSEK S  S++ TW G VTT ASEP K+NLFL+SL
Sbjct  61    ATYTPRVVSVNFQGSLGSMSSSGTIYSEKISARSNISTWFGNVTTHASEPRKKNLFLESL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+     D   GRE+D+ +E QDKDIVECL+ GV+YWTDFSKV +HPQSLY+LSGLW
Sbjct  121   YEEEQ-----DKVRGRENDNMSESQDKDIVECLDKGVEYWTDFSKVHYHPQSLYELSGLW  175

Query  1448  MDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             MD+Q+FN YGIGRD F    RGEEL+ERLRFF+EECDHIQG+QF+VDDSGGFS LAA+FL
Sbjct  176   MDSQDFNNYGIGRDIFSEGSRGEELSERLRFFVEECDHIQGIQFLVDDSGGFSALAADFL  235

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NIADDY+N+P+LLY+VRSP    NT+S K +IS  LH+A+SFSRL+SF KL +P+GL S
Sbjct  236   ENIADDYTNIPLLLYSVRSPSLHTNTRSSKRSISGDLHDAISFSRLSSFCKLFIPVGLPS  295

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             L  SKAS+ L ++DE+ Y++SAVYA+ALHS  +PFRME      +S   SGA+++  ++ 
Sbjct  296   LGGSKASKYLLLQDEKLYHSSAVYAAALHSSIIPFRMEPLSSALDSSEVSGAMDVNTLVQ  355

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ + RQN+V+ LD ++P+P+L+G Q + +L+ +   LTPEV +D ED  A+E M++ G
Sbjct  356   MLSGRDRQNIVAILDAAIPSPALSGKQSENTLVMDLQPLTPEVAEDVEDTRAIESMSLLG  415

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAIS-RPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
              +GS    A + E K  V  +YE+  S RP F ++SVS CPLP+PLPFP IFGN IG+ G
Sbjct  416   AIGSEGIEASISEAKDAVHASYEQNTSVRPLFCNVSVSRCPLPVPLPFPRIFGNLIGRKG  475

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L +P++++  RGPL+VHS+P+A+RLRSS+AILPFLE R+ NL+K GIQ GA+G+ ++ 
Sbjct  476   EILGSPLSDSLPRGPLDVHSVPLATRLRSSSAILPFLERRMGNLQKYGIQWGAVGSDLVR  535

Query  374   SWGFGRDEVEDLGETLSKLVNTLKP  300
             +WGFGR+E++++ E LSK+V  L P
Sbjct  536   TWGFGREELQEMRENLSKMVAELNP  560



>ref|XP_008792583.1| PREDICTED: protein misato homolog 1 isoform X1 [Phoenix dactylifera]
 ref|XP_008792584.1| PREDICTED: protein misato homolog 1 isoform X1 [Phoenix dactylifera]
 ref|XP_008792585.1| PREDICTED: protein misato homolog 1 isoform X1 [Phoenix dactylifera]
Length=649

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/565 (58%), Positives = 435/565 (77%), Gaps = 8/565 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG+++N+IGSHFWNFQDEL GL E    D +FKN SL+ DVLYR+GETQQGL
Sbjct  1     MREIVTIQVGNFANYIGSHFWNFQDELLGLVEEPHGDPIFKNSSLDMDVLYRAGETQQGL  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPS-QSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
             LTY+PRL+SVGFQGSLGS+SS G+L+    +   +D++TW G V+  A+EP K+NLFLQS
Sbjct  61    LTYSPRLISVGFQGSLGSLSSSGSLFDNISTYDPTDIVTWIGNVSRCAAEPDKKNLFLQS  120

Query  1631  LYMEEKNMNMV--DGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             L  E++  + +  + PD  ++    +IQDKD+VECLE+GVQ+WTDFSKVQ+HP+SLY+L 
Sbjct  121   LCEEDQQKSALYANDPDKEKTSPQKQIQDKDLVECLESGVQFWTDFSKVQYHPRSLYELH  180

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             G W D Q+  NYGIG+D      + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS +AA
Sbjct  181   GSWTDVQKLDNYGIGKDVLSEGLQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSSVAA  240

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             E+L+NIAD+Y+N PVLLY  R PG++A   SQK +I++ LH+AVSFSRL+SF KL+VP+G
Sbjct  241   EYLENIADEYTNTPVLLYAARDPGAYAFPVSQKESITRVLHDAVSFSRLSSFCKLMVPVG  300

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L SL +  +S    + D++ +++SAVYA+++HS+S+P RME PGPTA S Y SGA+++ E
Sbjct  301   LPSLRSKLSSVLN-VDDQKLFHSSAVYAASIHSISIPLRMELPGPTATSAYVSGAVDVGE  359

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             ++H+LA Q RQNMV+ LD +MPAPSLT    QGS+  N   LTPEVE+D++D+HA+E + 
Sbjct  360   IVHILAGQERQNMVTILDTAMPAPSLTDEHNQGSIHRNLHPLTPEVEEDDDDLHAVESLI  419

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             IHG L SG  RA + +VK  +  +Y     +PK ++LSV+ CPLPIPLPFP+IFG+ +G+
Sbjct  420   IHGALHSGDHRASISQVKDAINASYLGGSQKPKLAYLSVALCPLPIPLPFPSIFGSCVGR  479

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGELL        SRG LE+ SIPMA+RLRSS A++P +E RL NLRK G  RGA GA++
Sbjct  480   HGELLGNQSEGAHSRGSLEIDSIPMAARLRSSKAVMPLIERRLGNLRKHGTARGAPGAEL  539

Query  380   LESWGFGRDEVEDLGETLSKLVNTL  306
             L SWGFG+DEVED+GE LS+L+ +L
Sbjct  540   LRSWGFGKDEVEDMGEFLSRLLMSL  564



>ref|XP_009381223.1| PREDICTED: protein misato homolog 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381224.1| PREDICTED: protein misato homolog 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381225.1| PREDICTED: protein misato homolog 1 [Musa acuminata subsp. malaccensis]
Length=575

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/568 (57%), Positives = 428/568 (75%), Gaps = 8/568 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VTIQVG+++N++GSHFWNFQDEL GL E    D +FKN  L  DVLYR+GETQQG+
Sbjct  1     MRELVTIQVGTFANYVGSHFWNFQDELLGLTEVPDGDPIFKNSPLEMDVLYRAGETQQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TY PRL+S+ FQGSLGS+S  G+LY +   S  +D+LTW G V+   +EP K+NLFLQS
Sbjct  61    PTYCPRLISINFQGSLGSLSLSGSLYDDISSSDPTDILTWTGNVSRCMAEPHKKNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRE--SDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             L  EE  +  V   D  E  S S  ++QDK  +ECLE  V++WTDFSKVQ+HP+SLY+L 
Sbjct  121   LSAEEHEILDVSEDDSGEVMSSSQRQVQDKGRIECLETDVKFWTDFSKVQYHPRSLYELH  180

Query  1457  GLWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
               WMD Q+F+ YGIGRD      + EE+NERLRFFIEECDHIQG+QF+VDDSGGFS +AA
Sbjct  181   SSWMDIQKFDDYGIGRDVLSGGLQLEEMNERLRFFIEECDHIQGIQFVVDDSGGFSSVAA  240

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             E L+NI D+Y+N PVLLY VR PG++    +QK +I +SLH+AVSFSRL+SF  L++P+G
Sbjct  241   EVLENIEDEYTNTPVLLYAVRDPGAYTYATNQKSSIGRSLHDAVSFSRLSSFCNLMIPVG  300

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L SL +  +     + D++P+++SAVYA+++HS+S+PFRME PGP A S   SGA+++ E
Sbjct  301   LPSLRSGLSPLLH-VDDKKPFHSSAVYAASIHSISIPFRMEIPGPAANSTCTSGAMDVGE  359

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             ++H LA Q+RQNMV+ LDV+MP PSLT    QGS+L N   LTPE+ +D++D+ A+E + 
Sbjct  360   IVHTLAGQSRQNMVTVLDVAMPPPSLTDEHNQGSILRNLHPLTPEIRKDDDDLLAVESLV  419

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             +HG L SG  RA V +VK +++ AY+ A ++P FS LSV+ CPLPIPLPFP+IFG ++G+
Sbjct  420   VHGALYSGDHRATVSQVKDSIRVAYQTAPAKPMFSRLSVALCPLPIPLPFPSIFGRNVGR  479

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HGEL+   +   PSRG LE+ SIPMA+RLRSSTAI+PF+E RL +LRK GI RGA GA++
Sbjct  480   HGELVFNSVQGAPSRGSLEIESIPMAARLRSSTAIMPFVEKRLGDLRKHGIARGAPGAEL  539

Query  380   LESWGFGRDEVEDLGETLSKLVNTLKPY  297
             L +WGFGRDEV+D+GE LSKL+    P+
Sbjct  540   LRTWGFGRDEVQDMGEHLSKLLMGFDPH  567



>gb|KFK30343.1| hypothetical protein AALP_AA7G249200 [Arabis alpina]
Length=565

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/568 (59%), Positives = 428/568 (75%), Gaps = 20/568 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NFIGSHFWNFQDEL GLA   ESD VF+NH+L+ DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGDFANFIGSHFWNFQDELLGLASDPESDPVFRNHNLDMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDV-LTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV F+GSLGSMS+ G LY+E  S  +D   TW G V T+ SEP KRNLFLQS
Sbjct  61    STYTPRLVSVNFKGSLGSMSARGTLYNEGSSSRADSSKTWLGGVETKRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE         D    +   EI+DKDIV CL+  V+ WTDFSK  +HPQSLY+LSG+
Sbjct  121   LYEEE---------DKAGKEKAREIEDKDIVGCLDEEVECWTDFSKSHYHPQSLYELSGV  171

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D+Q+FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++FIVDDSGGFS +AA+F
Sbjct  172   WTDSQDFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFIVDDSGGFSAVAADF  231

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+ IAD+Y+N+PVLLY+VRSP S  N  S K  +S  LH+A+SFSRL+SF KL  PIGL 
Sbjct  232   LETIADEYTNIPVLLYSVRSPMSQMNRGSSKKTVSNKLHDAISFSRLSSFCKLFTPIGLP  291

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPT-AESIYASGALNMYEV  918
             SLS SKAS+ L + DE+PY +SAVYA+ALHS ++PFR +   PT ++S   S ++++  +
Sbjct  292   SLSESKASKYLNLGDEKPYRSSAVYAAALHSSTIPFRTQ---PTSSDSSEVSNSMDVNTL  348

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQNMV+ LD +MPAPSL G Q++ +LL +  SLTPEV +D ED  A+E M I
Sbjct  349   VQLLTGRGRQNMVAILDSAMPAPSLAGKQLENTLLTDLQSLTPEVNEDVEDNQAIESMCI  408

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAI--SRPKFSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EV   V  +YE+A   +RP F +LSVS CPLPIPLPFP+IFGN +G
Sbjct  409   LGALRSEDKEASVSEVTNAVDASYEQATTKTRPLFCNLSVSRCPLPIPLPFPSIFGNLVG  468

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
             + GE+L +P++++  RG L+VHSIP+ +R RSS+AILPFLESR+ NL KLGIQ GA+G+ 
Sbjct  469   RKGEILSSPVSDSLYRGSLDVHSIPIVARWRSSSAILPFLESRMVNLEKLGIQWGAMGSD  528

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             ++ +WGFGR+E++++ E +SK+V+ LKP
Sbjct  529   LVRTWGFGREELQEMRENMSKMVSELKP  556



>ref|XP_007047168.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal isoform 
6 [Theobroma cacao]
 ref|XP_007047169.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal, putative 
isoform 6 [Theobroma cacao]
 ref|XP_007047170.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal isoform 
6 [Theobroma cacao]
 gb|EOX91325.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal isoform 
6 [Theobroma cacao]
 gb|EOX91326.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal, putative 
isoform 6 [Theobroma cacao]
 gb|EOX91327.1| Plasma membrane, myosin-like, Tubulin/FtsZ, N-terminal isoform 
6 [Theobroma cacao]
Length=495

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/487 (63%), Positives = 386/487 (79%), Gaps = 1/487 (0%)
 Frame = -2

Query  1754  MSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRES  1575
             MSS G LY+E  +  S+V+TW G V+T ASEP K+NLFLQSLY EE+++ +V+G +G + 
Sbjct  1     MSSRGTLYNEGSNAPSEVVTWEGNVSTHASEPQKKNLFLQSLYQEEQDVPLVNGINGGKK  60

Query  1574  DSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHN  1398
             D  NEIQD DIV+CL+ GVQ+WTDFSKV +HPQSLY+++GLWMDAQEF NYGIGRD F  
Sbjct  61    DLQNEIQDTDIVKCLDRGVQFWTDFSKVHYHPQSLYEVNGLWMDAQEFDNYGIGRDVFTE  120

Query  1397  HQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVR  1218
             + +GEE+ ERLRFF+EECDHIQG +FI DDSGGFS +AA+FL+NIAD+YSN PVLLY VR
Sbjct  121   NLQGEEVCERLRFFVEECDHIQGFKFIADDSGGFSPIAADFLENIADEYSNTPVLLYAVR  180

Query  1217  SPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPY  1038
              PGS  N +S+K  + + LH+AVSFSRL+SF K+IVP+GL  LS SKAS  L I+DE PY
Sbjct  181   GPGSHMNLRSRKQTVVRDLHDAVSFSRLSSFCKMIVPVGLPFLSMSKASTYLNIEDENPY  240

Query  1037  YTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSM  858
             + SAVYA+ALHS SLPFRME PGP+A+S    GAL++  ++ +LA Q+RQNMV+ LD++M
Sbjct  241   HCSAVYAAALHSASLPFRMEAPGPSADSSDTVGALDVNGIVQMLAGQSRQNMVAILDIAM  300

Query  857   PAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTV  678
             PAP +TG Q + SLL N   LTPEV +D +D+ A+E MT+HG +GS   RA V EVK  +
Sbjct  301   PAPGMTGRQDEKSLLGNLHPLTPEVAEDMDDLQAVESMTVHGAIGSEDHRASVSEVKNAI  360

Query  677   QDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVH  498
                YE AI RP F HLSV+ CPLPIPLPFP+IFGN +GQHGELL +PI  + SRG L+VH
Sbjct  361   NAEYEHAIIRPMFCHLSVARCPLPIPLPFPSIFGNLVGQHGELLGSPILGSSSRGSLDVH  420

Query  497   SIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKL  318
             SIPMA+RLRSS AILPFLE+RL NLRK GI+RG++G ++L SWGFGRDEVED+GETLSK+
Sbjct  421   SIPMAARLRSSCAILPFLENRLANLRKFGIERGSLGTELLRSWGFGRDEVEDIGETLSKM  480

Query  317   VNTLKPY  297
             V  + P+
Sbjct  481   VKAVNPH  487



>ref|XP_009623984.1| PREDICTED: protein misato homolog 1 isoform X2 [Nicotiana tomentosiformis]
Length=475

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/468 (66%), Positives = 379/468 (81%), Gaps = 1/468 (0%)
 Frame = -2

Query  1700  LTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENG  1521
             +TW G+V T ASEPL+RNLFLQSL  EE+        D R   S  EIQDKDIVECLE+ 
Sbjct  1     MTWKGRVATHASEPLRRNLFLQSLSEEEQESMDKAALDNRNGSSPGEIQDKDIVECLESD  60

Query  1520  VQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEEC  1344
             VQYWTDFSKV +HPQSLY+LSGLW++ Q+F NY +G+D F  HQ GEE+++RLRFFIEEC
Sbjct  61    VQYWTDFSKVHYHPQSLYELSGLWVEIQDFDNYALGKDAFCGHQHGEEIDDRLRFFIEEC  120

Query  1343  DHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQS  1164
             DHIQG+Q +VDDSGGFSG+AA FL+NIAD+Y NVPVLLY  R+P    ++K +K  IS++
Sbjct  121   DHIQGIQCVVDDSGGFSGVAAAFLENIADEYPNVPVLLYNARNPSLNMDSKGRKQAISRN  180

Query  1163  LHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFR  984
             LH+AVSFSRL+   KLI+P+GL SLS S+AS+ LCIKDE+PY++SAVYASA+HS SLPFR
Sbjct  181   LHDAVSFSRLSELCKLIIPVGLPSLSGSRASQFLCIKDEKPYHSSAVYASAMHSFSLPFR  240

Query  983   MEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNF  804
             M+  GP+AESI  SGAL+MY ++ +LA Q RQNMV+ LD +MPAPSL+ NQ Q SLL + 
Sbjct  241   MKQSGPSAESICTSGALDMYGIVQMLAGQMRQNMVTVLDFAMPAPSLSVNQAQQSLLRSL  300

Query  803   VSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSV  624
               LTP+V +D ED+HA+E M IHG + SG++RA +YEVK  VQ AY+ +++ PKFSHLSV
Sbjct  301   QPLTPDVAEDVEDLHAVETMNIHGAVTSGNQRASIYEVKDAVQAAYDSSMTMPKFSHLSV  360

Query  623   SccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFL  444
             + CPLPIPLPFP+IFGN +GQHGELLETPI+ + SRG LEV SIPM +RLRSSTA+LPFL
Sbjct  361   ATCPLPIPLPFPSIFGNMVGQHGELLETPISGSSSRGSLEVQSIPMVTRLRSSTAVLPFL  420

Query  443   ESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             ES+L NL K GI RGA+GA +L+SWGFG+DEVED+GETLSKLV TLKP
Sbjct  421   ESKLGNLHKFGIDRGALGAPLLQSWGFGKDEVEDMGETLSKLVVTLKP  468



>gb|KDP31886.1| hypothetical protein JCGZ_12347 [Jatropha curcas]
Length=525

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/515 (62%), Positives = 404/515 (78%), Gaps = 3/515 (1%)
 Frame = -2

Query  1847  DVLYRSGETQQGLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQA  1668
             DV YR+GETQQG+LTYTPRLVS+  QGSLGSMSS G LY+E     S+V TW G ++T A
Sbjct  2     DVFYRNGETQQGVLTYTPRLVSIDSQGSLGSMSSRGTLYNECSPAPSEVTTWTGHISTHA  61

Query  1667  SEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQ  1488
              E  K+NLFLQSLY EE+    + G +   + +  EI+D+DIVE LENGVQ+WTDFSKV 
Sbjct  62    FEAHKKNLFLQSLYEEEQESLKLTGINKGGNHAQREIRDQDIVESLENGVQFWTDFSKVH  121

Query  1487  FHPQSLYQLSGLWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVD  1311
             +HPQSLY+  GLW D +EFN YG GRD F +  RGEE+ ERLRFF+EECDHIQG QFIVD
Sbjct  122   YHPQSLYEFCGLWTDDEEFNNYGAGRDIFSSGFRGEEIGERLRFFVEECDHIQGFQFIVD  181

Query  1310  DSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLA  1131
             DSGG S LAA+FL++IAD+Y++ PVLLY+VR PG   + +SQK  IS+S+H++VSFSRL+
Sbjct  182   DSGGLSALAADFLESIADEYTSTPVLLYSVRGPGCHISPESQKQKISRSIHDSVSFSRLS  241

Query  1130  SFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESI  951
             S  KLIVP+GL  LS SKAS  LCI +E+PY+ SA+YASA+H++SLPFRME  GPTA+S 
Sbjct  242   SLCKLIVPVGLPFLSRSKASTYLCI-EEKPYHCSAIYASAIHAISLPFRMEPLGPTADSC  300

Query  950   YASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDN  771
               SGA+++YE++ VL+ Q RQNM + LDVSMPAP L+G  V+ SLL N  SLTPEV +  
Sbjct  301   LVSGAMDVYELVQVLSGQDRQNMTTILDVSMPAPPLSGKHVEQSLLGNLHSLTPEVAE-V  359

Query  770   EDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpf  591
             ED+ A+E MT+HG LGSG   A V +V  TV +AY+ A++RPKF HLSV+ CPLPIPLPF
Sbjct  360   EDLQAVESMTVHGALGSGGSHASVSDVMDTVNEAYKHALTRPKFCHLSVAACPLPIPLPF  419

Query  590   paiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLG  411
             P+IFG+ IGQHGELL +P+  + SRG L+VHSIPMA+RLRSS+A+LPFLE+RL NLR+ G
Sbjct  420   PSIFGSLIGQHGELLSSPLPGSSSRGSLDVHSIPMAARLRSSSAVLPFLENRLLNLRRYG  479

Query  410   IQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTL  306
             I+RGA GA++L SWGF +DE+ED+ + LSK+V TL
Sbjct  480   IERGAPGAELLRSWGFAKDELEDIEQNLSKMVTTL  514



>ref|NP_195436.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB16779.1| tubulin-like protein [Arabidopsis thaliana]
 emb|CAB80385.1| tubulin-like protein [Arabidopsis thaliana]
 gb|AAZ23923.1| At4g37190 [Arabidopsis thaliana]
 gb|ACF41946.1| At4g37190 [Arabidopsis thaliana]
 gb|AEE86764.1| uncharacterized protein AT4G37190 [Arabidopsis thaliana]
Length=562

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/568 (57%), Positives = 427/568 (75%), Gaps = 23/568 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F+NH+L+ DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNHNLDMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV  +G+LG+MSS G LY+E   S+S    TW G V TQ SEP KRNLFLQS
Sbjct  61    ATYTPRLVSVNLKGALGTMSSRGTLYNEGSSSRSDSSATWFGDVDTQRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE  +       G+E     EI+DKDIV CL+  V+ WTDFSK  +HPQSLY+L+GL
Sbjct  121   LYEEEHVV-------GKEK--AKEIEDKDIVGCLDEEVECWTDFSKSHYHPQSLYELNGL  171

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+Q FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+VDDSGGFS +AA+F
Sbjct  172   WMDSQAFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAADF  231

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+N+AD+Y+NVPVLLY+VR+P S     S K  +S  LH+A+SFSRL+SF KL  PIGL 
Sbjct  232   LENMADEYTNVPVLLYSVRTPMS---QMSSKKTVSNKLHDAISFSRLSSFCKLFTPIGLP  288

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGA-LNMYEV  918
             SL+ SKAS+ L + DE+PY +SAVYA+ALHS ++PFRM+   PT+         +++  +
Sbjct  289   SLTGSKASKFLNLGDEKPYRSSAVYAAALHSSTIPFRMQ---PTSSDSSEVSNSMDVNTL  345

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQN+V+ LD +MPAP+L G Q++ +LL +  +LTPEV +D ED  A+E M I
Sbjct  346   VQLLTGRGRQNIVAILDSAMPAPTLAGKQLENTLLTSLQALTPEVTEDVEDNQAVESMCI  405

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISR--PKFSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EVK  V  +YE+A ++  P F +LSVS CPLP+PLPFP+IFGN +G
Sbjct  406   LGALRSEDKEALVSEVKNAVDASYEQATTKGKPLFCNLSVSRCPLPVPLPFPSIFGNLVG  465

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
             + GE+L +P++++  RG L+VHSIP+A+R RSS+AILPFLE+R+ NL KLGIQ GA+G+ 
Sbjct  466   RKGEILSSPVSDSLYRGSLDVHSIPVATRWRSSSAILPFLETRMGNLEKLGIQWGAMGSD  525

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             V+ +WGFGR+E++++ E LSK+V+ L P
Sbjct  526   VVRAWGFGREELQEMRENLSKMVSELNP  553



>ref|XP_010905634.1| PREDICTED: protein misato homolog 1 [Elaeis guineensis]
Length=574

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/562 (57%), Positives = 425/562 (76%), Gaps = 9/562 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG+++N+IGSHFWNFQDEL GL E    D VFKN SL+ DVLYR+GETQQ +
Sbjct  1     MREIVTIQVGNFANYIGSHFWNFQDELLGLVEEPHGDPVFKNSSLDMDVLYRAGETQQRI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
               Y PRLVS+ F GSLGS S  G+L+    P  ++D++TW G V+   +EP K+NLFLQS
Sbjct  61    F-YCPRLVSMSFVGSLGSRSLSGSLFDNISPYDTTDIVTWTGNVSRCVAEPHKKNLFLQS  119

Query  1631  LYMEEKNMNMV--DGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             L  E++  + +  + PD +E  S  +IQDKD VECLE+GV++WTDFSKV +HP+SLY+L 
Sbjct  120   LAEEDQQNSALYANDPD-KEKSSQKQIQDKDRVECLESGVKFWTDFSKVHYHPRSLYELD  178

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             G W D Q+F NYGIG+D      + EE++ERLRFF+EECDHIQG+QFIVDDSGGFS +AA
Sbjct  179   GSWTDVQKFDNYGIGKDVLSAGLQIEEMSERLRFFVEECDHIQGIQFIVDDSGGFSSVAA  238

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             E+L+NIAD+Y+N PVLLY  + PG++A   SQK +I++ LH+A+SFSRL+S  KL+VP+G
Sbjct  239   EYLENIADEYANTPVLLYAAKDPGAYAFPVSQKESITRVLHDAISFSRLSSLCKLMVPVG  298

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
             L SLS SK S  L + D++ +++SAVYA+++HS+S+PFRME PGPTA S Y SGA ++ E
Sbjct  299   LPSLSRSKLSSVLHVDDQKLFHSSAVYAASIHSISIPFRMELPGPTATSSYVSGAADVGE  358

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMT  741
             VIH+LA QARQNMV+ LD +MPAPSLT    QG +  N   LTPEVE+D++D++A+E + 
Sbjct  359   VIHILAGQARQNMVTILDTAMPAPSLTDEHNQGFIHRNLHPLTPEVEEDDDDLYAVESLI  418

Query  740   IHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             IHG L SG  RA + +VK ++  +Y     +P F+HLS++ CPLPIPLPFP+IFG+S+G 
Sbjct  419   IHGALHSGHHRASISQVKDSIYASYLGGSQKPMFAHLSIALCPLPIPLPFPSIFGSSVGP  478

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
             HG+L         SRG LE+ S+PMA+RLRSS A++P +E RL NLRK G  RGA GA +
Sbjct  479   HGQLSGNQSEGAQSRGSLEIDSVPMAARLRSSKAVMPLIEKRLGNLRKYGTARGAPGADL  538

Query  380   LESWGFGRDEVEDLGETLSKLV  315
             L SWGFG+DE+ED+GE LS+L+
Sbjct  539   LRSWGFGKDEIEDMGEFLSRLL  560



>ref|XP_002866980.1| hypothetical protein ARALYDRAFT_912663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43239.1| hypothetical protein ARALYDRAFT_912663 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/568 (57%), Positives = 432/568 (76%), Gaps = 23/568 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F++H+L+ DVLYRSGET QG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRSHNLDMDVLYRSGETLQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV  +GSLG+MSS G LY+E   S+S    TW G V TQ SEP KRNLFLQS
Sbjct  61    ATYTPRLVSVNLKGSLGTMSSRGTLYNEGSSSRSDSSTTWFGDVDTQRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE+ +       G+E     EI+DKDIV CL+ GV+ WTDFSK  +HPQSLY+L+GL
Sbjct  121   LYEEEQKV-------GKEK--AKEIEDKDIVGCLDEGVECWTDFSKSHYHPQSLYELNGL  171

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+Q+FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+VDDSGGFS +AA+F
Sbjct  172   WMDSQDFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAADF  231

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+N+AD+Y+NVPVLLY+VRSP S     S K  ++  LH+A+SFSRL+SF KL  PIGL 
Sbjct  232   LENMADEYTNVPVLLYSVRSPMS---QMSPKKTVTNKLHDAISFSRLSSFCKLFTPIGLP  288

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPT-AESIYASGALNMYEV  918
             SL+ SKAS+ L + DE+PY +SAVYA+ALHS ++PFRM+   PT ++S   S ++++  +
Sbjct  289   SLTGSKASKFLNLGDEKPYRSSAVYAAALHSSTIPFRMQ---PTSSDSSEVSNSMDVNTL  345

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQN+VS LD +MPAP+L G Q++ +LL +  +LTPEV +D ED  A+E M I
Sbjct  346   VQLLTGRGRQNIVSILDSAMPAPTLAGKQLENTLLTSLQALTPEVTEDVEDDQAVESMCI  405

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAIS--RPKFSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EVK  V  +YE+A +  +P   +LSVS CPLP+PLPFP+IFGN +G
Sbjct  406   LGALRSEDKEALVSEVKNAVDASYEQATTKGKPLICNLSVSRCPLPVPLPFPSIFGNLVG  465

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
             + GE+L +P++++  RG L+VHSIP+A+R RSS+A+LPFLE+R+ NL KLGIQ GA+G+ 
Sbjct  466   RKGEILSSPVSDSLFRGSLDVHSIPVATRWRSSSAVLPFLETRMGNLEKLGIQWGAMGSD  525

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             V+ +WGFGR+E++++ E LSK+V+ L P
Sbjct  526   VVRAWGFGREELQEMRENLSKMVSELNP  553



>dbj|BAF01517.1| tubulin-like protein [Arabidopsis thaliana]
 dbj|BAH19902.1| AT4G37190 [Arabidopsis thaliana]
Length=562

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/568 (57%), Positives = 426/568 (75%), Gaps = 23/568 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F+NH+L+ DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNHNLDMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV  +G+LG+MSS G LY+E   S+S    TW G V TQ SEP KRNLFLQS
Sbjct  61    ATYTPRLVSVNLKGALGTMSSRGTLYNEGSSSRSDSSATWFGDVDTQRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE  +       G+E     EI+DKDIV CL+  V+ WTDFSK  +HPQSLY+L+GL
Sbjct  121   LYEEEHVV-------GKEK--AKEIEDKDIVGCLDEEVECWTDFSKSHYHPQSLYELNGL  171

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+Q FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+VDDSGGFS +AA+F
Sbjct  172   WMDSQAFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAADF  231

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+N+AD+Y+NVPVLLY+VR+P S     S K  +S  LH+A+SFSRL+SF KL  PIGL 
Sbjct  232   LENMADEYTNVPVLLYSVRTPMS---QMSSKKTVSNKLHDAISFSRLSSFCKLFTPIGLP  288

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGA-LNMYEV  918
             SL+ SKAS+ L + DE+PY +SAVYA+ALHS ++PFRM+   PT+         +++  +
Sbjct  289   SLTGSKASKFLNLGDEKPYRSSAVYAAALHSSTIPFRMQ---PTSSDSSEVSNSMDVNTL  345

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQN+V+ LD +MPAP+L G Q++ +LL +  +LTPEV +D  D  A+E M I
Sbjct  346   VQLLTGRGRQNIVAILDSAMPAPTLAGKQLENTLLTSLQALTPEVTEDVGDNQAVESMCI  405

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISR--PKFSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EVK  V  +YE+A ++  P F +LSVS CPLP+PLPFP+IFGN +G
Sbjct  406   LGALRSEDKEALVSEVKNAVDASYEQATTKGKPLFCNLSVSRCPLPVPLPFPSIFGNLVG  465

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
             + GE+L +P++++  RG L+VHSIP+A+R RSS+AILPFLE+R+ NL KLGIQ GA+G+ 
Sbjct  466   RKGEILSSPVSDSLYRGSLDVHSIPVATRWRSSSAILPFLETRMGNLEKLGIQWGAMGSD  525

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             V+ +WGFGR+E++++ E LSK+V+ L P
Sbjct  526   VVRAWGFGREELQEMRENLSKMVSELNP  553



>ref|XP_010432114.1| PREDICTED: protein misato homolog 1-like [Camelina sativa]
Length=558

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/568 (57%), Positives = 422/568 (74%), Gaps = 27/568 (5%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F+NH+LN DVLYRSGET QG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNHNLNMDVLYRSGETHQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV  +GSLG+MSS G LY+E   S+S    TW G V TQ SEP KRNLFLQS
Sbjct  61    ATYTPRLVSVNLKGSLGTMSSRGTLYNEGSSSRSVSSTTWFGDVDTQRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE+ +               EI+DKDIV  L+  V+ WTDFSK  +HPQSLY+L+GL
Sbjct  121   LYEEEQKVG-------------KEIEDKDIVGSLDEDVECWTDFSKSHYHPQSLYELNGL  167

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+++FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+VDDSGGFS +AA+F
Sbjct  168   WMDSKDFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAADF  227

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+N+AD+Y+NVPVLLY+VRSP S     S K  +S  LH+A+S SRL+S  KL  PIGL 
Sbjct  228   LENMADEYTNVPVLLYSVRSPMS---QMSPKKTVSNKLHDAISLSRLSSLCKLFTPIGLP  284

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGA-LNMYEV  918
             SL+ SKAS+ L + DE+PY +SAVYA+ALH+ ++PFRM+   PT+         +++  +
Sbjct  285   SLTGSKASKYLNLGDEKPYRSSAVYAAALHASTIPFRMQ---PTSSDSSEVSTSMDVNTL  341

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQN+V+ LD +MPAP+L G Q++ +LL N  SLTPEV +D ED  A+E M I
Sbjct  342   VQLLTGRGRQNIVTILDSAMPAPTLAGKQLENTLLTNLQSLTPEVNEDVEDNQAVESMCI  401

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISR--PKFSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EVK  V  +YE+AI++  P F +LSVS CPLP+PLPFP+IFGN +G
Sbjct  402   LGALRSEDKEALVSEVKNAVDASYEQAITKTKPLFCNLSVSRCPLPVPLPFPSIFGNLVG  461

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
               GE+L +P++++  RG L+VHSIP+A+R RSS+AILPFLESR+ NL KLGIQ GA+G+ 
Sbjct  462   IKGEILSSPVSDSLYRGSLDVHSIPVATRWRSSSAILPFLESRMGNLEKLGIQWGAMGSD  521

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             V+ SWGFGR+E++++ E LSK+V+ L P
Sbjct  522   VVRSWGFGREELQEMRENLSKMVSELNP  549



>ref|XP_006411946.1| hypothetical protein EUTSA_v10024834mg [Eutrema salsugineum]
 gb|ESQ53399.1| hypothetical protein EUTSA_v10024834mg [Eutrema salsugineum]
Length=551

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/568 (57%), Positives = 421/568 (74%), Gaps = 34/568 (6%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F+NH+L+ DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNHNLDMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVL-TWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV F+GSLGSMSS G LY+E  S  SD   TW G V TQ SEP KRNLFLQS
Sbjct  61    ATYTPRLVSVNFKGSLGSMSSRGTLYNEGSSSRSDSSKTWCGDVDTQRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE  +       G+E  +  EI+DKDIV CL+ GV+ WTDFSK  +HPQSLY+LSGL
Sbjct  121   LYEEEVKV-------GKEKAT--EIEDKDIVGCLDEGVECWTDFSKSHYHPQSLYELSGL  171

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+Q+FN YGIG+D F+   RGEE+ +RLRFF+EECDHIQG++F+VDDSGGFS +AA+F
Sbjct  172   WMDSQDFNNYGIGKDVFYEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAADF  231

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+Y+N+PVLLY+VRSP S  N +S K  +S  LH+A+S     SF K        
Sbjct  232   LENIADEYTNIPVLLYSVRSPMSQMNPRSSKKTVSNKLHDAISLLDSPSFCK--------  283

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPT-AESIYASGALNMYEV  918
                   AS+ L + DE+ Y +SAVYA+ALHS ++PFRM+   PT ++S   S ++++  +
Sbjct  284   ------ASKFLNLGDEKLYRSSAVYAAALHSSTIPFRMQ---PTSSDSSEVSNSMDVNTL  334

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQNMV+ LD +MPAP+L G Q++ +LL +  +LTPEV +D ED  A+E M I
Sbjct  335   VQLLTGRGRQNMVTILDSAMPAPTLAGKQLENTLLTDLQALTPEVSEDVEDNQAIESMCI  394

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAI--SRPKFSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EVK  V  +YE+AI  ++P F  LSVS CPLP+PLPFP+IFGN +G
Sbjct  395   LGALSSEDKEASVSEVKNAVDASYEQAITKTKPLFCTLSVSRCPLPVPLPFPSIFGNLVG  454

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
             + GE+L +P++++  RG L+VHSIP+A+R RSS+AILPFLE R+ NL KLGIQ GA+G+ 
Sbjct  455   RKGEILSSPVSDSLYRGSLDVHSIPVAARWRSSSAILPFLERRMGNLEKLGIQWGAMGSD  514

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             V+ +WGFGR+E++++ E +SK+V+ L P
Sbjct  515   VVRTWGFGREELQEMRENMSKMVSELSP  542



>ref|XP_010446724.1| PREDICTED: protein misato homolog 1-like [Camelina sativa]
Length=558

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/568 (57%), Positives = 426/568 (75%), Gaps = 27/568 (5%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F+NH+LN DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNHNLNMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV  +GSLG+MSS G LY+E   S+S    TW G V TQ SEP KRNLFLQS
Sbjct  61    ATYTPRLVSVNLKGSLGTMSSRGTLYNEGSSSRSDSSTTWFGDVDTQRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE+ +               EI+DKDIV  L+  V+ WTDFSK  +HPQSLY+L+GL
Sbjct  121   LYEEEQKVG-------------KEIEDKDIVGSLDEEVECWTDFSKSHYHPQSLYELNGL  167

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+++FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+VDDSGGFS +A +F
Sbjct  168   WMDSKDFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAGDF  227

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+N+AD+Y+NVPVLLY+VRSP S     S K  +S  LH+A+SFSRL+S  KL  PIGL 
Sbjct  228   LENMADEYTNVPVLLYSVRSPMS---QMSPKKTVSNKLHDAISFSRLSSLCKLFTPIGLP  284

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPT-AESIYASGALNMYEV  918
             SL+ SKAS+ L + DE+PY +SAVYA+ALH+ ++PFRM+   PT + S   S ++++  +
Sbjct  285   SLTGSKASKYLNLGDEKPYRSSAVYAAALHASTIPFRMQ---PTSSNSSEVSNSMDVNTL  341

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQN+V+ LD +MPAP+L G Q++ +LL N  SLTPEV +D ED  A+E M I
Sbjct  342   VQLLTGRGRQNIVAILDSAMPAPTLAGKQLENTLLTNLQSLTPEVNEDVEDNQAVESMCI  401

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPK--FSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EVK  V  +YE+A+++ K  F +LSVS CPLP+PLPFP+IFGN +G
Sbjct  402   LGALRSEDKEALVSEVKNAVDASYEQAVTKTKRLFCNLSVSRCPLPVPLPFPSIFGNLVG  461

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
               GE+L +P++++  RG L+VHSIP+A+R RSS+AILPFLESR+ +L KLGIQ GA+G+ 
Sbjct  462   IKGEILSSPVSDSLYRGSLDVHSIPIAARWRSSSAILPFLESRMGHLEKLGIQWGAMGSD  521

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             V+ SWGFGR+E++++ E LSK+V+ L P
Sbjct  522   VVRSWGFGREELQEMRENLSKMVSELNP  549



>ref|XP_010531227.1| PREDICTED: protein misato homolog 1 isoform X2 [Tarenaya hassleriana]
Length=540

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/565 (56%), Positives = 417/565 (74%), Gaps = 39/565 (7%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG ++NF+GSHFWNFQDEL GLA   ESD +FKN  LN DVLYR+GETQ G+
Sbjct  1     MREIVTVQVGGFANFVGSHFWNFQDELLGLADDPESDPIFKNQRLNMDVLYRAGETQMGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TYTPR+VSV FQGSLGSMSS G +YSEK S  S++ TW G VTT ASEP K+NLFL+SL
Sbjct  61    ATYTPRVVSVNFQGSLGSMSSSGTIYSEKISARSNISTWFGNVTTHASEPRKKNLFLESL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
             Y EE+     D   GRE+D+ +E QDKDIVECL+ GV+YWTDFSKV +HPQSLY+LSGLW
Sbjct  121   YEEEQ-----DKVRGRENDNMSESQDKDIVECLDKGVEYWTDFSKVHYHPQSLYELSGLW  175

Query  1448  MDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             MD+Q+FN YGIGRD F    RGEEL+ERLRFF+EECDHIQG+QF+VDDSGGFS LAA+FL
Sbjct  176   MDSQDFNNYGIGRDIFSEGSRGEELSERLRFFVEECDHIQGIQFLVDDSGGFSALAADFL  235

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NIADDY+N+P+LLY+VRSP    NT+S K +IS               SK ++      
Sbjct  236   ENIADDYTNIPLLLYSVRSPSLHTNTRSSKRSIS------------GKASKYLL------  277

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
                        ++DE+ Y++SAVYA+ALHS  +PFRME      +S   SGA+++  ++ 
Sbjct  278   -----------LQDEKLYHSSAVYAAALHSSIIPFRMEPLSSALDSSEVSGAMDVNTLVQ  326

Query  911   VLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHG  732
             +L+ + RQN+V+ LD ++P+P+L+G Q + +L+ +   LTPEV +D ED  A+E M++ G
Sbjct  327   MLSGRDRQNIVAILDAAIPSPALSGKQSENTLVMDLQPLTPEVAEDVEDTRAIESMSLLG  386

Query  731   VLGSGSRRAPVYEVKRTVQDAYEKAIS-RPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
              +GS    A + E K  V  +YE+  S RP F ++SVS CPLP+PLPFP IFGN IG+ G
Sbjct  387   AIGSEGIEASISEAKDAVHASYEQNTSVRPLFCNVSVSRCPLPVPLPFPRIFGNLIGRKG  446

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L +P++++  RGPL+VHS+P+A+RLRSS+AILPFLE R+ NL+K GIQ GA+G+ ++ 
Sbjct  447   EILGSPLSDSLPRGPLDVHSVPLATRLRSSSAILPFLERRMGNLQKYGIQWGAVGSDLVR  506

Query  374   SWGFGRDEVEDLGETLSKLVNTLKP  300
             +WGFGR+E++++ E LSK+V  L P
Sbjct  507   TWGFGREELQEMRENLSKMVAELNP  531



>ref|XP_006283453.1| hypothetical protein CARUB_v10004498mg [Capsella rubella]
 gb|EOA16351.1| hypothetical protein CARUB_v10004498mg [Capsella rubella]
Length=558

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/567 (57%), Positives = 425/567 (75%), Gaps = 25/567 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F+NH+LN DVLYRSGET QG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNHNLNMDVLYRSGETLQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV  +GSLG+MSS G LY+E   S+S    TW G V TQ SEP KRNLFLQS
Sbjct  61    ATYTPRLVSVNLKGSLGTMSSRGTLYNEGSSSRSDSSTTWFGDVDTQRSEPRKRNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE         +G+E      I+DKDIV CL+ GV  WTDFSK  +HPQSLY+L+GL
Sbjct  121   LYEEEPK-------EGKE------IEDKDIVGCLDEGVDCWTDFSKSHYHPQSLYELNGL  167

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD Q+FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+VDDSGGFS +AA+F
Sbjct  168   WMDPQDFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAADF  227

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+++AD+Y+NVPVLLY+VRSP S     + K  +S  LH+A+SFSRL+SF KL  PIGL 
Sbjct  228   LESMADEYTNVPVLLYSVRSPMS---QMTPKKTVSHKLHDAISFSRLSSFCKLFTPIGLP  284

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SL+ SKAS+ L + DE+PY +SAVYA+ LH+ ++PFRM     +++S   S ++++  ++
Sbjct  285   SLTGSKASKFLNLGDEKPYRSSAVYAATLHASTIPFRMRPS--SSDSSEVSSSMDVNTLV  342

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +L  + RQN+V+ L+ +MPAP L G Q++ +LL N  +LTPEV +D ED  A+E M I 
Sbjct  343   QLLTGRGRQNIVAILESAMPAPPLAGKQLENTLLTNLQALTPEVTEDIEDNQAVESMCIL  402

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISR--PKFSHLSVSccplpiplpfpaiFGNSIGQ  561
             G L S  + A V EVK  V  +YE+AI++  P F  LSVS CPLP+PLPFP+IFGN +G+
Sbjct  403   GALRSEDKEASVSEVKNAVDASYEQAITKTKPLFCSLSVSRCPLPVPLPFPSIFGNLVGR  462

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
              GE+L +P+++   RG L+VHSIP+A+R RSS+AILPFLE+R+ NL KLGIQ GA+G+ V
Sbjct  463   KGEILSSPVSDALYRGSLDVHSIPIAARWRSSSAILPFLENRMGNLEKLGIQWGAMGSDV  522

Query  380   LESWGFGRDEVEDLGETLSKLVNTLKP  300
             + +WGFGR+E++++ E+LSK+V+ L P
Sbjct  523   VRTWGFGREELQEMRESLSKMVSELNP  549



>ref|XP_009366792.1| PREDICTED: protein misato homolog 1-like isoform X3 [Pyrus x 
bretschneideri]
Length=497

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/489 (63%), Positives = 380/489 (78%), Gaps = 5/489 (1%)
 Frame = -2

Query  1754  MSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMV---DGPDG  1584
             MS+ G LY E  S SS++ TW G VTTQ +EP K+NLFLQSLY EE+ +N++   +G + 
Sbjct  1     MSTRGTLYDESSSASSNIYTWGGNVTTQVAEPHKKNLFLQSLY-EEEQVNLLTLGNGVNA  59

Query  1583  RESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDT  1407
              E     EI D D VE LENGVQYWTDFSKV +HPQSLY+LSGLW+D Q+F NYGIGR++
Sbjct  60    GEKSCRREIHDSDKVESLENGVQYWTDFSKVHYHPQSLYELSGLWVDPQKFDNYGIGRES  119

Query  1406  FHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLY  1227
                  +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA + L++IAD+Y+N PVLLY
Sbjct  120   LSAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAVDVLESIADEYTNAPVLLY  179

Query  1226  TVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDE  1047
              VR PGS  + +SQK  +S+ LH+AVSFS+L+S  KLIVP+GL SLS SKASR L I DE
Sbjct  180   AVRGPGSSMDPRSQKQRVSRKLHDAVSFSKLSSLCKLIVPVGLPSLSTSKASRFLSINDE  239

Query  1046  QPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLD  867
             +PY+ SA YA+ LHS+SLPFRME  GPTA+S YASGA+ + EV+ +L+ QARQNMV+ LD
Sbjct  240   KPYHCSAAYAATLHSISLPFRMEPLGPTADSSYASGAVTISEVVQILSGQARQNMVAILD  299

Query  866   VSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVK  687
              +MP+PSLTGNQV  +L  N   LTPE+ +D ED+ ++E M +HG LGSG  RA + EVK
Sbjct  300   AAMPSPSLTGNQVGQNLTGNLQPLTPEIAEDVEDLQSVESMIVHGALGSGGHRASISEVK  359

Query  686   RTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPL  507
              TV  AYE AI+RP F HLSV+ CPLPIPLPFP+IFGN +GQHGELL TPI  +PSRG L
Sbjct  360   DTVHAAYEHAITRPMFCHLSVAQCPLPIPLPFPSIFGNLVGQHGELLSTPIVGSPSRGSL  419

Query  506   EVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETL  327
             +VH IPMA+RLRSS+A+LPFL++RL  LR  GI RGA GA+++ SWGF +DE+ED+GE L
Sbjct  420   DVHFIPMAARLRSSSAVLPFLQNRLSGLRSSGIARGAPGAELVRSWGFAKDELEDMGEML  479

Query  326   SKLVNTLKP  300
             SK++ TL P
Sbjct  480   SKMIATLDP  488



>ref|XP_011092125.1| PREDICTED: protein misato homolog 1 isoform X2 [Sesamum indicum]
Length=478

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/469 (63%), Positives = 377/469 (80%), Gaps = 2/469 (0%)
 Frame = -2

Query  1700  LTWAGKVTTQASEPLKRNLFLQSLYMEE-KNMNMVDGPDGRESDSHNEIQDKDIVECLEN  1524
             +   G VTT  S+PLK+NLFLQSLY+EE +N+        R  D   E+QDKDIVECLEN
Sbjct  1     MCRTGPVTTHTSQPLKKNLFLQSLYLEETENVGTSRDCGSRNGDFCPEVQDKDIVECLEN  60

Query  1523  GVQYWTDFSKVQFHPQSLYQLSGLWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEE  1347
              VQYWTDFSKV +HPQSLY+LSGLW D ++FN YGIGR+ F      EE+NERLRFF+EE
Sbjct  61    EVQYWTDFSKVHYHPQSLYELSGLWCDIKDFNNYGIGREAFFGGLHAEEINERLRFFVEE  120

Query  1346  CDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQ  1167
             CD  QG+QFI+DDSGGFSG+A EFL+NIAD+Y+N+PVLLY+VRSP S  ++ ++KL +S+
Sbjct  121   CDLPQGIQFIIDDSGGFSGVAGEFLENIADEYTNIPVLLYSVRSPYSSLDSTNRKLTLSR  180

Query  1166  SLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPF  987
              LH+AVSFS+L++FSKLIVP+GL SL  S+ S+ LC++D++PY+ SAVYASA+HS+SLPF
Sbjct  181   KLHDAVSFSKLSTFSKLIVPMGLPSLRTSRMSKYLCLEDQKPYHNSAVYASAIHSISLPF  240

Query  986   RMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDN  807
             RM+  GP+A+  Y  GA+++ E++ +LA QA+QN V  LD+ MPAP+L+  Q + SLL+N
Sbjct  241   RMQPLGPSAQLSYTCGAVDVNELVQMLAGQAQQNKVMALDIVMPAPALSDIQCRQSLLEN  300

Query  806   FVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLS  627
                LTPEV ++ EDMHA+E MTIHGV GSG +RA V EVK  VQ AY  A  RP+FSHLS
Sbjct  301   LHPLTPEVAENVEDMHALESMTIHGVFGSGCKRASVSEVKDAVQTAYSTAAERPRFSHLS  360

Query  626   VSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPF  447
             V+ CPLPIPLPFP+IFGN +G+HGELL+TPI+E+ SRG LEVHSIPMA+RLRSS+ ILPF
Sbjct  361   VAQCPLPIPLPFPSIFGNLVGRHGELLDTPISESASRGSLEVHSIPMAARLRSSSCILPF  420

Query  446   LESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             LE+RLENLRK GI RGA+G+++L SWGFG+D+VED+GETLS +V TL P
Sbjct  421   LENRLENLRKFGIARGALGSELLASWGFGKDDVEDMGETLSNMVRTLNP  469



>emb|CDY42711.1| BnaA03g53640D [Brassica napus]
Length=548

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/566 (55%), Positives = 413/566 (73%), Gaps = 32/566 (6%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG  +NF+GSHFWNFQDEL GLA   ESD +F+N++LN DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGELANFVGSHFWNFQDELLGLASDPESDPIFRNNNLNMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVL-TWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRL+S+ F+GSLGSMSS G LY++  S  SD   TW G V TQ SEP KRNLF Q+
Sbjct  61    STYTPRLLSINFKGSLGSMSSHGTLYNQGSSSRSDSSKTWFGDVDTQRSEPRKRNLFQQT  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE               +  EI+DKDIV  LE  V+ WTDFSK  +HPQ+LY+L+GL
Sbjct  121   LYEEE---------------AQAEIEDKDIVGSLEETVECWTDFSKSHYHPQTLYELNGL  165

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+Q+FN YG G+D F    RGEE+ ++LRFF+EECDHIQGV F+VDDSGGFS LA +F
Sbjct  166   WMDSQDFNNYGAGKDLFSEASRGEEICDKLRFFVEECDHIQGVNFLVDDSGGFSPLAGDF  225

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+ +ADDY+NVPVLLY++RSP       +QK  +   LH+AVSFSRL+SF KL  PIGL 
Sbjct  226   LETMADDYTNVPVLLYSLRSP------VAQKKTVINKLHDAVSFSRLSSFCKLFTPIGLP  279

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SL   K      + DE+PY +SAVYA+ALHS +LPFRM+H   +++S   S A+++  ++
Sbjct  280   SLRGMKYLN---LGDEKPYRSSAVYAAALHSSTLPFRMQHT--SSDSTQESNAMDVNTLV  334

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +L ++ RQN+V+ LD +MPAP+L   Q++ +LL N  +LTPEV +D ED  ++E M I 
Sbjct  335   QLLTNRGRQNIVAILDSAMPAPTLAAKQLEKTLLTNLQALTPEVAEDVEDNQSVESMCIL  394

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G L S  + A V EV+  V  +Y++  SRP F +LSVS  PLP+PLPFP+IFGN +G+ G
Sbjct  395   GALRSEDQEATVSEVRNAVDASYDEQ-SRPLFCNLSVSRVPLPVPLPFPSIFGNLVGRRG  453

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L +P ++   RG L+VHS+P+A+R RSS+A+LPFLESR+ NL KLGIQ GA+G+ V+ 
Sbjct  454   EILSSPASDLMCRGSLDVHSVPVATRWRSSSAVLPFLESRMVNLEKLGIQWGAVGSDVVR  513

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             +WGFGR+E++++ E L+K+V+ L P+
Sbjct  514   TWGFGREELQEMRENLAKMVSELSPH  539



>ref|XP_010437289.1| PREDICTED: protein misato homolog 1-like [Camelina sativa]
Length=558

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/568 (56%), Positives = 420/568 (74%), Gaps = 27/568 (5%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA    SD +F+NH+LN DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPGSDPIFRNHNLNMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRLVSV  +GSLG+MSS G LY+E   S+S    TW G V TQ SEP KR LFL+S
Sbjct  61    ATYTPRLVSVNLKGSLGTMSSRGTLYNEGSSSRSDSSTTWFGDVDTQRSEPRKRKLFLKS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE+ +               EI+DKDIV  L+  V+ WTDFSK  +HPQSL +L+GL
Sbjct  121   LYEEEQKVG-------------KEIEDKDIVGSLDEEVECWTDFSKSHYHPQSLDELNGL  167

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+++FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+VDDSGGF+ +AA+F
Sbjct  168   WMDSKDFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFAAVAADF  227

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+N+AD+Y+NVPVLLY+VRSP S     S K  +S  LH+A+SFSRL+S  KL  PIGL 
Sbjct  228   LENMADEYTNVPVLLYSVRSPMS---QMSPKKTVSNKLHDAISFSRLSSLCKLFTPIGLP  284

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGA-LNMYEV  918
             SL+ SKAS+ L + DE+PY +SAVYA+ALH+ ++PFRM+   PT+         +++  +
Sbjct  285   SLTGSKASKFLNLGDEKPYRSSAVYAAALHASTIPFRMQ---PTSSDSSEVSNSMDVNTL  341

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L  + RQN+V+ LD +MPAP+L G Q++ +LL N  +LTPEV +D ED  A+E M I
Sbjct  342   VQLLTGRGRQNIVAILDSAMPAPTLAGKQLENTLLTNLKALTPEVNEDVEDNQAVESMCI  401

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISR--PKFSHLSVSccplpiplpfpaiFGNSIG  564
              G L S  + A V EVK  V  +YE AI++  P F +LSVS CPLP+PLPFP+IFGN +G
Sbjct  402   LGALRSEDKEALVSEVKNAVDASYEHAITKTKPLFCNLSVSRCPLPVPLPFPSIFGNLVG  461

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
               GE+L +P++++  RG L+VHSIP+A+R RSS+AILPFLESR+ +L KLGIQ GA+G+ 
Sbjct  462   IKGEILSSPVSDSLYRGSLDVHSIPVATRWRSSSAILPFLESRMGHLEKLGIQWGAMGSD  521

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             V+ SWGFGR+E++++ E LSK+V+ L P
Sbjct  522   VVRSWGFGREELQEMRENLSKMVSELNP  549



>ref|XP_008339786.1| PREDICTED: protein misato homolog 1-like isoform X2 [Malus domestica]
Length=497

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/489 (62%), Positives = 378/489 (77%), Gaps = 3/489 (1%)
 Frame = -2

Query  1754  MSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKN--MNMVDGPDGR  1581
             MSS G LY+E  S SS++ TW G V+TQA+EP K+NLFLQSLY EE+   + +  G  G 
Sbjct  1     MSSRGTLYNEGSSASSNIFTWGGNVSTQAAEPHKKNLFLQSLYEEEZGDFLTLQSGVSGG  60

Query  1580  ESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTF  1404
             E  S  EI D +IVE LENGV+YWTDFSKV +HPQSLY+LSGLW+D Q+F NYGIGR++ 
Sbjct  61    EESSQREIHDSEIVESLENGVRYWTDFSKVHYHPQSLYELSGLWVDPQKFDNYGIGRESL  120

Query  1403  HNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYT  1224
                 +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA + L++IAD+Y+N PV+LY 
Sbjct  121   SAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAVDVLESIADEYTNAPVMLYA  180

Query  1223  VRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQ  1044
             VR  GS  + +SQK  +S+ LH+AVSFS L+S  KLIVP+GL SLS SKAS  L I +E+
Sbjct  181   VRGSGSSMDPRSQKQRVSRKLHDAVSFSMLSSLCKLIVPVGLPSLSTSKASTFLSINBER  240

Query  1043  PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDV  864
             PY+ SA YA+ LHS+SLPFRME  GPT +S YASGA+ + EV+ +L+ QARQNMV+ LD 
Sbjct  241   PYHCSAAYAATLHSVSLPFRMEPLGPTGDSSYASGAVTVSEVVQILSGQARQNMVAILDA  300

Query  863   SMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKR  684
             +MP+PSL GN +  +LL N   LTPE  +D ED+ ++E MT+HG LGSG  RA + EVK 
Sbjct  301   AMPSPSLAGNSLGETLLXNLQPLTPETAEDVEDLQSVESMTVHGALGSGGHRASISEVKD  360

Query  683   TVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLE  504
             TV  AYE AI+RP + HLSV+ CPLPIPLPFP+IFGN +GQHGELL TPI  +P+RG L+
Sbjct  361   TVHAAYEHAITRPIYCHLSVAQCPLPIPLPFPSIFGNLVGQHGELLSTPIVGSPTRGSLD  420

Query  503   VHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLS  324
             VHSIPMA+RLRSS+A+LPFLE+RL  LR  GI RGA GA+++ SWGF +DE+ED+GE LS
Sbjct  421   VHSIPMAARLRSSSAVLPFLENRLGGLRSCGIARGAPGAELVRSWGFAKDELEDMGEMLS  480

Query  323   KLVNTLKPY  297
             K++ TL P+
Sbjct  481   KMIATLDPH  489



>ref|XP_009138460.1| PREDICTED: protein misato homolog 1 [Brassica rapa]
Length=548

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/566 (55%), Positives = 412/566 (73%), Gaps = 32/566 (6%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG  +NF+GSHFWNFQDEL GLA   ESD +F+N++LN DVLYRSGETQQG+
Sbjct  1     MREIVTIQVGELANFVGSHFWNFQDELLGLASDPESDPIFRNNNLNMDVLYRSGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVL-TWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRL+S+ F+GSLGSMSS G LY++  S  SD   TW G V TQ SEP KRNLF Q+
Sbjct  61    STYTPRLLSINFKGSLGSMSSHGTLYNQGSSSRSDSSKTWFGDVDTQRSEPRKRNLFQQT  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE               +  EI+DKDIV  LE  V+ WTDFSK  + PQ+LY+L+GL
Sbjct  121   LYEEE---------------AQAEIEDKDIVGSLEETVECWTDFSKSHYRPQTLYELNGL  165

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+Q+FN YG G+D F    RGEE+ ++LRFF+EECDHIQGV F+VDDSGGFS LA +F
Sbjct  166   WMDSQDFNNYGAGKDLFSEASRGEEICDKLRFFVEECDHIQGVNFLVDDSGGFSPLAGDF  225

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+ +ADDY+NVPVLLY++RSP       +QK  +   LH+AVSFSRL+SF KL  PIGL 
Sbjct  226   LETMADDYTNVPVLLYSLRSP------VAQKKTVINKLHDAVSFSRLSSFCKLFTPIGLP  279

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SL   K      + DE+PY +SAVYA+ALHS +LPFRM+H   +++S   S A+++  ++
Sbjct  280   SLRGMKYLN---LGDEKPYRSSAVYAAALHSSTLPFRMQHT--SSDSTQESNAMDVNTLV  334

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +L ++ RQN+V+ LD +MPAP+L   Q++ +LL N  +LTPEV +D ED  ++E M I 
Sbjct  335   QLLTNRGRQNIVAILDSAMPAPTLAAKQLEKTLLTNLQALTPEVAEDVEDNQSVESMCIL  394

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G L S  + A V EV+  V  +Y++  SRP F +LSVS  PLP+PLPFP+IFGN +G+ G
Sbjct  395   GALRSEDQEATVSEVRNAVDASYDEQ-SRPLFCNLSVSRVPLPVPLPFPSIFGNLVGRRG  453

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L +P ++   RG L+VHS+P+A+R RSS+A+LPFLESR+ NL KLGIQ GA+G+ V+ 
Sbjct  454   EILSSPASDLMCRGSLDVHSVPVATRWRSSSAVLPFLESRMVNLEKLGIQWGAVGSDVVR  513

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             +WGFGR+E++++ E L+K+V+ L P+
Sbjct  514   TWGFGREELQEMRENLAKMVSELSPH  539



>ref|XP_010652652.1| PREDICTED: protein misato homolog 1 isoform X2 [Vitis vinifera]
Length=479

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/467 (63%), Positives = 371/467 (79%), Gaps = 3/467 (1%)
 Frame = -2

Query  1688  GKVTTQASEPLKRNLFLQSLYMEEK-NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQY  1512
             G V+T  SEP K+NLFLQSLY EE+ N+  +DG +  ++D  +EIQDKDIVE LENGVQ+
Sbjct  5     GNVSTHLSEPHKKNLFLQSLYEEEQENLAPMDGINSGKNDCESEIQDKDIVESLENGVQF  64

Query  1511  WTDFSKVQFHPQSLYQLSGLWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHI  1335
             WTDFSKV +HPQSLY+L+GLWMDAQ+FN YGIG D F    RGEE+NERLRFF+EECDHI
Sbjct  65    WTDFSKVHYHPQSLYELNGLWMDAQDFNNYGIGMDVFSEGLRGEEMNERLRFFVEECDHI  124

Query  1334  QGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHN  1155
             QG+QF+VDDSGGFS +AA+FL+NIAD+Y+N P+LLYTVR P S+ N +S++  ++  LH+
Sbjct  125   QGIQFVVDDSGGFSSVAADFLENIADEYTNTPILLYTVRGPESYMNRRSRRQTMASDLHD  184

Query  1154  AVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEH  975
             A+SFSRL+SF KLIVPIGL  L  SK S  LC++DE+PY+ SAVYA+ALHS+SLPFRME 
Sbjct  185   AISFSRLSSFCKLIVPIGLPLLGRSKVSSYLCLEDEKPYHCSAVYAAALHSISLPFRMET  244

Query  974   PGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
              GP  +S Y SGA+++Y +I +LA QARQN+V+TLD  MPAPSLTG QV+ SLL +    
Sbjct  245   LGPAMDSCYVSGAVDVYGLIQMLAGQARQNIVATLDAVMPAPSLTGKQVEQSLLGSLHPF  304

Query  794   TPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVScc  615
             TPE+ +D ED+  +E +TIHG  GSG  RA V EV+ TV  AYE A ++P FSHLSV+ C
Sbjct  305   TPEIAEDVEDLQEVESLTIHGAFGSGGYRASVSEVEDTVHAAYENATTKPLFSHLSVAHC  364

Query  614   plpiplpfpaiFGNSIGQHGELLETPIT-ETPSRGPLEVHSIPMASRLRSSTAILPFLES  438
             PLPIPLPFP+IFGN +GQHGELL +P+    PSRG L+VHSIPMA+RLRS+TAILPFLE+
Sbjct  365   PLPIPLPFPSIFGNLVGQHGELLGSPVMGGRPSRGSLDVHSIPMAARLRSTTAILPFLEN  424

Query  437   RLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             RL NL++ GI RGA G ++L SWGF +DE+ED  E LSK++ TL P+
Sbjct  425   RLGNLQRFGIARGASGTELLRSWGFAKDELEDTAERLSKMIMTLDPH  471



>ref|XP_008338273.1| PREDICTED: protein misato homolog 1-like isoform X2 [Malus domestica]
Length=497

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/487 (62%), Positives = 377/487 (77%), Gaps = 5/487 (1%)
 Frame = -2

Query  1754  MSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMV---DGPDG  1584
             MS+ G LY E  S SS++ TW G VTTQ +EP K+NLFL SLY EE+ +N++   +G + 
Sbjct  1     MSTRGTLYDESSSASSNIYTWGGNVTTQVAEPHKKNLFLXSLY-EEEXVNLLTLGNGVNA  59

Query  1583  RESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDT  1407
                    EI D D VE LENGVQYWTDFSKV +HPQSLY+LSGLW+D Q+F NYGIGR++
Sbjct  60    GGKSCRGEIHDSDKVESLENGVQYWTDFSKVHYHPQSLYELSGLWVDPQKFDNYGIGRES  119

Query  1406  FHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLY  1227
                  +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA + L++IAD+Y+N PVLLY
Sbjct  120   LSAGLQGEEVSERLRFFVEECDHIQGFQFIVDDSGGFSPLAVDVLESIADEYTNAPVLLY  179

Query  1226  TVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDE  1047
              VR PGS  + +SQK  +S+ LH+AVSFS+L+S  KLIVP+GL SLS SKASR L I D+
Sbjct  180   AVRGPGSSMDPRSQKQRVSRKLHDAVSFSKLSSLCKLIVPVGLPSLSTSKASRFLSINDK  239

Query  1046  QPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLD  867
             +PY+ SA YA+ LHS+SLPFRME  GPTA+S YASGA+ + EV+ +LA QARQNMV+ LD
Sbjct  240   KPYHCSAAYAATLHSISLPFRMEPLGPTADSSYASGAVTISEVVQILAGQARQNMVAILD  299

Query  866   VSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVK  687
              +MP+PSLTGN V  +L  N   LTPE+ +D ED+ ++E M +HG LGSG  RA + EVK
Sbjct  300   AAMPSPSLTGNWVGQNLTGNLQPLTPEIAEDVEDLQSLESMIVHGALGSGGHRASISEVK  359

Query  686   RTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPL  507
              TV  AYE  I+RP F HLSV+ CPLPIPLPFP+IFGN +GQHGELL TPI  +PSRG L
Sbjct  360   DTVHAAYEHGITRPMFCHLSVAQCPLPIPLPFPSIFGNLVGQHGELLSTPIVGSPSRGSL  419

Query  506   EVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETL  327
             ++HSIPMA+RLRSS+A+LPFLE+RL +LR  GI RGA GA+++ +WGF +DE+ED+GE L
Sbjct  420   DIHSIPMAARLRSSSAVLPFLENRLGSLRSCGIARGAPGAELVRNWGFAKDELEDMGEML  479

Query  326   SKLVNTL  306
             SK++ TL
Sbjct  480   SKMIATL  486



>ref|XP_008440247.1| PREDICTED: protein misato homolog 1 isoform X2 [Cucumis melo]
Length=527

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/521 (57%), Positives = 394/521 (76%), Gaps = 6/521 (1%)
 Frame = -2

Query  1856  LNTDVLYRSGETQQGLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVT  1677
             L  ++L  +  T  G+LTYTPRLVSVGF+G LGS+S+ G LY++     SD++TW G V 
Sbjct  4     LRINILIWTYSTVLGVLTYTPRLVSVGFKGGLGSVSARGTLYNDDVDTPSDIVTWRGSVA  63

Query  1676  TQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFS  1497
             T  +EP K+NLFLQSL  EE+  N+VDG    E+ S  EI+DKDIV+CLEN V +WTDFS
Sbjct  64    THHTEPRKKNLFLQSLSEEEQE-NLVDG----ENSSRGEIEDKDIVKCLENDVTFWTDFS  118

Query  1496  KVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQF  1320
             KV +HPQSLYQL+G W+DAQEF NYGIG+++F    +GE+++ERLRFF+EECDHIQG QF
Sbjct  119   KVHYHPQSLYQLAGSWVDAQEFDNYGIGKESFSWSLQGEDIDERLRFFVEECDHIQGFQF  178

Query  1319  IVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFS  1140
             IV+DSGGFS +A +FL+++AD+YSN PVLLY+VRSP S    ++++  +S+ LH+A+SF+
Sbjct  179   IVEDSGGFSAVAGDFLESVADEYSNTPVLLYSVRSPSSNVLRENKRQIVSRDLHDAISFA  238

Query  1139  RLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTA  960
             RL+SF +L VP+GL SLS SKA+  LCI D++PY+ SAVYA+ALHS+ LPFRME  GPT 
Sbjct  239   RLSSFCQLYVPVGLPSLSRSKAATHLCIDDQKPYHCSAVYAAALHSIGLPFRMEAQGPTT  298

Query  959   ESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVE  780
             +S Y SGAL++ +++ +LA Q RQNMV+ LDV+MPAP+L    +  SLL +   LTPEV+
Sbjct  299   DSCYVSGALHVNDMVRMLAGQGRQNMVAILDVAMPAPTLLEKHLGQSLLGSLQPLTPEVK  358

Query  779   QDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpip  600
             +D ED+ A+E MT+HGV  SG  RA V E+K  +  AYE    RP   HLS + CPLP+P
Sbjct  359   EDAEDLLALESMTVHGVFESGGDRASVSELKDQISAAYEGETVRPMLCHLSAAQCPLPVP  418

Query  599   lpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLR  420
             L FP+IFGN +GQHG+LL TPI+   SRG L+V+SIPMA+RLRSS A+LPF+E RL NL 
Sbjct  419   LSFPSIFGNLVGQHGQLLATPISGVSSRGSLDVYSIPMAARLRSSNAVLPFIERRLTNLL  478

Query  419   KLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             + G  +G+    +L SWGFGR+E+ED+GE+LSK+V  L P+
Sbjct  479   RHGTVQGSSATPLLRSWGFGREELEDMGESLSKMVLALNPH  519



>ref|XP_010028288.1| PREDICTED: protein misato homolog 1 isoform X2 [Eucalyptus grandis]
Length=513

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/507 (59%), Positives = 380/507 (75%), Gaps = 9/507 (2%)
 Frame = -2

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G+LTYTPRLVS+ FQGSLGSMSS G LY+ +P+  SD+ TW   V+T  +E  K+NLFLQ
Sbjct  7     GILTYTPRLVSIDFQGSLGSMSSHGTLYNHEPTIPSDITTWTAGVSTHTAERHKKNLFLQ  66

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             SLY E+       GP G       E QDKDIVE L  GV++WTDFSKV +HPQSLY+LSG
Sbjct  67    SLYEEQDRAVDKSGPQG-------EYQDKDIVESLGKGVKFWTDFSKVHYHPQSLYELSG  119

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LWMDA+EF NYGIGRD   +  +GEE++ERLR F+EECD +QG QF+VDDSGGFS +A+E
Sbjct  120   LWMDAREFDNYGIGRDALSHGLQGEEISERLRVFVEECDRVQGFQFMVDDSGGFSAVASE  179

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L+NIAD+YSN PVLLY +R+P S+ N   +K  I +SLH+AVSFSRLAS+  L+VP+GL
Sbjct  180   LLENIADEYSNTPVLLYALRAPESYVNLGKRKQTILRSLHDAVSFSRLASYCHLVVPVGL  239

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS S+AS   CI+DE+PY+ SAVYA+ALHS+SLPFRM    PTA+  Y SGA+++ +V
Sbjct  240   PSLSTSRASSFFCIEDERPYHCSAVYAAALHSISLPFRMGSLAPTADLHYVSGAVDVGDV  299

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ Q+R+  V+ LD++MPAPSLTG +    LL+N   +TPE+ +D ED+ A+E MTI
Sbjct  300   VRILSGQSRRK-VAILDMAMPAPSLTGKESGERLLNNLHPVTPEITEDVEDLQAVETMTI  358

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HGVLG G   A   EVK T+  AYE   +RPKF HLS +  PLPIPLPFP+IF N +GQ 
Sbjct  359   HGVLGPGGHPASASEVKDTIHAAYEHTSTRPKFCHLSAAHSPLPIPLPFPSIFKNVVGQR  418

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GELLE P      +G LEVHS+PMA RLRSS+AILP+LE+RL  LR+ G+ RGA GA+++
Sbjct  419   GELLENPTASPLLKGSLEVHSVPMAVRLRSSSAILPYLENRLGYLRRYGVDRGAPGAELV  478

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKPY  297
              SWGFG+DE+ED GE LSK++N LKP+
Sbjct  479   RSWGFGKDELEDFGEALSKMINELKPH  505



>gb|EPS62835.1| hypothetical protein M569_11949, partial [Genlisea aurea]
Length=558

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/563 (55%), Positives = 411/563 (73%), Gaps = 17/563 (3%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             M+EIVTIQVGSY+NF+GSHFWNFQDEL GLAESD+ FKNH LN DVLYR+GETQQG+LTY
Sbjct  1     MKEIVTIQVGSYANFVGSHFWNFQDELLGLAESDDNFKNHGLNMDVLYRTGETQQGILTY  60

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRLVSV FQGSLG++S  G LY+     S+D   W G VTT AS+P+K+NLFLQSL  E
Sbjct  61    TPRLVSVDFQGSLGALSCHGTLYNRPTKASTDSSVWRGPVTTLASQPIKKNLFLQSLDSE  120

Query  1619  EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
             E         +G  S S +EIQDK IVECLEN VQYWTDFSKV FHP+SLY+L   W D 
Sbjct  121   ENECANKSNCEG-SSYSDDEIQDKSIVECLENEVQYWTDFSKVYFHPKSLYELHSFWSDF  179

Query  1439  QEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNI  1263
              +F NYGIGR+ F      E++NERLRFF+EECD  QG+QFIVDD GGF+G+A EFL+NI
Sbjct  180   NDFSNYGIGREAFSTDSHAEDVNERLRFFVEECDLPQGIQFIVDDYGGFAGVAGEFLENI  239

Query  1262  ADDYSNVPVLLYTVR-SPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssls  1086
             AD+Y+N+PVLLY VR S  +  +  ++K  IS+ LH+AVSF+ L+SF +LIVP+GL SL+
Sbjct  240   ADEYTNIPVLLYNVRNSCSNNLDATNRKQAISRKLHDAVSFTTLSSFCQLIVPVGLPSLN  299

Query  1085  askasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVL  906
               + ++ L ++D++PY++SA+YASA+ S+SLP R+E   P   S +  G++ + E+  +L
Sbjct  300   TGRLAKYLTLEDQKPYHSSAIYASAICSMSLPSRIE---PLCPSPHTFGSITINELTQML  356

Query  905   ADQARQNMVSTLDVSMPAPSLTGNQVQGSL-LDNFVSLTPEVEQDNEDMHAMECMTIHGV  729
             A Q RQN VS LD++MPAP L+G +    + L N  +L+P++++  ED+ A+E + +HG 
Sbjct  357   AGQGRQNTVSILDIAMPAPPLSGGKRSHQIFLKNLQALSPDIDEGIEDIEALESIIVHGA  416

Query  728   LGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGEL  549
               SG +RA   EVK  VQD Y K   +PKF ++SV+ CPLPIPLPFP+IFG+SIG++G  
Sbjct  417   FASGLKRASTSEVKYAVQDGYSKMEVKPKFYNVSVADCPLPIPLPFPSIFGSSIGEYG--  474

Query  548   LETPITETPSR-GPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLES  372
              E  +   P R   ++V S+PMA+RLRSS A+LPFLE RL++LR +G      G+++  +
Sbjct  475   -EEEVVHDPERLKRVDVKSVPMAARLRSSKAVLPFLEKRLDSLRGMG------GSELFRN  527

Query  371   WGFGRDEVEDLGETLSKLVNTLK  303
             WGFG+++V+++ ETLS +V  LK
Sbjct  528   WGFGKEDVDEIAETLSSMVMRLK  550



>ref|XP_006573621.1| PREDICTED: protein misato homolog 1-like isoform X2 [Glycine 
max]
Length=543

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/506 (59%), Positives = 395/506 (78%), Gaps = 1/506 (0%)
 Frame = -2

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G+ +YTPRL+S+  +GSLGSMSS G LY+E  S + DV+TW G+V+TQASEP KRNLFLQ
Sbjct  30    GIPSYTPRLLSINLRGSLGSMSSRGTLYTEVASTTPDVVTWTGRVSTQASEPYKRNLFLQ  89

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
              LY EE+++NM++   G  + S +E +DKDI ECLENGVQ+WTD+SKV +HP+SLY+L+G
Sbjct  90    RLYEEEESLNMINEIRGSNNGSQSEYEDKDITECLENGVQFWTDYSKVHYHPRSLYELNG  149

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             +W   +EF NYGIGRD+F    +GEE+ +RLRFF+EECDHIQG QF+VDDSGGFS +A+E
Sbjct  150   VWAHVEEFDNYGIGRDSFAWAAQGEEIGDRLRFFVEECDHIQGFQFVVDDSGGFSAVASE  209

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
             FL+NI D+Y+N+PVLLY V+  GS  N +S+K  + + LH+AVSFSRL+S+ KLIVP+GL
Sbjct  210   FLENIVDEYTNIPVLLYAVQGSGSRTNLQSRKRAVLEDLHDAVSFSRLSSYCKLIVPVGL  269

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKASR L I+D + Y++SAVYA+ALHS+SLPFRM   GPTA++   SGA++++ V
Sbjct  270   PSLSKSKASRFLHIEDAKHYHSSAVYAAALHSISLPFRMVPVGPTADACSVSGAVDVHGV  329

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ Q RQNMVS LDV+MPAP+LTG Q + SLL+    LTP++ +D EDM A+E MT+
Sbjct  330   VQMLSGQGRQNMVSVLDVAMPAPALTGEQNELSLLEILQPLTPQIAEDVEDMQAIEHMTV  389

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG L S   RA V EVK TV  A+  A +RP F HLSV+  PLPIPLPFP+IFGN++GQH
Sbjct  390   HGALASEGHRASVGEVKDTVDAAFRCANTRPMFCHLSVALSPLPIPLPFPSIFGNNVGQH  449

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GEL+   IT +  +G L++HSIPMA+RLRSS+ +LP LES+L NL + GIQRGA GA++L
Sbjct  450   GELMSGQITNSSPKGSLDIHSIPMAARLRSSSIVLPLLESKLRNLHQFGIQRGAAGAELL  509

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKP  300
              SWGFG++E+ ++ E LSK+V  L P
Sbjct  510   RSWGFGQEELVEMEEMLSKMVAALHP  535



>gb|KDO37718.1| hypothetical protein CISIN_1g040160mg, partial [Citrus sinensis]
Length=459

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/458 (63%), Positives = 351/458 (77%), Gaps = 5/458 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG ++NFIGSHFWNFQDEL GLA    +D VF+N  LN DVLYR+GETQQG+
Sbjct  1     MREIVTVQVGGFANFIGSHFWNFQDELLGLASDPNNDPVFRNQCLNMDVLYRTGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSVGFQGSLGSMSS G LY+E     SDV+TW+G V+T AS P K+NLFLQ L
Sbjct  61    LTYTPRLVSVGFQGSLGSMSSRGVLYNESSPGPSDVVTWSGSVSTHASAPRKKNLFLQRL  120

Query  1628  YMEEK-NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             Y EE+ + +M++G    +SDS  EIQDKDIVE L+N V++WTDFSKV +HPQSLY+L GL
Sbjct  121   YEEEQESFSMINGTSSGKSDSQREIQDKDIVELLDNHVEFWTDFSKVHYHPQSLYELGGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD Q+F NYGIG+D F    RGEE+ ERLRFF+EE DHIQG QF+VDDSGGFS +AA+ 
Sbjct  181   WMDPQDFDNYGIGKDAFSEGFRGEEICERLRFFVEESDHIQGFQFVVDDSGGFSAVAADL  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+Y+N PVLL++VRSP S  N +S+K  I + LH+ VSFSRLASFSKLIVP+GL 
Sbjct  241   LENIADEYANTPVLLFSVRSPSSQMNLRSRKQTIFRELHDTVSFSRLASFSKLIVPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
              LS SKAS  L I++E+PY+ SAVYA+ALHS +LP+RME  GPTA+S   SGA++    +
Sbjct  301   FLSESKASTFLRIENEKPYHCSAVYAAALHSATLPYRMEPVGPTADSFDVSGAVDFNGFV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +LA QARQN V  LD +MPAP+L G Q + SLL N   LTPEV +D ED+ A+E M IH
Sbjct  361   QMLAGQARQNTVVILDAAMPAPALNGKQHEQSLLGNLQPLTPEVSEDVEDLQAVESMIIH  420

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVS  621
             G L S  +RA + EVK TV   Y  AI+RP F HLSV+
Sbjct  421   GALRSDGQRASISEVKETVNAIYGHAITRPMFCHLSVA  458



>ref|XP_008344323.1| PREDICTED: protein misato homolog 1-like [Malus domestica]
Length=521

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/477 (62%), Positives = 370/477 (78%), Gaps = 3/477 (1%)
 Frame = -2

Query  1718  SQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKN--MNMVDGPDGRESDSHNEIQDKD  1545
             S SS++ TW G V+TQA+EP K+NLFLQSLY EE+   + +  G  G E  S  EI D +
Sbjct  37    SASSNIFTWGGNVSTQAAEPHKKNLFLQSLYEEEQGDFLTLQSGVSGGEESSQREIHDSE  96

Query  1544  IVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNER  1368
             IVE LENGV+YWTDFSKV +HPQSLY+LSGLW+D Q+F NYGIGR++     +GEE++ER
Sbjct  97    IVESLENGVRYWTDFSKVHYHPQSLYELSGLWVDPQKFDNYGIGRESLSAGLQGEEVSER  156

Query  1367  LRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKS  1188
             LRFF+EECDHIQG QFIVDDSGGFS LA + L++IAD+Y+N PV+LY VR  GS  + +S
Sbjct  157   LRFFVEECDHIQGFQFIVDDSGGFSPLAVDVLESIADEYTNAPVMLYAVRGSGSSMDPRS  216

Query  1187  QKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASAL  1008
             QK  +S+ LH+AVSFS L+S  KLIVP+GL SLS SKAS  L I +E+PY+ SA YA+ L
Sbjct  217   QKQRVSRKLHDAVSFSMLSSLCKLIVPVGLPSLSTSKASTFLSINBERPYHCSAAYAATL  276

Query  1007  HSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQV  828
             HS+SLPFRME  GPT +S YASGA+ + EV+ +L+ QARQNMV+ LD +MP+PSL GN +
Sbjct  277   HSVSLPFRMEPLGPTGDSSYASGAVTVSEVVQILSGQARQNMVAILDAAMPSPSLAGNSL  336

Query  827   QGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISR  648
               +LL N   LTPE  +D ED+ ++E MT+HG LGSG  RA + EVK TV  AYE AI+R
Sbjct  337   GETLLRNLQPLTPETAEDVEDLQSVESMTVHGALGSGGHRASISEVKDTVHAAYEHAITR  396

Query  647   PKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRS  468
             P + HLSV+ CPLPIPLPFP+IFGN +GQHGELL TPI  +P+RG L+VHSIPMA+RLRS
Sbjct  397   PIYCHLSVAQCPLPIPLPFPSIFGNLVGQHGELLSTPIVGSPTRGSLDVHSIPMAARLRS  456

Query  467   STAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             S+A+LPFLE+RL  LR  GI RGA GA+++ SWGF +DE+ED+GE LSK++ TL P+
Sbjct  457   SSAVLPFLENRLGGLRSCGIARGAPGAELVRSWGFAKDELEDMGEMLSKMIATLDPH  513



>ref|NP_001049512.1| Os03g0240900 [Oryza sativa Japonica Group]
 gb|ABF94891.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11426.1| Os03g0240900 [Oryza sativa Japonica Group]
Length=571

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/568 (54%), Positives = 421/568 (74%), Gaps = 14/568 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE VT+QVG ++N++GSHFWNFQDEL GLA+   +D VFKN +L+ DVLYRSGET QG+
Sbjct  1     MREAVTVQVGGFANYVGSHFWNFQDELLGLADDPDADPVFKNDALDMDVLYRSGETHQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSD---VLTWAGKVTTQASEPLKRNLFL  1638
              TY PRLVSVG +GSLGS+SS  +    + S S+D   V TW+G VT   S+P  RNLFL
Sbjct  61    PTYCPRLVSVGSRGSLGSLSS--SGNLGQTSASADQLNVATWSGSVTRSVSKPHGRNLFL  118

Query  1637  QSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             QSL  E +N +  +G     S+S   ++DKD+++CLEN V +WTD+SKVQ+HPQSLY+L 
Sbjct  119   QSLVEEGQNPSTSNG----ASNSQKSVEDKDLIDCLENSVNFWTDYSKVQYHPQSLYELH  174

Query  1457  GLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
             G W D  +F NYG  ++   +  + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS +AA
Sbjct  175   GSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSSVAA  234

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTK-SQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             +FL+NIADDY+N PVLLY VR P +  +++ +Q+ +I ++LH+AVSFS+L+SF  L+VPI
Sbjct  235   QFLENIADDYTNTPVLLYCVRDPMTLGSSRRNQRESIMRALHDAVSFSKLSSFCNLMVPI  294

Query  1103  GlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
             G  SLS S  S  L I+DE+P++ SAV A+A+HS+++PFR++  GP+++  ++SG L++ 
Sbjct  295   GPPSLSRSYMSSYLYIQDEKPFHASAVCAAAIHSITVPFRLQRTGPSSDLAHSSGNLDIG  354

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECM  744
             E++H+L+DQ RQNMV+ LDV+MPAPSLT     G++     SLTPE+  ++ED +++E +
Sbjct  355   ELLHILSDQGRQNMVTALDVAMPAPSLTDRDAMGNIEMKLHSLTPEISDEDEDPYSVESL  414

Query  743   TIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIG  564
              +HG L  G +R  + +VK +V   YE   ++PKFSHLS S CPLP+PLPFP+IF  +IG
Sbjct  415   VVHGALDKGGQRTSISQVKGSVCSVYEARETKPKFSHLSASLCPLPVPLPFPSIFRGNIG  474

Query  563   QHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
             +HGE+L     E+  +G L++ SIPMA+RLRSS+A+LPF+E R  +L+K G+ RGAIG+ 
Sbjct  475   RHGEILSDHAEESQPKGSLDIESIPMAARLRSSSAVLPFIERRSGSLQKHGVARGAIGSL  534

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
             VL  WGFGR+EVED+ E L+KL+    P
Sbjct  535   VLRDWGFGREEVEDMAEHLAKLLGPFHP  562



>ref|XP_004963027.1| PREDICTED: protein misato homolog 1-like [Setaria italica]
Length=569

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/566 (54%), Positives = 423/566 (75%), Gaps = 12/566 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA+   +D VF+  +L+ DVLYR+GET QG+
Sbjct  1     MREVVTVQVGGFANFVGSHFWNFQDELLGLADDPGADPVFRTAALDMDVLYRAGETHQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TY PRLVSVG +GSLGS+SS G L S    +   +VLTW+G VT   ++P +RNLFLQS
Sbjct  61    ATYCPRLVSVGSRGSLGSLSSSGTLGSSSAATDQPNVLTWSGNVTKSVAKPHERNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             L  EE+N +  +      +++   ++DKD++E LENGV++WTD+SKVQ+HPQSLY+L G 
Sbjct  121   LSEEEQNTSSSND----RNNAKKSVEDKDLIESLENGVKFWTDYSKVQYHPQSLYELYGS  176

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D  +F NYG  R+      + EELNER+RFF+EECDHIQG+QFIVDDSGGFS +AA++
Sbjct  177   WTDFDKFDNYGTAREVVSEWSQMEELNERIRFFVEECDHIQGIQFIVDDSGGFSSVAAQY  236

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+ IADDY+N PVLLY VR P S  ++++Q+  I +SLH+AVSFS+L+S   L+VPIGL 
Sbjct  237   LEGIADDYTNTPVLLYCVRDPVSHGSSRNQRETIIRSLHDAVSFSKLSSSCNLMVPIGLP  296

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS         IKDE+ +++SA+ A+A+HSLS+PFR++H GP ++S ++SG L++ E++
Sbjct  297   SLSYLSPLLS--IKDEKYFHSSAICAAAVHSLSVPFRLQHVGPASDSAHSSGNLDIGELV  354

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
             H+L+DQ RQNMV+ LD++MPAPSLT  +   ++  +  SLTPE+  D+ED +A+E +  H
Sbjct  355   HILSDQGRQNMVTALDIAMPAPSLTDRKDLRNIQRSLRSLTPEISDDDEDPYAVESLVFH  414

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G L SG +RA V +VK  V  A E   ++PKFSHLSVS CPLPIPLPFP+IF +SIGQHG
Sbjct  415   GALDSGGQRASVSQVKDFVCSALEGRGTKPKFSHLSVSPCPLPIPLPFPSIFSSSIGQHG  474

Query  554   ELLETPITE-TPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             ++L     E T  +G L+V S+PMA+RLRSS AI+PF+E R  +L++LG+ RG++G+Q+L
Sbjct  475   KILSNDHPEGTRPKGSLDVVSVPMAARLRSSNAIVPFIEKRSGSLQRLGMARGSLGSQIL  534

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKP  300
               WGFG++EVED+GE L+K++    P
Sbjct  535   REWGFGKEEVEDMGEHLAKMLRPFYP  560



>ref|NP_001141510.1| uncharacterized protein LOC100273622 [Zea mays]
 gb|ACF79166.1| unknown [Zea mays]
 gb|ACF86520.1| unknown [Zea mays]
Length=567

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/565 (53%), Positives = 418/565 (74%), Gaps = 13/565 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA+   +D VF+  +L+ DVLYR+GET Q +
Sbjct  1     MREVVTVQVGGFANFVGSHFWNFQDELLGLADDPGADPVFRTAALDMDVLYRAGETHQSV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              +Y PRLVSVG +GSLGS+SS G L S    +   ++ TW+GKVT   ++P +RNLFLQS
Sbjct  61    ASYCPRLVSVGSRGSLGSLSSSGTLGSSSAAADEPNIFTWSGKVTKSVAKPHERNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             L  EE+N +  DG       ++  ++DKD+V  LENGV++WTD+SKVQ+HPQSLY+L G 
Sbjct  121   LSEEEQNPSSSDG------QNNASVEDKDLVANLENGVKFWTDYSKVQYHPQSLYELYGS  174

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D   F NYG  ++      + EE+NERLRFF+EECDHIQG+QF+VDDSGGF+ +AA+F
Sbjct  175   WTDFDRFDNYGTAKEVVSEWSQMEEMNERLRFFVEECDHIQGIQFLVDDSGGFASVAAQF  234

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++I DDY+N PV+LY VR+P S+ ++++Q   I +SLH+AVS S+L+ +  L+VPIGL 
Sbjct  235   LESIVDDYTNTPVMLYCVRNPDSYGSSRNQCETIIRSLHDAVSLSKLSYYCNLMVPIGLP  294

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS         IKDE+ +++SA+ A+A+HSLS+PFR++H GP ++S ++SG L++ E++
Sbjct  295   SLSYLSPLLS--IKDEKHFHSSAICAAAMHSLSIPFRLQHVGPASDSAHSSGKLDIGELV  352

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
             H+L+DQ RQNM++ LDV+MPAPSLT      ++  +  SLTPE+  ++ED +A+E M +H
Sbjct  353   HILSDQGRQNMITALDVAMPAPSLTDRTDLRNIQRSLHSLTPEISDEDEDPYAVESMVVH  412

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             GVL +G +RA + +VK ++  A E   ++PKFSHLSVS CPLPIPLPFP+IF +S+GQ G
Sbjct  413   GVLDAGGKRASISQVKESICSALEGRATKPKFSHLSVSRCPLPIPLPFPSIFSSSVGQQG  472

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L T       +GPL V S+PMA+RLRSS+AI PF+E R  +L++LG+ RG +G+QVL 
Sbjct  473   EILGTSHAGARPKGPLAVGSVPMAARLRSSSAIAPFIERRSASLQRLGVARGTLGSQVLH  532

Query  374   SWGFGRDEVEDLGETLSKLVNTLKP  300
              WGFGR+EVED+ E L+K++    P
Sbjct  533   DWGFGREEVEDMAEHLAKMLRPFYP  557



>gb|EEC74843.1| hypothetical protein OsI_10699 [Oryza sativa Indica Group]
Length=572

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/569 (53%), Positives = 421/569 (74%), Gaps = 15/569 (3%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE VT+QVG ++N++GSHFWNFQDEL GLA+   +D VFKN +L+ DVLYRSGET QG+
Sbjct  1     MREPVTVQVGGFANYVGSHFWNFQDELLGLADDPDADPVFKNDALDMDVLYRSGETHQGI  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSD---VLTW-AGKVTTQASEPLKRNLF  1641
              TY PRLVSVG +GSLGS+SS  +    + S S+D   V TW +G VT   S+P  RNLF
Sbjct  61    PTYCPRLVSVGSRGSLGSLSS--SGNLGQTSASADQLNVATWQSGSVTRSVSKPHGRNLF  118

Query  1640  LQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             LQSL  E +N +  +G     S+S   ++DKD+++CLEN V +WTD+SKVQ+HPQSLY+L
Sbjct  119   LQSLVEEGQNPSTSNG----ASNSQKSVEDKDLIDCLENNVNFWTDYSKVQYHPQSLYEL  174

Query  1460  SGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
              G W D  +F NYG  ++   +  + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS +A
Sbjct  175   HGSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSSVA  234

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTK-SQKLNISQSLHNAVSFSRLASFSKLIVP  1107
             A+FL+NIADDY+N PVLLY VR P +  +++ +Q+ +I ++LH+AVSFS+L+SF  L+VP
Sbjct  235   AQFLENIADDYTNTPVLLYCVRDPMTLGSSRRNQRESIMRALHDAVSFSKLSSFCNLMVP  294

Query  1106  IGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNM  927
             IG  SLS S  S  L I+DE+P++ SAV A+A+HS+++PFR++  GP+++  ++SG L++
Sbjct  295   IGPPSLSRSYMSSYLYIQDEKPFHASAVCAAAIHSITVPFRLQRTGPSSDLAHSSGNLDI  354

Query  926   YEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMEC  747
              E++H+L+DQ +QNMV+ LDV+MPAPSLT     G++     SLTPE+  ++ED +++E 
Sbjct  355   GELLHILSDQGQQNMVTALDVAMPAPSLTDRDAMGNIEMKLHSLTPEISDEDEDPYSVES  414

Query  746   MTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSI  567
             + +HG L  G +R  + +VK +V   YE   ++PKFSHL+ S CPLP+PLPFP+IF  +I
Sbjct  415   LVVHGALDKGGQRTSISQVKDSVCSVYEARETKPKFSHLTASLCPLPVPLPFPSIFRGNI  474

Query  566   GQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGA  387
             G+HGE+L     E+  +G L++ SIPMA+RLRSS+A+LPF+E R  +L+K G+ RGAIG+
Sbjct  475   GRHGEILSDHAEESQPKGSLDIESIPMAARLRSSSAVLPFIERRSGSLQKHGVARGAIGS  534

Query  386   QVLESWGFGRDEVEDLGETLSKLVNTLKP  300
              VL  WGFGR+EVED+ E L+KL+    P
Sbjct  535   LVLRDWGFGREEVEDMAEHLAKLLGPFHP  563



>ref|XP_007156834.1| hypothetical protein PHAVU_002G021300g [Phaseolus vulgaris]
 gb|ESW28828.1| hypothetical protein PHAVU_002G021300g [Phaseolus vulgaris]
Length=543

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/506 (58%), Positives = 394/506 (78%), Gaps = 1/506 (0%)
 Frame = -2

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G+ +YTPRLVS+  +GSLGSM+S G LY+E  S S DV+TW GKV+TQASEP KRNLFLQ
Sbjct  30    GIPSYTPRLVSINLRGSLGSMNSHGTLYTEVASTSPDVVTWTGKVSTQASEPFKRNLFLQ  89

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
              LY EE+N NM++   G ++ S +E +DK+I+ECLENGVQ+W+D+SKV +HP+SLY+L G
Sbjct  90    RLYEEEENSNMLNEIPGSKNGSPSEYEDKEIIECLENGVQFWSDYSKVHYHPRSLYELDG  149

Query  1454  LWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             +W   +EFN YGIGRD F    +GEE+++RLRFF+EECD+IQG QFIVDDSGGFS +AAE
Sbjct  150   VWPVVEEFNNYGIGRDCFAWAAQGEEISDRLRFFVEECDNIQGFQFIVDDSGGFSAVAAE  209

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
             FL+NI D+Y+N+PVLLY V+  G   N +S+K  +S+ LH+++SFSRL+S+ KLIVP+GL
Sbjct  210   FLENIVDEYTNIPVLLYAVQGSGPRTNLQSRKRTVSEVLHDSISFSRLSSYCKLIVPVGL  269

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKASR L I+D + +++SAVYA+ALHS+SLPFRM   GPTA++  +SGA++++ V
Sbjct  270   PSLSKSKASRFLHIEDAKHFHSSAVYAAALHSISLPFRMVPVGPTADACSSSGAVDIHGV  329

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ Q RQNMVS LDV+MPAP+LTG Q   SLL+    LTP+   D EDM A+E MT+
Sbjct  330   VQMLSGQGRQNMVSVLDVAMPAPALTGGQNDLSLLEMLQPLTPQTADDVEDMLAIEHMTV  389

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HG L S   RA V EVK TV+ A+  A +RP   HLSV+ CPLPIPLPFP+IFGN++G+ 
Sbjct  390   HGALASEGHRASVGEVKDTVEGAFRCANTRPMSCHLSVALCPLPIPLPFPSIFGNNVGKQ  449

Query  557   GELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             GEL+ +    +  +G LE+HS+PMA+RLRSS+ +LP LE++L+NL++ GIQRGA GA++L
Sbjct  450   GELMGSQTINSSPKGSLEIHSVPMAARLRSSSVVLPLLENKLQNLQRFGIQRGAAGAELL  509

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKP  300
              SWGFG +E+ ++ E LSK+V  L+P
Sbjct  510   RSWGFGMEELMEMDEMLSKMVAALRP  535



>gb|EAY83695.1| hypothetical protein OsI_38918 [Oryza sativa Indica Group]
Length=566

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/570 (52%), Positives = 407/570 (71%), Gaps = 23/570 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE VT+QVG ++N++GSHFWNFQDEL GLA+   +D VFKN +L+ DVLYRSGET QG+
Sbjct  1     MREAVTVQVGGFANYVGSHFWNFQDELLGLADDPDADPVFKNAALDMDVLYRSGETHQGV  60

Query  1808  LTYTPRLVSVGFQGSL-----GSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNL  1644
              TY PRLVSVG +  +     G +     L+             +G VT   S+P  RNL
Sbjct  61    ATYCPRLVSVGSRVYILHVHGGIICRVSWLFE---------FIRSGNVTRSVSKPHGRNL  111

Query  1643  FLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQ  1464
             FLQSL  E +N +  +G      +S   ++DKD++ECLENGV +WTD+SKV +HPQSLY+
Sbjct  112   FLQSLVEEGQNPSTSNG----GCNSQKSVEDKDLIECLENGVNFWTDYSKVHYHPQSLYE  167

Query  1463  LSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
             L G W D  +F NYG  ++   +  + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS +
Sbjct  168   LYGSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSSV  227

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFA-NTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             AA+FL+NIADDY+N  VLLY VR P +   + ++Q+ +I ++LH+AVSFS+L+SF  L+V
Sbjct  228   AAQFLENIADDYTNTLVLLYCVRDPMTLGPSRRNQRESIMRALHDAVSFSKLSSFCNLMV  287

Query  1109  PIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALN  930
             PIG  SLS S  S  L I+DE+P++ SAV A+A+HS+++PFR++  GP+++  ++SG L+
Sbjct  288   PIGPPSLSRSCMSPYLYIQDEKPFHASAVCAAAIHSITVPFRLQRTGPSSDLAHSSGNLD  347

Query  929   MYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAME  750
             + E++H+L+DQ RQNMV+ LDV+MPAPSLT     G++     SLTPE+  ++ED +++E
Sbjct  348   IGELVHILSDQGRQNMVTALDVAMPAPSLTDRDAMGNIEMKLHSLTPEISDEDEDPYSVE  407

Query  749   CMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNS  570
              + +HG L  G +R  + +VK +V   YE   ++PKFSHLS S CPLP+PLPFP+IF  +
Sbjct  408   SLVVHGALDRGGQRTSISQVKDSVCSVYEARETKPKFSHLSASLCPLPVPLPFPSIFRGN  467

Query  569   IGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIG  390
             IG+HGE+L     E+  +G L++ SIPMA+RLRSS+A+LPF+E R  +L+K G+ RGAIG
Sbjct  468   IGRHGEILSDHAEESQPKGSLDIESIPMAARLRSSSAVLPFIERRSGSLQKHGVARGAIG  527

Query  389   AQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             + VL  WGFGR+EVED+GE L+KL+    P
Sbjct  528   SLVLHDWGFGREEVEDMGEHLAKLLCPFHP  557



>gb|EMS56543.1| Protein misato-like protein 1 [Triticum urartu]
Length=559

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/565 (51%), Positives = 407/565 (72%), Gaps = 20/565 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEV---FKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+G+HFWNFQDEL GLA+       F+   L+ DVLYR+GET QG+
Sbjct  1     MREVVTVQVGGFANFVGAHFWNFQDELLGLADDPAADAAFRTAPLDMDVLYRTGETLQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
              TY PRLVSVG +        C +  +   + +  +  W+G VT    +P  RNLFLQSL
Sbjct  61    STYCPRLVSVGSR-------DCDDACTYPTALT--ISAWSGNVTRSVEKPHGRNLFLQSL  111

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
               +E N +  +G +    +S   ++DKD+VECLE  V +WTD++KVQ+HPQSLY++ G W
Sbjct  112   TEQEPNPSTSNGGN----NSQKSVEDKDLVECLEKDVNFWTDYTKVQYHPQSLYEMYGSW  167

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
              D  +F N+G  R+        EE+NE+LRFF+EECDHIQG+QFIVDDSGGFS +A+ +L
Sbjct  168   TDFDKFDNFGTAREVVSEWSLMEEMNEKLRFFVEECDHIQGIQFIVDDSGGFSSIASTYL  227

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
             +NIADDY+N PVLLY VR P +  ++++Q+  I++SLH+AVS S+L+SF  L+VPIGL S
Sbjct  228   ENIADDYTNTPVLLYCVRDPVTHGSSRNQRDTITRSLHDAVSLSKLSSFCSLMVPIGLPS  287

Query  1091  lsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIH  912
             LS S  S  L I+D +P+++SA+ A+A+HS+++PFR+++ GP +   ++SG ++M E++H
Sbjct  288   LSQSSLSPFLSIQDAKPFHSSAISAAAIHSVTVPFRLQNAGPASNIAHSSGNIDMRELVH  347

Query  911   VLADQARQNMVSTLDVSMPAPSLT-GNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
             +++DQ RQNMV+ LDV+MPAPSL  GN +    + +  +LTPE+  D ED +++E + +H
Sbjct  348   IISDQGRQNMVTALDVAMPAPSLKDGNDLWN--MKSLHTLTPEISDDEEDPYSVESLVVH  405

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             GVL +G  RA + +VK +V  AYE   ++PKFSHLSVS CPLPIPLPFP+IF ++IGQHG
Sbjct  406   GVLRAGGHRASISQVKGSVCSAYEARDTKPKFSHLSVSPCPLPIPLPFPSIFRSNIGQHG  465

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L   +  T ++G L+V SIPMA+RLRSS A+LPF+E R  +L+K GI RGA+G Q+L 
Sbjct  466   EILSNHVEGTQTKGSLDVESIPMAARLRSSNAVLPFIERRSLSLQKFGIARGALGTQILR  525

Query  374   SWGFGRDEVEDLGETLSKLVNTLKP  300
              WGFGR+E+ED+GE LSK+V    P
Sbjct  526   DWGFGREEMEDMGEHLSKMVRAFHP  550



>ref|XP_006852952.1| hypothetical protein AMTR_s00033p00240560 [Amborella trichopoda]
 gb|ERN14419.1| hypothetical protein AMTR_s00033p00240560 [Amborella trichopoda]
Length=551

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/541 (55%), Positives = 395/541 (73%), Gaps = 7/541 (1%)
 Frame = -2

Query  1907  DELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGLLTYTPRLVSVGFQGSLGSMSSCGN  1737
             DEL GLAE    D V+KN  ++ DV YR+GET QG+ TYTPRL+S+  QG+LGS+ + G+
Sbjct  2     DELLGLAEENNGDPVYKNTDMDMDVFYRAGETHQGIPTYTPRLLSIDMQGALGSLRASGS  61

Query  1736  LYSEKPS-QSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDG-PDGRESDSHN  1563
             LY   PS  +S V+TW GK T   SEP K+NLFLQSL  E+++++  +    G E +   
Sbjct  62    LYEGVPSLDASSVVTWKGKSTKHVSEPHKKNLFLQSLEDEDESLSYCNELAGGIEDNQTQ  121

Query  1562  EIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEFN-YGIGRDTFHNHQRG  1386
             E +DK  V+CLENGV++WTD+SKV FHPQSL++L+GLW    EFN YG GR+ F    +G
Sbjct  122   EDKDKQCVDCLENGVEFWTDYSKVHFHPQSLFELNGLWRGPHEFNNYGTGREVFSECLQG  181

Query  1385  EELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGS  1206
             EE++ RLRFF+EECDH+QG QFIVDDSGGFS +AAEFL+ I+D+Y N+P+LLY  R P S
Sbjct  182   EEISTRLRFFVEECDHMQGFQFIVDDSGGFSSVAAEFLEQISDEYRNIPILLYAARGPDS  241

Query  1205  FANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSA  1026
             + N  S K ++S++LH+A+SFSRL+SF  L+VP+GL SLS S ASR LC+ D +P++TSA
Sbjct  242   YTNIPSWKASMSKNLHDAISFSRLSSFCNLMVPLGLPSLSQSDASRFLCVDDAKPFHTSA  301

Query  1025  VYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPS  846
             VYA+ALHS+SLPFRM  PGP+A S   +GAL++  +  +L+ QA QNMV+ LD++MP+P 
Sbjct  302   VYAAALHSISLPFRMMLPGPSANSELIAGALDIGTMTQMLSGQAWQNMVTILDMAMPSP-  360

Query  845   LTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAY  666
             L G + +  L  +  SLTP + + +ED   +E M IHG L SG  RA +++VK +++  Y
Sbjct  361   LIGERNEVGLHRSLRSLTPNIAEGSEDRRGVETMVIHGALLSGGSRASIHQVKNSIEYGY  420

Query  665   EKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPM  486
             +    RP FSHLS S CPLPIPLPFP+IFGN IG +GE+LE PI    +RG L V SIPM
Sbjct  421   QNQAIRPLFSHLSTSLCPLPIPLPFPSIFGNRIGGYGEILEEPIFGVRARGSLGVSSIPM  480

Query  485   ASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTL  306
             A+RLRSS AILPF+E RL ++RKLG  RG+ G ++L+SWGF +DEV+D+ E L+K+ + L
Sbjct  481   ATRLRSSKAILPFIEKRLADIRKLGTARGSYGVELLQSWGFQKDEVDDMAEGLAKMAHAL  540

Query  305   K  303
             K
Sbjct  541   K  541



>gb|ABA99735.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ21037.1| hypothetical protein OsJ_36684 [Oryza sativa Japonica Group]
Length=566

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/570 (51%), Positives = 406/570 (71%), Gaps = 23/570 (4%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE VT+QVG ++N++GSHFWNFQDEL GLA+   +D VFKN +L+ DVLYRSGET QG+
Sbjct  1     MREAVTVQVGGFANYVGSHFWNFQDELLGLADDPDADPVFKNAALDMDVLYRSGETHQGV  60

Query  1808  LTYTPRLVSVGFQGSL-----GSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNL  1644
              TY PRLVSV  +  +     G +     L+             +G VT   S+P  RNL
Sbjct  61    ATYCPRLVSVDSRVYILHVHGGIICRVSWLFE---------FIRSGNVTRSVSKPHGRNL  111

Query  1643  FLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQ  1464
             FLQSL  E +N +  +G     S+S   ++ KD++ECLENG+ +WTD+SKV +HPQSLY+
Sbjct  112   FLQSLVEEGQNPSTSNG----GSNSQKSVEYKDLIECLENGINFWTDYSKVHYHPQSLYE  167

Query  1463  LSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
             L G W D  +F NYG  ++   +  + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS +
Sbjct  168   LYGSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSSV  227

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFA-NTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             AA+FL+NIADDY+N  VLLY VR P +   + ++Q+ +I ++LH+AVSFS+L+SF  L+V
Sbjct  228   AAQFLENIADDYTNTLVLLYCVRDPMTLGPSRRNQRESIMRALHDAVSFSKLSSFCNLMV  287

Query  1109  PIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALN  930
             PIG  SLS S  S  L I+DE+P++ SAV A+A+HS+++PFR++  GP+++  ++SG L+
Sbjct  288   PIGPPSLSRSCMSPYLYIQDEKPFHASAVCAAAIHSITVPFRLQRTGPSSDLAHSSGNLD  347

Query  929   MYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAME  750
             + E++H+L+DQ RQNMV+ LDV+MPAPSLT     G++     SLTPE+  ++ED +++E
Sbjct  348   IGELVHILSDQGRQNMVTALDVAMPAPSLTDRDAMGNIEMKLHSLTPEISDEDEDPYSVE  407

Query  749   CMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNS  570
              + +HG L  G +R  + +VK +V   YE   ++PKFSHLS S CPLP+PLPFP+IF  +
Sbjct  408   SLVVHGALDRGGQRTSISQVKDSVCSVYEARETKPKFSHLSASLCPLPVPLPFPSIFRGN  467

Query  569   IGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIG  390
             IG+HGE+L     E+  +G L++ SIPMA+RLRSS+A+LPF+E R  +L+K G+ RGAIG
Sbjct  468   IGRHGEILSDHTEESQPKGSLDIESIPMAARLRSSSAVLPFIERRSGSLQKHGVARGAIG  527

Query  389   AQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             + VL  WGFGR+EVED+GE L+KL+    P
Sbjct  528   SLVLHDWGFGREEVEDMGEHLAKLLRPFHP  557



>ref|XP_007204204.1| hypothetical protein PRUPE_ppa003427mg [Prunus persica]
 gb|EMJ05403.1| hypothetical protein PRUPE_ppa003427mg [Prunus persica]
Length=434

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/425 (64%), Positives = 337/425 (79%), Gaps = 7/425 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVGS++NF+GSHFWNFQDEL+GLAE   +D VFKN SLN DVLYRSGET QG 
Sbjct  1     MRELVTLQVGSFANFVGSHFWNFQDELNGLAEDPYADPVFKNQSLNMDVLYRSGETHQGT  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRLVSV  QGSLGSMSS G LY E  S SS++LTW G V+T A+EP K+NLFLQSL
Sbjct  61    LTYTPRLVSVDLQGSLGSMSSRGTLYDEGSSASSNILTWGGNVSTHAAEPHKKNLFLQSL  120

Query  1628  YMEEK--NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             Y EE+  ++   +G  G E +   EI D+D VE LENGVQYWTDFSKV++HPQSLY+LSG
Sbjct  121   YGEEQENSLTFENGVTGGE-NPRTEIHDRDKVESLENGVQYWTDFSKVEYHPQSLYELSG  179

Query  1454  LWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             LW+D Q+F NYGIGR++     +GEE++ERLRFF+EECDHIQG QFIVDDSGGFS LA +
Sbjct  180   LWVDPQKFDNYGIGRESLSGGLQGEEISERLRFFVEECDHIQGFQFIVDDSGGFSPLAVD  239

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L++IAD+Y+N PVLLY VR PGS  + +SQK  +S+ LH+AVSFSRL+S  KLIVP+GL
Sbjct  240   VLESIADEYTNAPVLLYAVRGPGSSVDPRSQKQRVSRKLHDAVSFSRLSSLCKLIVPVGL  299

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
              SLS SKAS  L I DE+PY+ SA YA+ LHSLSLPFRME  GPTA+S YASGA+ + EV
Sbjct  300   PSLSRSKASTFLWINDEKPYHCSAAYAATLHSLSLPFRMEPLGPTADSSYASGAVTVNEV  359

Query  917   IHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             + +L+ Q RQNMV+ LD +MPAPSL GNQV+ +LL +   LTPE+ +D ED+ ++E +++
Sbjct  360   VEILSGQTRQNMVAILDAAMPAPSLIGNQVEQTLLRHLQPLTPEIAKDIEDLQSVESISV  419

Query  737   HGVLG  723
             HG LG
Sbjct  420   HGALG  424



>ref|XP_002442421.1| hypothetical protein SORBIDRAFT_08g019730 [Sorghum bicolor]
 gb|EES16259.1| hypothetical protein SORBIDRAFT_08g019730 [Sorghum bicolor]
Length=576

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/566 (52%), Positives = 418/566 (74%), Gaps = 12/566 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE VT+QVG ++NF+GSHFWNFQDEL GLA+   +D VF+  +L+ DVLYR+GETQQG+
Sbjct  1     MREAVTVQVGGFANFVGSHFWNFQDELLGLADDPGADPVFRTAALDLDVLYRAGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEK-PSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TY PRLVSVG +GSLGS+SS G L S    +   ++ TW+G VT   ++P +RNLFLQS
Sbjct  61    ATYCPRLVSVGSRGSLGSLSSSGTLGSSSSAADQPNIFTWSGNVTKSVAKPHERNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             L   E N +  +G     +++   I+DKD+VE LENGV +WTD+SKVQ+HPQSLY+L G 
Sbjct  121   LSEGESNPSSSNG----RNNARENIEDKDLVENLENGVIFWTDYSKVQYHPQSLYELYGS  176

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D  +F NYG  ++      + EE+NERLRFF+EECDHIQG+QF+VDDSGGF+ +AA+F
Sbjct  177   WTDFDKFDNYGTAKEVVSEWSQMEEMNERLRFFVEECDHIQGIQFLVDDSGGFASVAAQF  236

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++IADDY+N PV+LY VR+P S  ++++Q+  I +SLH+AVS S+L+    L+VPIGL 
Sbjct  237   LESIADDYTNTPVMLYCVRNPDSSGSSRNQRETIIRSLHDAVSLSKLSYSCNLMVPIGLP  296

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS         IKD++ +++SA+ A+A+HSLS+PFR++H GP  +S ++SG L++ E++
Sbjct  297   SLSYLSPLLS--IKDDKHFHSSAICAAAIHSLSVPFRLQHVGPATDSAHSSGKLDIGELV  354

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
             H+L+DQ RQNM++ LDV+MPAPSLT  +   ++  +  SLTPE+  ++ED +A+E + +H
Sbjct  355   HILSDQGRQNMITALDVAMPAPSLTDRKDLRNIQRSLHSLTPEISNNDEDPYAVESLVVH  414

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G L +G +RA + +VK  ++   E   ++PKFSHLSVS CPLPIPLPFP+IF  SIGQ G
Sbjct  415   GALDAGGKRASISQVKDAIRSGLEGRETKPKFSHLSVSPCPLPIPLPFPSIFSGSIGQQG  474

Query  554   ELLETPITE-TPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVL  378
             E+L     E +  +G L+V S+PMA+RLRSS+AI+PF+E R  +L++LG+ RG +G+QVL
Sbjct  475   EILSNSHPEGSRPKGSLDVVSVPMAARLRSSSAIVPFIERRSTSLQRLGVARGTLGSQVL  534

Query  377   ESWGFGRDEVEDLGETLSKLVNTLKP  300
               WGFG++EVED+GE L+K++    P
Sbjct  535   RDWGFGKEEVEDMGEHLAKMLRPFYP  560



>ref|XP_006664689.1| PREDICTED: protein misato homolog 1-like [Oryza brachyantha]
Length=599

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/557 (52%), Positives = 414/557 (74%), Gaps = 9/557 (2%)
 Frame = -2

Query  1955  VGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGLLTYTPRLV  1785
             VG ++N++GSHFWNFQDEL GLA+    D VF+  +L+ DVLYR+GET QG+ TY PRLV
Sbjct  38    VGGFANYVGSHFWNFQDELLGLADDPDVDPVFRTAALDMDVLYRTGETHQGVPTYCPRLV  97

Query  1784  SVGFQGSLGSMSSCGNLY-SEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKNM  1608
             SVG +GSLGS+SS GNL  +  P+   D++TW+G VT   S+P  RNLFLQSL  E +N 
Sbjct  98    SVGSRGSLGSLSSSGNLSQTSAPADQLDIITWSGNVTKSVSKPHGRNLFLQSLVEEGQNP  157

Query  1607  NMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-  1431
             +  +G     S+S   ++DKD++ECLENGV +WTD+SKVQ+HPQSLY+L G W D  +F 
Sbjct  158   STSNG----GSNSQKSVEDKDLIECLENGVNFWTDYSKVQYHPQSLYELHGSWTDFDKFD  213

Query  1430  NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDY  1251
             NYG  ++   +  + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS +AA FL+NIADDY
Sbjct  214   NYGSAQEVVLDWSQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSSVAARFLENIADDY  273

Query  1250  SNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskas  1071
             +N PVLLY VR P +  ++++++ +I++SLH+AVSF++L+S+  L+VPIG  SLS S  S
Sbjct  274   TNTPVLLYCVRDPVTLGSSRNKRESITRSLHDAVSFAKLSSYCNLMVPIGPPSLSRSYLS  333

Query  1070  rrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQAR  891
               L I+DE+P+++SAV A+A+HS+++PFR+   GP++   ++SG L++ E++H+L+DQ R
Sbjct  334   PYLYIQDEKPFHSSAVCAAAIHSVTVPFRLTRLGPSSNLAHSSGNLDIGELVHILSDQGR  393

Query  890   QNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSR  711
              NM++ LDV+MPAPSLT     G++     SLTPE+  ++ED +++E + IHG +  G +
Sbjct  394   LNMITALDVAMPAPSLTDRDAMGNIEMKLQSLTPEIRDEDEDPYSVESLVIHGAIDRGGQ  453

Query  710   RAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPIT  531
             R  + +VK +V   YE   +R KFSHL+VS CPLP+PLPFP+IF  +IG+HGE+L     
Sbjct  454   RTSISQVKDSVCSVYEGRETRAKFSHLAVSMCPLPVPLPFPSIFRGNIGRHGEILGDNSE  513

Query  530   ETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDE  351
              T  +G +++ S+PMA+RLRSS+A+LPF+E R  +L+K G+ RG++G+QVL  WGFGR+E
Sbjct  514   GTQPKGSIDIESVPMAARLRSSSAVLPFIERRSGSLQKHGVARGSVGSQVLRDWGFGREE  573

Query  350   VEDLGETLSKLVNTLKP  300
             V+D+GE L+KL+    P
Sbjct  574   VQDMGEHLAKLLRPFYP  590



>gb|ACG28797.1| hypothetical protein [Zea mays]
Length=560

 Score =   535 bits (1377),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 288/545 (53%), Positives = 403/545 (74%), Gaps = 13/545 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA+   +D VF+  +L+ DVLYR+GET Q +
Sbjct  1     MREVVTVQVGGFANFVGSHFWNFQDELLGLADDPGADPVFRTAALDMDVLYRAGETHQSV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSS-DVLTWAGKVTTQASEPLKRNLFLQS  1632
              +Y PRLVSVG +GSLGS+SS G L S   +    ++ TW+GKVT   ++P +RNLFLQS
Sbjct  61    ASYCPRLVSVGSRGSLGSLSSSGTLGSSSAAADEPNIFTWSGKVTKSVAKPHERNLFLQS  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             L  EE+N +  DG       ++  ++DKD+V  LENGV++WTD+SKVQ+HPQSLY+L G 
Sbjct  121   LSEEEQNPSSSDG------QNNASVEDKDLVANLENGVKFWTDYSKVQYHPQSLYELYGS  174

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D   F NYG  ++      + EE+NERLRFF+EECDHIQG+QF+VDDSGGF+ +AA+F
Sbjct  175   WTDFDRFDNYGTAKEVVSEWSQMEEMNERLRFFVEECDHIQGIQFLVDDSGGFASVAAQF  234

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++I DDY+N PV+LY VR+P S+ ++++Q   I +SLH+AVS S+L+ +  L+VPIGL 
Sbjct  235   LESIVDDYTNTPVMLYCVRNPDSYGSSRNQCETIIRSLHDAVSLSKLSYYCNLMVPIGLP  294

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS         IKDE+ +++SA+ A+A+HSLS+PFR++H GP ++S ++SG L++ E++
Sbjct  295   SLSYLSPLLS--IKDEKHFHSSAICAAAMHSLSIPFRLQHVGPASDSAHSSGKLDIGELV  352

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
             H+L+DQ RQNM++ LDV+MPAPSLT      ++  +  SLTPE+  ++ED +A+E M +H
Sbjct  353   HILSDQGRQNMITALDVAMPAPSLTDRTDLRNIQRSLHSLTPEISDEDEDPYAVESMVVH  412

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             GVL +G +RA + +VK ++  A E   ++PKFSHLSVS CPLPIPLPFP+IF +S+GQ G
Sbjct  413   GVLDAGGKRASISQVKESICSALEGRATKPKFSHLSVSRCPLPIPLPFPSIFSSSVGQQG  472

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L T       +GPL V S+PMA+RLRSS+AI PF+E R  +L++LG+ RG +G+QVL 
Sbjct  473   EILGTSHAGARPKGPLAVGSVPMAARLRSSSAIAPFIERRSASLQRLGVARGTLGSQVLH  532

Query  374   SWGFG  360
              WG G
Sbjct  533   DWGLG  537



>ref|XP_008792587.1| PREDICTED: protein misato homolog 1 isoform X3 [Phoenix dactylifera]
 ref|XP_008792588.1| PREDICTED: protein misato homolog 1 isoform X3 [Phoenix dactylifera]
Length=594

 Score =   535 bits (1379),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 288/508 (57%), Positives = 387/508 (76%), Gaps = 5/508 (1%)
 Frame = -2

Query  1817  QGLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPS-QSSDVLTWAGKVTTQASEPLKRNLF  1641
             +GLLTY+PRL+SVGFQGSLGS+SS G+L+    +   +D++TW G V+  A+EP K+NLF
Sbjct  3     EGLLTYSPRLISVGFQGSLGSLSSSGSLFDNISTYDPTDIVTWIGNVSRCAAEPDKKNLF  62

Query  1640  LQSLYMEEKNMNMV--DGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLY  1467
             LQSL  E++  + +  + PD  ++    +IQDKD+VECLE+GVQ+WTDFSKVQ+HP+SLY
Sbjct  63    LQSLCEEDQQKSALYANDPDKEKTSPQKQIQDKDLVECLESGVQFWTDFSKVQYHPRSLY  122

Query  1466  QLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
             +L G W D Q+  NYGIG+D      + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS 
Sbjct  123   ELHGSWTDVQKLDNYGIGKDVLSEGLQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSS  182

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             +AAE+L+NIAD+Y+N PVLLY  R PG++A   SQK +I++ LH+AVSFSRL+SF KL+V
Sbjct  183   VAAEYLENIADEYTNTPVLLYAARDPGAYAFPVSQKESITRVLHDAVSFSRLSSFCKLMV  242

Query  1109  PIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALN  930
             P+GL SL +  +S    + D++ +++SAVYA+++HS+S+P RME PGPTA S Y SGA++
Sbjct  243   PVGLPSLRSKLSSVLN-VDDQKLFHSSAVYAASIHSISIPLRMELPGPTATSAYVSGAVD  301

Query  929   MYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAME  750
             + E++H+LA Q RQNMV+ LD +MPAPSLT    QGS+  N   LTPEVE+D++D+HA+E
Sbjct  302   VGEIVHILAGQERQNMVTILDTAMPAPSLTDEHNQGSIHRNLHPLTPEVEEDDDDLHAVE  361

Query  749   CMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNS  570
              + IHG L SG  RA + +VK  +  +Y     +PK ++LSV+ CPLPIPLPFP+IFG+ 
Sbjct  362   SLIIHGALHSGDHRASISQVKDAINASYLGGSQKPKLAYLSVALCPLPIPLPFPSIFGSC  421

Query  569   IGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIG  390
             +G+HGELL        SRG LE+ SIPMA+RLRSS A++P +E RL NLRK G  RGA G
Sbjct  422   VGRHGELLGNQSEGAHSRGSLEIDSIPMAARLRSSKAVMPLIERRLGNLRKHGTARGAPG  481

Query  389   AQVLESWGFGRDEVEDLGETLSKLVNTL  306
             A++L SWGFG+DEVED+GE LS+L+ +L
Sbjct  482   AELLRSWGFGKDEVEDMGEFLSRLLMSL  509



>ref|XP_010263737.1| PREDICTED: protein misato homolog 1 isoform X3 [Nelumbo nucifera]
 ref|XP_010263739.1| PREDICTED: protein misato homolog 1 isoform X3 [Nelumbo nucifera]
 ref|XP_010263740.1| PREDICTED: protein misato homolog 1 isoform X3 [Nelumbo nucifera]
 ref|XP_010263741.1| PREDICTED: protein misato homolog 1 isoform X3 [Nelumbo nucifera]
Length=474

 Score =   529 bits (1362),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 285/472 (60%), Positives = 357/472 (76%), Gaps = 12/472 (3%)
 Frame = -2

Query  1703  VLTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLEN  1524
             V TW G VT   S+P K+NLFLQ L  EE       G    E D H  IQDKDIVECLEN
Sbjct  3     VRTWTGNVTKLVSDPQKKNLFLQRLDEEEH------GKPSAEEDDH--IQDKDIVECLEN  54

Query  1523  GVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEE  1347
             GV +WTDFSKV +HPQSLY+L GLWMDAQEF NYGIGRD F    RGEE+N+RLRFF+EE
Sbjct  55    GVHFWTDFSKVHYHPQSLYELKGLWMDAQEFDNYGIGRDIFSEALRGEEINDRLRFFVEE  114

Query  1346  CDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKS---QKLN  1176
             CD IQG+QFIVDDSGGFS +AAEFL+NIAD+Y+N PVLLY  R PG     K+   +K +
Sbjct  115   CDQIQGIQFIVDDSGGFSSVAAEFLENIADEYTNTPVLLYAARGPGPGTTNKNALGRKDS  174

Query  1175  ISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLS  996
             IS++LH+AVSFSRL+SFSKLIVPIGL  LS SKAS  LCI+D + Y+ SAVYA+ALHS+S
Sbjct  175   ISKALHDAVSFSRLSSFSKLIVPIGLPFLSRSKASTFLCIEDSKAYHCSAVYAAALHSIS  234

Query  995   LPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL  816
             LPFRME  G   +S Y +GA+++  ++ +LA QARQNMV+ LDV+MPAP LTG Q + S+
Sbjct  235   LPFRMESIGSATDSHYVAGAIDVNGIVQMLAGQARQNMVAILDVAMPAPCLTGEQNKQSV  294

Query  815   LDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFS  636
                  SLTPE+ +D ED  A+E  T+HG+  SG   A + EV+ ++  +YE A++RP FS
Sbjct  295   QRGLHSLTPEIAEDVEDFRAIESTTVHGIHHSGGNPASISEVQDSIFASYESALTRPMFS  354

Query  635   HLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAI  456
             HLSV+ CPLPIPLPFP+IF N + + GELL++PI  + SRG L+VHSIPMA+RLRSS AI
Sbjct  355   HLSVALCPLPIPLPFPSIFSNLVRERGELLDSPIYGSQSRGSLDVHSIPMAARLRSSNAI  414

Query  455   LPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             LP++E+RL NLR+ GI++GA G++VL SWGF +DE++D+GE LS++V  L P
Sbjct  415   LPYIETRLGNLRRFGIEKGAPGSEVLRSWGFEKDELQDMGEELSRMVMALDP  466



>emb|CDX72616.1| BnaC07g46380D [Brassica napus]
Length=874

 Score =   540 bits (1391),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 306/566 (54%), Positives = 407/566 (72%), Gaps = 40/566 (7%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVTIQVG ++NF+GSHFWNFQDEL GLA   ESD +F+N++L+ DVLYRSGETQQG+
Sbjct  335   MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNNNLDMDVLYRSGETQQGV  394

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVL-TWAGKVTTQASEPLKRNLFLQS  1632
              TYTPRL+S+ F+GSLGSMSS G LY++  S  SD   TW G V TQ SEP KRNLF QS
Sbjct  395   STYTPRLLSINFKGSLGSMSSHGTLYNQASSSRSDSSQTWFGDVDTQRSEPRKRNLFQQS  454

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             LY EE     +              +DKDIV  L+  V+ WTDFSK  +HPQSLY+L+GL
Sbjct  455   LYEEEATATEI--------------EDKDIVGSLDETVECWTDFSKSHYHPQSLYELNGL  500

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD+ +FN YG G+D F    RG+E+ ++LRFF+EECDHIQGV F+VDDSGGFS LA +F
Sbjct  501   WMDSHDFNNYGAGKDLFSEASRGDEICDKLRFFVEECDHIQGVNFLVDDSGGFSPLAGDF  560

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+ +ADDY+NVPVLLY++RSP       SQK  +   LH+AVSFSRL+SF KL  PIGL 
Sbjct  561   LETMADDYTNVPVLLYSLRSP------VSQKKTVINKLHDAVSFSRLSSFCKLFTPIGLP  614

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SL+  K      + DE+PY +SAVYA+ALHS +LPFRM+H   +++S   S A+++  ++
Sbjct  615   SLTGMKYLS---LGDEKPYRSSAVYAAALHSSTLPFRMQHT--SSDSSEVSNAMDVNTLV  669

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIH  735
              +L ++ RQN+V+ LD +MP        ++ +LL N  +LTPEV +D ED  ++E M I 
Sbjct  670   QLLTNRGRQNIVAILDSAMP--------LEKTLLTNLQTLTPEVTEDVEDNQSVESMCIL  721

Query  734   GVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHG  555
             G LGS  + A V EV+  V  +Y++   RP F +LSVS  PLP+PLPFP+IFGN +G+ G
Sbjct  722   GALGSEDQEATVSEVRNAVDASYDE--QRPLFCNLSVSRVPLPVPLPFPSIFGNLVGRKG  779

Query  554   ELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLE  375
             E+L +P ++   RG L+VHS+P+A+R RSS+A+LPFLESR+ NL KLGIQ GA+G+ V+ 
Sbjct  780   EILSSPASDLMCRGSLDVHSVPVATRWRSSSAVLPFLESRMVNLEKLGIQWGAVGSDVVR  839

Query  374   SWGFGRDEVEDLGETLSKLVNTLKPY  297
             +WGFGR+E++++ E L+K+V+ L P+
Sbjct  840   AWGFGREELQEMRENLAKMVSELSPH  865



>ref|XP_003578235.1| PREDICTED: protein misato homolog 1 [Brachypodium distachyon]
Length=571

 Score =   527 bits (1358),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 294/568 (52%), Positives = 415/568 (73%), Gaps = 14/568 (2%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHS---LNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA+            L+ D LYR+GET QG+
Sbjct  1     MREVVTVQVGGFANFVGSHFWNFQDELLGLADDPAADAAFRAAPLDMDALYRAGETLQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
              TY PRLVSVG +GSLGS+SS G        +Q   V TW+G VT   ++P  RNLFL+S
Sbjct  61    STYCPRLVSVGSRGSLGSLSSSGTSGLSSAAAQELKVPTWSGNVTRSVAKPHGRNLFLES  120

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             L   E+  +  DG     +DS   ++DK++VECLENGV +WTD++KVQ+HPQSLY+L+G 
Sbjct  121   LAEGEQKPSTGDGAG---NDSQKSVEDKELVECLENGVNFWTDYTKVQYHPQSLYELNGS  177

Query  1451  WMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W +  +F+ YG  R+      + EE+NERLRFF+EECDHIQG+QFI+DDSGGFS +AA +
Sbjct  178   WTNFDKFDHYGTAREVVSEWSQMEEMNERLRFFVEECDHIQGIQFILDDSGGFSSVAAHY  237

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIADDY+N PVLLY VR P +    ++Q+ ++++SLH+AVSFS+L+SF  L+VPIGL 
Sbjct  238   LENIADDYTNTPVLLYCVRDPVTHGPPRTQRESMTRSLHDAVSFSKLSSFCNLMVPIGLP  297

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
             SLS S  S  L I+D +P+++SAV A+A+HS+++PFR+++ GP +   ++SG +++ E++
Sbjct  298   SLSQSYFSPFLSIQDVKPFHSSAVSAAAIHSVTVPFRLQNAGPASNFAHSSGNIDIGELV  357

Query  914   HVLADQARQNMVSTLDVSMPAPSLT-GNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTI  738
             H+++ Q  QNMV+ LDV+MPAPSLT GN +    + +  SLTPE+  ++ED +++E + +
Sbjct  358   HIISGQGWQNMVTALDVAMPAPSLTDGNGLWN--IKSLHSLTPEISDEDEDPYSVESLVV  415

Query  737   HGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH  558
             HGV+ +G +RA + +VK +V  AYE   ++PKFSHLSVS CPL IPLPFP+IF ++IG+H
Sbjct  416   HGVMLAGGQRASISQVKDSVCSAYEGRSTKPKFSHLSVSPCPLAIPLPFPSIFRSNIGRH  475

Query  557   GELL--ETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQ  384
             GE+L   +  T+ P +G L+V S+PMA+RLRSS AILPF+E R  +L+KLG+ RG +G+Q
Sbjct  476   GEILSNHSERTQLP-KGSLDVESVPMAARLRSSNAILPFIERRSLSLQKLGVARGTLGSQ  534

Query  383   VLESWGFGRDEVEDLGETLSKLVNTLKP  300
              L  WGFG++E+ED+ E LSK+V    P
Sbjct  535   ALRDWGFGKEEIEDMSEHLSKMVRMFHP  562



>ref|NP_001031800.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH19516.1| AT4G37190 [Arabidopsis thaliana]
 gb|AEE86765.1| uncharacterized protein AT4G37190 [Arabidopsis thaliana]
Length=516

 Score =   525 bits (1351),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 292/521 (56%), Positives = 387/521 (74%), Gaps = 20/521 (4%)
 Frame = -2

Query  1847  DVLYRSGETQQGLLTYTPRLVSVGFQGSLGSMSSCGNLYSE-KPSQSSDVLTWAGKVTTQ  1671
             DVLYRSGETQQG+ TYTPRLVSV  +G+LG+MSS G LY+E   S+S    TW G V TQ
Sbjct  2     DVLYRSGETQQGVATYTPRLVSVNLKGALGTMSSRGTLYNEGSSSRSDSSATWFGDVDTQ  61

Query  1670  ASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKV  1491
              SEP KRNLFLQSLY EE  +       G+E     EI+DKDIV CL+  V+ WTDFSK 
Sbjct  62    RSEPRKRNLFLQSLYEEEHVV-------GKEK--AKEIEDKDIVGCLDEEVECWTDFSKS  112

Query  1490  QFHPQSLYQLSGLWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIV  1314
              +HPQSLY+L+GLWMD+Q FN YGIG+D F    RGEE+ +RLRFF+EECDHIQG++F+V
Sbjct  113   HYHPQSLYELNGLWMDSQAFNNYGIGKDVFSEASRGEEICDRLRFFVEECDHIQGIKFLV  172

Query  1313  DDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRL  1134
             DDSGGFS +AA+FL+N+AD+Y+NVPVLLY+VR+P S     S K  +S  LH+A+SFSRL
Sbjct  173   DDSGGFSAVAADFLENMADEYTNVPVLLYSVRTPMS---QMSSKKTVSNKLHDAISFSRL  229

Query  1133  ASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAES  954
             +SF KL  PIGL SL+ SKAS+ L + DE+PY +SAVYA+ALHS ++PFRM+   PT+  
Sbjct  230   SSFCKLFTPIGLPSLTGSKASKFLNLGDEKPYRSSAVYAAALHSSTIPFRMQ---PTSSD  286

Query  953   IYASGA-LNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQ  777
                    +++  ++ +L  + RQN+V+ LD +MPAP+L G Q++ +LL +  +LTPEV +
Sbjct  287   SSEVSNSMDVNTLVQLLTGRGRQNIVAILDSAMPAPTLAGKQLENTLLTSLQALTPEVTE  346

Query  776   DNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISR--PKFSHLSVSccplpi  603
             D ED  A+E M I G L S  + A V EVK  V  +YE+A ++  P F +LSVS CPLP+
Sbjct  347   DVEDNQAVESMCILGALRSEDKEALVSEVKNAVDASYEQATTKGKPLFCNLSVSRCPLPV  406

Query  602   plpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENL  423
             PLPFP+IFGN +G+ GE+L +P++++  RG L+VHSIP+A+R RSS+AILPFLE+R+ NL
Sbjct  407   PLPFPSIFGNLVGRKGEILSSPVSDSLYRGSLDVHSIPVATRWRSSSAILPFLETRMGNL  466

Query  422   RKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
              KLGIQ GA+G+ V+ +WGFGR+E++++ E LSK+V+ L P
Sbjct  467   EKLGIQWGAMGSDVVRAWGFGREELQEMRENLSKMVSELNP  507



>gb|EMT07279.1| hypothetical protein F775_02253 [Aegilops tauschii]
Length=610

 Score =   524 bits (1350),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 291/607 (48%), Positives = 406/607 (67%), Gaps = 53/607 (9%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEV---FKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA+       F+   L+ DVLYR+GET QG+
Sbjct  1     MREVVTVQVGGFANFVGSHFWNFQDELLGLADDPAADAAFRTAPLDMDVLYRTGETLQGV  60

Query  1808  LTYTPRLVSVGF---------------------QGSLGSMSSCGNLYSE---------KP  1719
              TY PRLVSVG                      Q ++ +       Y E          P
Sbjct  61    STYCPRLVSVGSRGSLGSLSSSGAPSLSSAASDQLNVTTWQVTLLTYPEFVSVPRLPTMP  120

Query  1718  SQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIV  1539
                S + +W+G VT    +P  RNLFLQSL  +E N +  +G +    +S   ++DKD+V
Sbjct  121   LMHSWLFSWSGNVTRSVEKPHGRNLFLQSLTEQEPNPSTSNGGN----NSQKSVEDKDLV  176

Query  1538  ECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLR  1362
             ECLE  V +WTD++KVQ+HPQSLY++ G W D  +F N+G  R+        EE+NE+LR
Sbjct  177   ECLEKDVNFWTDYTKVQYHPQSLYEMYGSWTDFDKFDNFGTAREVVSEWSLMEEMNEKLR  236

Query  1361  FFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQK  1182
             FF+EECDHIQG+QFIVDDSGGFS +AA +L+NIADDY+N PVLLY VR P +  ++++Q+
Sbjct  237   FFVEECDHIQGIQFIVDDSGGFSSIAATYLENIADDYTNTPVLLYCVRDPVTHGSSRNQR  296

Query  1181  LNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHS  1002
               I++SLH+AVS S+L+SF  L+VPIGL SLS S  S  L I+D +P+++SA+ A+A+HS
Sbjct  297   DTITRSLHDAVSLSKLSSFCSLMVPIGLPSLSQSSLSPFLSIQDAKPFHSSAISAAAIHS  356

Query  1001  LSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLT-GNQVQ  825
             +++PFR+++ GP +   ++SG ++M E++H+++DQ RQNMV+ LDV+MPAPSL  GN + 
Sbjct  357   VTVPFRLQNAGPASNIAHSSGNIDMRELVHIISDQGRQNMVTALDVAMPAPSLKDGNDLW  416

Query  824   GSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVL------------GSGSRRAPVYEVKRT  681
                + +  +LTPE+  + ED +++E + +HGVL             +G  RA + +VK +
Sbjct  417   N--MKSLRTLTPEISDEEEDPYSVESLVVHGVLRAEITNTSCRFADTGGHRASISQVKDS  474

Query  680   VQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEV  501
             V  AYE   ++PKFSHLSVS CPLPIPLPFP+IF + IGQHGE+L      T  +G L+V
Sbjct  475   VYSAYEGRATKPKFSHLSVSPCPLPIPLPFPSIFRSHIGQHGEILSNHAEGTQPKGSLDV  534

Query  500   HSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSK  321
              SIPMA+RLRSS A+LPF+E R  +L+K G+ RG++G Q+L  WGFGR+E+ED+ E LSK
Sbjct  535   ESIPMAARLRSSNAVLPFIERRSLSLQKFGVARGSLGTQILRDWGFGREEMEDMSEHLSK  594

Query  320   LVNTLKP  300
             +V    P
Sbjct  595   MVRAFHP  601



>tpg|DAA47291.1| TPA: hypothetical protein ZEAMMB73_753758 [Zea mays]
Length=577

 Score =   517 bits (1331),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 278/583 (48%), Positives = 399/583 (68%), Gaps = 39/583 (7%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQGL  1809
             MRE+VT+QVG ++NF+GSHFWNFQDEL GLA+   +D VF+  +L+ DVLYR+GET Q  
Sbjct  1     MREVVTVQVGGFANFVGSHFWNFQDELLGLADDPGADPVFRTAALDMDVLYRAGETHQ--  58

Query  1808  LTYTPRLVSVGFQGSL-GSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQS  1632
               Y+  L+    +  +  S+    NL     S        +GKVT   ++P +RNLFLQS
Sbjct  59    --YSGDLILSDERAQIRNSVIGSWNLVITGLS-----CCRSGKVTKSVAKPHERNLFLQS  111

Query  1631  LYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             L  EE+N +  DG       ++  ++DKD+V  LENGV++WTD+SKVQ+HPQSLY+L G 
Sbjct  112   LSEEEQNPSSSDG------QNNASVEDKDLVANLENGVKFWTDYSKVQYHPQSLYELYGS  165

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             W D   F NYG  ++      + EE+NERLRFF+EECDHIQG+QF+VDDSGGF+ +AA+F
Sbjct  166   WTDFDRFDNYGTAKEVVSEWSQMEEMNERLRFFVEECDHIQGIQFLVDDSGGFASVAAQF  225

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L++I DDY+N PV+LY VR+P S+ ++++Q   I +SLH+AVS S+L+ +  L++ +  S
Sbjct  226   LESIVDDYTNTPVMLYCVRNPDSYGSSRNQCETIIRSLHDAVSLSKLSYYCNLMM-LHSS  284

Query  1094  slsaskasrrLC------------------IKDEQPYYTSAVYASALHSLSLPFRMEHPG  969
                    +   C                  IKDE+ +++SA+ A+A+HSLS+PFR++H G
Sbjct  285   PQITHTPTVGECNAHSIITQPYGYLSPLLSIKDEKHFHSSAICAAAMHSLSIPFRLQHVG  344

Query  968   PTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
             P ++S ++SG L++ E++H+L+DQ RQNM++ LDV+MPAPSLT      ++  +  SLTP
Sbjct  345   PASDSAHSSGKLDIGELVHILSDQGRQNMITALDVAMPAPSLTDRTDLRNIQRSLHSLTP  404

Query  788   EVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccpl  609
             E+  ++ED +A+E M +HGVL +G +RA + +VK ++  A E   ++PKFSHLSVS CPL
Sbjct  405   EISDEDEDPYAVESMVVHGVLDAGGKRASISQVKESICSALEGRATKPKFSHLSVSRCPL  464

Query  608   piplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLE  429
             PIPLPFP+IF +S+GQ GE+L T       +GPL V S+PMA+RLRSS+AI PF+E R  
Sbjct  465   PIPLPFPSIFSSSVGQQGEILGTSHAGARPKGPLAVGSVPMAARLRSSSAIAPFIERRSA  524

Query  428   NLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             +L++LG+ RG +G+QVL  WGFGR+EVED+ E L+K++    P
Sbjct  525   SLQRLGVARGTLGSQVLHDWGFGREEVEDMAEHLAKMLRPFYP  567



>gb|KDO79315.1| hypothetical protein CISIN_1g0109571mg, partial [Citrus sinensis]
Length=403

 Score =   508 bits (1309),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 258/403 (64%), Positives = 315/403 (78%), Gaps = 5/403 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG ++NFIGSHFWNFQDEL GLA    +D VF+N  LN DVLYR+GETQQG+
Sbjct  1     MREIVTVQVGGFANFIGSHFWNFQDELLGLASDPNNDPVFRNQCLNMDVLYRTGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRL+SVGFQGSLGSMSS G LY+E     SDV+TW+G V+T AS P K+NLFLQ L
Sbjct  61    LTYTPRLLSVGFQGSLGSMSSRGLLYNESSPGPSDVVTWSGSVSTHASAPRKKNLFLQRL  120

Query  1628  YMEEK-NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             Y EE+ + +M++G    +SDS  EIQDKDIVE L+N V++WTDFSKV +HPQSLY+L GL
Sbjct  121   YEEEQESFSMINGTSSGKSDSQREIQDKDIVEFLDNHVEFWTDFSKVHYHPQSLYELGGL  180

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD QEF NYGIG+D F    RGEE+ ERLRFF+EE DHIQG QF+VDDSGGFS +AA+ 
Sbjct  181   WMDPQEFDNYGIGKDAFSEGFRGEEICERLRFFVEESDHIQGFQFVVDDSGGFSAVAADL  240

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+Y+N PVLL+ VRSP S  N +S+K  I + LH+ VSFSRLASF KLIVP+GL 
Sbjct  241   LENIADEYANTPVLLFAVRSPSSQMNLRSRKQTIFRELHDTVSFSRLASFGKLIVPVGLP  300

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
              L+ SKAS  LCI++E+PY+ SAVYA+ALHS +LP+RME  GPTA+S    GA+++   +
Sbjct  301   FLNESKASTLLCIENEKPYHCSAVYAAALHSATLPYRMEPVGPTADSFDVFGAVDINGFV  360

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPE  786
              +LA QARQN V+ LD +MPAP+L G Q + SLL N   LTPE
Sbjct  361   QMLAGQARQNTVAILDAAMPAPALNGKQHEQSLLGNLQPLTPE  403



>gb|EAZ26222.1| hypothetical protein OsJ_10090 [Oryza sativa Japonica Group]
Length=553

 Score =   503 bits (1295),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 274/571 (48%), Positives = 387/571 (68%), Gaps = 38/571 (7%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAE---SDEVFKNHSLNTDVLYRSGETQQ-G  1812
             MRE VT+QVG ++ ++GSHFWNFQDEL GLA+   +D VFKN +L+ DVLYRSGET Q  
Sbjct  1     MREAVTVQVGGFAKYVGSHFWNFQDELLGLADDPDADPVFKNDALDMDVLYRSGETHQHT  60

Query  1811  LLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKV-----TTQASEPLKRN  1647
             +L +T                    +Y          L W   V             +  
Sbjct  61    MLDFT-------------------RVYPHT------ALVWCRLVLECWLRVHGGIICRVP  95

Query  1646  LFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLY  1467
              F + + + E+  N         S+S   ++DKD+++CLEN V +WTD+SKVQ+HPQSLY
Sbjct  96    WFFEFICLVEEGQN--PSTSNGASNSQKSVEDKDLIDCLENSVNFWTDYSKVQYHPQSLY  153

Query  1466  QLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
             +L G W D  +F NYG  ++   +  + EE+NERLRFF+EECDHIQG+QFIVDDSGGFS 
Sbjct  154   ELHGSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFFVEECDHIQGIQFIVDDSGGFSS  213

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTK-SQKLNISQSLHNAVSFSRLASFSKLI  1113
             +AA+FL+NIADDY+N PVLLY VR P +  +++ +Q+ +I ++LH+AVSFS+L+SF  L+
Sbjct  214   VAAQFLENIADDYTNTPVLLYCVRDPMTLGSSRRNQRESIMRALHDAVSFSKLSSFCNLM  273

Query  1112  VPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGAL  933
             VPIG  SLS S  S  L I+DE+P++ SAV A+A+HS+++PFR++  GP+++  ++SG L
Sbjct  274   VPIGPPSLSRSYMSSYLYIQDEKPFHASAVCAAAIHSITVPFRLQRTGPSSDLAHSSGNL  333

Query  932   NMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAM  753
             ++ E++H+L+DQ RQNMV+ LDV+MPAPSLT     G++     SLTPE+  ++ED +++
Sbjct  334   DIGELLHILSDQGRQNMVTALDVAMPAPSLTDRDAMGNIEMKLHSLTPEISDEDEDPYSV  393

Query  752   ECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGN  573
             E + +HG L  G +R  + +VK +V   YE   ++PKFSHLS S CPLP+PLPFP+IF  
Sbjct  394   ESLVVHGALDKGGQRTSISQVKGSVCSVYEARETKPKFSHLSASLCPLPVPLPFPSIFRG  453

Query  572   SIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAI  393
             +IG+HGE+L     E+  +G L++ SIPMA+RLRSS+A+LPF+E R  +L+K G+ RGAI
Sbjct  454   NIGRHGEILSDHAEESQPKGSLDIESIPMAARLRSSSAVLPFIERRSGSLQKHGVARGAI  513

Query  392   GAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             G+ VL  WGFGR+EVED+ E L+KL+    P
Sbjct  514   GSLVLRDWGFGREEVEDMAEHLAKLLGPFHP  544



>ref|XP_008792586.1| PREDICTED: protein misato homolog 1 isoform X2 [Phoenix dactylifera]
Length=615

 Score =   505 bits (1301),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 264/464 (57%), Positives = 351/464 (76%), Gaps = 4/464 (1%)
 Frame = -2

Query  1688  GKVTTQASEPLKRNLFLQSLYME--EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQ  1515
             G V+  A+EP K+NLFLQSL  E  +K+    + PD  ++    +IQDKD+VECLE+GVQ
Sbjct  68    GNVSRCAAEPDKKNLFLQSLCEEDQQKSALYANDPDKEKTSPQKQIQDKDLVECLESGVQ  127

Query  1514  YWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDH  1338
             +WTDFSKVQ+HP+SLY+L G W D Q+  NYGIG+D      + EE+NERLRFF+EECDH
Sbjct  128   FWTDFSKVQYHPRSLYELHGSWTDVQKLDNYGIGKDVLSEGLQIEEMNERLRFFVEECDH  187

Query  1337  IQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLH  1158
             IQG+QFIVDDSGGFS +AAE+L+NIAD+Y+N PVLLY  R PG++A   SQK +I++ LH
Sbjct  188   IQGIQFIVDDSGGFSSVAAEYLENIADEYTNTPVLLYAARDPGAYAFPVSQKESITRVLH  247

Query  1157  NAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRME  978
             +AVSFSRL+SF KL+VP+GL SL +  +S    + D++ +++SAVYA+++HS+S+P RME
Sbjct  248   DAVSFSRLSSFCKLMVPVGLPSLRSKLSSVLN-VDDQKLFHSSAVYAASIHSISIPLRME  306

Query  977   HPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVS  798
              PGPTA S Y SGA+++ E++H+LA Q RQNMV+ LD +MPAPSLT    QGS+  N   
Sbjct  307   LPGPTATSAYVSGAVDVGEIVHILAGQERQNMVTILDTAMPAPSLTDEHNQGSIHRNLHP  366

Query  797   LTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSc  618
             LTPEVE+D++D+HA+E + IHG L SG  RA + +VK  +  +Y     +PK ++LSV+ 
Sbjct  367   LTPEVEEDDDDLHAVESLIIHGALHSGDHRASISQVKDAINASYLGGSQKPKLAYLSVAL  426

Query  617   cplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLES  438
             CPLPIPLPFP+IFG+ +G+HGELL        SRG LE+ SIPMA+RLRSS A++P +E 
Sbjct  427   CPLPIPLPFPSIFGSCVGRHGELLGNQSEGAHSRGSLEIDSIPMAARLRSSKAVMPLIER  486

Query  437   RLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTL  306
             RL NLRK G  RGA GA++L SWGFG+DEVED+GE LS+L+ +L
Sbjct  487   RLGNLRKHGTARGAPGAELLRSWGFGKDEVEDMGEFLSRLLMSL  530



>gb|KHN42060.1| Protein misato like 1 [Glycine soja]
Length=444

 Score =   469 bits (1206),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 254/434 (59%), Positives = 337/434 (78%), Gaps = 1/434 (0%)
 Frame = -2

Query  1604  MVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-N  1428
             M++   G  + S +E +DKDI ECLENGVQ+WTD+SKV +HP+SLY+L+G+W   +EF N
Sbjct  1     MINEIRGSNNGSQSEYEDKDITECLENGVQFWTDYSKVHYHPRSLYELNGVWAHVEEFDN  60

Query  1427  YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYS  1248
             YGIGRD+F    +GEE+++RLRFF+EECDHIQG QF+VDDSGGFS +AAEFL+NI D+Y+
Sbjct  61    YGIGRDSFAWAAQGEEISDRLRFFVEECDHIQGFQFVVDDSGGFSAVAAEFLENIVDEYT  120

Query  1247  NVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasr  1068
             N+PVLLY V+  GS  N +S+K  + + LH+AVSFSRL+SF KLIVP+GL SLS SKASR
Sbjct  121   NIPVLLYAVQGSGSRTNLQSRKHTVLEDLHDAVSFSRLSSFCKLIVPVGLPSLSKSKASR  180

Query  1067  rLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQ  888
              L I+D + Y++SAVYA+ALHS+SLPFRM   GPT+++   SGA++++ V+ +L+ Q RQ
Sbjct  181   FLHIEDAKHYHSSAVYAAALHSISLPFRMVPVGPTSDACSVSGAVDVHGVVQMLSGQGRQ  240

Query  887   NMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRR  708
             NMVS LDV+MPAP+LTG Q + SLL+    LTP++ +D EDM A+E MT+HG L S   R
Sbjct  241   NMVSVLDVAMPAPALTGVQNELSLLEILQPLTPQIAEDVEDMQAIEHMTVHGALASEGHR  300

Query  707   APVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITE  528
             A V +VK TV  A+  A +RP F HLSV+  PLPIPLPFP+IFGN++GQHGEL+   IT 
Sbjct  301   ASVGQVKDTVDAAFLCADTRPMFCHLSVALSPLPIPLPFPSIFGNNVGQHGELMSGQITN  360

Query  527   TPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEV  348
             +  +G L +HSIPMA+RLRSS+ +LPFLES+L NL + GIQR A GA++L +WGFG++E+
Sbjct  361   SSPKGSLVIHSIPMAARLRSSSIVLPFLESKLRNLHQYGIQRRAAGAELLRTWGFGQEEL  420

Query  347   EDLGETLSKLVNTL  306
              ++ E LSK+V  L
Sbjct  421   VEMEEVLSKMVAAL  434



>gb|KDO79314.1| hypothetical protein CISIN_1g0109571mg, partial [Citrus sinensis]
Length=381

 Score =   461 bits (1187),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 243/403 (60%), Positives = 296/403 (73%), Gaps = 27/403 (7%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG ++NFIGSHFWNFQDEL GLA    +D VF+N  LN DVLYR+GETQQG+
Sbjct  1     MREIVTVQVGGFANFIGSHFWNFQDELLGLASDPNNDPVFRNQCLNMDVLYRTGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPRL+SVGFQGSLGSMSS G LY+E     SDV+TW+G V+T AS P K+NLFLQ L
Sbjct  61    LTYTPRLLSVGFQGSLGSMSSRGLLYNESSPGPSDVVTWSGSVSTHASAPRKKNLFLQRL  120

Query  1628  YMEEK-NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             Y EE+ + +M++G    +SDS  EIQDKDI                      SLY+L GL
Sbjct  121   YEEEQESFSMINGTSSGKSDSQREIQDKDI----------------------SLYELGGL  158

Query  1451  WMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
             WMD QEF NYGIG+D F    RGEE+ ERLRFF+EE DHIQG QF+VDDSGGFS +AA+ 
Sbjct  159   WMDPQEFDNYGIGKDAFSEGFRGEEICERLRFFVEESDHIQGFQFVVDDSGGFSAVAADL  218

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L+NIAD+Y+N PVLL+ VRSP S  N +S+K  I + LH+ VSFSRLASF KLIVP+GL 
Sbjct  219   LENIADEYANTPVLLFAVRSPSSQMNLRSRKQTIFRELHDTVSFSRLASFGKLIVPVGLP  278

Query  1094  slsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVI  915
              L+ SKAS  LCI++E+PY+ SAVYA+ALHS +LP+RME  GPTA+S    GA+++   +
Sbjct  279   FLNESKASTLLCIENEKPYHCSAVYAAALHSATLPYRMEPVGPTADSFDVFGAVDINGFV  338

Query  914   HVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPE  786
              +LA QARQN V+ LD +MPAP+L G Q + SLL N   LTPE
Sbjct  339   QMLAGQARQNTVAILDAAMPAPALNGKQHEQSLLGNLQPLTPE  381



>dbj|BAC84426.1| tubulin-related protein-like [Oryza sativa Japonica Group]
Length=489

 Score =   462 bits (1188),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 244/473 (52%), Positives = 347/473 (73%), Gaps = 7/473 (1%)
 Frame = -2

Query  1712  SSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVEC  1533
             SS  L  +G VT   S+P  RNLFLQSL  E +N +  +G     S+S   ++DKD+++C
Sbjct  13    SSFALAMSGNVTRSVSKPHGRNLFLQSLVEEGQNPSTSNG----ASNSQKSVEDKDLIDC  68

Query  1532  LENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFF  1356
             LENGV +WTD+SKVQ+HPQSLY+L G W D  +F NYG  ++   +  + EE+NERLRFF
Sbjct  69    LENGVNFWTDYSKVQYHPQSLYELHGSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFF  128

Query  1355  IEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTK-SQKL  1179
             +EECDHIQG+QFIV DSG FS +AA+FL+NIADDY+N PVLLY VR P +  +++ +Q+ 
Sbjct  129   VEECDHIQGIQFIVGDSGSFSSVAAQFLENIADDYTNTPVLLYCVRDPMTLGSSRMNQRE  188

Query  1178  NISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSL  999
             +I ++LH+AVSFS+L+SF  L+VPIG  SLS S  S  L I+DE+P++ SAV A+A+HS+
Sbjct  189   SIMRALHDAVSFSKLSSFCNLMVPIGPPSLSRSYMSPYLYIQDEKPFHASAVCAAAIHSI  248

Query  998   SLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGS  819
             ++PFR++  GP+++  ++SG L++ E++H+L+DQ RQNMV+ LDV+MPAPSLT   + G+
Sbjct  249   TVPFRLQRTGPSSDLAHSSGNLDIGELLHILSDQGRQNMVTALDVAMPAPSLT-EMLLGN  307

Query  818   LLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKF  639
             +     SLTPE+  ++ED +++E + +HG L  G +R  + +VK +V   YE   ++PKF
Sbjct  308   IEMKLHSLTPEISDEDEDPYSVESLVVHGALDRGGQRTSISQVKDSVCSVYEARETKPKF  367

Query  638   SHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTA  459
             SHLS S CPLP+PLPFP+IF  +IG+HGE+L     E+  +G L++ SIPMA+RLRSS+ 
Sbjct  368   SHLSASLCPLPVPLPFPSIFRGNIGRHGEILSDHAEESQPKGSLDIESIPMAARLRSSST  427

Query  458   ILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             +LPF+E R  +L+K G+ RGAIG+ VL  WGFGR+EV+D+GE L+KL+    P
Sbjct  428   VLPFIERRSGSLQKHGVARGAIGSLVLRDWGFGREEVDDMGEHLAKLLRPFHP  480



>gb|EEE67107.1| hypothetical protein OsJ_24116 [Oryza sativa Japonica Group]
Length=1572

 Score =   460 bits (1183),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 241/466 (52%), Positives = 344/466 (74%), Gaps = 7/466 (2%)
 Frame = -2

Query  1691  AGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQY  1512
             +G VT   S+P  RNLFLQSL  E +N +  +G     S+S   ++DKD+++CLENGV +
Sbjct  1103  SGNVTRSVSKPHGRNLFLQSLVEEGQNPSTSNG----ASNSQKSVEDKDLIDCLENGVNF  1158

Query  1511  WTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHI  1335
             WTD+SKVQ+HPQSLY+L G W D  +F NYG  ++   +  + EE+NERLRFF+EECDHI
Sbjct  1159  WTDYSKVQYHPQSLYELHGSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFFVEECDHI  1218

Query  1334  QGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTK-SQKLNISQSLH  1158
             QG+QFIV DSG FS +AA+FL+NIADDY+N PVLLY VR P +  +++ +Q+ +I ++LH
Sbjct  1219  QGIQFIVGDSGSFSSVAAQFLENIADDYTNTPVLLYCVRDPMTLGSSRMNQRESIMRALH  1278

Query  1157  NAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRME  978
             +AVSFS+L+SF  L+VPIG  SLS S  S  L I+DE+P++ SAV A+A+HS+++PFR++
Sbjct  1279  DAVSFSKLSSFCNLMVPIGPPSLSRSYMSPYLYIQDEKPFHASAVCAAAIHSITVPFRLQ  1338

Query  977   HPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVS  798
               GP+++  ++SG L++ E++H+L+DQ RQNMV+ LDV+MPAPSLT   + G++     S
Sbjct  1339  RTGPSSDLAHSSGNLDIGELLHILSDQGRQNMVTALDVAMPAPSLT-EMLLGNIEMKLHS  1397

Query  797   LTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSc  618
             LTPE+  ++ED +++E + +HG L  G +R  + +VK +V   YE   ++PKFSHLS S 
Sbjct  1398  LTPEISDEDEDPYSVESLVVHGALDRGGQRTSISQVKDSVCSVYEARETKPKFSHLSASL  1457

Query  617   cplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLES  438
             CPLP+PLPFP+IF  +IG+HGE+L     E+  +G L++ SIPMA+RLRSS+ +LPF+E 
Sbjct  1458  CPLPVPLPFPSIFRGNIGRHGEILSDHAEESQPKGSLDIESIPMAARLRSSSTVLPFIER  1517

Query  437   RLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             R  +L+K G+ RGAIG+ VL  WGFGR+EV+D+GE L+KL+    P
Sbjct  1518  RSGSLQKHGVARGAIGSLVLRDWGFGREEVDDMGEHLAKLLRPFHP  1563



>ref|XP_009759816.1| PREDICTED: protein misato homolog 1-like [Nicotiana sylvestris]
Length=334

 Score =   399 bits (1025),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 243/297 (82%), Gaps = 4/297 (1%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAES---DEVFKNHSLNTDVLYRSGETQQGL  1809
             MREIVT+QVG+Y+NFIGSHFWNFQDEL GLAES   D+VF+NH L+ DVLYR+GETQQG+
Sbjct  1     MREIVTVQVGNYANFIGSHFWNFQDELLGLAESPGTDQVFRNHGLDMDVLYRTGETQQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL  1629
             LTYTPR+VSV FQGSLGS+SS G+LY++ P++S DV+TW G+V T ASEPL+RNLFLQSL
Sbjct  61    LTYTPRMVSVNFQGSLGSLSSRGSLYNQIPAKSLDVMTWKGRVATHASEPLRRNLFLQSL  120

Query  1628  YMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLW  1449
               EE+        D R   S  EIQDKDIVECLE+ VQYWTDFSKV +HPQSLY+LSGLW
Sbjct  121   SEEEQESMDKAALDNRNDSSQGEIQDKDIVECLESDVQYWTDFSKVHYHPQSLYELSGLW  180

Query  1448  MDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
             +D Q+F NY +G+D F  HQ GEE+++RLRFFIEECD IQG+Q +VDDSGGFSG+AA FL
Sbjct  181   VDIQDFDNYALGKDAFCGHQHGEEIDDRLRFFIEECDRIQGIQCVVDDSGGFSGVAAAFL  240

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
             +NIAD+Y NVPVLLY  R+P    ++K +K  IS++LH+AVSFSRL+   KLI+P+G
Sbjct  241   ENIADEYPNVPVLLYNARTPSLHMDSKGRKQAISRNLHDAVSFSRLSELCKLIIPVG  297



>ref|XP_008344324.1| PREDICTED: protein misato homolog 1-like [Malus domestica]
Length=364

 Score =   396 bits (1018),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 214/346 (62%), Positives = 269/346 (78%), Gaps = 0/346 (0%)
 Frame = -2

Query  1334  QGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHN  1155
             QG QFIVDDSGGFS LA + L++IAD+Y+N PV+LY VR  GS  + +SQK  +S+ LH+
Sbjct  11    QGFQFIVDDSGGFSPLAVDVLESIADEYTNAPVMLYAVRGSGSSMDPRSQKQRVSRKLHD  70

Query  1154  AVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEH  975
             AVSFS L+S  KLIVP+GL SLS SKAS  L I DE+PY+ SA YA+ LHS+SLPFRME 
Sbjct  71    AVSFSMLSSLCKLIVPVGLPSLSTSKASTFLSINDERPYHCSAAYAATLHSVSLPFRMEP  130

Query  974   PGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
              GPT +S YASGA+ + EV+ +L+ QARQNMV+ LD +MP+PSL GN +  +LL N   L
Sbjct  131   LGPTGDSSYASGAVTVSEVVQILSGQARQNMVAILDAAMPSPSLAGNSLGETLLRNLQPL  190

Query  794   TPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVScc  615
             TPE  +D ED+ ++E MT+HG LGSG  RA + EVK TV  AYE AI+RP + HLSV+ C
Sbjct  191   TPETAEDVEDLQSVESMTVHGALGSGGHRASISEVKDTVHAAYEHAITRPIYCHLSVAQC  250

Query  614   plpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESR  435
             PLPIPLPFP+IFGN +GQHGELL TPI  +P+RG L+VHSIPMA+RLRSS+A+LPFLE+R
Sbjct  251   PLPIPLPFPSIFGNLVGQHGELLSTPIVGSPTRGSLDVHSIPMAARLRSSSAVLPFLENR  310

Query  434   LENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             L  LR  GI RGA GA+++ SWGF +DE+ED+GE LSK++ TL P+
Sbjct  311   LGGLRSCGIARGAPGAELVRSWGFAKDELEDMGEMLSKMIATLDPH  356



>gb|EEC77882.1| hypothetical protein OsI_17172 [Oryza sativa Indica Group]
Length=798

 Score =   405 bits (1041),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 311/466 (67%), Gaps = 39/466 (8%)
 Frame = -2

Query  1691  AGKVTTQASEPLKRNLFLQSLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQY  1512
             +G VT   S+P  RNLFLQSL  E +N +  +G     S+S   ++DKD+++CLENGV +
Sbjct  361   SGNVTRSVSKPHGRNLFLQSLVEEGQNPSTSNGA----SNSQKSVEDKDLIDCLENGVNF  416

Query  1511  WTDFSKVQFHPQSLYQLSGLWMDAQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHI  1335
             WTD+SKVQ+HPQSLY+L G W D  +F NYG  ++   +  + EE+NERLRFF+EECDHI
Sbjct  417   WTDYSKVQYHPQSLYELHGSWTDFDKFDNYGSAQEVVSDWSQIEEMNERLRFFVEECDHI  476

Query  1334  QGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTK-SQKLNISQSLH  1158
             QG+QFIV DSG FS +AA+FL+NIADDY+N PVLLY VR P +  +++ +Q+ +I ++LH
Sbjct  477   QGIQFIVGDSGSFSSVAAQFLENIADDYTNTPVLLYCVRDPMTLGSSRMNQRESIMRALH  536

Query  1157  NAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRME  978
             +AVSFS+L+SF  L+VPIG  SLS S  S  L I+DE+P++ SAV A+A+HS++ PFR++
Sbjct  537   DAVSFSKLSSFCNLMVPIGPPSLSRSYMSPYLYIQDEKPFHASAVCAAAIHSITAPFRLQ  596

Query  977   HPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVS  798
               GP+++  ++SG L++ E++H+L+DQ RQNM+  L               G++     S
Sbjct  597   RTGPSSDLAHSSGNLDIGELLHILSDQGRQNMIEML--------------LGNIEMKLHS  642

Query  797   LTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSc  618
             LTPE+  ++ED +++E + +HG L  G +R                +ISR K SHL    
Sbjct  643   LTPEISDEDEDPYSVESLVVHGALDRGGQRT---------------SISRVKDSHL---F  684

Query  617   cplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLES  438
              P   P       GN IG+HGE+L     E+  +G L++ SIPMA+RLRSS+ +LPF+E 
Sbjct  685   APSLSPFRSRQSSGN-IGRHGEILSDHAEESQPKGSLDIESIPMAARLRSSSTVLPFIER  743

Query  437   RLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             R  +L+K G+ RGAIG+ VL  WGFGR+EV+D+GE L+KL+    P
Sbjct  744   RSGSLQKHGVARGAIGSLVLRDWGFGREEVDDMGEHLAKLLRPFHP  789



>ref|XP_002963360.1| hypothetical protein SELMODRAFT_79429 [Selaginella moellendorffii]
 gb|EFJ35231.1| hypothetical protein SELMODRAFT_79429 [Selaginella moellendorffii]
Length=543

 Score =   366 bits (939),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 241/573 (42%), Positives = 354/573 (62%), Gaps = 51/573 (9%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREI T+Q+G+Y+NF+G+HFWNFQDEL GLA   E+D VF+   L+ DVLYR+GET+QG+
Sbjct  1     MREIATLQIGAYANFVGAHFWNFQDELLGLAADHEADPVFQRSGLDMDVLYRTGETRQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPS--QSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
              TYTPRLV++  +GSLG++ S G+LY E       + + TW G V+    EP +++ FL+
Sbjct  61    ATYTPRLVAIDLRGSLGAVRSSGSLYDEGQGVLHGTQLHTWTGPVSLHKEEPPEKSEFLK  120

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
              L  EE          G++S++     D+ IV+ L+  VQ WTD+SKVQ HP+S+Y++ G
Sbjct  121   RLEAEEA---------GQQSNA----TDETIVQGLDERVQSWTDYSKVQLHPRSVYEIEG  167

Query  1454  LWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             +W     F+ +  G+  F    R EE  ER RF +EECDH+QGVQ +VDDSGGFSG+A++
Sbjct  168   VWNTVTPFDSFCHGKGLFTQSFRLEEFQERFRFVVEECDHLQGVQALVDDSGGFSGVASD  227

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L N  D+Y  +P +L+TVR P      + +   + +SLH+A SF+ L+S   ++VP+GL
Sbjct  228   ILTNFEDEYGGIPFMLFTVRPP------EEEPRPVVRSLHDAFSFASLSSIGDIVVPLGL  281

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
               LS S  +R L I D + + TSAVYA ALH+ +LPFRM      A S  A G  +M  +
Sbjct  282   PQLSRSAFARHLTIDDAKVFQTSAVYAGALHNATLPFRM-----LASSTQAGGC-DMGVL  335

Query  917   IHVLADQARQNMVSTLDVSMPA--PSLTGNQVQGSLLDNF-VSLTPEVEQDNEDMHAMEC  747
             +  L    R   V+ L  ++P+   S+    ++  L+    VSLTPEV   +   +A E 
Sbjct  336   VKGLTYATRN--VANLSAALPSGMSSVFKKDLREPLVFFLSVSLTPEVALASSQDYAAES  393

Query  746   MTIHGVLGSGSR-RAPVYEVKRTVQDAYEKAISRPKF-SHLSVSccplpiplpfpaiFGN  573
               I G   +GS+  A V +V +++   YEK     KF SH++ S CPLP+PLPFP+IF +
Sbjct  394   YVIQGARLAGSKGLATVTDVMKSIN--YEKQ----KFSSHVACSPCPLPVPLPFPSIFRS  447

Query  572   SIGQHGE-LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGA  396
             S+G++G+ +LET  +    RG L+V S+P+A+ LR+   I P+L  RL ++ +LG++R  
Sbjct  448   SVGRYGDIILETSPSSATGRGALDVFSVPVATSLRTDKGIEPYLRRRLSDIEQLGLKR--  505

Query  395   IGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
               + VL+ W   R++VE+L E L+   NTL  Y
Sbjct  506   -QSPVLQGWDLAREDVEELREVLA---NTLARY  534



>ref|XP_002974649.1| hypothetical protein SELMODRAFT_101569 [Selaginella moellendorffii]
 gb|EFJ24169.1| hypothetical protein SELMODRAFT_101569 [Selaginella moellendorffii]
Length=543

 Score =   365 bits (937),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 238/573 (42%), Positives = 351/573 (61%), Gaps = 51/573 (9%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLA---ESDEVFKNHSLNTDVLYRSGETQQGL  1809
             MREI T+Q+G+Y+NF+G+HFWNFQDEL GLA   E+D VF+   L+ DVLYR+GET+QG+
Sbjct  1     MREIATLQIGAYANFVGAHFWNFQDELLGLAADHEADPVFQRSGLDMDVLYRTGETRQGV  60

Query  1808  LTYTPRLVSVGFQGSLGSMSSCGNLYSEKPS--QSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
              TYTPRLV++  +GSLG++ S G+LY E       + + TW G V+    EP +++ FL+
Sbjct  61    ATYTPRLVAIDLRGSLGAVRSSGSLYDEGQGVLHGTQLHTWTGPVSLHKEEPPEKSEFLK  120

Query  1634  SLYMEEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
              L  EE          G++S++     D+ IV+ L+  VQ WTD+SKVQ HP+S+Y++ G
Sbjct  121   RLEAEEA---------GQQSNA----TDETIVQGLDERVQSWTDYSKVQLHPRSVYEIEG  167

Query  1454  LWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
             +W     F+ +  G+  F    R EE  ER RFF+EECDH+QGVQ +VDDSGGFSG+A++
Sbjct  168   IWNTVTPFDSFCHGKGLFTQSFRLEEFQERFRFFVEECDHLQGVQALVDDSGGFSGVASD  227

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
              L N  D+Y  +P +L+TVR P      + +   + +SLH+AVSF+ L+S   ++VP+GL
Sbjct  228   ILTNFEDEYGGIPFMLFTVRPP------EEEPRPVVRSLHDAVSFASLSSIGDIVVPLGL  281

Query  1097  sslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEV  918
               LS S  +R L I D + + TSAVYA ALH+ +LPFRM        S    G  +M  +
Sbjct  282   PQLSRSAFARHLTIDDAKVFQTSAVYAGALHNATLPFRM------LASSTQVGGCDMGVL  335

Query  917   IHVLADQARQNMVSTLDVSMPA--PSLTGNQVQGSLLDNF-VSLTPEVEQDNEDMHAMEC  747
             +  L    R   V+ L  ++P+   S+    ++  L+    V LTPEV   +   +A E 
Sbjct  336   VKGLTYATRN--VANLSAALPSGMSSIFKQDLREPLVFFLSVPLTPEVALASSQDYAAES  393

Query  746   MTIHGVLGSGSR-RAPVYEVKRTVQDAYEKAISRPKF-SHLSVSccplpiplpfpaiFGN  573
               I G   +GS+  A V +V +++         + KF SH++ S CPLP+PLPFP+IF +
Sbjct  394   YVIQGARLAGSKGLATVTDVMKSMN------YGKQKFSSHVACSPCPLPVPLPFPSIFRS  447

Query  572   SIGQHGE-LLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGA  396
             S+G++G+ LLET  +    RG L+V S+P+A+ LR+   I P+L  RL ++ +LG++R  
Sbjct  448   SVGRYGDILLETSPSSATGRGALDVFSVPVATSLRTDKGIEPYLRRRLSDIEQLGLKR--  505

Query  395   IGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
               + VL+ W   R++VE+L E L+   NTL  Y
Sbjct  506   -QSPVLQDWDLAREDVEELREVLA---NTLARY  534



>ref|XP_001758033.1| predicted protein [Physcomitrella patens]
 gb|EDQ77275.1| predicted protein [Physcomitrella patens]
Length=553

 Score =   364 bits (934),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 213/562 (38%), Positives = 335/562 (60%), Gaps = 31/562 (6%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             MRE+VT+Q+G ++NF+G+HFWNFQDE+ G  E         L+ DVLYR GET+QG+ TY
Sbjct  1     MREVVTVQLGGFANFVGAHFWNFQDEVLGSLEDG---GQIGLDMDVLYRVGETRQGIATY  57

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPS-QSSDVLTWAGKVTTQASEPLKRNLFLQSLYM  1623
              PRL+++  +G+LG++ + G+LY   P  QSS V T    +  Q++              
Sbjct  58    MPRLLALDLRGNLGAVRAAGSLYEYSPQLQSSSVNTCFSSIEFQST--------------  103

Query  1622  EEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMD  1443
                  N+ +    R+     E +++ +V+ L+  V++WTD+ K   HP+S+Y+L   +  
Sbjct  104   -----NVPESSRSRDIAPSEETKERSLVKSLDGSVEFWTDYLKAHLHPRSVYELPNTFHG  158

Query  1442  AQEF-NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
                F NY  G+  F   ++ EE+  RLRFF+EECDH+QG QF+VD+SGGF+ +AA+FL+ 
Sbjct  159   VTPFDNYSCGQGFFKEQEQLEEVENRLRFFVEECDHLQGFQFMVDNSGGFAAVAADFLEA  218

Query  1265  IADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssls  1086
             + D+Y+  P LL+++R P S   + S +  +  SLH +VS +RL+S + L+VP+GL  L+
Sbjct  219   VGDEYNRTPHLLFSLRPPWS-PPSASHRDAVIASLHESVSLARLSSLTNLLVPVGLQQLA  277

Query  1085  askasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPT-AESIYASGALNMYEVIHV  909
             +S+ S+  C+ D + ++TSA+YA+AL++++LPFRM+  GPT A      G+ +M   +  
Sbjct  278   SSQFSKYTCVNDSKIFHTSALYATALNTITLPFRMQVSGPTEASQQKGVGSSDMSNTVR-  336

Query  908   LADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGV  729
             L   ++Q  ++ L+ ++P P L         L +  SLTP+V+Q      A E + I G 
Sbjct  337   LVSCSQQKKIALLEAAVPGPPLPVGTPGAFDLTSLSSLTPDVDQSYFGTQAAEALVIQGA  396

Query  728   LGSGSRRAPVYEVKRTVQDAYEKAISRPK----FSHLSVSccplpiplpfpaiFGNSIGQ  561
               SG+       V + ++  Y    +  +    +  LSVS  P+PIP+PFP IFG +I  
Sbjct  397   RISGAMLTRSASVAQVLECTYTGKPANRRGAISYCQLSVSPNPVPIPVPFPCIFGPNISA  456

Query  560   HGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQV  381
              G++L   I     RG L++ SIP+A+RL S  ++LP+++ RL + RKLG+ R +IG  V
Sbjct  457   RGDILPNSIASVAGRGGLDILSIPVAARLTSRDSLLPYVKGRLMSFRKLGLSRASIGGGV  516

Query  380   LESWGFGRDEVEDLGETLSKLV  315
             LE WGF ++EV+DL E L  L 
Sbjct  517   LEDWGFMKEEVQDLAEVLGNLA  538



>ref|XP_009774711.1| PREDICTED: uncharacterized protein LOC104224720 [Nicotiana sylvestris]
Length=244

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 195/237 (82%), Gaps = 0/237 (0%)
 Frame = -2

Query  1010  LHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQ  831
             ++S SLPFRM+  GP+AESI  SGAL+MY ++ +LA Q RQNMV+ LDV+MPAPSL+ NQ
Sbjct  1     MYSFSLPFRMKQSGPSAESICTSGALDMYGIVQMLAGQMRQNMVTVLDVAMPAPSLSVNQ  60

Query  830   VQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAIS  651
              Q SLL +   LTP+V +D ED+HA+E M IHG + SGS+RA +YEVK  VQ AY+ +++
Sbjct  61    AQQSLLGSLQPLTPDVAEDVEDLHAVETMNIHGAVTSGSQRASIYEVKDAVQAAYDSSLT  120

Query  650   RPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLR  471
              PKFSHLSV+ CPLPIPLPFP+IFGN +GQHGELLETPI+ + SRG LEV S PM +RLR
Sbjct  121   MPKFSHLSVATCPLPIPLPFPSIFGNMVGQHGELLETPISGSSSRGSLEVQSFPMVTRLR  180

Query  470   SSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKP  300
             SSTA+LPFLES+L NLRK GI RGA+GA +L+SWGFG+DEVED+GETLSKLV TLKP
Sbjct  181   SSTAVLPFLESKLGNLRKFGIDRGALGAPLLQSWGFGKDEVEDMGETLSKLVVTLKP  237



>dbj|BAK06655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=311

 Score =   280 bits (716),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 156/304 (51%), Positives = 229/304 (75%), Gaps = 3/304 (1%)
 Frame = -2

Query  1208  SFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQPYYTS  1029
             S  ++++Q+  IS+SLH+AVSFS+L+SF  L+VPIGL SLS S  S  L I+D +P+++S
Sbjct  1     SHGSSRNQRETISRSLHDAVSFSKLSSFCSLMVPIGLPSLSQSYLSPFLSIQDAKPFHSS  60

Query  1028  AVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAP  849
             A+ A+A+HS+++PFR+++ GP +   ++SG ++M E++H+++DQ RQNMV+ LDV+MPAP
Sbjct  61    AISAAAIHSVTVPFRLQNAGPASNIAHSSGNIDMRELVHIISDQGRQNMVTALDVAMPAP  120

Query  848   SLT-GNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQD  672
             SL  GN +    + +  SLTPE+  + ED +++E + +HGVL +G  RA + +VK +V  
Sbjct  121   SLKDGNDLWN--MKSLHSLTPEISDEEEDPYSVESLVVHGVLRAGGHRASISQVKSSVYS  178

Query  671   AYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSI  492
             AYE   ++PKFSHLSVS CPLPIPLPFP+IF ++I QHGE+L      T ++G L+V SI
Sbjct  179   AYEARATKPKFSHLSVSPCPLPIPLPFPSIFRSNISQHGEILGNHAEGTQTKGSLDVESI  238

Query  491   PMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVN  312
             PMA+RLRSS A+LPF+E R  +L+K G+ RGA+G Q+L  WGFGR+E+ED+GE LS++V 
Sbjct  239   PMAARLRSSNAVLPFIERRSLSLQKFGVARGALGTQILRDWGFGREEMEDMGEHLSRMVR  298

Query  311   TLKP  300
              L+P
Sbjct  299   ALRP  302



>gb|ACR35312.1| unknown [Zea mays]
Length=350

 Score =   251 bits (642),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 191/253 (75%), Gaps = 0/253 (0%)
 Frame = -2

Query  1058  IKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMV  879
             IKDE+ +++SA+ A+A+HSLS+PFR++H GP ++S ++SG L++ E++H+L+DQ RQNM+
Sbjct  88    IKDEKHFHSSAICAAAMHSLSIPFRLQHVGPASDSAHSSGKLDIGELVHILSDQGRQNMI  147

Query  878   STLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPV  699
             + LDV+MPAPSLT      ++  +  SLTPE+  ++ED +A+E M +HGVL +G +RA +
Sbjct  148   TALDVAMPAPSLTDRTDLRNIQRSLHSLTPEISDEDEDPYAVESMVVHGVLDAGGKRASI  207

Query  698   YEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPS  519
              +VK ++  A E   ++PKFSHLSVS CPLPIPLPFP+IF +S+GQ GE+L T       
Sbjct  208   SQVKESICSALEGRATKPKFSHLSVSRCPLPIPLPFPSIFSSSVGQQGEILGTSHAGARP  267

Query  518   RGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDL  339
             +GPL V S+PMA+RLRSS+AI PF+E R  +L++LG+ RG +G+QVL  WGFGR+EVED+
Sbjct  268   KGPLAVGSVPMAARLRSSSAIAPFIERRSASLQRLGVARGTLGSQVLHDWGFGREEVEDM  327

Query  338   GETLSKLVNTLKP  300
              E L+K++    P
Sbjct  328   AEHLAKMLRPFYP  340



>ref|XP_005644159.1| tubulin nucleotide-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19615.1| tubulin nucleotide-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
Length=514

 Score =   188 bits (478),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 167/586 (28%), Positives = 252/586 (43%), Gaps = 113/586 (19%)
 Frame = -2

Query  1973  EIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYTP  1794
             E++TIQ GS++NF G+H+WNFQ                               G   +TP
Sbjct  4     EVITIQAGSFANFTGAHYWNFQ-------------------------------GQPIFTP  32

Query  1793  RLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEK  1614
             RLV     GSLG  S      +E+ + +  V TW+G VT   +EPL R+ F Q L +E  
Sbjct  33    RLVLFDLCGSLGGASQSSLEGAEQATPA--VTTWSGPVTVHRAEPLPRSRFAQQLEVEPD  90

Query  1613  NMNMVDGPDGRE--SDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
                   GP G +    +++ I +       E  V+ WTDF KV+ HP+SL  L G W  A
Sbjct  91    EAPA--GPSGNQEIDAAYDAISEAARELDREGAVRSWTDFLKVRLHPRSLALLPGRWQGA  148

Query  1439  QEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQ---GVQFIVDDSGGFSGLAAEFL  1272
              EF+ +G GR    + +  E+  +R+R F EECD +Q   G Q+ VDD  GF   + E L
Sbjct  149   AEFSGFGHGRGALASDEAREDAADRIRGFAEECDSLQARHGFQYFVDDLSGFGHFSYELL  208

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNI--SQSLHNAVSFSRLASFSKLIVPIGl  1098
             Q + DDY+  PVLL+ +R   S   T +Q  ++   + L  A S +RL+  S L +PI  
Sbjct  209   QMMQDDYARSPVLLFALRP--SLEETSAQPASVLRQRRLSEAASMARLSEVSSLHIPIA-  265

Query  1097  sslsaskasrrLCI--KDEQPYYTSAVYASALHSLSLPFRM---EHPGPTAESIYASGAL  933
                    ++   C+  +    ++ SA+ AS + + +LP+R+     PGP    +   G  
Sbjct  266   ------PSANLPCVRWRPGNVFHASALCASVIDTATLPYRLTRTPRPGPLGVPV---GGC  316

Query  932   NMYEVIHVLADQARQNMVSTLDVSMPAPSL-------------TGNQVQGS----LLDNF  804
             ++  +  +L      N  +    ++P P +             TG     S     +   
Sbjct  317   HLRSLTELLGTSQANNYTAAF-AAVPCPDVPEAHAAAAAADARTGGNASSSQPPFTMQRT  375

Query  803   VSLTPEVEQDNEDMHAMECMTIHGV-LGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLS  627
              S TP +  D E+  A E +T+ G   G    RA             E A  R       
Sbjct  376   SSWTPGIPADVEERLA-ESVTLRGAKRGGHPLRADEAAQALDAALLQEGANGR-------  427

Query  626   VSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPF  447
                             G S GQH  L +       + GP    SIP+ +RL +S A    
Sbjct  428   --------------QNGGSSGQHSRLHQ-------NDGPA---SIPVLARLCASPAAADV  463

Query  446   LESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
              +++LE  R L    G  G  VL+ WG+  D+V ++ E L  + + 
Sbjct  464   AKTQLERFRGLVGSGG--GMAVLQGWGYTADDVTEIEERLLTMASA  507



>emb|CEG67125.1| hypothetical protein RMATCC62417_03593 [Rhizopus microsporus]
Length=484

 Score =   182 bits (461),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/351 (33%), Positives = 189/351 (54%), Gaps = 28/351 (8%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             MREI+T+Q+GS SN++G+HFWN Q+E       +   K + +N DVLYR+GE+  G++TY
Sbjct  1     MREIITLQLGSLSNYVGTHFWNAQEEYFDYT-GNNTEKTNEINHDVLYRAGESANGVMTY  59

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPR +    +G+ GS      L+  +P+ +    TW   +T +   P+ +N + Q L   
Sbjct  60    TPRTLIYNLKGNFGSYQKYNKLF--EPNSADINHTWDQGMT-RIDRPIPKNKYQQEL---  113

Query  1619  EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMD-  1443
                       D  + DS  ++ D D +E LE+ V  W+DF+++ +HP+S+  +S    D 
Sbjct  114   ----------DRMDVDSEYQM-DLDAIEQLESTVYNWSDFNRIYYHPRSMNAISTHQADD  162

Query  1442  -AQEF-NYGIGRDTF-HNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFL  1272
                 F NY IG+D +  N +     ++  R F EECD++QG Q + D    F G     +
Sbjct  163   VVNPFDNYTIGKDAYVENEKEMNVFDDNFRLFAEECDYLQGFQILTDIDDAFGGFTEGLI  222

Query  1271  QNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI---G  1101
              +I D+++ +PVL Y +    S  + ++ ++    +L+ A+S +RL   S + VPI    
Sbjct  223   HDIRDEFAKIPVLTYGLSD--SCLHYRNDRMKQKVALNRALSMTRLGELSSVYVPIYTPT  280

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPT-AESI  951
              +SL  S     L   +   Y+TSA+ A+A+ + SLPFR++    T AES+
Sbjct  281   KTSLQKSHLQSDLVFNENSRYHTSAIIAAAIETNSLPFRLKKNAATLAESV  331



>ref|XP_004693702.1| PREDICTED: protein misato homolog 1-like [Condylura cristata]
Length=565

 Score =   182 bits (463),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 112/349 (32%), Positives = 185/349 (53%), Gaps = 24/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G +S F+G+H+WN QD  L G A++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFSGFVGAHWWNQQDAALGGPADAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   RN +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYSRNPYLQDLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+G++   H     K ++  +E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLS-SDGIWRVKSIPNGKDPPPHTATTLKPLIP-MEGSIRVWSDFLRVHLHPRSICLI  179

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G     + +  EEL +RL F++EECD +QG Q + D   GFSG
Sbjct  180   QKYNHDGEAGRLEAFGQGESILKDPKYLEELEDRLHFYVEECDFLQGFQILCDLHDGFSG  239

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG + N +  + NI + L+ A    RL++ S L+ 
Sbjct  240   VGAKAAELLQDEYSGRGIITWGLL-PGPY-NLRDPQKNIYRVLNTAFGLVRLSAHSSLVC  297

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             P+ L      +    +           P++  A+ A+AL ++++P+R+ 
Sbjct  298   PLSLGGSLGLRPEPPVSFPHLHYDATLPFHCGAILATALDTVTVPYRLR  346



>gb|ERZ97993.1| hypothetical protein GLOINDRAFT_88712 [Rhizophagus irregularis 
DAOM 181602]
Length=552

 Score =   182 bits (461),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 110/342 (32%), Positives = 182/342 (53%), Gaps = 19/342 (6%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             M EI+T+Q G ++NF+G+HFWN Q+      ES    K+  ++ D L+R+G T +G+ TY
Sbjct  1     MHEILTLQFGHFANFVGTHFWNSQEAYFTYNESLNAPKSEIVH-DTLFRAGVTPRGIETY  59

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSS-DVLTWAGKVTTQASEPLKRNLFLQSLYM  1623
             TPRL+    +G  GS+     LY E P ++      W G+  T A  P  +N++LQ L  
Sbjct  60    TPRLLLYDLKGGFGSLKKINKLYEESPGKNELHESNWNGRSETHAQMPYSKNIYLQHLEN  119

Query  1622  EEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSL-----YQLS  1458
             EE+ ++        E+++  +I+ +D    L+  VQ+W+DF+++ +HP+S+     YQ  
Sbjct  120   EEELVST------EETENKMKIETEDFK--LDETVQFWSDFNRMYYHPKSVNTMMQYQFE  171

Query  1457  GLWMDAQEFNYGIGRDTFHNHQRG-EELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
               +M    F+YG  ++ F  H++  +  +E  RFF+EECD IQG Q       GF G A 
Sbjct  172   DEFMPFDIFSYG--KNAFLAHEKELDSFDENFRFFVEECDAIQGFQVYTSIIDGFGGFAC  229

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
              FL+ + D+Y    +  + +    S+A  K       Q L+ A+S ++L  FS L  PI 
Sbjct  230   SFLEQLRDEYPKTAIWSFGITENRSWA-PKGHNSYYKQILNIALSTTQLTEFSSLFNPIN  288

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEH  975
               + +    +         PY+TS++ ++A+ + +LPFR  H
Sbjct  289   TPAANQPNFNSFYHPNLNLPYHTSSIVSAAIETATLPFRSRH  330



>ref|XP_792803.3| PREDICTED: protein misato homolog 1-like [Strongylocentrotus 
purpuratus]
Length=591

 Score =   181 bits (460),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 168/567 (30%), Positives = 265/567 (47%), Gaps = 73/567 (13%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             REIVT+Q G Y+NF+G+H WN Q+      ++        +N DVL+R G T QG  TYT
Sbjct  6     REIVTLQCGHYANFVGTHLWNIQESSFTYDKNPAQTIPKEINNDVLFREGRTLQGEETYT  65

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRLV +  +GSL ++ + G LY  K  +  DVL W G +T   S P  +N FL  L  ++
Sbjct  66    PRLVCLDLKGSLNTLRAEGILYDLKAEE--DVL-WGGDITLHKSSPAHKNQFLADLEAQD  122

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVEC-----------------LENGVQYWTDFSKVQ  1488
             +  +  +   G + D  +   D D  E                  L++ V  W+DF +  
Sbjct  123   EYYHQGEPKVGDDEDDLS-TPDMDTSEVNADDSKFDDPPGLKHYDLDDDVYVWSDFLRSH  181

Query  1487  FHPQSLYQLSGLWMDAQEFNYGI---GRDTFHNHQRGEELNERLRFFIEECDHIQGVQFI  1317
              HP+S+  +     D+    + +   G++ F      +E+ +++ FF+EECDH+QG Q  
Sbjct  182   LHPKSVSVVKEYSHDSTVGGFDMFTQGKNVFRKKDVSDEIEDKIHFFVEECDHLQGFQVY  241

Query  1316  VDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSR  1137
             +D   GFSGL    LQ +ADDY    +    V +P  F +T +  L+  + L++ +SFSR
Sbjct  242   LDFCDGFSGLGCGMLQGLADDYHGKGIFAAGV-APAIFDDT-NPLLDSFRILNSVLSFSR  299

Query  1136  LASFSKLIVPIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHP  972
             L + S L VP+ L+S    K    L     Q     PY+TS + ASAL + +LP R    
Sbjct  300   LVAHSSLFVPLSLASTLWRKVGPPLSFPHLQYRPSMPYHTSGILASALDTATLPLR----  355

Query  971   GPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMP----APSLTGNQVQGSLLDNF  804
                  ++ +S  L+M       A  AR   +++L  S P    + S   + + GSLL   
Sbjct  356   -----TVDSSVTLSMM----TDALGARGRKIASLRTSFPLSFHSSSTLADTLGGSLL-PC  405

Query  803   VSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAP---------VYEVKRTVQD----AYE  663
               LTP + Q+     A + + + G+     +R P          Y+ +  +++     Y+
Sbjct  406   QPLTPHLGQEIVAPFA-QSVVLRGIPQDRIKRPPQKDLNPYHKCYDEEEMLRNYLLSNYQ  464

Query  662   KAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMA  483
             + +S  +         P     PFP +FG  + + G L      +   +    V SIP  
Sbjct  465   RTLSSGR-----CVKQPCKTLAPFPHLFGPEVNRDGFL-----ADEDRKKEQGVESIPAM  514

Query  482   SRLRSSTAILPFLESRLENLRKLGIQR  402
             + L+SS A+   L+S L   RKL I +
Sbjct  515   TSLQSSPAVKHLLKSLLTEARKLDIHK  541



>ref|XP_001624271.1| predicted protein [Nematostella vectensis]
 gb|EDO32171.1| predicted protein [Nematostella vectensis]
Length=561

 Score =   181 bits (458),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 216/425 (51%), Gaps = 45/425 (11%)
 Frame = -2

Query  1994  LSNTDMREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQ  1815
             +++  +RE++T+Q G Y+NF+G+H+WN Q+        D       +N D L+R G T  
Sbjct  1     MADATVREVITLQFGHYANFVGTHWWNIQESSFCY---DAASPKSEINHDCLFREGLTVT  57

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G  TYTPRL+    +GSL ++S+ G LY E PS+    + W G++T   + P ++N F  
Sbjct  58    GQETYTPRLLLYDLKGSLRNLSTEGLLY-ESPSKK--YVDWEGEITIYETNPDQKNEFQA  114

Query  1634  SLYMEEKNMNMVD---GPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQ  1464
              +   EK M +     G D +  D+  E+ DK  V  L++ +  W+DF   Q HP+S+  
Sbjct  115   DI---EKTMVVESEESGMDSQTGDATGELSDK--VYNLDDEIVVWSDFLGTQLHPRSVNI  169

Query  1463  LSGLWMDAQ--EFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFS  1293
             ++    DA    F+ YG G+  +++    +   + LRFF EECD +QG Q + D   GF 
Sbjct  170   INEYSHDADMSPFSVYGYGQSLYNDESFRDNFEDGLRFFAEECDRLQGFQILADVHNGFG  229

Query  1292  GLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLI  1113
             GL ++ L+++ D+Y N   ++     P  F +T  Q+ N+ + L+ A+SFS++     L 
Sbjct  230   GLMSQCLEDLRDEY-NSKSMITVGCVPAHFKDT-DQEHNVKRILNMALSFSQITEHCDLF  287

Query  1112  VPIGlsslsaskasrrLCI-----KDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIY  948
             VP+ +S     K    +       K E PY+TSA+ ASAL + SLP+R++ P        
Sbjct  288   VPLCVSKQVWPKPGTYVTFPYLNYKGELPYHTSAILASALDTFSLPYRLDTP--------  339

Query  947   ASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL--------DNFVSLT  792
                   M ++I  +A   R   ++     +P P +   +   SLL        D+ + LT
Sbjct  340   --KGCGMRDLISTIAFSGRN--IAHAHTMLPIP-VGPQKSLASLLNDCIEKRPDSMLPLT  394

Query  791   PEVEQ  777
             P + Q
Sbjct  395   PHINQ  399



>gb|EPB90735.1| hypothetical protein HMPREF1544_02480 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=531

 Score =   178 bits (451),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 118/389 (30%), Positives = 194/389 (50%), Gaps = 50/389 (13%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             MREIVT+Q+GS +N +G+H WN Q+E     +S +  K   +N DVLYR GET  G+LTY
Sbjct  1     MREIVTLQLGSIANHVGTHLWNSQEEYFNYGDSTQT-KTEEINHDVLYRQGETSSGVLTY  59

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSL-YM  1623
             TPR +    +G  GSM     L+S   + +  V  W   V  +    + +N + Q L  M
Sbjct  60    TPRTLIYDLKGGFGSMQKYNKLFSGGDADAQQV-PWEQGVN-RIDRRIAKNQYQQQLDRM  117

Query  1622  EEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMD  1443
             + +++NM                    ++ L   V  W+D++++ +HP+S+  +    MD
Sbjct  118   DTEHVNM-----------------DAAIQQLNQTVNNWSDYNRIYYHPRSINPIVTHQMD  160

Query  1442  AQEF---NYGIGRDTFHNHQRGEELNE-RLRFFIEECDHIQGVQFIVDDSGGFSGLAAEF  1275
                    NY IGR ++ ++++  ++ E   RFF+EECD++QG Q + D    F G A   
Sbjct  161   NDITPFDNYTIGRQSYQDNEKETDIFEDNFRFFVEECDNLQGFQVMTDVDDAFGGFAEGL  220

Query  1274  LQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             L N+ D+++  P++ Y +    +   T   K  I   L+ A+S +RLA  S + VPI   
Sbjct  221   LNNMRDEFAKTPIITYGLSDSHAQHRTDRHKQKI--MLNRALSMTRLADLSSIYVPI---  275

Query  1094  slsaskasrrLC-------IKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGA  936
               + +  + + C         D   Y+TSA+ ASA+ S SLP+R++H             
Sbjct  276   -YTPTHTAVQKCGLSPFVQFNDLSRYHTSAIIASAIESNSLPYRLKH-----------NP  323

Query  935   LNMYEVIHVLADQARQNMVSTLDVSMPAP  849
             + M + +  L +  R   +++L V +P P
Sbjct  324   MTMADTVSKL-NWVRSTSLASLSVCLPLP  351



>ref|XP_005331418.1| PREDICTED: protein misato homolog 1-like isoform X1 [Ictidomys 
tridecemlineatus]
Length=567

 Score =   179 bits (453),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 159/585 (27%), Positives = 272/585 (46%), Gaps = 61/585 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A S +      L  DVLYR+G+T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRATSAQESLG-ELCPDVLYRTGQTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GS+ S+   G LY +K  Q    + W GK+TT   E   +N  LQ L +  
Sbjct  65    PRLILMDLKGSVNSLKQEGGLYWDK--QLDAAVAWHGKLTTHKEEVYPQNPHLQDL-LSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+       +    I + LE+ V+ W+DF +V  HP+S+  + 
Sbjct  122   EGVRSSDGFWRVKSIPNGKGPPP---VTTAAIPKPLESSVRVWSDFLRVHLHPRSICMIQ  178

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  179   KYNHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  238

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PGS++  + QK NI + L+ A    RL ++S  + P
Sbjct  239   GAKAAELLQDEYSGRGIITWGL-IPGSYSLGEPQK-NIYRLLNTAFGLVRLTAYSSFVCP  296

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  297   LSLGGSLGLRPQPPVNFPHLHYDATLPFHCSAILATALDTVTVPYRLR-----------S  345

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL--LDNFVSLTPEVEQDNE  768
               ++M  + ++L    ++  V T    +P P + G  +  +L  L    S TP     N 
Sbjct  346   SPVSMVHLANMLTFSGKK--VVTAGAVIPFPLVPGQSLPDALVQLRGATSWTPLSACGNP  403

Query  767   --DMHAMECMTIHGV--------LGSGSRRAPVYEVKRTVQDAYEKAI--SRPKFSHLSV  624
                    + + + G+        L  G+          T ++   + +   +P+ +  S 
Sbjct  404   LGTRCFAQSVVLRGIDRACHTSQLTPGTPLPSPLHACTTGEEVLAQYLHQQQPRVTSSSH  463

Query  623   SccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFL  444
                      P      +S+ Q G +L+ P   T       VHSIP+   L SS+++   L
Sbjct  464   LLLTPCRVAPPYPYLFSSLRQQGMVLDGPPRGT------AVHSIPVFGALCSSSSLHQTL  517

Query  443   ESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
                   L KL ++R    A  L++ G  +DE+E+L + L  L   
Sbjct  518   GGLATELTKLDLRR---WASFLDA-GVEQDEMEELLQELHSLAQC  558



>ref|XP_005541579.1| PREDICTED: protein misato homolog 1-like isoform X3 [Macaca fascicularis]
Length=559

 Score =   178 bits (452),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 158/583 (27%), Positives = 259/583 (44%), Gaps = 65/583 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +      P  S L        +  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSSLHACTTGEEVLA  451

Query  596   pfpaiFGNSIGQHGELLETPITETP-------SRGPLEVHSIPMASRLRSSTAILPFLES  438
              +       +     LL TP    P       S  P  V SIP+   L SS+++   LE+
Sbjct  452   QYLQQQQPRVMSSSHLLLTPYRVAPPYPHLFSSCSPQAVESIPVFGALCSSSSLHQTLEA  511

Query  437   RLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
                +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   LARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  550



>ref|XP_005331419.1| PREDICTED: protein misato homolog 1-like isoform X2 [Ictidomys 
tridecemlineatus]
Length=566

 Score =   178 bits (452),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 160/585 (27%), Positives = 273/585 (47%), Gaps = 62/585 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A S +      L  DVLYR+G+T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRATSAQESLG-ELCPDVLYRTGQTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GS+ S+   G LY +K  Q    + W GK+TT   E   +N  LQ L +  
Sbjct  65    PRLILMDLKGSVNSLKQEGGLYWDK--QLDAAVAWHGKLTTHKEEVYPQNPHLQDL-LSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+       +    I + LE+ V+ W+DF +V  HP+S+  + 
Sbjct  122   EGVRSSDGFWRVKSIPNGKGPPP---VTTAAIPKPLESSVRVWSDFLRVHLHPRSICMIQ  178

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  179   KYNHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  238

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PGS++  + QK NI + L+ A    RL ++S  + P
Sbjct  239   GAKAAELLQDEYSGRGIITWGL-IPGSYSLGEPQK-NIYRLLNTAFGLVRLTAYSSFVCP  296

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  297   LSLGGSLGLRPQPPVNFPHLHYDATLPFHCSAILATALDTVTVPYRLR-----------S  345

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL--LDNFVSLTPEVEQDNE  768
               ++M  + ++L    ++  V T    +P P + G  +  +L  L    S TP     N 
Sbjct  346   SPVSMVHLANMLTFSGKK--VVTAGAVIPFPLVPGQSLPDALVQLRGATSWTPLSACGNP  403

Query  767   --DMHAMECMTIHGV--------LGSGSRRAPVYEVKRTVQDAYEKAI--SRPKFSHLSV  624
                    + + + G+        L  G+          T ++   + +   +P+ +  S 
Sbjct  404   LGTRCFAQSVVLRGIDRACHTSQLTPGTPLPSPLHACTTGEEVLAQYLHQQQPRVTSSSH  463

Query  623   SccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFL  444
                      P      +S+ Q G +L     + P RG   VHSIP+   L SS+++   L
Sbjct  464   LLLTPCRVAPPYPYLFSSLRQQGMVL-----DGPPRG--TVHSIPVFGALCSSSSLHQTL  516

Query  443   ESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
                   L KL ++R    A  L++ G  +DE+E+L + L  L   
Sbjct  517   GGLATELTKLDLRR---WASFLDA-GVEQDEMEELLQELHSLAQC  557



>ref|XP_005331421.1| PREDICTED: protein misato homolog 1-like isoform X4 [Ictidomys 
tridecemlineatus]
Length=555

 Score =   178 bits (451),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 159/579 (27%), Positives = 262/579 (45%), Gaps = 61/579 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A S +      L  DVLYR+G+T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRATSAQESLG-ELCPDVLYRTGQTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GS+ S+   G LY +K  Q    + W GK+TT   E   +N  LQ L +  
Sbjct  65    PRLILMDLKGSVNSLKQEGGLYWDK--QLDAAVAWHGKLTTHKEEVYPQNPHLQDL-LSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+       +    I + LE+ V+ W+DF +V  HP+S+  + 
Sbjct  122   EGVRSSDGFWRVKSIPNGKGPPP---VTTAAIPKPLESSVRVWSDFLRVHLHPRSICMIQ  178

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  179   KYNHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  238

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PGS++  + QK NI + L+ A    RL ++S  + P
Sbjct  239   GAKAAELLQDEYSGRGIITWGL-IPGSYSLGEPQK-NIYRLLNTAFGLVRLTAYSSFVCP  296

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  297   LSLGGSLGLRPQPPVNFPHLHYDATLPFHCSAILATALDTVTVPYRLR-----------S  345

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL--LDNFVSLTPEVEQDNE  768
               ++M  + ++L    ++  V T    +P P + G  +  +L  L    S TP     N 
Sbjct  346   SPVSMVHLANMLTFSGKK--VVTAGAVIPFPLVPGQSLPDALVQLRGATSWTPLSACGNP  403

Query  767   DMHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfp  588
                   C     VL    R     ++              P  S L        +   + 
Sbjct  404   --LGTRCFAQSVVLRGIDRACHTSQLTP----------GTPLPSPLHACTTGEEVLAQYL  451

Query  587   aiFGNSIGQHGELLETPITETPSRGPL------EVHSIPMASRLRSSTAILPFLESRLEN  426
                   +     LL TP    P    L      +VHSIP+   L SS+++   L      
Sbjct  452   HQQQPRVTSSSHLLLTPCRVAPPYPYLFSSLRQQVHSIPVFGALCSSSSLHQTLGGLATE  511

Query  425   LRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
             L KL ++R    A  L++ G  +DE+E+L + L  L   
Sbjct  512   LTKLDLRR---WASFLDA-GVEQDEMEELLQELHSLAQC  546



>ref|XP_001116160.1| PREDICTED: protein misato homolog 1-like isoform 1 [Macaca mulatta]
Length=558

 Score =   178 bits (451),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 158/582 (27%), Positives = 260/582 (45%), Gaps = 64/582 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     LA+ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLAAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLQPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +      P  S L        +  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSSLHACTTGEEVLA  451

Query  596   pfpaiFGNSIGQHGELLETPITETPSRGPL------EVHSIPMASRLRSSTAILPFLESR  435
              +       +     LL TP    P    L      +V SIP+   L SS+++   LE+ 
Sbjct  452   QYLQQQQPRVMSSSHLLLTPYRVAPPYPHLFSSCSPQVESIPVFGALCSSSSLHQTLEAL  511

Query  434   LENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
               +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   ARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  549



>gb|EHH50349.1| hypothetical protein EGM_01163, partial [Macaca fascicularis]
Length=427

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ     E
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQDFEYRE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_009431823.1| PREDICTED: protein misato homolog 1 isoform X3 [Pan troglodytes]
Length=559

 Score =   177 bits (450),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 159/583 (27%), Positives = 258/583 (44%), Gaps = 65/583 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +      P  S L        I  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILA  451

Query  596   pfpaiFGNSIGQHGELLETPITETP-------SRGPLEVHSIPMASRLRSSTAILPFLES  438
              +       +     LL TP    P       S  P  V SIP+   L SS+++   LE+
Sbjct  452   QYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPAVESIPVFGALCSSSSLHQTLEA  511

Query  437   RLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
                +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   LARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  550



>ref|XP_006923716.1| PREDICTED: protein misato homolog 1, partial [Pteropus alecto]
Length=566

 Score =   177 bits (449),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/348 (32%), Positives = 185/348 (53%), Gaps = 23/348 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L   A + E  +   L  DVLYR+G T  G  TY
Sbjct  2     REVLTLQLGHFAGFVGAHWWNQQDAALREPAHAKETPEE--LCPDVLYRAGRTLHGQETY  59

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   EP  +N +LQ L   
Sbjct  60    TPRLILMDLKGSLNSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEPHPKNPYLQDLLSA  117

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  118   EGALSS-DGIWRTRSLPNGKGPTPLTTATSPKPLMPTEGSIRVWSDFLRVHLHPRSICMI  176

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  177   QKYNHDGEAGRLEAFGQGERVLQEPRYLEELEDRLHFYVEECDYLQGFQVLCDLHDGFSG  236

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +A  + ++ N+ + L+ A   +RL++ S L+ 
Sbjct  237   VGAKAAELLQDEYSGRGIIAWGLL-PGPYALGEPRR-NVYRLLNTAFGLARLSAHSSLVC  294

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRM  981
             P+   G   L    A     ++ +   P++ SA+ A+AL +++ P+R+
Sbjct  295   PLSLGGSLGLRPEPAVHFPHLRYDAALPFHCSAILATALDTVTAPYRL  342



>ref|XP_001116222.1| PREDICTED: protein misato homolog 1-like isoform 5 [Macaca mulatta]
Length=570

 Score =   177 bits (448),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 205/411 (50%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     LA+ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLAAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLQPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_006219703.1| PREDICTED: protein misato homolog 1-like isoform X2 [Vicugna 
pacos]
Length=570

 Score =   176 bits (447),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 180/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L    ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCRPTDAKEPLGE--LCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   +P  +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEDPYPKNPYLQDLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLSS-DGIWRVKSIPNGRGETPFTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLQDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrL-----CIKDEQPYYTSAVYASALHSLSLPFRME  978
             P+ L      +    +     C     P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRQEPPVNFPHLCYDAALPFHCSAILATALDTVTVPYRLR  347



>ref|XP_006219702.1| PREDICTED: protein misato homolog 1-like isoform X1 [Vicugna 
pacos]
Length=571

 Score =   176 bits (447),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 178/348 (51%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPLGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   +P  +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEDPYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGIWRVKSIPNGRGETPFTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrL-----CIKDEQPYYTSAVYASALHSLSLPFRME  978
             + L      +    +     C     P++ SA+ A+AL ++++P+R+ 
Sbjct  300   LSLGGSLGLRQEPPVNFPHLCYDAALPFHCSAILATALDTVTVPYRLR  347



>ref|XP_005541580.1| PREDICTED: protein misato homolog 1-like isoform X4 [Macaca fascicularis]
Length=558

 Score =   176 bits (447),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 157/582 (27%), Positives = 259/582 (45%), Gaps = 64/582 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +      P  S L        +  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSSLHACTTGEEVLA  451

Query  596   pfpaiFGNSIGQHGELLETPITETPSRGPL------EVHSIPMASRLRSSTAILPFLESR  435
              +       +     LL TP    P    L      +V SIP+   L SS+++   LE+ 
Sbjct  452   QYLQQQQPRVMSSSHLLLTPYRVAPPYPHLFSSCSPQVESIPVFGALCSSSSLHQTLEAL  511

Query  434   LENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
               +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   ARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  549



>gb|EKC42612.1| misato-like protein 1 [Crassostrea gigas]
Length=572

 Score =   176 bits (447),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 162/605 (27%), Positives = 288/605 (48%), Gaps = 88/605 (15%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             REIV++Q+G YSNF+G+H+WN Q+     + S+   K+  +N D+L+R G+T +  +T+T
Sbjct  4     REIVSLQIGHYSNFVGTHWWNIQESSFLYSPSEAQIKDKEVNHDILWREGKTFKEEVTFT  63

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL++V  +GSL ++   G LY    +   D + W+G +T   + P ++N FL +L  E+
Sbjct  64    PRLIAVDLKGSLITLKQEGILYE---TNQQDDIKWSGDITLHKASPAEKNDFLSNLDKED  120

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVEC-----------------------LENGVQYWT  1506
             + +        + +D+   I D D+ +                        L+N V+ W+
Sbjct  121   QAIVEC----RKRTDTAEVIDDVDVKDTLSRAGTEANKSDSQLVFGKVDHDLDNVVKVWS  176

Query  1505  DFSKVQFHPQSL------YQLSGLWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEE  1347
             DF +V  HP+++      Y L+ L      F+ YG G     +++   E+ +R+  F EE
Sbjct  177   DFLRVYLHPKTIQIIEQYYHLNSL----HPFDIYGAGIKAIDDYETKSEMEDRIHHFCEE  232

Query  1346  CDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQ  1167
             CD +QG   +VD   GF G+ A+ LQ++AD+Y++  V+ +         +T   + N  +
Sbjct  233   CDSLQGFHVLVDTHDGFGGVGAQTLQHLADEYTSKSVMTFGFTPANLPDDTPVSRAN--R  290

Query  1166  SLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCIKDEQ----PYYTSAVYASALHSL  999
              L++A+S+ +  + S L  P+ L++                     Y+TSA+ A+ L + 
Sbjct  291   ILNSALSYQKCFTHSSLFFPLSLANSLWKTLGNYADFPQLDFKMIDYHTSAILAATLDTA  350

Query  998   SLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQ--NMVSTLDVSMPAPS---LTGN  834
             SLP+R  +P            ++M ++        R+  +M S L + M A S       
Sbjct  351   SLPYRTVNP------------IHMCDITDNFQSFGRKVGSMSSALPICMEADSNFLDVLQ  398

Query  833   QVQGSLLDNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAP--VYEVKRTVQDAYEK  660
              +QGSL   ++SLTP     N+    M+ + + G+    + R+P  +Y   R+V D  + 
Sbjct  399   DLQGSL--PWLSLTPHCT--NQSTPFMQSVVVRGI-PETTPRSPRGIYSSCRSVNDTLQV  453

Query  659   AISRPKFSHL---SVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLE-VHSI  492
              ++    S L   +V   P  +  PFP IF  ++ + G      +  T  R   + V ++
Sbjct  454   YLTENFNSCLNAGTVINTPCKVNTPFPHIFKKNVNKFG------LVSTTERSRFQGVETV  507

Query  491   PMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVN  312
             PM + ++SS      L +   + +KL I++     + LE+   G +E +D  E L   V+
Sbjct  508   PMMTSMQSSPDTAVLLNTLYSDAKKLNIRK---HTRFLEA---GLEE-DDYQEILQDFVS  560

Query  311   TLKPY  297
               K Y
Sbjct  561   LEKCY  565



>ref|XP_007979298.1| PREDICTED: LOW QUALITY PROTEIN: protein misato homolog 1-like, 
partial [Chlorocebus sabaeus]
Length=425

 Score =   173 bits (439),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  3     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  61

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ     E
Sbjct  62    PRLILMDLKGSLSSLKGEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQDFXSTE  119

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  120   GVLSS-DGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  178

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  179   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  238

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  239   GAKAAELLQDEYSGRGIVTWGLL-PGLYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  296

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  297   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  345

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  346   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  393



>ref|XP_006219704.1| PREDICTED: protein misato homolog 1-like isoform X3 [Vicugna 
pacos]
Length=559

 Score =   176 bits (446),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 180/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L    ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCRPTDAKEPLGE--LCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   +P  +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEDPYPKNPYLQDLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLSS-DGIWRVKSIPNGRGETPFTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLQDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrL-----CIKDEQPYYTSAVYASALHSLSLPFRME  978
             P+ L      +    +     C     P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRQEPPVNFPHLCYDAALPFHCSAILATALDTVTVPYRLR  347



>gb|EXX51497.1| Dml1p [Rhizophagus irregularis DAOM 197198w]
Length=540

 Score =   176 bits (446),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/342 (32%), Positives = 174/342 (51%), Gaps = 31/342 (9%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             M EI+T+Q G ++NF+G+HFWN Q+      ES    K+  ++ D L+R+G T +G+ TY
Sbjct  1     MHEILTLQFGHFANFVGTHFWNSQEAYFTYNESLNAPKSEIVH-DTLFRAGVTPRGIETY  59

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSS-DVLTWAGKVTTQASEPLKRNLFLQSLYM  1623
             TPRL+    +G  GS+     LY E P ++      W G+  T A  P  +N++LQ L  
Sbjct  60    TPRLLLYDLKGGFGSLKKINKLYEESPGKNELHESNWNGRSETHAQMPYSKNIYLQHLEN  119

Query  1622  EEKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSL-----YQLS  1458
             E K                  I+ +D    L+  VQ+W+DF+++ +HP+S+     YQ  
Sbjct  120   EMK------------------IETEDFK--LDETVQFWSDFNRMYYHPKSVNTMMQYQFE  159

Query  1457  GLWMDAQEFNYGIGRDTFHNHQRG-EELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
               +M    F+YG  ++ F  H++  +  +E  RFF+EECD IQG Q       GF G A 
Sbjct  160   DEFMPFDIFSYG--KNAFLAHEKELDSFDENFRFFVEECDAIQGFQVYTSIIDGFGGFAC  217

Query  1280  EFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIG  1101
              FL+ + D+Y    +  + +    S+A  K       Q L+ A+S ++L  FS L  PI 
Sbjct  218   SFLEQLRDEYPKTAIWSFGITENRSWA-PKGHNSYYKQILNIALSTTQLTEFSSLFNPIN  276

Query  1100  lsslsaskasrrLCIKDEQPYYTSAVYASALHSLSLPFRMEH  975
               + +    +         PY+TS++ ++A+ + +LPFR  H
Sbjct  277   TPAANQPNFNSFYHPNLNLPYHTSSIVSAAIETATLPFRSRH  318



>ref|XP_004089908.1| PREDICTED: protein misato homolog 1 isoform 2 [Nomascus leucogenys]
Length=558

 Score =   175 bits (444),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 156/582 (27%), Positives = 258/582 (44%), Gaps = 64/582 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLQEGGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S S         +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPSLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F    P         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGAAP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +   +  P  S L        +  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTLGTPPPSALHACTTGEEVLA  451

Query  596   pfpaiFGNSIGQHGELLETPITETPSRGPL------EVHSIPMASRLRSSTAILPFLESR  435
              +       +     LL TP    P    L       V S+P+   L SS+++   LE+ 
Sbjct  452   QYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFASCSPPVESVPVFGALCSSSSLHQTLEAL  511

Query  434   LENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
               +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   ARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  549



>ref|XP_005541578.1| PREDICTED: protein misato homolog 1-like isoform X2 [Macaca fascicularis]
Length=569

 Score =   175 bits (444),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 204/411 (50%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|NP_001243462.1| protein misato homolog 1 isoform c [Homo sapiens]
 emb|CAH18652.1| hypothetical protein [Homo sapiens]
 gb|ACE86865.1| misato homolog 1 (Drosophila) protein [synthetic construct]
 gb|ACE87553.1| misato homolog 1 (Drosophila) protein [synthetic construct]
Length=558

 Score =   175 bits (443),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 157/582 (27%), Positives = 256/582 (44%), Gaps = 64/582 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +      P  S L        I  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILA  451

Query  596   pfpaiFGNSIGQHGELLETPITETPSRGPL------EVHSIPMASRLRSSTAILPFLESR  435
              +       +     LL TP    P    L       V SIP+   L SS+++   LE+ 
Sbjct  452   QYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPVESIPVFGALCSSSSLHQTLEAL  511

Query  434   LENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
               +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   ARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  549



>ref|XP_006174639.1| PREDICTED: protein misato homolog 1-like isoform X1 [Camelus 
ferus]
 ref|XP_010952232.1| PREDICTED: protein misato homolog 1 isoform X2 [Camelus bactrianus]
Length=571

 Score =   175 bits (444),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/349 (32%), Positives = 181/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L    ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCRPTDAKEPLGE--LCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   EP  +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEPYPKNPYLQDLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLS-SDGIWRVKSIPNGRGPPPCTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVNLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRME  978
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRQEPPVNFPYLRYDAALPFHCSAILATALDTVTVPYRLR  347



>ref|XP_006174640.1| PREDICTED: protein misato homolog 1-like isoform X2 [Camelus 
ferus]
Length=570

 Score =   175 bits (444),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/349 (32%), Positives = 181/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L    ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCRPTDAKEPLGE--LCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   EP  +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEPYPKNPYLQDLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLS-SDGIWRVKSIPNGRGPPPCTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVNLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRME  978
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRQEPPVNFPYLRYDAALPFHCSAILATALDTVTVPYRLR  347



>ref|XP_005541577.1| PREDICTED: protein misato homolog 1-like isoform X1 [Macaca fascicularis]
Length=570

 Score =   175 bits (444),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 204/411 (50%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_010366410.1| PREDICTED: LOW QUALITY PROTEIN: protein misato homolog 1 [Rhinopithecus 
roxellana]
Length=570

 Score =   175 bits (443),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ     E
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQDFXSTE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGVWRIKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLMHLTTHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_003259482.1| PREDICTED: protein misato homolog 1 isoform 1 [Nomascus leucogenys]
Length=570

 Score =   175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 201/403 (50%), Gaps = 34/403 (8%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLQEGGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S S         +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPSLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
               ++M  +  +L+   ++  V T    +P P   G  +  SL+
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM  389



>gb|ELU05985.1| hypothetical protein CAPTEDRAFT_160708 [Capitella teleta]
Length=548

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 147/544 (27%), Positives = 265/544 (49%), Gaps = 50/544 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             REIVT+Q+G YSNFIG+H+WN QD     A +      + +N DVL+R G    G +TYT
Sbjct  6     REIVTLQLGHYSNFIGTHWWNIQDS--SFAYNPNAVATNEINHDVLFREGCNPSGEVTYT  63

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+    +GSL ++   G LY + P  + D L W   VT   +E L +N +LQ L  E+
Sbjct  64    PRLLLFDLKGSLNTLKQNGQLY-DVPDAAED-LQWGSDVTMHKAETLPKNDYLQDL--EK  119

Query  1616  KNMNMVDGPDG--------RESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
              +   VD  D         +E  S+        +  L++ V+ W+DF ++  HP++++ +
Sbjct  120   LDSYEVDERDEGGDKEDQVKEPSSNQPPMFGKRLHHLDDQVRVWSDFLRLHLHPKTVHVV  179

Query  1460  SGLWMDAQE--FN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                W D+    F+ + +G    ++H    E+ +RL FF+EECD++QG+  + D   GF G
Sbjct  180   QQYWHDSDSEIFDVHNLGESVVNDHHTHNEIEDRLHFFLEECDNLQGLHILCDPGNGFGG  239

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             +AA+  + ++D++++  +++     P      K Q  +    + N +S+S L   +  ++
Sbjct  240   MAAKLAEELSDEFASKSIVVIPAHEPE--YTKKPQSESAVSLVSNMLSYSSLLEHASAVI  297

Query  1109  PIGlsslsaskasrr----LCIKDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             P+ +S    + +       L  K    Y++SAV A A+ SLSLP+R   P          
Sbjct  298   PLSVSPCLFTPSFSNPFPHLSPKFNLAYHSSAVLACAVESLSLPYRRLGP----------  347

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPA-PSLTGNQVQGSLLDN--FVSLTPEVEQDN  771
              +  M  +   L    R+ +   + +  P  P +  ++    L D   + SLTP   + N
Sbjct  348   DSCLMPHLTEALTPAGRKLLNLQMALPFPGQPDVLFDETLSGLGDRLPWRSLTPYCHR-N  406

Query  770   EDMHAMECMTIHGV-LGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplp  594
             +++   + +   GV L SG++       ++++ +  +K  S P  S ++       +  P
Sbjct  407   QEVDGGQSVVFQGVELHSGTQSC-----EKSLLEYLQKINSSP--SAVTTLKKACNVTEP  459

Query  593   fpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKL  414
             FP  F   +   G  L + +    + G   V S+P+ + L+SS+ +   L+  L+  +K+
Sbjct  460   FPHFFNTEVSSKG--LLSAVHRDSNTG---VESVPLLTSLQSSSGVSAILDQMLQRTKKV  514

Query  413   GIQR  402
              +++
Sbjct  515   ELRK  518



>ref|XP_006174641.1| PREDICTED: protein misato homolog 1-like isoform X3 [Camelus 
ferus]
Length=559

 Score =   175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/349 (32%), Positives = 181/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L    ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCRPTDAKEPLGE--LCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   EP  +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEPYPKNPYLQDLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLS-SDGIWRVKSIPNGRGPPPCTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVNLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRME  978
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRQEPPVNFPYLRYDAALPFHCSAILATALDTVTVPYRLR  347



>ref|XP_009431940.1| PREDICTED: LOW QUALITY PROTEIN: protein misato homolog 1-like 
[Pan troglodytes]
Length=428

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             +E++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     QEVLTLQLGRFAGFVGAHWWNQQDAALGXA-TDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKESKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGWGIITWGLL-PGPYHRGETQR-NIYRLLNTAFGLVHLTAHSXLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDAILPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_001161939.2| PREDICTED: protein misato homolog 1 isoform X4 [Pan troglodytes]
Length=558

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 158/582 (27%), Positives = 257/582 (44%), Gaps = 64/582 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +      P  S L        I  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILA  451

Query  596   pfpaiFGNSIGQHGELLETPITETPSRGPL------EVHSIPMASRLRSSTAILPFLESR  435
              +       +     LL TP    P    L       V SIP+   L SS+++   LE+ 
Sbjct  452   QYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPVESIPVFGALCSSSSLHQTLEAL  511

Query  434   LENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
               +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   ARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  549



>ref|XP_004026980.1| PREDICTED: LOW QUALITY PROTEIN: protein misato homolog 1 [Gorilla 
gorilla gorilla]
Length=570

 Score =   175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGXA-TDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLIFMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLTTTTTPKPLIPTEASIRVWSDFLRVHLHPRSIRMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYKHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_003415182.1| PREDICTED: protein misato homolog 1 isoform X2 [Loxodonta africana]
Length=568

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 164/595 (28%), Positives = 273/595 (46%), Gaps = 80/595 (13%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE+VT+Q+G ++ F+G+H+WN QD    +  +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVVTLQLGHFAGFVGAHWWNQQDAAL-VRPADGKEPPGELCPDVLYRTGRTVHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ+L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQTLGSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS-SDGVWRVKSIPNGKGPLPLTTAKTPKPLMPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
             AA+  + + D+YS   V+ + +  P  ++  + QK NI + L+ A     LA+ S L+ P
Sbjct  242   AAKTAELLQDEYSGRGVIAWGLL-PAPYSLGEPQK-NIYRLLNTAFGLVHLAAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVTFPHLHYDATLPFHCSAILATALDTITVPYRLR-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVEQDN  771
               ++M  +  +L+   ++  V T   ++P PS        SL D  V L   TP +    
Sbjct  349   SPVSMVHLADMLSFSGKK--VVTAGATIPFPS------GQSLPDTLVQLGGATPWIPLSA  400

Query  770   EDMHAMECMTIHGVLGSGSRRA--------------PVYE-------VKRTVQDAYEKAI  654
                 +  C     V+  G  RA              P++        + + +Q    +A+
Sbjct  401   CGDPSGACCFAQSVVLRGLDRACHTSQLTPGTPLPSPLHACATGEEVLAQYLQQQQPRAL  460

Query  653   SRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRL  474
             S    SHL ++ C +  P P      +S+ Q G  L+ P    P+R   E  SIP+   L
Sbjct  461   SS---SHLLLTPCKVAPPYPHLF---SSLSQQGLFLDGP----PTRAAAE--SIPVFGAL  508

Query  473   RSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
              SS+++   L      L KL ++R A       + G  +D++E++ + L  L   
Sbjct  509   CSSSSLHQTLGGLARELTKLDLRRWA----SFMAAGVEQDDLEEMLQELYSLAQC  559



>ref|XP_010998537.1| PREDICTED: protein misato homolog 1 isoform X2 [Camelus dromedarius]
Length=571

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 181/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L    ++ E      +  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCRPTDAKEPLGE--MCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   EP  +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEPYPKNPYLQDLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLS-SDGIWRVKSIPNGRGPPPCTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVNLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRME  978
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRQEPPVNFPYLRYDAALPFHCSAILATALDTVTVPYRLR  347



>emb|CAI59784.1| hypothetical protein [Homo sapiens]
Length=570

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>dbj|BAF83299.1| unnamed protein product [Homo sapiens]
Length=569

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|NP_001243461.1| protein misato homolog 1 isoform b [Homo sapiens]
 dbj|BAD96583.1| misato variant [Homo sapiens]
Length=569

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_008982827.1| PREDICTED: protein misato homolog 1 [Callithrix jacchus]
Length=565

 Score =   174 bits (441),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 116/403 (29%), Positives = 202/403 (50%), Gaps = 34/403 (8%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  +M  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FMSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+ +         +   +   E+ ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNDKGPPPLTMSANPKPLIPTEDSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG + + ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAEMLQDEYSGRGIITWGLL-PGPYRHGEAQR-NIYRLLNTAFGLMHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          ++ +   P++ SA+ A+AL + + P+R+            S
Sbjct  300   LSLDGSLGLRPEPPVNFPYLRYDATLPFHCSAILATALDTFTAPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
               ++M ++  +L+   ++  V T   ++P P   G  +  SL+
Sbjct  349   SPVSMVQLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM  389



>ref|NP_060586.2| protein misato homolog 1 isoform a [Homo sapiens]
 sp|Q9BUK6.1|MSTO1_HUMAN RecName: Full=Protein misato homolog 1 [Homo sapiens]
 gb|AAH02535.1| Misato homolog 1 (Drosophila) [Homo sapiens]
 emb|CAL37881.1| hypothetical protein [synthetic construct]
 dbj|BAJ17881.1| misato homolog 1 [synthetic construct]
 gb|AIC51725.1| MSTO1, partial [synthetic construct]
Length=570

 Score =   174 bits (441),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_009431818.1| PREDICTED: protein misato homolog 1 isoform X2 [Pan troglodytes]
Length=569

 Score =   174 bits (441),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_010593120.1| PREDICTED: protein misato homolog 1 isoform X4 [Loxodonta africana]
Length=567

 Score =   174 bits (440),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 163/595 (27%), Positives = 272/595 (46%), Gaps = 81/595 (14%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE+VT+Q+G ++ F+G+H+WN QD    +  +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVVTLQLGHFAGFVGAHWWNQQDAAL-VRPADGKEPPGELCPDVLYRTGRTVHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ+L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQTLGSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS-SDGVWRVKSIPNGKGPLPLTTAKTPKPLMPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
             AA+  + + D+YS   V+ + +  P  ++  + QK NI + L+ A     LA+ S L+ P
Sbjct  242   AAKTAELLQDEYSGRGVIAWGLL-PAPYSLGEPQK-NIYRLLNTAFGLVHLAAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVTFPHLHYDATLPFHCSAILATALDTITVPYRLR-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVEQDN  771
               ++M  +  +L+   ++  V T   ++P PS        SL D  V L   TP +    
Sbjct  349   SPVSMVHLADMLSFSGKK--VVTAGATIPFPS------GQSLPDTLVQLGGATPWIPLSA  400

Query  770   EDMHAMECMTIHGVLGSGSRRA--------------PVYE-------VKRTVQDAYEKAI  654
                 +  C     V+  G  RA              P++        + + +Q    +A+
Sbjct  401   CGDPSGACCFAQSVVLRGLDRACHTSQLTPGTPLPSPLHACATGEEVLAQYLQQQQPRAL  460

Query  653   SRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRL  474
             S    SHL ++ C +  P P      +S+ Q G  L+ P    P+R      SIP+   L
Sbjct  461   SS---SHLLLTPCKVAPPYPHLF---SSLSQQGLFLDGP----PTRA---AESIPVFGAL  507

Query  473   RSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
              SS+++   L      L KL ++R A       + G  +D++E++ + L  L   
Sbjct  508   CSSSSLHQTLGGLARELTKLDLRRWA----SFMAAGVEQDDLEEMLQELYSLAQC  558



>ref|XP_513863.2| PREDICTED: protein misato homolog 1 isoform X1 [Pan troglodytes]
Length=570

 Score =   174 bits (440),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_010593118.1| PREDICTED: protein misato homolog 1 isoform X1 [Loxodonta africana]
Length=569

 Score =   174 bits (440),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 164/596 (28%), Positives = 273/596 (46%), Gaps = 81/596 (14%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE+VT+Q+G ++ F+G+H+WN QD    +  +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVVTLQLGHFAGFVGAHWWNQQDAAL-VRPADGKEPPGELCPDVLYRTGRTVHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ+L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQTLGSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS-SDGVWRVKSIPNGKGPLPLTTAKTPKPLMPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
             AA+  + + D+YS   V+ + +  P  ++  + QK NI + L+ A     LA+ S L+ P
Sbjct  242   AAKTAELLQDEYSGRGVIAWGLL-PAPYSLGEPQK-NIYRLLNTAFGLVHLAAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVTFPHLHYDATLPFHCSAILATALDTITVPYRLR-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVEQDN  771
               ++M  +  +L+   ++  V T   ++P PS        SL D  V L   TP +    
Sbjct  349   SPVSMVHLADMLSFSGKK--VVTAGATIPFPS------GQSLPDTLVQLGGATPWIPLSA  400

Query  770   EDMHAMECMTIHGVLGSGSRRA---------------PVYE-------VKRTVQDAYEKA  657
                 +  C     V+  G  RA               P++        + + +Q    +A
Sbjct  401   CGDPSGACCFAQSVVLRGLDRACHTSSQLTPGTPLPSPLHACATGEEVLAQYLQQQQPRA  460

Query  656   ISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASR  477
             +S    SHL ++ C +  P P      +S+ Q G  L+ P    P+R   E  SIP+   
Sbjct  461   LSS---SHLLLTPCKVAPPYPHLF---SSLSQQGLFLDGP----PTRAAAE--SIPVFGA  508

Query  476   LRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
             L SS+++   L      L KL ++R A       + G  +D++E++ + L  L   
Sbjct  509   LCSSSSLHQTLGGLARELTKLDLRRWA----SFMAAGVEQDDLEEMLQELYSLAQC  560



>dbj|BAA91651.1| unnamed protein product [Homo sapiens]
Length=570

 Score =   174 bits (440),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDSKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLV-QFGGATP  396



>ref|XP_004315243.1| PREDICTED: protein misato homolog 1-like isoform 1 [Tursiops 
truncatus]
Length=571

 Score =   173 bits (439),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYKDK--QLDAAIAWQGKLTTHKEEIYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTATTPKPVLPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|XP_004284639.1| PREDICTED: protein misato homolog 1-like isoform 1 [Orcinus orca]
Length=571

 Score =   173 bits (439),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYKDK--QLDAAIAWQGKLTTHKEEIYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTATTPKPVIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|XP_004315244.1| PREDICTED: protein misato homolog 1-like isoform 2 [Tursiops 
truncatus]
Length=559

 Score =   173 bits (438),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYKDK--QLDAAIAWQGKLTTHKEEIYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTATTPKPVLPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|XP_004436236.1| PREDICTED: protein misato homolog 1 isoform 2 [Ceratotherium 
simum simum]
Length=559

 Score =   173 bits (438),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 108/349 (31%), Positives = 182/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L G  ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCGPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K   ++  + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQDGGLYRDKLLDAA--IAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  +N  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGPPLLTTATTPKPLTPPEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A    RL++ S L+ 
Sbjct  241   VGAKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVRLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             P+ L      +    +     +     P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRPESPVSFPHLRYDATLPFHCSAILATALDTVTVPYRLR  347



>ref|XP_004436235.1| PREDICTED: protein misato homolog 1 isoform 1 [Ceratotherium 
simum simum]
Length=571

 Score =   173 bits (438),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 108/349 (31%), Positives = 182/349 (52%), Gaps = 23/349 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L G  ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCGPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K   ++  + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQDGGLYRDKLLDAA--IAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  +N  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGPPLLTTATTPKPLTPPEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A    RL++ S L+ 
Sbjct  241   VGAKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVRLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             P+ L      +    +     +     P++ SA+ A+AL ++++P+R+ 
Sbjct  299   PLSLGGSLGLRPESPVSFPHLRYDATLPFHCSAILATALDTVTVPYRLR  347



>ref|XP_010593119.1| PREDICTED: protein misato homolog 1 isoform X3 [Loxodonta africana]
Length=568

 Score =   173 bits (438),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 163/596 (27%), Positives = 272/596 (46%), Gaps = 82/596 (14%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE+VT+Q+G ++ F+G+H+WN QD    +  +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVVTLQLGHFAGFVGAHWWNQQDAAL-VRPADGKEPPGELCPDVLYRTGRTVHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ+L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQTLGSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS-SDGVWRVKSIPNGKGPLPLTTAKTPKPLMPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
             AA+  + + D+YS   V+ + +  P  ++  + QK NI + L+ A     LA+ S L+ P
Sbjct  242   AAKTAELLQDEYSGRGVIAWGLL-PAPYSLGEPQK-NIYRLLNTAFGLVHLAAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVTFPHLHYDATLPFHCSAILATALDTITVPYRLR-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVEQDN  771
               ++M  +  +L+   ++  V T   ++P PS        SL D  V L   TP +    
Sbjct  349   SPVSMVHLADMLSFSGKK--VVTAGATIPFPS------GQSLPDTLVQLGGATPWIPLSA  400

Query  770   EDMHAMECMTIHGVLGSGSRRA---------------PVYE-------VKRTVQDAYEKA  657
                 +  C     V+  G  RA               P++        + + +Q    +A
Sbjct  401   CGDPSGACCFAQSVVLRGLDRACHTSSQLTPGTPLPSPLHACATGEEVLAQYLQQQQPRA  460

Query  656   ISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASR  477
             +S    SHL ++ C +  P P      +S+ Q G  L+ P    P+R      SIP+   
Sbjct  461   LSS---SHLLLTPCKVAPPYPHLF---SSLSQQGLFLDGP----PTRA---AESIPVFGA  507

Query  476   LRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
             L SS+++   L      L KL ++R A       + G  +D++E++ + L  L   
Sbjct  508   LCSSSSLHQTLGGLARELTKLDLRRWA----SFMAAGVEQDDLEEMLQELYSLAQC  559



>ref|XP_004284640.1| PREDICTED: protein misato homolog 1-like isoform 2 [Orcinus orca]
Length=559

 Score =   173 bits (438),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYKDK--QLDAAIAWQGKLTTHKEEIYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTATTPKPVIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|NP_001153266.1| protein misato homolog 1 [Pongo abelii]
 sp|Q5RF82.1|MSTO1_PONPY RecName: Full=Protein misato homolog 1 [Pongo pygmaeus]
 emb|CAH89575.1| hypothetical protein [Pongo abelii]
Length=570

 Score =   172 bits (437),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGQA-TDSKEPLGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  396



>gb|EDM00680.1| misato homolog 1 (Drosophila) (predicted), isoform CRA_b [Rattus 
norvegicus]
Length=518

 Score =   172 bits (435),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 118/396 (30%), Positives = 196/396 (49%), Gaps = 37/396 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G     E      L  DVLYRSG T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRTTEGEESPGE-LCPDVLYRSGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   G+LY ++  Q    + W GK+TT   E   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGSLYRDR--QLEAAIAWQGKLTTHREEANSKNPNLQDLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQ  1437
               ++           S   ++ K I    EN ++ W+DF +V  HP+S+  +     D +
Sbjct  123   GVLS-----------SDGALRAKLIQNGKENSIKVWSDFLRVHLHPRSICVIQKYNHDGE  171

Query  1436  EFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
                   +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  + 
Sbjct  172   TGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKTAEL  231

Query  1265  IADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssls  1086
             + D+YS   VL + +  PG ++  + QK NI + L+ A     LA +S  + P+ L    
Sbjct  232   LQDEYSGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLAGYSSFVCPLSLGGNL  289

Query  1085  askasrrLCI-----KDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
               +    +           P++ SA+ A+AL ++++P+R+            S  ++M  
Sbjct  290   GLRPKPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRLR-----------SSTVSMAH  338

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
             +  VL+   ++  V T +  +P P + G  +   L+
Sbjct  339   LADVLSFSGKK--VVTAEAIIPFPLVRGQSLPDILM  372



>ref|XP_007171958.1| PREDICTED: protein misato homolog 1 [Balaenoptera acutorostrata 
scammoni]
Length=571

 Score =   172 bits (437),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTAATPKPVIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLREPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|NP_001099913.1| protein misato homolog 1 [Rattus norvegicus]
 gb|EDM00679.1| misato homolog 1 (Drosophila) (predicted), isoform CRA_a [Rattus 
norvegicus]
Length=553

 Score =   172 bits (436),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 118/396 (30%), Positives = 196/396 (49%), Gaps = 37/396 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G     E      L  DVLYRSG T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRTTEGEESPGE-LCPDVLYRSGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   G+LY ++  Q    + W GK+TT   E   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGSLYRDR--QLEAAIAWQGKLTTHREEANSKNPNLQDLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQ  1437
               ++           S   ++ K I    EN ++ W+DF +V  HP+S+  +     D +
Sbjct  123   GVLS-----------SDGALRAKLIQNGKENSIKVWSDFLRVHLHPRSICVIQKYNHDGE  171

Query  1436  EFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
                   +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  + 
Sbjct  172   TGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKTAEL  231

Query  1265  IADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssls  1086
             + D+YS   VL + +  PG ++  + QK NI + L+ A     LA +S  + P+ L    
Sbjct  232   LQDEYSGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLAGYSSFVCPLSLGGNL  289

Query  1085  askasrrLCI-----KDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
               +    +           P++ SA+ A+AL ++++P+R+            S  ++M  
Sbjct  290   GLRPKPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRLR-----------SSTVSMAH  338

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
             +  VL+   ++  V T +  +P P + G  +   L+
Sbjct  339   LADVLSFSGKK--VVTAEAIIPFPLVRGQSLPDILM  372



>ref|XP_005331420.1| PREDICTED: protein misato homolog 1-like isoform X3 [Ictidomys 
tridecemlineatus]
Length=556

 Score =   172 bits (436),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 157/585 (27%), Positives = 269/585 (46%), Gaps = 72/585 (12%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A S +      L  DVLYR+G+T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRATSAQESLG-ELCPDVLYRTGQTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GS+ S+   G LY +K  Q    + W GK+TT   E   +N  LQ L +  
Sbjct  65    PRLILMDLKGSVNSLKQEGGLYWDK--QLDAAVAWHGKLTTHKEEVYPQNPHLQDL-LSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+  +S              + V+ W+DF +V  HP+S+  + 
Sbjct  122   EGVRSSDGFWRVKSIPNGKGENS--------------SSVRVWSDFLRVHLHPRSICMIQ  167

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  168   KYNHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  227

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PGS++  + QK NI + L+ A    RL ++S  + P
Sbjct  228   GAKAAELLQDEYSGRGIITWGL-IPGSYSLGEPQK-NIYRLLNTAFGLVRLTAYSSFVCP  285

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  286   LSLGGSLGLRPQPPVNFPHLHYDATLPFHCSAILATALDTVTVPYRLR-----------S  334

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL--LDNFVSLTPEVEQDNE  768
               ++M  + ++L    ++  V T    +P P + G  +  +L  L    S TP     N 
Sbjct  335   SPVSMVHLANMLTFSGKK--VVTAGAVIPFPLVPGQSLPDALVQLRGATSWTPLSACGNP  392

Query  767   --DMHAMECMTIHGV--------LGSGSRRAPVYEVKRTVQDAYEKAI--SRPKFSHLSV  624
                    + + + G+        L  G+          T ++   + +   +P+ +  S 
Sbjct  393   LGTRCFAQSVVLRGIDRACHTSQLTPGTPLPSPLHACTTGEEVLAQYLHQQQPRVTSSSH  452

Query  623   SccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFL  444
                      P      +S+ Q G +L+ P   T       VHSIP+   L SS+++   L
Sbjct  453   LLLTPCRVAPPYPYLFSSLRQQGMVLDGPPRGT------AVHSIPVFGALCSSSSLHQTL  506

Query  443   ESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
                   L KL ++R    A  L++ G  +DE+E+L + L  L   
Sbjct  507   GGLATELTKLDLRR---WASFLDA-GVEQDEMEELLQELHSLAQC  547



>ref|XP_002928326.1| PREDICTED: protein misato homolog 1-like [Ailuropoda melanoleuca]
 gb|EFB14301.1| hypothetical protein PANDA_018253 [Ailuropoda melanoleuca]
Length=571

 Score =   172 bits (437),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 118/409 (29%), Positives = 202/409 (49%), Gaps = 38/409 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G +S F+G+H+WN QD     A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFSGFVGAHWWNQQDAAL-CAPTDAKEPPGELCPDVLYRAGRTPHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYGDR--QLDAAIAWQGKLTTHKEELYPQNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+            ++   E+ ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGIWRVKSIPNGKGPPPLTAAIAPKLLIPTESSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     +++ S L+ P
Sbjct  242   GAKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHMSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ +A+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVTFPHLHYDATLPFHCAAILATALDTVTVPYRLR-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
               ++M  +  +L    ++  V T   ++P P + G     SL D  V L
Sbjct  349   SPVSMVHLADMLNFSGKK--VVTAAATVPFPLVPGQ----SLPDALVQL  391



>sp|Q4R681.2|MSTO1_MACFA RecName: Full=Protein misato homolog 1 [Macaca fascicularis]
Length=569

 Score =   172 bits (436),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  T T
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTCT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLST  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_005898765.1| PREDICTED: protein misato homolog 1-like isoform X2 [Bos mutus]
Length=561

 Score =   172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 158/584 (27%), Positives = 258/584 (44%), Gaps = 61/584 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSH-NEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
               ++  DG       P+G+      N I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNAITPKPVMPT-ERSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             L A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   LGAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     Q     P++  A+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVSFPLLQYDATLPFHCGAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNED  765
             S  ++M  +  +L    ++  V T   ++P PS+    +  +L+      TP        
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFPSVPSQSLPDTLM-QLGEATPWTPLSACG  404

Query  764   MHAMECMTIHGVLGSGSRRAPVYEVKRTVQDAYEKAISRPKFSHLSVSccplpiplpfpa  585
               +  C     V+  G  RA             + A   P  S L        +   +  
Sbjct  405   DPSGTCCFAQSVVLRGLDRA---------HHTSQLAPGTPLPSPLHACATGEEVLAQYLQ  455

Query  584   iFGNSIGQHGELLETPITETPSRGPL--------EVHSIPMASRLRSSTAILPFLESRLE  429
                  +     LL TP    P    L         V SIP+   L SS+++   L    +
Sbjct  456   QQQPRVRSSSHLLLTPCKVVPPYPSLFSSSLSQHAVESIPVLGALCSSSSLNRALGDLAK  515

Query  428   NLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             +L KL ++R A       S+     E +DL ETL  L +  + Y
Sbjct  516   DLSKLDLRRWA-------SFMDAGVEQDDLEETLQDLRSLAQCY  552



>ref|XP_005103386.1| PREDICTED: protein misato homolog 1-like [Aplysia californica]
Length=579

 Score =   172 bits (436),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 169/590 (29%), Positives = 265/590 (45%), Gaps = 108/590 (18%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNT-------DVLYRSGET  1821
             +REIVT+Q G YSNF+G+H+WN Q       ES  V+    L+T       DVL+R G+T
Sbjct  3     VREIVTLQFGHYSNFVGTHWWNVQ-------ESSFVYDPQLLSTFPKEVNHDVLFREGKT  55

Query  1820  QQGLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLF  1641
               G  T+TPRLV V   GSLGS+   G LY    + S + + W G VT   +E  ++N F
Sbjct  56    ISGHTTFTPRLVLVDLHGSLGSLRREGTLYG---ASSEENIQWLGDVTLHQTEASEKNKF  112

Query  1640  LQSLY--------------MEEKNMNMVDGPDGRESDSHNEIQDKDIVECL--------E  1527
             LQ LY              +++   +  DGPD  + D  +  +       L        +
Sbjct  113   LQDLYEDQAEETSSDRSCKLKDAETSDTDGPDTGKQDCDDSEESSKSEAELPGPHSYHLD  172

Query  1526  NGVQYWTDFSKVQFHPQSLYQLSGLWMDAQEFNYGI---GRDTFHNHQRGEELNERLRFF  1356
             + V  W+DF +   HP+S++ +     +  + ++GI   G+      +  E L +++R+F
Sbjct  173   SDVTVWSDFLRTGLHPRSIHLVKEYQHNNSQNDFGIFGQGQQIAKTDREWEALEDQIRYF  232

Query  1355  IEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVL---LYTVRSPGSFANTKSQ  1185
              EECD +QG   ++D+  GF GL++  L  ++D++S+   L   L     P   A  +S 
Sbjct  233   TEECDQLQGFHILLDNHNGFGGLSSSALSYLSDEFSSKSRLSLGLTPACPPDQTAVERST  292

Query  1184  KLNISQSLHNAVSFSRLASFSKLIVPIGlsslsaskasrrLCI-----KDEQPYYTSAVY  1020
             ++     L++A+S    +  S L VP+ L+S         +       K E  Y+TSAV 
Sbjct  293   RI-----LNSALSLRHCSEHSSLYVPLSLASSLWRNVGAPVKFDNLQYKAELDYHTSAVL  347

Query  1019  ASALHSLSLPFRMEHPGPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLT  840
             A+AL + SLP+R E+   +   I +S            +   R+  VS L++S+P P   
Sbjct  348   AAALDTASLPYRRENDPASISDITSS-----------FSSLGRK--VSALNLSLPFPLRM  394

Query  839   GNQVQGSLL-----DNFVSLTPEVEQDNEDMHAMECMTIHGVLGSGSRRAPVYEVKRTVQ  675
             G  V  +L+     D + SLTP V   +  M   +   + GV        P    KR V 
Sbjct  395   GTTVADTLVSLGQTDPWTSLTPSVHCVSSPM--FQSCVLRGV--------PQLGAKRLVS  444

Query  674   DAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQH---GELLETPI----------  534
             D+     SR   S  SV                NS G H   G ++ TP           
Sbjct  445   DS---PASRLLSSCSSVDDVLRLYLTETYPGSFNS-GCHMRDGVVVSTPFPHIFSPGVNW  500

Query  533   ------TETPSRGPLEVHSIPMASRLRSSTAILPFLESRLENLRKLGIQR  402
                   TE PS   L V  +P+ + L+S++ +   ++S  E++ K  I +
Sbjct  501   HGFLSDTERPSH--LGVERVPVLTSLQSTSDVFSHIDSLTESVSKFNISK  548



>ref|XP_004402995.1| PREDICTED: protein misato homolog 1 [Odobenus rosmarus divergens]
Length=570

 Score =   172 bits (435),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 150/559 (27%), Positives = 261/559 (47%), Gaps = 60/559 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L   A++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALCDPADARE--PPGELCPDVLYRAGRTPYGQDTY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E   +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYGDR--QLDAAIAWQGKLTTHKEELYPQNPYLQDLLTA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+G+             +   E+  + W+DF +V  HP+S+  +
Sbjct  122   EGVLSS-DGIWRVKSIPNGKGPPPLTAATAPKPLVPTESSSRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     +++ S L+ 
Sbjct  241   VGAKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHMSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     +     P++ +A+ A+AL ++++P+R+            
Sbjct  299   PLSLGRSLGLRPEPPVTFPHLRYDATLPFHCAAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL--LDNFVSLTP-EVEQD  774
             S  ++M  +  +L    ++  V T   ++P P + G  +  +L  L    + TP     D
Sbjct  348   SSPVSMVHLADMLNSSGKK--VVTAAATIPFPLVPGQCLPDALVQLGGATAWTPLSACGD  405

Query  773   NEDMHAMECMTIHGV--------LGSGSRRAPVYEVKRTVQDAYEKAI--SRPKF---SH  633
                    + + + G+        L  G+R         T +D   + +   +P+    +H
Sbjct  406   PSGTCFAQSVVLRGLDKACHTSRLAPGTRLPSPLHACDTGEDVLAQYLQQQQPRVRSSAH  465

Query  632   LSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAIL  453
             L ++ C +  P P       S+G+HG LL+ P +         V SIP+   L SS+ + 
Sbjct  466   LLLAPCKVVPPYPCLFS--PSLGRHGLLLDGPPSGA------AVESIPVLGALCSSSTLG  517

Query  452   PFLESRLENLRKLGIQRGA  396
               L      L KL ++R A
Sbjct  518   RALGDLARELGKLDVRRWA  536



>ref|XP_007457985.1| PREDICTED: protein misato homolog 1-like isoform X1 [Lipotes 
vexillifer]
Length=571

 Score =   172 bits (435),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEIYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTATTPKPVIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLHDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDATLPFHCGAILATALDTVTVPYRL  346



>ref|XP_007457986.1| PREDICTED: protein misato homolog 1-like isoform X2 [Lipotes 
vexillifer]
Length=570

 Score =   172 bits (435),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEIYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTATTPKPVIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLHDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDATLPFHCGAILATALDTVTVPYRL  346



>ref|XP_006736806.1| PREDICTED: protein misato homolog 1-like [Leptonychotes weddellii]
Length=570

 Score =   172 bits (435),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/409 (29%), Positives = 201/409 (49%), Gaps = 38/409 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD     A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CATTDAREPPGELCPDVLYRAGRTAHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E    N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYGDR--QLDAAIAWQGKLTTHKEELYPPNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+             +   E+ ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGIWRVKPIPNGKGPPPLPAAIAPKPLIPTESSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPRYLEELEDRLHFYMEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     +++ S L+ P
Sbjct  242   GAKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHMSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ +A+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVTFPHLHYDATLPFHCAAILATALDTVTVPYRLR-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
               ++M  +  +L    ++  V+T   ++P P + G     SL D  V L
Sbjct  349   SPVSMVHLADMLNSSGKK--VATAAATIPFPLVPGQ----SLPDALVQL  391



>ref|XP_005541562.1| PREDICTED: protein misato homolog 1 isoform X3 [Macaca fascicularis]
Length=558

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 156/582 (27%), Positives = 257/582 (44%), Gaps = 64/582 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  T T
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTCT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  +   
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FESS  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   QGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDM  762
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP         
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP---------  396

Query  761   HAMECMTIHGVLG--SGSRRAPVYEVKRTVQDAYEKA---ISRPKFSHLSVSccplpipl  597
                   T     G  SG+R      V R +  A   +      P  S L        +  
Sbjct  397   -----WTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSSLHACTTGEEVLA  451

Query  596   pfpaiFGNSIGQHGELLETPITETPSRGPL------EVHSIPMASRLRSSTAILPFLESR  435
              +       +     LL TP    P    L      +V SIP+   L SS+++   LE+ 
Sbjct  452   QYLQQQQPRVMSSSHLLLTPYRVAPPYPHLFSSCSPQVESIPVFGALCSSSSLHQTLEAL  511

Query  434   LENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
               +L KL ++R A         G   D+V +L + L  L   
Sbjct  512   ARDLTKLDLRRWA----SFMDAGVEHDDVAELLQELQSLAQC  549



>ref|XP_007457987.1| PREDICTED: protein misato homolog 1-like isoform X3 [Lipotes 
vexillifer]
Length=559

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 176/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEIYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGKGPPPFTTATTPKPVIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLHDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDATLPFHCGAILATALDTVTVPYRL  346



>ref|NP_001039873.1| protein misato homolog 1 [Bos taurus]
 sp|A5D9D4.2|MSTO1_BOVIN RecName: Full=Protein misato homolog 1 [Bos taurus]
 gb|AAI13255.1| Misato homolog 1 (Drosophila) [Bos taurus]
 tpg|DAA31805.1| TPA: protein misato homolog 1 [Bos taurus]
Length=572

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 164/595 (28%), Positives = 275/595 (46%), Gaps = 72/595 (12%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSH-NEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
               ++  DG       P+G+      N I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNAITPKPVMPT-EGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             L A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   LGAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     Q     P++  A+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVSFPLLQYDATLPFHCGAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNED  765
             S  ++M  +  +L    ++  V T   ++P PS+    +  +L+      TP        
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFPSVPSQSLPDTLM-QLGEATPWTPLSACG  404

Query  764   MHAMECMTIHGVLGSGSRRA--------------PVYEVKRTVQDAYEKAI--SRPKF--  639
               +  C     V+  G  RA              P++    T ++   + +   +P+   
Sbjct  405   DPSGTCCFAQSVVLRGLDRAHHTSQLAPGTPLPSPLHACA-TGEEVLAQYLQQQQPRVRS  463

Query  638   -SHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSST  462
              SHL ++ C +  P P      +S+ QHG +L+   T T       V SIP+   L SS+
Sbjct  464   SSHLLLTPCKVVPPYPSLFS--SSLSQHGSVLDGLPTGT------AVESIPVLGALCSSS  515

Query  461   AILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             ++   L    ++L KL ++R A       S+     E +DL ETL  L +  + Y
Sbjct  516   SLNRALGDLAKDLSKLDLRRWA-------SFMDAGVEQDDLEETLQDLRSLAQCY  563



>ref|XP_008569063.1| PREDICTED: protein misato homolog 1 isoform X1 [Galeopterus variegatus]
Length=570

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAELGRA-TDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLNSLKEEGGLYRDK--QLDATIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+ +                ++  ++ W+DF KV  HP+S+  + 
Sbjct  123   GVLSS-DGVCRVKSIPNSKGPPPLTNATTPKPFIPMDGSIRVWSDFLKVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D        +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGDTGRLEAFGQGESVLKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + + S G +   + QK NI + L+ A     L ++S L+ P
Sbjct  242   GAKTAELLHDEYSGRGIITWGLLS-GPYNLMEPQK-NIYRLLNTAFGLVHLTAYSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G  SL          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSMSLRPEAPVNFPYLHYDATLPFHCSAILATALDTVTVPYRLR-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P + G  +  +L+  F   TP
Sbjct  349   SPVSMAHLADMLSISGKK--VVTAGAAIPFPLVPGQSLPDTLM-QFGGATP  396



>ref|XP_006153501.1| PREDICTED: protein misato homolog 1-like, partial [Tupaia chinensis]
Length=602

 Score =   172 bits (435),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/347 (31%), Positives = 180/347 (52%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A  D       L  DVLYR+G+T  G  TYT
Sbjct  2     REVLTLQLGHFAGFVGAHWWNQQDAGLGGAADDGEEAAGELCPDVLYRTGQTLHGQETYT  61

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K   ++  + W GK+TT   +   +N +LQ L   E
Sbjct  62    PRLILMDLKGSLSSLKEEGALYRDKLLDAA--IAWQGKLTTHKEDLCPKNPYLQDLPRAE  119

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+          K ++   E  ++ W+DF +V  HP+S+  + 
Sbjct  120   GVLSS-DGVWRVKSIPNGKGLPPCTTATPKPLIP-TEGSIRVWSDFLRVHLHPRSICMIQ  177

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  178   KYNHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  237

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK N+ + L+ A     LA+ S L+ P
Sbjct  238   GAKASELLQDEYSGRGIITWGLL-PGPYNLGEPQK-NVYRLLNTAFGLVHLAAHSSLVCP  295

Query  1106  IGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRM  981
             + L      +    +           P++ SA+ A+AL +++ P+R+
Sbjct  296   LSLGGSLGLRPEPPVTFPYLHYDATLPFHCSAILATALDTVTAPYRL  342



>ref|XP_005898764.1| PREDICTED: protein misato homolog 1-like isoform X1 [Bos mutus]
 gb|ELR54262.1| Protein misato-like protein 1 [Bos mutus]
Length=572

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 164/595 (28%), Positives = 275/595 (46%), Gaps = 72/595 (12%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSH-NEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
               ++  DG       P+G+      N I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNAITPKPVMPT-ERSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             L A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   LGAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     Q     P++  A+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVSFPLLQYDATLPFHCGAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNED  765
             S  ++M  +  +L    ++  V T   ++P PS+    +  +L+      TP        
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFPSVPSQSLPDTLM-QLGEATPWTPLSACG  404

Query  764   MHAMECMTIHGVLGSGSRRA--------------PVYEVKRTVQDAYEKAI--SRPKF--  639
               +  C     V+  G  RA              P++    T ++   + +   +P+   
Sbjct  405   DPSGTCCFAQSVVLRGLDRAHHTSQLAPGTPLPSPLHACA-TGEEVLAQYLQQQQPRVRS  463

Query  638   -SHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSST  462
              SHL ++ C +  P P      +S+ QHG +L+   T T       V SIP+   L SS+
Sbjct  464   SSHLLLTPCKVVPPYPSLFS--SSLSQHGSVLDGLPTGT------AVESIPVLGALCSSS  515

Query  461   AILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             ++   L    ++L KL ++R A       S+     E +DL ETL  L +  + Y
Sbjct  516   SLNRALGDLAKDLSKLDLRRWA-------SFMDAGVEQDDLEETLQDLRSLAQCY  563



>ref|XP_003795324.1| PREDICTED: protein misato homolog 1 [Otolemur garnettii]
Length=571

 Score =   171 bits (434),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 117/404 (29%), Positives = 199/404 (49%), Gaps = 34/404 (8%)
 Frame = -2

Query  1979  MREIVTIQVGSYSNFIGSHFWNFQDELHG-LAESDEVFKNHSLNTDVLYRSGETQQGLLT  1803
             +RE++T+Q+G ++ F+G+H+WN QD   G  AE+ E      L+ DVLYR+G T  G  T
Sbjct  5     VREVLTLQLGHFAGFVGAHWWNQQDAALGRAAEAQE--PPGELSPDVLYRTGRTLHGQET  62

Query  1802  YTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYM  1623
             YTPRL+ V  +GSL S+   G LY ++  Q    + W GK+TT   E   ++L LQ    
Sbjct  63    YTPRLILVDLKGSLSSLQEEGGLYRDR--QLDAAIAWQGKLTTHQEELYPKSLHLQDFPG  120

Query  1622  EEKNMN------MVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
              E  ++      +   P+G+    H        +   E  ++ W+DF +V  HP+S+  +
Sbjct  121   AEGVLSSEGIWRVKSIPNGKGPPPHTTAATTKPLVPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD +QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDFLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             +  +  + + D+YS   ++ + +  PG +   + QK NI + L+ A     LA+ S L+ 
Sbjct  241   VGVKAAELLQDEYSGRGIITWGLL-PGPYNLGEPQK-NIYRLLNTAFGLVHLAAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCI-----KDEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +           P + SA+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVNFPYLHYNAALPVHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
             S  ++M  +  +L+   ++  V T   ++P P + G  +  SL+
Sbjct  348   SSPVSMVHLADMLSFSGKK--VVTAGATIPFPLVPGQSLPDSLV  389



>ref|XP_010836570.1| PREDICTED: protein misato homolog 1 isoform X1 [Bison bison bison]
Length=572

 Score =   171 bits (434),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 164/595 (28%), Positives = 275/595 (46%), Gaps = 72/595 (12%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSH-NEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
               ++  DG       P+G+      N I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNAITPKPVMPT-EGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             L A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   LGAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     Q     P++  A+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVSFPLLQYDATLPFHCGAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNED  765
             S  ++M  +  +L    ++  V T   ++P PS+    +  +L+      TP        
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFPSVPSQSLPDTLM-QLGEATPWTPLSACG  404

Query  764   MHAMECMTIHGVLGSGSRRA--------------PVYEVKRTVQDAYEKAI--SRPKF--  639
               +  C     V+  G  RA              P++    T ++   + +   +P+   
Sbjct  405   DPSGTCCFAQSVVLRGLDRAHHTSQLAPGTPLPSPLHACA-TGEEVLAQYLQQQQPRVRS  463

Query  638   -SHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSST  462
              SHL ++ C +  P P      +S+ QHG +L+   T T       V SIP+   L SS+
Sbjct  464   SSHLLLTPCKVVPPYPSLFS--SSLSQHGSVLDGLPTGT------AVESIPVLGALCSSS  515

Query  461   AILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             ++   L    ++L KL ++R A       S+     E +DL ETL  L +  + Y
Sbjct  516   SLNRALGDLAKDLSKLDLRRWA-------SFMDAGVEQDDLEETLQDLRSLAQCY  563



>gb|ABQ12993.1| misato [Bos taurus]
Length=572

 Score =   171 bits (434),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 164/595 (28%), Positives = 275/595 (46%), Gaps = 72/595 (12%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSH-NEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
               ++  DG       P+G+      N I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSS-DGIWRVKSIPNGKGLPPFTNAITPKPVMPT-EGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             L A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   LGAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     Q     P++  A+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVSFPLLQYDATLPFHCGAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNED  765
             S  ++M  +  +L    ++  V T   ++P PS+    +  +L+      TP        
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFPSVPSQSLPDTLM-QLGEATPWTPLSACG  404

Query  764   MHAMECMTIHGVLGSGSRRA--------------PVYEVKRTVQDAYEKAI--SRPKF--  639
               +  C     V+  G  RA              P++    T ++   + +   +P+   
Sbjct  405   DPSGTCCFAQSVVLRGLDRAHHTSQLAPGTPLPSPLHACA-TGEEVLAQYLQQQQPRVRS  463

Query  638   -SHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSST  462
              SHL ++ C +  P P      +S+ QHG +L+   T T       V SIP+   L SS+
Sbjct  464   SSHLLLTPCKVVPPYPSLFS--SSLSQHGSVLDGLPTGT------AVESIPVLGALCSSS  515

Query  461   AILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
             ++   L    ++L KL ++R A       S+     E +DL ETL  L +  + Y
Sbjct  516   SLNRALGDLAKDLSKLDLRRWA-------SFMDAGVEQDDLEETLQDLRSLAQCY  563



>ref|XP_009181328.1| PREDICTED: LOW QUALITY PROTEIN: protein misato homolog 1-like 
[Papio anubis]
Length=569

 Score =   171 bits (433),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 36/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++E+CD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEQCDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   +    +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGITWGLL--PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  298

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  299   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  347

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  348   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  395



>ref|XP_006895845.1| PREDICTED: protein misato homolog 1-like [Elephantulus edwardii]
Length=564

 Score =   171 bits (433),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/392 (29%), Positives = 192/392 (49%), Gaps = 34/392 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             R+++T+Q+G ++ F+G+H+WN QD   G   +D       L  DVLYR+G T  G  TYT
Sbjct  6     RKVLTLQLGHFAGFVGAHWWNQQDAALG-RPTDAQEAPGELCPDVLYRAGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N ++  L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDATIAWQGKLTTHKEELYPKNPYVHDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+   +H   +           ++ W+DF +V  HP+S+  + 
Sbjct  123   GELSS-DGVWRVKSIPNGKGPPTHTTAKTPKPPTPTVGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   +L + +  PG +   + QK NI + L+ A     L + S L+ P
Sbjct  242   GAKTAELLQDEYSGRGILAWGLL-PGPYNLQEPQK-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +           P++ SA+ A+AL +L++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVTFPQLHYDASLPFHCSAILATALDTLTVPYRLH-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPS  846
               ++M  +  +L+   ++  V T   ++P PS
Sbjct  349   SPISMVHMADMLSYSGKK--VVTAGATIPFPS  378



>ref|XP_004002642.1| PREDICTED: protein misato homolog 1 isoform 1 [Ovis aries]
Length=572

 Score =   171 bits (433),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 178/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPEELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS-SDGTWRVKSIPNGKGLPPFTNGRTPKPVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
             +A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   SAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|XP_004002643.1| PREDICTED: protein misato homolog 1 isoform 2 [Ovis aries]
Length=561

 Score =   171 bits (432),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 178/347 (51%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPEELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS-SDGTWRVKSIPNGKGLPPFTNGRTPKPVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
             +A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   SAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|XP_007110459.1| PREDICTED: protein misato homolog 1-like [Physeter catodon]
Length=571

 Score =   171 bits (433),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 107/347 (31%), Positives = 175/347 (50%), Gaps = 21/347 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQDGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               +N  DG       P+G              V   E  ++ W+DF ++  HP+S+  + 
Sbjct  123   GVLNS-DGIWRVKSIPNGTAPPPFTTATTPKPVIPTEGSIRVWSDFLRIHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
             + L      +    +     Q     P++  A+ A+AL ++++P+R+
Sbjct  300   LSLGGSLGLQPEPPVNFPHLQYDAALPFHCGAILATALDTVTVPYRL  346



>ref|XP_005080198.1| PREDICTED: protein misato homolog 1 [Mesocricetus auratus]
Length=552

 Score =   171 bits (432),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 123/403 (31%), Positives = 196/403 (49%), Gaps = 43/403 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHG-LAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD   G +AE +E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEGEE--SPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E    N  LQ L   
Sbjct  64    TPRLIVMDLKGSLNSLKEEGGLYKDR--QLDTAIAWQGKLTTHREEAYPENPNLQDLLSA  121

Query  1619  EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
             E  ++  DG            + K I    EN V+ W+DF +V  HP+S+  +     D 
Sbjct  122   EGVLS-TDG----------VWKAKPIQNGKENSVRVWSDFLRVHLHPRSICVIQKYNHDG  170

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  +
Sbjct  171   ETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKTAE  230

Query  1268  NIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssl  1089
              + D+YS   V+ + +  PG +   + QK NI + L+ A     L  +S  + P+ L   
Sbjct  231   LLQDEYSGRGVISWGLL-PGPYNLGEPQK-NIYRLLNTAFGLVHLTGYSSFVCPLSLGGN  288

Query  1088  saskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
                +    +           P++  A+ A+AL +++ P+R+            S  + M 
Sbjct  289   LGLRPKPPVNFPHLHYDATLPFHCGAILATALDTVTAPYRLR-----------SSMVPMA  337

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
              + H+L+   ++  V T +  +P P + G     SL D  V L
Sbjct  338   HLAHLLSFSGKK--VVTAEAIIPFPLVPGQ----SLPDTLVQL  374



>ref|XP_006861623.1| PREDICTED: protein misato homolog 1 isoform X1 [Chrysochloris 
asiatica]
Length=568

 Score =   171 bits (432),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/346 (31%), Positives = 176/346 (51%), Gaps = 20/346 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G     +      L  DVLYR+G+T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRTNDAKELPGE-LCPDVLYRTGQTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K   +   + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDKLDAA---IAWQGKLTTHKEELCPKNPYLQDLLSAE  121

Query  1616  KNMNMVDG------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
               +N  D       P+G+ +      +        E  ++ W+DF +V  HP+S+  +  
Sbjct  122   GVLNSDDIWRVKSIPNGKGALPFTTCKMLTSPTPTEGSIRVWSDFLRVPLHPRSICMIHK  181

Query  1454  LWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
                D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+ 
Sbjct  182   YNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVG  241

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             A+  + + D+YS   ++ + +  P  ++  + QK NI + L+ A     LA+ S L+ P+
Sbjct  242   AKTTELLQDEYSGRGIIAWGLL-PAPYSLGEPQK-NIYRLLNTAFGLVHLAAHSSLVCPL  299

Query  1103  GlsslsaskasrrLCIKD-----EQPYYTSAVYASALHSLSLPFRM  981
              L      +    +           P++ SAV A+AL +L++P+R+
Sbjct  300   SLGGSLGLRPEPPVTFPHLHYDATMPFHCSAVLATALDTLTVPYRL  345



>ref|XP_006861625.1| PREDICTED: protein misato homolog 1 isoform X3 [Chrysochloris 
asiatica]
Length=556

 Score =   171 bits (432),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/346 (31%), Positives = 176/346 (51%), Gaps = 20/346 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G     +      L  DVLYR+G+T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRTNDAKELPGE-LCPDVLYRTGQTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K   +   + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDKLDAA---IAWQGKLTTHKEELCPKNPYLQDLLSAE  121

Query  1616  KNMNMVDG------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
               +N  D       P+G+ +      +        E  ++ W+DF +V  HP+S+  +  
Sbjct  122   GVLNSDDIWRVKSIPNGKGALPFTTCKMLTSPTPTEGSIRVWSDFLRVPLHPRSICMIHK  181

Query  1454  LWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
                D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+ 
Sbjct  182   YNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVG  241

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             A+  + + D+YS   ++ + +  P  ++  + QK NI + L+ A     LA+ S L+ P+
Sbjct  242   AKTTELLQDEYSGRGIIAWGLL-PAPYSLGEPQK-NIYRLLNTAFGLVHLAAHSSLVCPL  299

Query  1103  GlsslsaskasrrLCIKD-----EQPYYTSAVYASALHSLSLPFRM  981
              L      +    +           P++ SAV A+AL +L++P+R+
Sbjct  300   SLGGSLGLRPEPPVTFPHLHYDATMPFHCSAVLATALDTLTVPYRL  345



>ref|XP_004448654.1| PREDICTED: protein misato homolog 1-like isoform 2 [Dasypus novemcinctus]
Length=570

 Score =   171 bits (432),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 121/410 (30%), Positives = 199/410 (49%), Gaps = 40/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-CPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   RN +L      E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWEGKLTTHKEELYPRNPYLHDFLSAE  122

Query  1616  K--------NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
                       +  +    G    +   I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSGEGVWRVKAIPNSKGLPPLT-TAINSKPLIPT-EGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G +        EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGENVLKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     L + S L+ 
Sbjct  241   VGAKASELLQDEYSGRGIIAWGLL-PGPYSREEPQK-NIYRLLNTAFGLVHLTAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L+     +    +           P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLNGSLGLRPEPPVSFPHLHYDASLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +  +L+   R+  + T   +MP P LT  Q   SL D  V L
Sbjct  348   SSPVSMVHLADMLSCSGRK--MVTAGATMPFP-LTAGQ---SLPDILVQL  391



>ref|XP_006861624.1| PREDICTED: protein misato homolog 1 isoform X2 [Chrysochloris 
asiatica]
Length=567

 Score =   171 bits (432),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/346 (31%), Positives = 176/346 (51%), Gaps = 20/346 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G     +      L  DVLYR+G+T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRTNDAKELPGE-LCPDVLYRTGQTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K   +   + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDKLDAA---IAWQGKLTTHKEELCPKNPYLQDLLSAE  121

Query  1616  KNMNMVDG------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
               +N  D       P+G+ +      +        E  ++ W+DF +V  HP+S+  +  
Sbjct  122   GVLNSDDIWRVKSIPNGKGALPFTTCKMLTSPTPTEGSIRVWSDFLRVPLHPRSICMIHK  181

Query  1454  LWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
                D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+ 
Sbjct  182   YNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVG  241

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             A+  + + D+YS   ++ + +  P  ++  + QK NI + L+ A     LA+ S L+ P+
Sbjct  242   AKTTELLQDEYSGRGIIAWGLL-PAPYSLGEPQK-NIYRLLNTAFGLVHLAAHSSLVCPL  299

Query  1103  GlsslsaskasrrLCIKD-----EQPYYTSAVYASALHSLSLPFRM  981
              L      +    +           P++ SAV A+AL +L++P+R+
Sbjct  300   SLGGSLGLRPEPPVTFPHLHYDATMPFHCSAVLATALDTLTVPYRL  345



>ref|XP_004448653.1| PREDICTED: protein misato homolog 1-like isoform 1 [Dasypus novemcinctus]
Length=571

 Score =   171 bits (432),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 121/410 (30%), Positives = 199/410 (49%), Gaps = 40/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-CPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   RN +L      E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWEGKLTTHKEELYPRNPYLHDFLSAE  122

Query  1616  K--------NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
                       +  +    G    +   I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSGEGVWRVKAIPNSKGLPPLT-TAINSKPLIPT-EGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G +        EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGENVLKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     L + S L+ 
Sbjct  241   VGAKASELLQDEYSGRGIIAWGLL-PGPYSREEPQK-NIYRLLNTAFGLVHLTAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L+     +    +           P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLNGSLGLRPEPPVSFPHLHYDASLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +  +L+   R+  + T   +MP P LT  Q   SL D  V L
Sbjct  348   SSPVSMVHLADMLSCSGRK--MVTAGATMPFP-LTAGQ---SLPDILVQL  391



>ref|XP_005541560.1| PREDICTED: protein misato homolog 1 isoform X1 [Macaca fascicularis]
Length=570

 Score =   171 bits (432),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  T T
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTCT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  +   
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FESS  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   QGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_004714815.1| PREDICTED: protein misato homolog 1 [Echinops telfairi]
Length=572

 Score =   171 bits (432),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 107/350 (31%), Positives = 181/350 (52%), Gaps = 23/350 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-RPTDAKEAPAELCADVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ + +  
Sbjct  65    PRLIIMDLKGSLSSLQQEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQDV-LSA  121

Query  1616  KNMNMVDG-------PDGRESDSH--NEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQ  1464
             + +   DG       P+G ++ S      Q    +   E+ ++ W+DF +VQ HP+S+  
Sbjct  122   EGVRSSDGVWRVKSTPNGTQASSLPLTTAQTPTPLTTPESSIRVWSDFLRVQLHPRSICM  181

Query  1463  LSGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFS  1293
             +     D +      +G G          E+L +RL F++EECD++QG Q + D   GFS
Sbjct  182   IHKYNHDGETGRLEAFGQGESILKEPGYLEDLEDRLHFYVEECDYLQGFQILCDLHDGFS  241

Query  1292  GLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLI  1113
             G+ A+  + + D+YS   ++ + +  PG +   + QK +I + L+ A     L + S L+
Sbjct  242   GVGAKTAELLQDEYSGRGLITWGLL-PGPYRLGEPQK-SIYRLLNTAFGLVHLTAHSSLV  299

Query  1112  VPIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
              P+ L      +    +     Q     P++ SA+ A+AL ++++P+R+ 
Sbjct  300   CPLSLGGSLGLRPEPAVTFPHLQYDATLPFHCSAILATALDTVTVPYRLR  349



>ref|XP_005541561.1| PREDICTED: protein misato homolog 1 isoform X2 [Macaca fascicularis]
Length=569

 Score =   170 bits (431),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 119/411 (29%), Positives = 202/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  T T
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAKESPGELCPDVLYRTGRTLHGQDTCT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  +   
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELCPKNPYLQD-FESS  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   QGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-----------CS  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T   ++P P   G  +  SL+  F   TP
Sbjct  349   SPVSMVHLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM-QFGGATP  396



>ref|XP_004448655.1| PREDICTED: protein misato homolog 1-like isoform 3 [Dasypus novemcinctus]
Length=555

 Score =   170 bits (430),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 121/410 (30%), Positives = 199/410 (49%), Gaps = 40/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-CPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   RN +L      E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWEGKLTTHKEELYPRNPYLHDFLSAE  122

Query  1616  K--------NMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
                       +  +    G    +   I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSGEGVWRVKAIPNSKGLPPLT-TAINSKPLIPT-EGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G +        EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   HKYNHDGEAGRLEAFGQGENVLKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     L + S L+ 
Sbjct  241   VGAKASELLQDEYSGRGIIAWGLL-PGPYSREEPQK-NIYRLLNTAFGLVHLTAHSSLVC  298

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L+     +    +           P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLNGSLGLRPEPPVSFPHLHYDASLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +  +L+   R+  + T   +MP P LT  Q   SL D  V L
Sbjct  348   SSPVSMVHLADMLSCSGRK--MVTAGATMPFP-LTAGQ---SLPDILVQL  391



>ref|XP_005975168.1| PREDICTED: protein misato homolog 1 isoform X1 [Pantholops hodgsonii]
Length=572

 Score =   170 bits (431),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 177/348 (51%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELSPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNGRTPKAVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL ++++P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRLR  347



>ref|XP_005975169.1| PREDICTED: protein misato homolog 1 isoform X2 [Pantholops hodgsonii]
Length=561

 Score =   170 bits (430),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 177/348 (51%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELSPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS-SDGTWRVKSIPNGKGLPPFTNGRTPKAVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL ++++P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRLR  347



>ref|XP_009056694.1| hypothetical protein LOTGIDRAFT_120630 [Lottia gigantea]
 gb|ESO92553.1| hypothetical protein LOTGIDRAFT_120630 [Lottia gigantea]
Length=548

 Score =   169 bits (429),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 110/344 (32%), Positives = 183/344 (53%), Gaps = 28/344 (8%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             REIVT+Q+G YSNF+GSH+WN Q+      + + V    SLN DVL+R G+T +G +T+T
Sbjct  4     REIVTLQIGHYSNFVGSHWWNIQEGSFNY-DINHVKDGVSLNHDVLFREGQTTKGAVTFT  62

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRLV +  +GSL ++S  G LY +   +    + W   VT   +    +N +L  L  EE
Sbjct  63    PRLVCIDLKGSLNTLSKDGGLYGDDNEEE---VKWCEDVTLHEAGTGYKNEYLTDLEQEE  119

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQ  1437
                  V   D  E    N +        L+  V  W+D+ K   HP++L+ ++   +   
Sbjct  120   S----VLISDKEE----NNVCSGQKYYNLDKDVTVWSDYLKTYLHPKTLHIINDYMLGDT  171

Query  1436  E--FN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
             E  FN +G+G + F   +  E++ +R+RFF+E+CD +QG   +VD   GF G+A+ +LQ 
Sbjct  172   ERPFNVFGMGEEIFSKPETFEDVEDRIRFFVEDCDLLQGFHCLVDTYDGFGGVASTYLQY  231

Query  1265  IADDYSNVPVLLYTVRS---PGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGls  1095
             + D++S+   L + +     P S A  +S ++     +++A+ + +L   S L +PI L+
Sbjct  232   LQDEFSSKSKLTFGMTPHILPDSTAVERSNRI-----INSAICYEKLCESSGLFIPISLA  286

Query  1094  slsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             +    K          Q      Y+TSA+ AS L ++++P+R +
Sbjct  287   TSLWRKLGSSQTFPHLQYNVKLNYHTSAIIASTLDTMTIPYRRD  330



>ref|XP_010836571.1| PREDICTED: protein misato homolog 1 isoform X2 [Bison bison bison]
Length=567

 Score =   170 bits (430),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 164/593 (28%), Positives = 275/593 (46%), Gaps = 73/593 (12%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSH-NEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
               ++  DG       P+G+      N I  K ++   E  ++ W+DF +V  HP+S+  +
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNAITPKPVMPT-EGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN-YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
                  +A     +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL 
Sbjct  181   H---KEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGLG  237

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P+
Sbjct  238   AKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCPL  295

Query  1103  GlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASG  939
              L      +    +     Q     P++  A+ A+AL ++++P+R+            S 
Sbjct  296   SLGGSLGLRPEPPVSFPLLQYDATLPFHCGAILATALDTVTVPYRLR-----------SS  344

Query  938   ALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTPEVEQDNEDMH  759
              ++M  +  +L    ++  V T   ++P PS+    +  +L+      TP          
Sbjct  345   PVSMVHLADMLNFSGKK--VVTAGATIPFPSVPSQSLPDTLM-QLGEATPWTPLSACGDP  401

Query  758   AMECMTIHGVLGSGSRRA--------------PVYEVKRTVQDAYEKAI--SRPKF---S  636
             +  C     V+  G  RA              P++    T ++   + +   +P+    S
Sbjct  402   SGTCCFAQSVVLRGLDRAHHTSQLAPGTPLPSPLHACA-TGEEVLAQYLQQQQPRVRSSS  460

Query  635   HLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAI  456
             HL ++ C +  P P      +S+ QHG +L+   T T       V SIP+   L SS+++
Sbjct  461   HLLLTPCKVVPPYPSLFS--SSLSQHGSVLDGLPTGT------AVESIPVLGALCSSSSL  512

Query  455   LPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLKPY  297
                L    ++L KL ++R A       S+     E +DL ETL  L +  + Y
Sbjct  513   NRALGDLAKDLSKLDLRRWA-------SFMDAGVEQDDLEETLQDLRSLAQCY  558



>ref|XP_005677432.1| PREDICTED: protein misato homolog 1 isoform X2 [Capra hircus]
Length=565

 Score =   169 bits (429),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 177/348 (51%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELHPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNGRTPKPVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL ++++P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRLR  347



>ref|XP_006052085.1| PREDICTED: protein misato homolog 1 isoform X2 [Bubalus bubalis]
Length=561

 Score =   169 bits (429),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 176/348 (51%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNAVTPKPVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL ++++P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRLR  347



>ref|XP_005677431.1| PREDICTED: protein misato homolog 1 isoform X1 [Capra hircus]
Length=572

 Score =   169 bits (429),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 177/348 (51%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELHPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +    V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNGRTPKPVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL ++++P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRLR  347



>ref|XP_006052084.1| PREDICTED: protein misato homolog 1 isoform X1 [Bubalus bubalis]
Length=572

 Score =   169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 176/348 (51%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+             V   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGTWRVKSIPNGKGLPPFTNAVTPKPVMPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSGL
Sbjct  182   KYNHDGEAGRLEAFGQGESILKEPKYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGL  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGELQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL ++++P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPLLQYDAALPFHCGAILATALDTVTVPYRLR  347



>ref|XP_003768168.1| PREDICTED: protein misato homolog 1 [Sarcophilus harrisii]
Length=580

 Score =   169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 128/421 (30%), Positives = 207/421 (49%), Gaps = 46/421 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHG-LAESDEV-----FKNHSLNTDVLYRSGETQQ  1815
             RE++T+Q+G ++ F+G+H+WN QD   G LA + EV          L  DVLYR+G+T  
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRLAGAKEVPGIKELLPGELCPDVLYRAGQTLH  65

Query  1814  GLLTYTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQ  1635
             G  TYTPRL+ +  +GSL S+   G LY +K       + W GK+TT   E    N FLQ
Sbjct  66    GQETYTPRLIVMDLKGSLNSLKQEGGLYQDK--HLDAAIAWQGKLTTHKEELQANNPFLQ  123

Query  1634  SLYMEEKNMNMVDG-------PDGRE----SDSHNEIQDKDIVECLENGVQYWTDFSKVQ  1488
             +L   E  M+  DG       P+G+     + + +      I    E  ++ W+DF  VQ
Sbjct  124   NLLSAEGVMSS-DGVWRVQAFPNGKGLLPLAKAFSPTSKSLIPP--EGSIKVWSDFLHVQ  180

Query  1487  FHPQSLYQLSGLWMDAQEF---NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFI  1317
              HP+S+  +     D +      +G G          EEL +RL F++EECD++QG Q +
Sbjct  181   LHPRSICIIQKYNHDGEAGRLEGFGQGESLLREPTYLEELEDRLHFYVEECDYLQGFQVL  240

Query  1316  VDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSR  1137
              D   GFSGL A+  + + D+Y+   +L + +  PG +   + QK N  +  + A+    
Sbjct  241   CDLHDGFSGLGAKATELLQDEYAGRGILTWGLL-PGPYTLGEPQK-NFYRLFNTALGLVN  298

Query  1136  LASFSKLIVPIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHP  972
             +A+ S LI P+ L      +    +     +     PY++SA+ A+AL ++++P+R+   
Sbjct  299   IAAHSSLICPLSLGGGLGLRPEPPVTFPHLRYDVTLPYHSSALLATALDTITVPYRLH--  356

Query  971   GPTAESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLT  792
                      S  ++M  +  +L+   R+  V T   S+P P   G+ +  + L  F   T
Sbjct  357   ---------SSPISMVHLADMLSFSGRK--VVTAGASIPFPVAPGHSLPDT-LAQFGGTT  404

Query  791   P  789
             P
Sbjct  405   P  405



>ref|XP_008972841.1| PREDICTED: LOW QUALITY PROTEIN: protein misato homolog 1-like 
[Pan paniscus]
Length=572

 Score =   169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/414 (29%), Positives = 205/414 (50%), Gaps = 39/414 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             +E++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     QEVLTLQLGRFAGFVGAHWWNQQDAALGXA-TDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDS---HNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLY  1467
             + +   DG       P+G+   S         K ++   E  ++ W+DF +V  HP+S+ 
Sbjct  122   EGVLSSDGVWRVKSIPNGKGETSPALTTATTPKPLIP-TEASIRVWSDFLRVHLHPRSIC  180

Query  1466  QLSGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGF  1296
              +     D +      +G G       +  EEL +RL F++EECD++QG Q + D   GF
Sbjct  181   MIQKYNHDGEAGRLEAFGQGESVLKESKYQEELEDRLHFYVEECDYLQGFQILCDLHDGF  240

Query  1295  SGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKL  1116
             SG+ A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L
Sbjct  241   SGVGAKAAELLQDEYSGWGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSXL  298

Query  1115  IVPI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESI  951
             + P+   G   L          +  +   P++ SA+ A+AL ++++P+R+          
Sbjct  299   VCPLSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL----------  348

Query  950   YASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               S  ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  349   -CSSPVSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  398



>emb|CAH93412.1| hypothetical protein [Pongo abelii]
Length=566

 Score =   169 bits (428),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 203/411 (49%), Gaps = 35/411 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  2     REVLTLQLGHFAGFVGAHWWNQQDAALGQA-TDSKEPLGELCPDVLYRTGRTLHGQETYT  60

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  61    PRLILMDLEGSLSSLKEEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  117

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+G+ S           +   E  ++ W+DF +V  HP+S+  + 
Sbjct  118   EGVLSSDGVWRVKSIPNGKGSPPLTTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQ  177

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  E L +RL F++EECD++QG Q + D   GFSG+
Sbjct  178   KYNHDGEAGRLEAFGQGESVLKEPKYQEGLEDRLHFYVEECDYLQGFQILCDLHDGFSGV  237

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   ++Q+ NI + L+ A     L + S L+ P
Sbjct  238   GAKAAELLQDEYSGRGIITWGLL-PGPYHRGEAQR-NIYRLLNTAFGLVHLTAHSSLVCP  295

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L          +  +   P++ SA+ A+AL ++++P+R+  P P        
Sbjct  296   LSLGGSLGLRPEPPVNFPYLHYDATLPFHCSAILATALDTVTVPYRL-CPSP--------  346

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               ++M  +  +L+   ++  V T    +P P   G  +  SL+  F   TP
Sbjct  347   --VSMVHLADMLSFCGKK--VVTAGAIIPFPLAPGQSLPDSLM-QFGGATP  392



>dbj|BAE39645.1| unnamed protein product [Mus musculus]
Length=444

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/340 (31%), Positives = 176/340 (52%), Gaps = 21/340 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G    DE      L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPG-ELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   GNLY ++  Q    + W GK++T   +   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGNLYRDR--QLEAAVAWQGKLSTHRDDAQPKNPNLQGLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQ  1437
                  V   DG    +      ++I    EN ++ W+DF +V  HP+S+  +     D +
Sbjct  123   G----VRSSDG----AWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSICVIHKYHHDGE  174

Query  1436  EFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
                   +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  + 
Sbjct  175   TGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHDGFSGVGAKTAEL  234

Query  1265  IADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI---Gls  1095
             + D+Y+   VL + +  PG ++  + QK NI + L+ A     L  +S  + P+   G  
Sbjct  235   LQDEYAGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLTGYSSFVCPLSLGGNL  292

Query  1094  slsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRM  981
              L          +  +   P++ SA+ A+AL ++++P+R+
Sbjct  293   GLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRL  332



>ref|XP_008852203.1| PREDICTED: protein misato homolog 1 isoform X1 [Nannospalax galili]
Length=570

 Score =   169 bits (428),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 153/583 (26%), Positives = 262/583 (45%), Gaps = 58/583 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDGKESPRELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  +++  + W GK+TT   E   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNSLKEEGGLYKDKELEAA--IAWQGKLTTHKEEAYPKNPNLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG        +G+   S     +   +   E+ ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGVWRAKSIQNGKGPPSVIHATNPKPLIPTEDSIRVWSDFLRVHLHPRSICVIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   V+ + +  PG ++  + QK NI + L+ A     L ++S    P
Sbjct  242   GAKTAELLQDEYSGRGVITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLTAYSSFTCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      +    +     Q     P++ SA+ A+AL +++ P+R+            S
Sbjct  300   LSLGGNLGLRPKPPVSFPYLQYDATLPFHCSAILATALDTVTAPYRLH-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLD--NFVSLTP--EVEQD  774
               ++M  +  +L+   R+  V T +  +P P + G  +   L+        TP       
Sbjct  349   SPVSMAHLADLLSFSGRK--VVTAEAIIPFPLVPGQSLPDILMQVGGATPWTPLSACGDP  406

Query  773   NEDMHAMECMTIHGV--------LGSGSRRAPVYEVKRTVQDAYEKAI--SRPKFSHLSV  624
                +   + + + G+        L  G+          + ++   + +   RP     S 
Sbjct  407   TGTLCFAQSVVLRGIDSACHTSKLTPGTPLPSALHACASGEEVLAQYLQQQRPSVLSSSH  466

Query  623   SccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAILPFL  444
                      P      +S  Q G  L++P   T       V SIP+   LRSS+++   L
Sbjct  467   LLLTPCRVAPPYPHLFSSFSQKGVALDSPPKGT------AVQSIPVFGALRSSSSLHQTL  520

Query  443   ESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLV  315
                 E L +L ++R A         G  +D++E+L + L  L 
Sbjct  521   GGLAEELTRLDLRRWA----SFMDTGMEQDDMEELLQELHSLA  559



>ref|XP_001374376.2| PREDICTED: protein misato homolog 1-like [Monodelphis domestica]
Length=573

 Score =   169 bits (428),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/406 (30%), Positives = 204/406 (50%), Gaps = 40/406 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHG-LAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD   G LA + E+  +  L  DVLYR+G+T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRLAGTKEL--SGELCPDVLYRAGQTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N FLQ+L   
Sbjct  64    TPRLILMDLKGSLNSLKQEGGLYQDK--HLDAAIAWQGKLTTHKEELQAKNPFLQNLLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEI---QDKDIVECLENGVQYWTDFSKVQFHPQSL  1470
             E  M+  DG       P+G+      +      K ++   E  ++ W+DF  VQ HP+S+
Sbjct  122   EGVMSS-DGVWRVQTFPNGKGLPPLTKAFLPTPKSLIPP-EGSIKVWSDFLHVQLHPRSI  179

Query  1469  YQLSGLWMDAQEF---NYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGG  1299
               +     D +      +G G          EEL +RL F++EECD++QG Q + D   G
Sbjct  180   CIIQKYNHDGEAGRLEGFGQGESLLREPTYLEELEDRLHFYVEECDYLQGFQILCDLHDG  239

Query  1298  FSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSK  1119
             FSGL A+  + + D+Y+   +L + +  PG +   + QK N  +  + A+    +A+ S 
Sbjct  240   FSGLGAKATELLQDEYAGRGILTWGLL-PGPYTLGEPQK-NFYRLFNTALGLVNMAAHSS  297

Query  1118  LIVPIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAES  954
              + P+ L      +    +     +     PY++SA+ A+ L ++++P+R+         
Sbjct  298   FVCPLSLGGGLGLRPEPPVTFPHLRYDVTLPYHSSALLATVLDTITVPYRL---------  348

Query  953   IYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL  816
                S  ++M  +  +L+   R+  V T   S+P P   G+ +  +L
Sbjct  349   --CSSPISMVHLADMLSFSGRK--VVTAGASIPFPVAPGHSLPDTL  390



>ref|XP_004589070.1| PREDICTED: protein misato homolog 1 [Ochotona princeps]
Length=573

 Score =   169 bits (428),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 122/404 (30%), Positives = 197/404 (49%), Gaps = 37/404 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L   A+  E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALDRSADPKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +  SQ    + W GK+TT   EP  +N +LQ L + 
Sbjct  64    TPRLILMDLKGSLSSLQE-GGLYRD--SQLEAAIAWQGKLTTHQEEPDPKNPYLQEL-VS  119

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
              K +   DG       P  +         +      +E  V  W+DF +V  HP+S+  +
Sbjct  120   AKGVLSSDGVWRVRCVPRDKGPPPVPMAPEPQPPPPMEGSVTVWSDFLRVHLHPRSICMI  179

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  E L +RL F++EECD++QG Q + D   GFSG
Sbjct  180   HKYNHDGEAGRLEAFGQGESVLREPRYLEMLEDRLHFYVEECDYLQGFQILCDLHDGFSG  239

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +     QK NI + L+ A   + L + S L+ 
Sbjct  240   VGAKAAELLQDEYSGRGIIAWGLL-PGPYNLGDPQK-NIYRLLNTAFGLTHLTASSSLVC  297

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +           P++ SA+ A+AL +L+ P+R+            
Sbjct  298   PLSLGGSLGLRPEPPVTFPSLHYDAALPFHCSAILATALDTLTTPYRLR-----------  346

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
             S  + M  + H+L+   R+  V+T   S+P P + G  +  SL+
Sbjct  347   SSPVPMVHLAHMLSCSGRK--VATAGASIPFPWVPGQCLPDSLM  388



>gb|EDL15244.1| misato homolog 1 (Drosophila), isoform CRA_a [Mus musculus]
Length=521

 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 193/392 (49%), Gaps = 36/392 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G    DE      L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPG-ELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   GNLY ++  Q    + W GK++T   +   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGNLYRDR--QLEAAVAWQGKLSTHREDAQPKNPNLQGLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQ-DKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
                        R SD     +  ++I    EN ++ W+DF +V  HP+S+  +     D 
Sbjct  123   GV---------RSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSICVIHKYHHDG  173

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  +
Sbjct  174   ETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHDGFSGVGAKTAE  233

Query  1268  NIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssl  1089
              + D+Y+   VL + +  PG ++  + QK NI + L+ A     L  +S  + P+ L   
Sbjct  234   LLQDEYAGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLTGYSSFVCPLSLGGN  291

Query  1088  saskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
                +    +           P++ SA+ A+AL ++++P+R+            S  + M 
Sbjct  292   LGLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLR-----------SSMVTMA  340

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQV  828
              +  VL+   ++  V T +  +P P + G  +
Sbjct  341   HLADVLSFSGKK--VVTAEAIIPFPLVRGQSL  370



>ref|NP_659147.2| protein misato homolog 1 [Mus musculus]
Length=556

 Score =   168 bits (426),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 193/392 (49%), Gaps = 36/392 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G    DE      L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPG-ELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   GNLY ++  Q    + W GK++T   +   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGNLYRDR--QLEAAVAWQGKLSTHRDDAQPKNPNLQGLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQ-DKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
                        R SD     +  ++I    EN ++ W+DF +V  HP+S+  +     D 
Sbjct  123   GV---------RSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSICVIHKYHHDG  173

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  +
Sbjct  174   ETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHDGFSGVGAKTAE  233

Query  1268  NIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssl  1089
              + D+Y+   VL + +  PG ++  + QK NI + L+ A     L  +S  + P+ L   
Sbjct  234   LLQDEYAGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLTGYSSFVCPLSLGGN  291

Query  1088  saskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
                +    +           P++ SA+ A+AL ++++P+R+            S  + M 
Sbjct  292   LGLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLR-----------SSMVTMA  340

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQV  828
              +  VL+   ++  V T +  +P P + G  +
Sbjct  341   HLADVLSFSGKK--VVTAEAIIPFPLVRGQSL  370



>gb|AAH08103.1| Misato homolog 1 (Drosophila) [Mus musculus]
 gb|EDL15245.1| misato homolog 1 (Drosophila), isoform CRA_b [Mus musculus]
Length=556

 Score =   168 bits (426),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 193/392 (49%), Gaps = 36/392 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G    DE      L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPG-ELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   GNLY ++  Q    + W GK++T   +   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGNLYRDR--QLEAAVAWQGKLSTHREDAQPKNPNLQGLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQ-DKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
                        R SD     +  ++I    EN ++ W+DF +V  HP+S+  +     D 
Sbjct  123   GV---------RSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSICVIHKYHHDG  173

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  +
Sbjct  174   ETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHDGFSGVGAKTAE  233

Query  1268  NIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssl  1089
              + D+Y+   VL + +  PG ++  + QK NI + L+ A     L  +S  + P+ L   
Sbjct  234   LLQDEYAGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLTGYSSFVCPLSLGGN  291

Query  1088  saskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
                +    +           P++ SA+ A+AL ++++P+R+            S  + M 
Sbjct  292   LGLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLR-----------SSMVTMA  340

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQV  828
              +  VL+   ++  V T +  +P P + G  +
Sbjct  341   HLADVLSFSGKK--VVTAEAIIPFPLVRGQSL  370



>ref|XP_005367183.1| PREDICTED: protein misato homolog 1-like isoform X2 [Microtus 
ochrogaster]
Length=553

 Score =   168 bits (426),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 123/406 (30%), Positives = 192/406 (47%), Gaps = 42/406 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHG-LAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD   G   E D       L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGPRTEGDS--SPGELCPDVLYRAGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E   +N  LQ L   
Sbjct  64    TPRLILMDLKGSLNSLKEEGGLYKDR--QLEAAVAWQGKLTTHREEEYPKNPNLQDLLSA  121

Query  1619  EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
             E  +N  DG            + K I    ENGV+ W+DF +V  HP+S+  +     D 
Sbjct  122   EGVLN-TDG----------VWRTKPIQNGKENGVRVWSDFLRVHLHPRSICVIHKYNHDG  170

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  +
Sbjct  171   ETGRLEAFGQGEGILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKTAE  230

Query  1268  NIADDYSNVPVLLYTVRS-PGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlss  1092
              + D+YS   V+ + +   P S    + +   I + L+ A     L  +S  + P+ L  
Sbjct  231   LLQDEYSGRGVITWGLLPVPSSLGEPQKK---IYRLLNTAFGLVHLTGYSSFVCPLSLGG  287

Query  1091  lsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNM  927
                 +    +   D       P++ SA+ A+AL +++ PFR+            S  + M
Sbjct  288   HLGLRPKPPVSFPDLHYDATLPFHCSAILATALDTVTAPFRLR-----------SSMVPM  336

Query  926   YEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSLTP  789
               +  +L+   R+  V T +  +P P L   Q    +L      TP
Sbjct  337   AHLADLLSFSGRK--VVTAEAVIPFP-LDPGQALPDILGQLGGTTP  379



>sp|Q2YDW2.1|MSTO1_MOUSE RecName: Full=Protein misato homolog 1 [Mus musculus]
 gb|AAI08355.1| Misato homolog 1 (Drosophila) [Mus musculus]
Length=556

 Score =   168 bits (426),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 193/392 (49%), Gaps = 36/392 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G    DE      L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPG-ELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   GNLY ++  Q    + W GK++T   +   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGNLYRDR--QLEAAVAWQGKLSTHREDAHPKNPNLQGLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQ-DKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
                        R SD     +  ++I    EN ++ W+DF +V  HP+S+  +     D 
Sbjct  123   GV---------RSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSICVIHKYHHDG  173

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  +
Sbjct  174   ETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHDGFSGVGAKTAE  233

Query  1268  NIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssl  1089
              + D+Y+   VL + +  PG ++  + QK NI + L+ A     L  +S  + P+ L   
Sbjct  234   LLQDEYAGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLTGYSSFVCPLSLGGN  291

Query  1088  saskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
                +    +           P++ SA+ A+AL ++++P+R+            S  + M 
Sbjct  292   LGLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLR-----------SSMVTMA  340

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQV  828
              +  VL+   ++  V T +  +P P + G  +
Sbjct  341   HLADVLSFSGKK--VVTAEAIIPFPLVRGQSL  370



>ref|XP_005411667.1| PREDICTED: protein misato homolog 1 isoform X1 [Chinchilla lanigera]
Length=571

 Score =   168 bits (425),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 160/596 (27%), Positives = 273/596 (46%), Gaps = 75/596 (13%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D   ++  L  DVLYR G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-RTTDAPERSGELCPDVLYRRGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPL-KRNLFLQSLYME  1620
             PRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E +  +N +LQ     
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDR--QLDAAIAWQGKLTTHKEEEIYPKNPYLQDFQSA  122

Query  1619  EKNMN-----MVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             E  ++     +   P+G+       + +   +      ++ W+DF +V  HP+S+  +  
Sbjct  123   EGVLSNGIWRIKSIPNGKGPPPVTSVSNPKPLIPTVGSIRVWSDFLRVHLHPRSICLIQK  182

Query  1454  LWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
                D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ 
Sbjct  183   YNHDGETGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVG  242

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
              +  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     L + S  + P+
Sbjct  243   TKVAELLQDEYSGRGIITWGLL-PGPYSVGEPQK-NIYRLLNTAFGLVHLTASSSFVCPL  300

Query  1103  GlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASG  939
              LS     +    +           P++ SA+ A+AL +++ P+R+            S 
Sbjct  301   SLSGSLGLRPQPPVNFPYLHYDATLPFHCSAILATALDTVTAPYRLR-----------SS  349

Query  938   ALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVE-QDN  771
              ++M  +  +L+   ++  V T +  +P P + G     SL D  V L   TP       
Sbjct  350   PVSMVRLADMLSCSGKK--VVTAEAIIPFPWVPGQ----SLPDTLVQLGGSTPWTSLSAC  403

Query  770   EDMHAMEC----MTIHGV--------------LGSGSRRAPVYE--VKRTVQDAYEKAIS  651
              D     C    + + GV              L S     P  E  + + +Q+   + IS
Sbjct  404   GDPSGTRCFAQSVVLRGVDKASHTSWLPPGTALPSPLHACPTGEEVLAQYLQEQQPRVIS  463

Query  650   RPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLR  471
                 SHL ++ C +  P P      +S GQ G +   P+     +      SIP+   LR
Sbjct  464   S---SHLLLAPCRVAPPYPHFFS--SSFGQQGVVPSCPLRSEAGQ------SIPVFGALR  512

Query  470   SSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLK  303
             SS+++   L S  + L +L ++R    A  LE+ G  +D+VE+L + L  L    +
Sbjct  513   SSSSLHQTLRSLAKELTQLDLRR---WASFLEA-GVEQDDVEELLQELHSLAQCYR  564



>dbj|BAE38651.1| unnamed protein product [Mus musculus]
Length=556

 Score =   167 bits (424),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 193/391 (49%), Gaps = 34/391 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G    DE      L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPG-ELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL ++   GNLY ++  Q    + W GK++T   +   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNTLKEEGNLYRDR--QLEAAVAWQGKLSTHREDAHPKNPNLQGLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQ  1437
                  V   DG    +      ++I    EN ++ W+DF +V  HP+S+  +     D +
Sbjct  123   G----VRSSDG----AWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSICVIHKYHHDGE  174

Query  1436  EFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
                   +G G       +  EEL +RL F++EECD++QG Q + D   GFSG++A+  + 
Sbjct  175   TGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHDGFSGVSAKTAEL  234

Query  1265  IADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssls  1086
             + D+Y+   VL + +  PG ++  + QK NI + L+ A     L  +S  + P+ L    
Sbjct  235   LQDEYAGRGVLTWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHLTGYSSFVCPLSLGGNL  292

Query  1085  askasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
               +    +           P++ SA+ A+AL ++++P+R+            S  + M  
Sbjct  293   GLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLR-----------SSMVTMAH  341

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQV  828
             +  VL+   ++  V T +  +P P   G  +
Sbjct  342   LADVLSFSGKK--VVTAEAIIPFPLARGQSL  370



>ref|XP_007946803.1| PREDICTED: protein misato homolog 1 [Orycteropus afer afer]
Length=568

 Score =   167 bits (424),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 199/409 (49%), Gaps = 40/409 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-RPTDASDPAEELCPDVLYRTGRTLHGQDTYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYKDK--QLDAAIAWQGKLTTHREELCPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+        +  + +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGVWRVKSTPNGKGLLPLTTAETPNPLIPTEGSIRVWSDFLRVHLHPRSICMIH  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G          EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPGYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + +K +I + L+ A     L + S L+ P
Sbjct  242   GAKTAELLQDEYSGRGIISWGLL-PGPYTLEEPRK-SIYRLLNTAFGLVHLTAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             + L      K    +           P++ SA+ A+AL ++++P+R+            S
Sbjct  300   LSLGGSLGLKPEPPVIFPHLHYDATLPFHCSAILATALDTVTVPYRLH-----------S  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
               ++M  +  +L    ++  V+T   ++P PS        SL D  V L
Sbjct  349   SPVSMVHLAEMLNFSGKK--VATAGATIPFPS------DQSLPDTLVQL  389



>ref|XP_008695223.1| PREDICTED: protein misato homolog 1, partial [Ursus maritimus]
Length=571

 Score =   167 bits (424),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/347 (29%), Positives = 179/347 (52%), Gaps = 21/347 (6%)
 Frame = -2

Query  1973  EIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYTP  1794
             E++T+Q+G ++ F+G+H+WN QD     A +D       L  DVLYR+G T  G  TYTP
Sbjct  7     EVLTLQLGHFAGFVGAHWWNQQDAAL-CAPTDAKEPPGELCPDVLYRAGRTPHGQETYTP  65

Query  1793  RLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEEK  1614
             RL+ +  +GSL S+   G LY ++  Q    + W G +TT   E   +N +LQ L   E 
Sbjct  66    RLILMDLKGSLSSLKQEGGLYGDR--QLDAAIAWQGNLTTHKEELYPQNPYLQDLLSAEG  123

Query  1613  NMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
              ++  DG       P+G+            ++   E+ ++ W+DF +V  HP+S+  +  
Sbjct  124   VLSS-DGIWRVKSIPNGKGPPPLTAAIAPKLLIPTESSIRVWSDFLRVHLHPRSICMIQK  182

Query  1454  LWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
                D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ 
Sbjct  183   YNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVG  242

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A   + +++ S L+ P+
Sbjct  243   AKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLAHMSAHSSLVCPL  300

Query  1103  GlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
              L      +    +           P++ +A+ A+AL ++++P+R+ 
Sbjct  301   SLGGSLGLRPEPPVTFPHLHYDATLPFHCAAILATALDTVTVPYRLR  347



>ref|XP_005610090.1| PREDICTED: protein misato homolog 1 isoform X4 [Equus caballus]
Length=559

 Score =   167 bits (423),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/410 (30%), Positives = 203/410 (50%), Gaps = 40/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  +N  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGPPLLTAATTPKPLIPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ S L+ 
Sbjct  241   VGAKATELLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +  +L    ++  V T   ++P P L  NQ   SL D  V L
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQL  391



>ref|XP_001494865.1| PREDICTED: protein misato homolog 1 isoform X1 [Equus caballus]
Length=571

 Score =   167 bits (424),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/410 (30%), Positives = 203/410 (50%), Gaps = 40/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  +N  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGPPLLTAATTPKPLIPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ S L+ 
Sbjct  241   VGAKATELLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +  +L    ++  V T   ++P P L  NQ   SL D  V L
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQL  391



>ref|XP_005610089.1| PREDICTED: protein misato homolog 1 isoform X3 [Equus caballus]
Length=570

 Score =   167 bits (423),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/410 (30%), Positives = 203/410 (50%), Gaps = 40/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  +N  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGPPLLTAATTPKPLIPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ S L+ 
Sbjct  241   VGAKATELLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +  +L    ++  V T   ++P P L  NQ   SL D  V L
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQL  391



>ref|XP_008515003.1| PREDICTED: protein misato homolog 1 isoform X2 [Equus przewalskii]
Length=579

 Score =   167 bits (424),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 165/601 (27%), Positives = 278/601 (46%), Gaps = 81/601 (13%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  +N  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGPPLLTTATTPKPLIPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ S L+ 
Sbjct  241   VGAKATELLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVE-Q  777
             S  ++M  +  +L    ++  V T   ++P P L  NQ   SL D  V L   TP     
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQLGGATPWTPLS  401

Query  776   DNEDMHAMEC----MTIHGV----------LGSGSRRAPVYEVKRTV-----------QD  672
                D   + C    + + G+          L SGS+  P   +   +           Q 
Sbjct  402   ACGDPSGIRCFAQSVVLRGLDKACHTRWFWLCSGSQLTPGTPLPSPLHACTTGEEVLAQY  461

Query  671   AYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSI  492
               ++  S    SHL ++ C +  P P+     +S+ Q G LL+ P T         V SI
Sbjct  462   LQQQQPSVRSSSHLLLTPCKVVPPYPYLFS--SSLSQQGLLLDGPPTGA------AVESI  513

Query  491   PMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVN  312
             P+   L SS+++   L    + L KL ++R    A  L++ G  +D++E++ + L  L  
Sbjct  514   PVLGALCSSSSLNKTLGDLAKELTKLNLRR---WASFLDA-GVEQDDLEEVLQELCSLAQ  569

Query  311   T  309
              
Sbjct  570   C  570



>ref|XP_008515005.1| PREDICTED: protein misato homolog 1 isoform X4 [Equus przewalskii]
Length=571

 Score =   167 bits (423),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/410 (30%), Positives = 203/410 (50%), Gaps = 40/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  +N  DG       P+G+             +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGPPLLTTATTPKPLIPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ S L+ 
Sbjct  241   VGAKATELLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+            
Sbjct  299   PLSLGGSLGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR-----------  347

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +  +L    ++  V T   ++P P L  NQ   SL D  V L
Sbjct  348   SSPVSMVHLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQL  391



>ref|XP_008515006.1| PREDICTED: protein misato homolog 1 isoform X5 [Equus przewalskii]
Length=562

 Score =   167 bits (422),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 165/594 (28%), Positives = 276/594 (46%), Gaps = 84/594 (14%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
             E  +N         SD    +  K I    E  ++ W+DF +V  HP+S+  +     D 
Sbjct  122   EGVLN---------SDGIWRV--KSIPNGKEGSIRVWSDFLRVHLHPRSICMIQKYNHDG  170

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  +
Sbjct  171   EAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHNGFSGVGAKATE  230

Query  1268  NIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI---Gl  1098
              + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ S L+ P+   G 
Sbjct  231   LLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAHSSLVCPLSLGGS  288

Query  1097  sslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
               L          ++ +   P++ SA+ A+AL ++++P+R+            S  ++M 
Sbjct  289   LGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR-----------SSPVSMV  337

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVE-QDNEDMHA  756
              +  +L    ++  V T   ++P P L  NQ   SL D  V L   TP        D   
Sbjct  338   HLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQLGGATPWTPLSACGDPSG  391

Query  755   MEC----MTIHGV----------LGSGSRRAPVYEVKRTV-----------QDAYEKAIS  651
             + C    + + G+          L SGS+  P   +   +           Q   ++  S
Sbjct  392   IRCFAQSVVLRGLDKACHTRWFWLCSGSQLTPGTPLPSPLHACTTGEEVLAQYLQQQQPS  451

Query  650   RPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLR  471
                 SHL ++ C +  P P+     +S+ Q G LL+ P T         V SIP+   L 
Sbjct  452   VRSSSHLLLTPCKVVPPYPYLFS--SSLSQQGLLLDGPPTGA------AVESIPVLGALC  503

Query  470   SSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNT  309
             SS+++   L    + L KL ++R    A  L++ G  +D++E++ + L  L   
Sbjct  504   SSSSLNKTLGDLAKELTKLNLRR---WASFLDA-GVEQDDLEEVLQELCSLAQC  553



>ref|XP_006001695.1| PREDICTED: protein misato homolog 1 [Latimeria chalumnae]
Length=555

 Score =   166 bits (421),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 198/407 (49%), Gaps = 41/407 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHS--LNTDVLYRSGETQQGLLT  1803
             RE+VT+Q+G Y+NF+G+H+WN QD        D   KN    +  DVL+R G TQ G  T
Sbjct  6     REVVTVQLGHYANFVGTHWWNLQDASFCY---DLELKNQCNEIRNDVLFREGLTQTGQQT  62

Query  1802  YTPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYM  1623
             YTPRL+ +  +GSL ++   G LY +   +    LTW G V T   EP+ +N FL+ L  
Sbjct  63    YTPRLILMDVKGSLNTLKQDGCLYDD--GKQDTALTWKGTVATHREEPVVKNPFLKDLDH  120

Query  1622  EE----KNMNMVDGPDGRESDSHNEIQDKDIVEC------LENGVQYWTDFSKVQFHPQS  1473
              E     +  M    DG        + D  ++E       LE  V+ W+DF +V  HP++
Sbjct  121   RELYGDGDFQMQTLRDGNTGIPQVHV-DNGLLELPRKVYRLETSVRVWSDFLRVHLHPRT  179

Query  1472  LYQLSGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSG  1302
             +  +     D +      +G GR  F      +EL +RL F++EECD++QG Q + D   
Sbjct  180   ISLIQQYNHDGETSRLEAFGQGRSLFKEPAFLDELEDRLHFYVEECDYLQGFQVLCDLQD  239

Query  1301  GFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFS  1122
             GFSG++++ ++++ D+Y    +  + +    +    +S    + + ++  +   +L+S S
Sbjct  240   GFSGVSSKVVEHLHDEYGRKGIFTWGLTP--TLQPKRSVAKEVYRLINTVLGIVQLSSQS  297

Query  1121  KLIVPIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAE  957
              L  P+ L+S    +                 Y+TSA+ A+AL S++LP+R+        
Sbjct  298   SLFCPLSLNSNLGRQTLPPTSFPHVNYDASLNYHTSALLATALESMTLPYRLH-------  350

Query  956   SIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSL  816
                 S ++ M ++   L    R+  V T   S+P P   G+ +  +L
Sbjct  351   ----SASVTMSQLAEALTFSGRK--VVTSWASVPFPMKDGDSLPDAL  391



>ref|XP_005367184.1| PREDICTED: protein misato homolog 1-like isoform X3 [Microtus 
ochrogaster]
Length=552

 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/346 (32%), Positives = 173/346 (50%), Gaps = 25/346 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHG-LAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD   G   E D       L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGPRTEGDS--SPGELCPDVLYRAGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E   +N  LQ L   
Sbjct  64    TPRLILMDLKGSLNSLKEEGGLYKDR--QLEAAVAWQGKLTTHREEEYPKNPNLQDLLSA  121

Query  1619  EKNMNMVDGPDG--RESDSHNEIQDKDI--VECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             E  +N     DG  R     N   +  +  +   ENGV+ W+DF +V  HP+S+  +   
Sbjct  122   EGVLNT----DGVWRTKPIQNGKGEAVLPTISPTENGVRVWSDFLRVHLHPRSICVIHKY  177

Query  1451  WMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
               D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A
Sbjct  178   NHDGETGRLEAFGQGEGILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGA  237

Query  1280  EFLQNIADDYSNVPVLLYTVRS-PGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             +  + + D+YS   V+ + +   P S    + +   I + L+ A     L  +S  + P+
Sbjct  238   KTAELLQDEYSGRGVITWGLLPVPSSLGEPQKK---IYRLLNTAFGLVHLTGYSSFVCPL  294

Query  1103  GlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRM  981
              L      +    +   D       P++ SA+ A+AL +++ PFR+
Sbjct  295   SLGGHLGLRPKPPVSFPDLHYDATLPFHCSAILATALDTVTAPFRL  340



>gb|EPY88673.1| protein misato 1-like protein [Camelus ferus]
Length=560

 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/372 (30%), Positives = 184/372 (49%), Gaps = 45/372 (12%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPLGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   EP  +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEEPYPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLY---  1467
               ++  DG       P+GR             +   E  ++ W+DF +V  HP+S+    
Sbjct  123   GVLSS-DGIWRVKSIPNGRGPPPCTTAATLKPLIPAEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1466  ---------QLSGL--------WM------DAQEFN-YGIGRDTFHNHQRGEELNERLRF  1359
                      Q+ G+        W+      +A     +G G       +  EEL +RL F
Sbjct  182   KYNHDGCVEQVEGIDVGEPCKSWIGFTHGREAGRLEAFGQGESILKEPKYLEELEDRLHF  241

Query  1358  FIEECDHIQGVQFIVDDSGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKL  1179
             ++EECD++QG Q + D   GFSG+ A+  + + D+YS   ++ + +  PG +   + QK 
Sbjct  242   YVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGRGIITWGLL-PGPYCLGEPQK-  299

Query  1178  NISQSLHNAVSFSRLASFSKLIVPI---GlsslsaskasrrLCIKDEQ--PYYTSAVYAS  1014
             NI + L+ A     L++ S L+ P+   G   L          ++ +   P++ SA+ A+
Sbjct  300   NIYRLLNTAFGLVNLSAHSSLVCPLSLGGSLGLRQEPPVNFPYLRYDAALPFHCSAILAT  359

Query  1013  ALHSLSLPFRME  978
             AL ++++P+R+ 
Sbjct  360   ALDTVTVPYRLR  371



>ref|XP_005367182.1| PREDICTED: protein misato homolog 1-like isoform X1 [Microtus 
ochrogaster]
Length=564

 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/347 (32%), Positives = 173/347 (50%), Gaps = 25/347 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHG-LAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD   G   E D       L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGPRTEGDS--SPGELCPDVLYRAGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E   +N  LQ L   
Sbjct  64    TPRLILMDLKGSLNSLKEEGGLYKDR--QLEAAVAWQGKLTTHREEEYPKNPNLQDLLSA  121

Query  1619  EKNMNMVDGPDG--RESDSHNEIQDKDI--VECLENGVQYWTDFSKVQFHPQSLYQLSGL  1452
             E  +N     DG  R     N   +  +  +   ENGV+ W+DF +V  HP+S+  +   
Sbjct  122   EGVLNT----DGVWRTKPIQNGKGEAVLPTISPTENGVRVWSDFLRVHLHPRSICVIHKY  177

Query  1451  WMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAA  1281
               D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A
Sbjct  178   NHDGETGRLEAFGQGEGILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGA  237

Query  1280  EFLQNIADDYSNVPVLLYTVRS-PGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
             +  + + D+YS   V+ + +   P S    + +   I + L+ A     L  +S  + P+
Sbjct  238   KTAELLQDEYSGRGVITWGLLPVPSSLGEPQKK---IYRLLNTAFGLVHLTGYSSFVCPL  294

Query  1103  GlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
              L      +    +   D       P++ SA+ A+AL +++ PFR+ 
Sbjct  295   SLGGHLGLRPKPPVSFPDLHYDATLPFHCSAILATALDTVTAPFRLR  341



>ref|NP_001231563.1| uncharacterized protein LOC100525162 [Sus scrofa]
Length=570

 Score =   166 bits (420),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 174/348 (50%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLGAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+             +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGIWRVKPIPNGKGPPPFTTTTAPKPLIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  E L +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPKYLEALEDRLHFYVEECDYLQGFQVLCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL +++ P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPHLQYDAALPFHCGAILATALDTVTAPYRLR  347



>ref|XP_005610088.1| PREDICTED: protein misato homolog 1 isoform X2 [Equus caballus]
 ref|XP_008515004.1| PREDICTED: protein misato homolog 1 isoform X3 [Equus przewalskii]
Length=574

 Score =   166 bits (420),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 123/415 (30%), Positives = 209/415 (50%), Gaps = 47/415 (11%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEI-----QDKDIVECLENGVQYWTDFSKVQFHPQ  1476
             E  +N  DG       P+G+   S +       Q +++ +  E  ++ W+DF +V  HP+
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGEASPDTAGWGTGQSRNMEK--EGSIRVWSDFLRVHLHPR  178

Query  1475  SLYQLSGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDS  1305
             S+  +     D +      +G G       +  EEL +RL F++EECD++QG Q + D  
Sbjct  179   SICMIQKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLH  238

Query  1304  GGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASF  1125
              GFSG+ A+  + + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ 
Sbjct  239   NGFSGVGAKATELLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAH  296

Query  1124  SKLIVPI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTA  960
             S L+ P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+       
Sbjct  297   SSLVCPLSLGGSLGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR------  350

Query  959   ESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
                  S  ++M  +  +L    ++  V T   ++P P L  NQ   SL D  V L
Sbjct  351   -----SSPVSMVHLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQL  394



>ref|XP_005663349.1| PREDICTED: uncharacterized protein LOC100525162 isoform X1 [Sus 
scrofa]
Length=571

 Score =   166 bits (420),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 174/348 (50%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLGAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+             +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGIWRVKPIPNGKGPPPFTTTTAPKPLIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  E L +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPKYLEALEDRLHFYVEECDYLQGFQVLCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL +++ P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPHLQYDAALPFHCGAILATALDTVTAPYRLR  347



>ref|XP_008515002.1| PREDICTED: protein misato homolog 1 isoform X1 [Equus przewalskii]
Length=582

 Score =   166 bits (420),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 167/606 (28%), Positives = 284/606 (47%), Gaps = 88/606 (15%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  L+   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALYRPTDAKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+   G LY +K       + W GK+TT   E   +N +LQ     
Sbjct  64    TPRLILMDLKGSLSSLKQEGGLYRDK--HLDAAIAWQGKLTTHKEELYPKNPYLQDFLSA  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEI-----QDKDIVECLENGVQYWTDFSKVQFHPQ  1476
             E  +N  DG       P+G+   S +       Q +++ +  E  ++ W+DF +V  HP+
Sbjct  122   EGVLNS-DGIWRVKSIPNGKGEASPDTAGWGTGQSRNMEK--EGSIRVWSDFLRVHLHPR  178

Query  1475  SLYQLSGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDS  1305
             S+  +     D +      +G G       +  EEL +RL F++EECD++QG Q + D  
Sbjct  179   SICMIQKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLH  238

Query  1304  GGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASF  1125
              GFSG+ A+  + + D+YS   ++ + +  PG ++  + QK +I + L+ A     L++ 
Sbjct  239   NGFSGVGAKATELLKDEYSGRGIITWGLL-PGPYSLREPQK-DIYRLLNTAFGLVHLSAH  296

Query  1124  SKLIVPI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTA  960
             S L+ P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+       
Sbjct  297   SSLVCPLSLGGSLGLRPEPPVHFPHLRYDATLPFHCSAILATALDTVTVPYRLR------  350

Query  959   ESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TP  789
                  S  ++M  +  +L    ++  V T   ++P P L  NQ   SL D  V L   TP
Sbjct  351   -----SSPVSMVHLADMLNFSGKK--VVTAGATIPFP-LVPNQ---SLPDTLVQLGGATP  399

Query  788   EVE-QDNEDMHAMEC----MTIHGV----------LGSGSRRAPVYEVKRTV--------  678
                     D   + C    + + G+          L SGS+  P   +   +        
Sbjct  400   WTPLSACGDPSGIRCFAQSVVLRGLDKACHTRWFWLCSGSQLTPGTPLPSPLHACTTGEE  459

Query  677   ---QDAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPL  507
                Q   ++  S    SHL ++ C +  P P+     +S+ Q G LL+ P T        
Sbjct  460   VLAQYLQQQQPSVRSSSHLLLTPCKVVPPYPYLFS--SSLSQQGLLLDGPPTGA------  511

Query  506   EVHSIPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETL  327
              V SIP+   L SS+++   L    + L KL ++R    A  L++ G  +D++E++ + L
Sbjct  512   AVESIPVLGALCSSSSLNKTLGDLAKELTKLNLRR---WASFLDA-GVEQDDLEEVLQEL  567

Query  326   SKLVNT  309
               L   
Sbjct  568   CSLAQC  573



>ref|XP_005411670.1| PREDICTED: protein misato homolog 1 isoform X4 [Chinchilla lanigera]
Length=554

 Score =   166 bits (419),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 161/591 (27%), Positives = 270/591 (46%), Gaps = 82/591 (14%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D   ++  L  DVLYR G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-RTTDAPERSGELCPDVLYRRGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPL-KRNLFLQSLYME  1620
             PRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E +  +N +LQ     
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDR--QLDAAIAWQGKLTTHKEEEIYPKNPYLQDFQSA  122

Query  1619  EKNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDA  1440
             E  +            S+   + K I     + ++ W+DF +V  HP+S+  +     D 
Sbjct  123   EGVL------------SNGIWRIKSIPNGKGDSIRVWSDFLRVHLHPRSICLIQKYNHDG  170

Query  1439  QEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQ  1269
             +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+  +  +
Sbjct  171   ETGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGTKVAE  230

Query  1268  NIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssl  1089
              + D+YS   ++ + +  PG ++  + QK NI + L+ A     L + S  + P+ LS  
Sbjct  231   LLQDEYSGRGIITWGLL-PGPYSVGEPQK-NIYRLLNTAFGLVHLTASSSFVCPLSLSGS  288

Query  1088  saskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMY  924
                +    +           P++ SA+ A+AL +++ P+R+            S  ++M 
Sbjct  289   LGLRPQPPVNFPYLHYDATLPFHCSAILATALDTVTAPYRLR-----------SSPVSMV  337

Query  923   EVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVE-QDNEDMHA  756
              +  +L+   ++  V T +  +P P + G     SL D  V L   TP        D   
Sbjct  338   RLADMLSCSGKK--VVTAEAIIPFPWVPGQ----SLPDTLVQLGGSTPWTSLSACGDPSG  391

Query  755   MEC----MTIHGV--------------LGSGSRRAPVYE--VKRTVQDAYEKAISRPKFS  636
               C    + + GV              L S     P  E  + + +Q+   + IS    S
Sbjct  392   TRCFAQSVVLRGVDKASHTSWLPPGTALPSPLHACPTGEEVLAQYLQEQQPRVISS---S  448

Query  635   HLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLRSSTAI  456
             HL ++ C +  P P      +S GQ G +   P+     +      SIP+   LRSS+++
Sbjct  449   HLLLAPCRVAPPYPHFFS--SSFGQQGVVPSCPLRSEAGQ------SIPVFGALRSSSSL  500

Query  455   LPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLK  303
                L S  + L +L ++R    A  LE+ G  +D+VE+L + L  L    +
Sbjct  501   HQTLRSLAKELTQLDLRR---WASFLEA-GVEQDDVEELLQELHSLAQCYR  547



>ref|XP_005663350.1| PREDICTED: uncharacterized protein LOC100525162 isoform X2 [Sus 
scrofa]
Length=559

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/348 (30%), Positives = 174/348 (50%), Gaps = 21/348 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD       +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CRPTDAKEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYRDK--QLDAAIAWQGKLTTHKEELYPKNPYLQDLLGAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       P+G+             +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLSS-DGIWRVKPIPNGKGPPPFTTTTAPKPLIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  E L +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGETGRLEAFGQGESILKEPKYLEALEDRLHFYVEECDYLQGFQVLCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ P
Sbjct  242   GAKAAELLQDEYSGRGIITWGLL-PGPYRLGEPQK-NIYRLLNTAFGLVHLSAHSSLVCP  299

Query  1106  IGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRME  978
             + L      +    +     Q     P++  A+ A+AL +++ P+R+ 
Sbjct  300   LSLGGSLGLRPEPPVSFPHLQYDAALPFHCGAILATALDTVTAPYRLR  347



>ref|XP_008170172.1| PREDICTED: protein misato homolog 1 isoform X3 [Chrysemys picta 
bellii]
Length=581

 Score =   165 bits (418),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/352 (31%), Positives = 174/352 (49%), Gaps = 33/352 (9%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             R  +T+Q+GSY+ F+G+H+WN QD      ES+   +   +  DVLYR+G T     TYT
Sbjct  9     RAALTLQLGSYAGFVGAHWWNLQDAALR-CESEVQEQERKICPDVLYRAGRTLSRQETYT  67

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +    +S  + W G + T   +P  +NLFLQ L   E
Sbjct  68    PRLILMDLKGSLNSLKQEGCLYGDTKIDTS--VAWQGNLMTHQEDPPAKNLFLQDLSKLE  125

Query  1616  KNMNMVDGPDGRE-------SDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               M+   G   R        S    ++        LE  V+ W+D+ +V+ HP+S++ + 
Sbjct  126   GGMSSDGGFSPRALPLSKDVSQLPTQLHVSQKGHQLEGSVRVWSDYLRVRLHPRSIFMIH  185

Query  1457  GLWMDAQEFNYGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAE  1278
                 D Q   +G G    H+    EEL +RL F++EECD++QG Q + D + GFSG+ A+
Sbjct  186   QYNDDGQLEAFGQGESLLHDPTYLEELEDRLHFYVEECDYLQGFQILCDLNNGFSGVGAK  245

Query  1277  FLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGl  1098
               + + D+YS   +L + +       N      +  + ++  +    L+S S L  P+ L
Sbjct  246   VTELLHDEYSGRGILTWGLTP--VIHNVGVSWKDFYRLMNTVLGIVHLSSHSSLFCPLSL  303

Query  1097  sslsaskasrrLCIKDEQP-------------YYTSAVYASALHSLSLPFRM  981
             +            +K E P             Y++SA+ A+AL +LS P+R+
Sbjct  304   NGSLG--------LKPEAPVTLPYVHYDASLNYHSSAILATALDTLSAPYRL  347



>ref|XP_008071434.1| PREDICTED: LOW QUALITY PROTEIN: protein misato homolog 1-like 
[Tarsius syrichta]
Length=310

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/295 (33%), Positives = 154/295 (52%), Gaps = 17/295 (6%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-ADAEEPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ V  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ L   E
Sbjct  65    PRLILVDLKGSLNSLKEEGGLYRDK--QLDAAIAWQGKLTTHTEESCPKNPYLQDLLSAE  122

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
               ++  DG       PDG+             +   E  ++ W+DF +V  HP+S+  + 
Sbjct  123   GVLS--DGVWRVKSIPDGKGPPPLTPAATPKPLTPSEGSIRVWSDFLRVHLHPRSICVIQ  180

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +E     +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  181   KYNHDGEEGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  240

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFS  1122
              A+  + + D+YS   ++ + +  PG ++  + Q+ N+ + ++ A     L S +
Sbjct  241   GAKAAELLQDEYSGRGIITWGLL-PGPYSLGEPQE-NLYRLINTAFGLPLLVSLA  293



>gb|ERE92242.1| putative protein misato isoform 1 [Cricetulus griseus]
Length=553

 Score =   164 bits (416),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 120/402 (30%), Positives = 193/402 (48%), Gaps = 41/402 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G +S F+G+H+WN QD   G     E      L  DVL+R+G T  G  TYT
Sbjct  6     REVLTLQLGHFSGFVGAHWWNQQDAALGRTTEGEESPG-ELCPDVLFRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY ++       + W GK+TT   E   +N  LQ L   E
Sbjct  65    PRLILMDLKGSLNSLKEEGGLYKDR--HPDTTVAWQGKLTTHREEAYPKNPNLQDLLSAE  122

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQ  1437
               ++  DG            + K I    EN ++ W+DF +V  HP+S+  +     D +
Sbjct  123   GVLS-TDG----------VWRAKPIENGKENIIRVWSDFLRVHLHPRSICVIQKYNHDGE  171

Query  1436  EFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
                   +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  + 
Sbjct  172   TGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKTAEL  231

Query  1265  IADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssls  1086
             + D+YS   V+ + +  PG     + QK NI + L+ A     L  +S L+ P+ L    
Sbjct  232   LQDEYSGRGVITWGLL-PGPCNLGEPQK-NIYRLLNTAFGLVHLTGYSSLVCPLSLGGNL  289

Query  1085  askasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
               +    +   +       P++ SA+ A+AL +++ P+R+            S  + M  
Sbjct  290   GLRPKPPVNFPNLHYDATLPFHCSAILATALDTVTAPYRL-----------CSSMVPMAH  338

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             +  +L+   ++  V T +  +P P + G     SL D  V L
Sbjct  339   LADLLSFSGKK--VVTAEAIIPFPLVPGQ----SLPDTLVQL  374



>ref|XP_003501626.2| PREDICTED: protein misato homolog 1 [Cricetulus griseus]
 ref|XP_007629338.1| PREDICTED: protein misato homolog 1 [Cricetulus griseus]
Length=575

 Score =   164 bits (416),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 120/402 (30%), Positives = 193/402 (48%), Gaps = 41/402 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G +S F+G+H+WN QD   G     E      L  DVL+R+G T  G  TYT
Sbjct  28    REVLTLQLGHFSGFVGAHWWNQQDAALGRTTEGEESPG-ELCPDVLFRTGRTLHGQETYT  86

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY ++       + W GK+TT   E   +N  LQ L   E
Sbjct  87    PRLILMDLKGSLNSLKEEGGLYKDR--HPDTTVAWQGKLTTHREEAYPKNPNLQDLLSAE  144

Query  1616  KNMNMVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSGLWMDAQ  1437
               ++  DG            + K I    EN ++ W+DF +V  HP+S+  +     D +
Sbjct  145   GVLS-TDG----------VWRAKPIENGKENIIRVWSDFLRVHLHPRSICVIQKYNHDGE  193

Query  1436  EFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLAAEFLQN  1266
                   +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ A+  + 
Sbjct  194   TGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKTAEL  253

Query  1265  IADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPIGlssls  1086
             + D+YS   V+ + +  PG     + QK NI + L+ A     L  +S L+ P+ L    
Sbjct  254   LQDEYSGRGVITWGLL-PGPCNLGEPQK-NIYRLLNTAFGLVHLTGYSSLVCPLSLGGNL  311

Query  1085  askasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYASGALNMYE  921
               +    +   +       P++ SA+ A+AL +++ P+R+            S  + M  
Sbjct  312   GLRPKPPVNFPNLHYDATLPFHCSAILATALDTVTAPYRL-----------CSSMVPMAH  360

Query  920   VIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             +  +L+   ++  V T +  +P P + G     SL D  V L
Sbjct  361   LADLLSFSGKK--VVTAEAIIPFPLVPGQ----SLPDTLVQL  396



>ref|XP_008153905.1| PREDICTED: protein misato homolog 1 isoform X1 [Eptesicus fuscus]
Length=569

 Score =   164 bits (416),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 107/348 (31%), Positives = 179/348 (51%), Gaps = 23/348 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  LH   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALHERTDTKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+     LY +K  Q    + W GK+TT   E   +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQESGLYRDK--QLDTAIAWQGKLTTHKEELHPKNPYLQDLLSV  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG         G+           + +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLS-SDGIWRVKSISSGKGPTPLTTAATPEPLIPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLHDEYSGRGIITWGLL-PGPYTLGEPQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRM  981
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+
Sbjct  299   PLSLGGSLGLRPEPPVNFPHLRYDATLPFHCSAILATALDTITVPYRL  346



>ref|XP_005622772.1| PREDICTED: protein misato homolog 1 isoform X1 [Canis lupus familiaris]
Length=564

 Score =   164 bits (416),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 118/410 (29%), Positives = 199/410 (49%), Gaps = 39/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD     A +D       L+ DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CAPTDAKEPPGELSPDVLYRAGRTPHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRN-LFLQSLYME  1620
             PRL+ +  +GSL S+   G LYS++  Q    + W GK+TT   E   +N  +LQ L   
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYSDR--QLDAAIAWQGKLTTHKEELCPKNPYYLQDLQSA  122

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+ + +               E  ++ W+DF  V  HP+S+  +
Sbjct  123   EGVLSS-DGIWRVKSIPNVKGAPPFTTATAPKPHVPTEGSIKVWSDFLSVHLHPRSICMI  181

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  182   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYLEECDYLQGFQILCDLHNGFSG  241

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     +++ S L+ 
Sbjct  242   VGAKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHMSAHSSLVC  299

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     +     P++  A+ A+AL +L++P+R+            
Sbjct  300   PLSLGGSLGLRPEPPVTFPHLRYDAALPFHCGAILATALDTLTVPYRLR-----------  348

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +   L    ++  V T   ++P P + G     SL D  V L
Sbjct  349   SSPVSMVHLADTLNFSGKK--VVTAAATIPFPLVPGQ----SLPDALVQL  392



>ref|XP_008153906.1| PREDICTED: protein misato homolog 1 isoform X2 [Eptesicus fuscus]
Length=558

 Score =   164 bits (416),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 107/348 (31%), Positives = 179/348 (51%), Gaps = 23/348 (7%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDE-LHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTY  1800
             RE++T+Q+G ++ F+G+H+WN QD  LH   ++ E      L  DVLYR+G T  G  TY
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALHERTDTKE--PPGELCPDVLYRTGRTLHGQETY  63

Query  1799  TPRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYME  1620
             TPRL+ +  +GSL S+     LY +K  Q    + W GK+TT   E   +N +LQ L   
Sbjct  64    TPRLILMDLKGSLSSLKQESGLYRDK--QLDTAIAWQGKLTTHKEELHPKNPYLQDLLSV  121

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG         G+           + +   E  ++ W+DF +V  HP+S+  +
Sbjct  122   EGVLS-SDGIWRVKSISSGKGPTPLTTAATPEPLIPTEGSIRVWSDFLRVHLHPRSICMI  180

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  181   QKYNHDGEAGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSG  240

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG +   + QK NI + L+ A     L++ S L+ 
Sbjct  241   VGAKAAELLHDEYSGRGIITWGLL-PGPYTLGEPQK-NIYRLLNTAFGLVHLSAHSSLVC  298

Query  1109  PI---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRM  981
             P+   G   L          ++ +   P++ SA+ A+AL ++++P+R+
Sbjct  299   PLSLGGSLGLRPEPPVNFPHLRYDATLPFHCSAILATALDTITVPYRL  346



>ref|XP_547545.3| PREDICTED: protein misato homolog 1 isoform X2 [Canis lupus familiaris]
Length=572

 Score =   164 bits (416),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 118/410 (29%), Positives = 199/410 (49%), Gaps = 39/410 (10%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD     A +D       L+ DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAAL-CAPTDAKEPPGELSPDVLYRAGRTPHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRN-LFLQSLYME  1620
             PRL+ +  +GSL S+   G LYS++  Q    + W GK+TT   E   +N  +LQ L   
Sbjct  65    PRLILMDLKGSLSSLKQEGGLYSDR--QLDAAIAWQGKLTTHKEELCPKNPYYLQDLQSA  122

Query  1619  EKNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQL  1461
             E  ++  DG       P+ + +               E  ++ W+DF  V  HP+S+  +
Sbjct  123   EGVLSS-DGIWRVKSIPNVKGAPPFTTATAPKPHVPTEGSIKVWSDFLSVHLHPRSICMI  181

Query  1460  SGLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSG  1290
                  D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG
Sbjct  182   QKYNHDGEAGRLEAFGQGESILKEPRYLEELEDRLHFYLEECDYLQGFQILCDLHNGFSG  241

Query  1289  LAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIV  1110
             + A+  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     +++ S L+ 
Sbjct  242   VGAKATELLQDEYSGRGIITWGLL-PGPYSLGEPQK-NIYRLLNTAFGLVHMSAHSSLVC  299

Query  1109  PIGlsslsaskasrrLCIKDEQ-----PYYTSAVYASALHSLSLPFRMEHPGPTAESIYA  945
             P+ L      +    +     +     P++  A+ A+AL +L++P+R+            
Sbjct  300   PLSLGGSLGLRPEPPVTFPHLRYDAALPFHCGAILATALDTLTVPYRLR-----------  348

Query  944   SGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL  795
             S  ++M  +   L    ++  V T   ++P P + G     SL D  V L
Sbjct  349   SSPVSMVHLADTLNFSGKK--VVTAAATIPFPLVPGQ----SLPDALVQL  392



>ref|XP_010346720.1| PREDICTED: protein misato homolog 1 isoform X2 [Saimiri boliviensis 
boliviensis]
Length=564

 Score =   164 bits (415),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 113/403 (28%), Positives = 198/403 (49%), Gaps = 34/403 (8%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGGA-TDAKQPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYKDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+ +             +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNDKGPPQLTTSTTPKPLIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG     ++Q+ N+ + L+ A       + S L+ P
Sbjct  242   GAKAAEMLQDEYSGRGIITWGLL-PGPCHRGEAQR-NVYRLLNTAFGLVHPTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L      +   +  +   P++ SA+ A+AL +L+ P+R+            +
Sbjct  300   LSLDGSLGLRPEPPVKFPYLHYDATLPFHHSAILATALDTLTAPYRL-----------CA  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
               ++M ++  +L+   ++  V T   ++P P   G  +  SL+
Sbjct  349   SPVSMVQLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM  389



>ref|XP_003937860.1| PREDICTED: protein misato homolog 1 isoform X1 [Saimiri boliviensis 
boliviensis]
Length=565

 Score =   164 bits (415),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 113/403 (28%), Positives = 198/403 (49%), Gaps = 34/403 (8%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D       L  DVLYR+G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGGA-TDAKQPPGELCPDVLYRTGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPLKRNLFLQSLYMEE  1617
             PRL+ +  +GSL S+   G LY +K  Q    + W GK+TT   E   +N +LQ  ++  
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYKDK--QLDAAIAWQGKLTTHKEELYPKNPYLQD-FLSA  121

Query  1616  KNMNMVDG-------PDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             + +   DG       P+ +             +   E  ++ W+DF +V  HP+S+  + 
Sbjct  122   EGVLSSDGVWRVKSIPNDKGPPQLTTSTTPKPLIPTEGSIRVWSDFLRVHLHPRSICMIQ  181

Query  1457  GLWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGL  1287
                 D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+
Sbjct  182   KYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGV  241

Query  1286  AAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVP  1107
              A+  + + D+YS   ++ + +  PG     ++Q+ N+ + L+ A       + S L+ P
Sbjct  242   GAKAAEMLQDEYSGRGIITWGLL-PGPCHRGEAQR-NVYRLLNTAFGLVHPTAHSSLVCP  299

Query  1106  I---GlsslsaskasrrLCIKDEQ--PYYTSAVYASALHSLSLPFRMEHPGPTAESIYAS  942
             +   G   L      +   +  +   P++ SA+ A+AL +L+ P+R+            +
Sbjct  300   LSLDGSLGLRPEPPVKFPYLHYDATLPFHHSAILATALDTLTAPYRL-----------CA  348

Query  941   GALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLL  813
               ++M ++  +L+   ++  V T   ++P P   G  +  SL+
Sbjct  349   SPVSMVQLADMLSFCGKK--VVTAGATIPFPLAPGQSLPDSLM  389



>ref|XP_005411668.1| PREDICTED: protein misato homolog 1 isoform X2 [Chinchilla lanigera]
Length=567

 Score =   164 bits (415),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 159/596 (27%), Positives = 272/596 (46%), Gaps = 79/596 (13%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G   +D   ++  L  DVLYR G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALG-RTTDAPERSGELCPDVLYRRGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPL-KRNLFLQSLYME  1620
             PRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E +  +N +LQ     
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDR--QLDAAIAWQGKLTTHKEEEIYPKNPYLQDFQSA  122

Query  1619  EKNMN-----MVDGPDGRESDSHNEIQDKDIVECLENGVQYWTDFSKVQFHPQSLYQLSG  1455
             E  ++     +   P+G+       + +   +      ++ W+DF +V  HP+S+  +  
Sbjct  123   EGVLSNGIWRIKSIPNGKGPPPVTSVSNPKPLIPTVGSIRVWSDFLRVHLHPRSICLIQK  182

Query  1454  LWMDAQEFN---YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDDSGGFSGLA  1284
                D +      +G G       +  EEL +RL F++EECD++QG Q + D   GFSG+ 
Sbjct  183   YNHDGETGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVG  242

Query  1283  AEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLASFSKLIVPI  1104
              +  + + D+YS   ++ + +  PG ++  + QK NI + L+ A     L + S  + P+
Sbjct  243   TKVAELLQDEYSGRGIITWGLL-PGPYSVGEPQK-NIYRLLNTAFGLVHLTASSSFVCPL  300

Query  1103  GlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPTAESIYASG  939
              LS     +    +           P++ SA+ A+AL +++ P+R+            S 
Sbjct  301   SLSGSLGLRPQPPVNFPYLHYDATLPFHCSAILATALDTVTAPYRLR-----------SS  349

Query  938   ALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---TPEVE-QDN  771
              ++M  +  +L+   ++  V T +  +P P + G     SL D  V L   TP       
Sbjct  350   PVSMVRLADMLSCSGKK--VVTAEAIIPFPWVPGQ----SLPDTLVQLGGSTPWTSLSAC  403

Query  770   EDMHAMEC----MTIHGV--------------LGSGSRRAPVYE--VKRTVQDAYEKAIS  651
              D     C    + + GV              L S     P  E  + + +Q+   + IS
Sbjct  404   GDPSGTRCFAQSVVLRGVDKASHTSWLPPGTALPSPLHACPTGEEVLAQYLQEQQPRVIS  463

Query  650   RPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHSIPMASRLR  471
                 SHL ++ C +  P P      N +G       T ++ T  +      SIP+   LR
Sbjct  464   S---SHLLLAPCRVAPPYPHFFSSNNPLGL------TFLSSTAGQ------SIPVFGALR  508

Query  470   SSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLVNTLK  303
             SS+++   L S  + L +L ++R    A  LE+ G  +D+VE+L + L  L    +
Sbjct  509   SSSSLHQTLRSLAKELTQLDLRR---WASFLEA-GVEQDDVEELLQELHSLAQCYR  560



>ref|XP_003475428.1| PREDICTED: protein misato homolog 1 isoform X1 [Cavia porcellus]
Length=570

 Score =   164 bits (415),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 162/604 (27%), Positives = 277/604 (46%), Gaps = 92/604 (15%)
 Frame = -2

Query  1976  REIVTIQVGSYSNFIGSHFWNFQDELHGLAESDEVFKNHSLNTDVLYRSGETQQGLLTYT  1797
             RE++T+Q+G ++ F+G+H+WN QD   G A +D +  +  L  DVLYR G T  G  TYT
Sbjct  6     REVLTLQLGHFAGFVGAHWWNQQDAALGRA-TDAMEPSGELCPDVLYRRGRTLHGQETYT  64

Query  1796  PRLVSVGFQGSLGSMSSCGNLYSEKPSQSSDVLTWAGKVTTQASEPL-KRNLFLQSLYME  1620
             PRL+ +  +GSL S+   G LY ++  Q    + W GK+TT   E +  +N +LQ     
Sbjct  65    PRLILMDLKGSLSSLKEEGGLYRDR--QLDTAIAWQGKLTTHKEEEVYPKNPYLQDFQSA  122

Query  1619  EKNMN-----MVDGPDGRESDSHNEIQD-KDIVECLENGVQYWTDFSKVQFHPQSLYQLS  1458
             E  ++     +   P+G+       + + K ++      ++ W+DF  V  HP+S+  + 
Sbjct  123   EGVLSNGVWRIKSIPNGKGPPPVTNVSNPKPLIPA--GSIKVWSDFLTVHLHPRSICLI-  179

Query  1457  GLWMDAQEFN----------YGIGRDTFHNHQRGEELNERLRFFIEECDHIQGVQFIVDD  1308
                   Q++N          +G G       +  EEL +RL F++EECD++QG Q + D 
Sbjct  180   ------QKYNHEGETGRLEAFGQGESILKEPRYLEELEDRLHFYVEECDYLQGFQILCDL  233

Query  1307  SGGFSGLAAEFLQNIADDYSNVPVLLYTVRSPGSFANTKSQKLNISQSLHNAVSFSRLAS  1128
               GF+G++ +  + + D+YS   ++ + +  PG     + QK NI + L+       L +
Sbjct  234   HDGFAGVSTKTAELLQDEYSGRGIITWGLL-PGPCNLGEPQK-NIYRLLNTVFGLVHLTA  291

Query  1127  FSKLIVPIGlsslsaskasrrLCIK-----DEQPYYTSAVYASALHSLSLPFRMEHPGPT  963
             +S  + P+ LS     +    +           P++ SA+ A+AL ++++P+R+      
Sbjct  292   YSSFVCPLSLSGSLGLRPQPPVNFPYLDYDATLPFHCSAILATALDTVTVPYRLR-----  346

Query  962   AESIYASGALNMYEVIHVLADQARQNMVSTLDVSMPAPSLTGNQVQGSLLDNFVSL---T  792
                   S  ++M  +  +L+   ++  V T +  +P P + G     SL D  V L   T
Sbjct  347   ------SSPVSMVRLADMLSFSGKK--VVTAEAIIPFPWIPGQ----SLPDTLVQLEGNT  394

Query  791   PEVE-QDNEDMHAMEC----MTIHGV--------LGSGS------RRAPVYE--VKRTVQ  675
             P        D     C    + + G+        L SG+         P  E  + + +Q
Sbjct  395   PWTPLSACGDTFGTRCYAQSVVLRGIDKASHISQLPSGTPLPSQLHACPTGEEVLAQYLQ  454

Query  674   DAYEKAISRPKFSHLSVSccplpiplpfpaiFGNSIGQHGELLETPITETPSRGPLEVHS  495
                 + IS    SHL ++ C +  P P       S GQ G +   P+  T       V S
Sbjct  455   QQQPRVISS---SHLLLAPCRVDPPYPHFFS--TSFGQQGVVPGCPLRST------AVQS  503

Query  494   IPMASRLRSSTAILPFLESRLENLRKLGIQRGAIGAQVLESWGFGRDEVEDLGETLSKLV  315
             IP+   LRSS+++   L    + L +L ++R    A  LE+ G  +D+VE+L + L  L 
Sbjct  504   IPVFGALRSSSSLHQTLRGLAKELTQLDLRR---WASFLEA-GMEQDDVEELLQELHSLA  559

Query  314   NTLK  303
                +
Sbjct  560   QCYR  563



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6399908556066