BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c77492_g1_i1 len=862 path=[1:0-861]

Length=862
                                                                      Score     E

ref|XP_009106014.1|  PREDICTED: non-specific lipid-transfer protein   96.3    9e-21   
emb|CDX96483.1|  BnaA07g30940D                                        96.3    9e-21   
ref|XP_009770324.1|  PREDICTED: lipid transfer-like protein VAS       94.7    6e-20   
ref|XP_009623935.1|  PREDICTED: protein YLS3-like                     94.4    9e-20   
ref|XP_010537503.1|  PREDICTED: protein YLS3                          91.7    7e-19   
ref|XP_006300977.1|  hypothetical protein CARUB_v10021367mg           89.7    2e-18   
ref|XP_004235821.2|  PREDICTED: protein YLS3                          89.4    4e-18   
ref|XP_006390544.1|  hypothetical protein EUTSA_v10019793mg           88.6    5e-18   
emb|CDY19202.1|  BnaC05g14030D                                        87.0    4e-17   
emb|CDY26174.1|  BnaA06g12430D                                        86.7    5e-17   
ref|XP_009149272.1|  PREDICTED: protein YLS3                          86.7    5e-17   
gb|KFK41791.1|  hypothetical protein AALP_AA2G172500                  85.5    6e-17   
emb|CDX96728.1|  BnaA08g22710D                                        85.5    1e-16   
ref|XP_009110357.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    1e-16   
emb|CDX83859.1|  BnaC08g17860D                                        85.1    2e-16   
ref|NP_173264.1|  Bifunctional inhibitor/lipid-transfer protein/s...  84.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28401.1|  unknown                                               84.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084068.1|  PREDICTED: lipid transfer-like protein VAS       83.2    5e-16   
ref|XP_010540032.1|  PREDICTED: protein YLS3-like                     83.2    8e-16   
ref|XP_002890266.1|  predicted protein                                82.8    1e-15   
ref|XP_006341508.1|  PREDICTED: non-specific lipid transfer prote...  82.0    2e-15   
ref|XP_006341697.1|  PREDICTED: lipid transfer-like protein VAS-like  80.9    2e-15   
emb|CDX81867.1|  BnaC08g37340D                                        81.3    3e-15   
ref|XP_006390543.1|  hypothetical protein EUTSA_v10019626mg           79.7    5e-15   
ref|XP_010428282.1|  PREDICTED: protein YLS3-like                     80.1    6e-15   
ref|XP_010025950.1|  PREDICTED: protein YLS3-like                     79.7    8e-15   
emb|CDX81864.1|  BnaC08g37370D                                        79.7    1e-14   
ref|XP_009104805.1|  PREDICTED: protein YLS3-like                     78.6    2e-14   
ref|XP_008393444.1|  PREDICTED: lipid transfer-like protein VAS       78.6    3e-14   
ref|XP_009127998.1|  PREDICTED: lipid transfer-like protein VAS       77.8    4e-14   
ref|NP_177496.3|  protease inhibitor/seed storage/LTP family protein  77.4    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008240131.1|  PREDICTED: lipid transfer-like protein VAS       77.8    6e-14   
emb|CDY21714.1|  BnaA09g44650D                                        77.8    6e-14   
ref|NP_565067.1|  Bifunctional inhibitor/lipid-transfer protein/s...  77.0    6e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28466.1|  unknown                                               77.0    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303831.1|  hypothetical protein CARUB_v10012497mg           77.4    7e-14   
ref|XP_002888933.1|  lipid binding protein                            76.6    9e-14   
ref|XP_009117621.1|  PREDICTED: lipid transfer-like protein VAS       77.0    1e-13   
ref|XP_007209686.1|  hypothetical protein PRUPE_ppa012361mg           76.6    1e-13   
gb|AAG30968.1|AC012396_4  hypothetical protein                        75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51811.1|AC079676_6  lipid transfer protein, putative, 3' pa...  75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117596.1|  protease inhibitor/seed storage/LTP family p...  75.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011035578.1|  PREDICTED: lipid transfer-like protein VAS       76.3    1e-13   
ref|XP_010477003.1|  PREDICTED: protein YLS3-like                     76.6    2e-13   
ref|XP_009360066.1|  PREDICTED: lipid transfer-like protein VAS i...  76.3    2e-13   
ref|XP_009360067.1|  PREDICTED: lipid transfer-like protein VAS i...  76.3    2e-13   
gb|ADV19014.1|  protease inhibitor/seed storage/lipid transfer pr...  76.3    2e-13   
emb|CDY21712.1|  BnaA09g44630D                                        76.3    2e-13   
emb|CDX82064.1|  BnaC02g22260D                                        75.5    2e-13   
ref|XP_008367600.1|  PREDICTED: surfeit locus protein 1-like isof...  79.0    3e-13   
emb|CDY58317.1|  BnaA02g16470D                                        75.1    3e-13   
gb|AAM65563.1|  lipid transfer protein, putative                      75.1    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374856.1|  PREDICTED: lipid transfer-like protein VAS       75.1    4e-13   
emb|CDY11102.1|  BnaC06g23540D                                        74.3    5e-13   
ref|XP_010663690.1|  PREDICTED: lipid transfer-like protein VAS       73.6    1e-12   
ref|XP_009356019.1|  PREDICTED: surfeit locus protein 1 isoform X3    77.0    1e-12   
ref|XP_002888934.1|  protease inhibitor/seed storage/lipid transf...  72.4    3e-12   
ref|XP_003525790.1|  PREDICTED: lipid transfer-like protein VAS-like  72.0    3e-12   
gb|KCW57776.1|  hypothetical protein EUGRSUZ_H00534                   71.6    4e-12   
ref|XP_004301245.1|  PREDICTED: lipid transfer-like protein VAS-like  72.4    4e-12   
ref|XP_006391823.1|  hypothetical protein EUTSA_v10023739mg           72.0    5e-12   
gb|KDP44295.1|  hypothetical protein JCGZ_22924                       71.2    2e-11   
gb|KDP25614.1|  hypothetical protein JCGZ_20770                       70.1    2e-11   
ref|XP_009627049.1|  PREDICTED: lipid transfer-like protein VAS       69.7    2e-11   
ref|XP_007036884.1|  Bifunctional inhibitor/lipid-transfer protei...  70.5    3e-11   
ref|NP_176467.1|  Bifunctional inhibitor/lipid-transfer protein/s...  69.3    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355503.1|  PREDICTED: lipid transfer-like protein VAS-like  69.3    3e-11   
gb|AFK33893.1|  unknown                                               69.3    4e-11   
ref|XP_004966252.1|  PREDICTED: lipid transfer-like protein VAS-like  68.9    5e-11   
ref|XP_006301407.1|  hypothetical protein CARUB_v10021822mg           68.6    7e-11   
gb|EYU40382.1|  hypothetical protein MIMGU_mgv1a015208mg              68.6    8e-11   
gb|AAF19539.1|AC007190_7  F23N19.16                                   67.0    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81865.1|  BnaC08g37360D                                        68.2    1e-10   
ref|XP_009381846.1|  PREDICTED: uncharacterized protein LOC103969939  68.2    1e-10   
ref|NP_849837.1|  Bifunctional inhibitor/lipid-transfer protein/s...  67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010245107.1|  PREDICTED: lipid transfer-like protein VAS       67.8    2e-10   
gb|KFK43990.1|  hypothetical protein AALP_AA1G200500                  67.8    2e-10   
ref|XP_007039954.1|  Bifunctional inhibitor/lipid-transfer protei...  67.0    2e-10   
ref|XP_003619850.1|  Lipid transfer-like protein VAS                  68.2    2e-10   
ref|XP_010430355.1|  PREDICTED: lipid transfer-like protein VAS       67.0    3e-10   
emb|CDY21713.1|  BnaA09g44640D                                        67.0    3e-10   
ref|XP_010471416.1|  PREDICTED: protein YLS3-like                     66.6    3e-10   
ref|XP_009418711.1|  PREDICTED: lipid transfer-like protein VAS i...  66.6    3e-10   
gb|ACF80670.1|  unknown                                               66.6    4e-10   Zea mays [maize]
ref|XP_002887289.1|  hypothetical protein ARALYDRAFT_476148           70.1    4e-10   
ref|NP_001132005.1|  uncharacterized protein LOC100193410 precursor   66.6    4e-10   Zea mays [maize]
gb|KFK40565.1|  hypothetical protein AALP_AA2G012700                  66.6    4e-10   
ref|XP_010498216.1|  PREDICTED: non-specific lipid transfer prote...  67.0    4e-10   
ref|XP_009628632.1|  PREDICTED: lipid transfer-like protein VAS       66.2    4e-10   
ref|XP_007152674.1|  hypothetical protein PHAVU_004G149600g           67.0    4e-10   
gb|AAB61093.1|  F20P5.4 gene product                                  65.5    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AFK39503.1|  unknown                                               66.2    5e-10   
ref|XP_009418713.1|  PREDICTED: lipid transfer-like protein VAS i...  66.2    5e-10   
ref|XP_002888005.1|  hypothetical protein ARALYDRAFT_475074           65.9    6e-10   
ref|XP_009117620.1|  PREDICTED: protein YLS3-like                     66.6    6e-10   
ref|XP_003560545.1|  PREDICTED: lipid transfer-like protein VAS       66.6    6e-10   
ref|XP_010473502.1|  PREDICTED: lipid transfer-like protein VAS i...  65.9    6e-10   
ref|XP_006416623.1|  hypothetical protein EUTSA_v10008878mg           66.2    8e-10   
ref|XP_009782851.1|  PREDICTED: lipid transfer-like protein VAS       65.5    8e-10   
ref|XP_011033913.1|  PREDICTED: lipid transfer-like protein VAS i...  65.5    9e-10   
ref|XP_008681138.1|  PREDICTED: uncharacterized protein LOC100193...  65.5    9e-10   
ref|XP_010497368.1|  PREDICTED: protein YLS3-like                     65.5    1e-09   
ref|XP_006358358.1|  PREDICTED: lipid transfer-like protein VAS-like  65.1    1e-09   
gb|KHG09346.1|  hypothetical protein F383_02248                       64.7    2e-09   
ref|XP_006440389.1|  hypothetical protein CICLE_v10022260mg           65.5    2e-09   
ref|NP_001147608.1|  lipid binding protein precursor                  64.3    2e-09   Zea mays [maize]
ref|XP_006477262.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    2e-09   
gb|AFW75950.1|  lipid binding protein                                 63.9    3e-09   
ref|XP_010473501.1|  PREDICTED: lipid transfer-like protein VAS i...  63.9    3e-09   
ref|XP_010419182.1|  PREDICTED: protein YLS3-like                     63.9    3e-09   
ref|NP_177182.2|  protease inhibitor/seed storage/LTP family protein  67.0    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459441.1|  PREDICTED: protein YLS3-like                     64.3    4e-09   
ref|XP_010418278.1|  PREDICTED: lipid transfer-like protein VAS i...  63.5    5e-09   
ref|XP_010676203.1|  PREDICTED: lipid transfer-like protein VAS       63.5    5e-09   
ref|XP_003608773.1|  Lipid transfer-like protein VAS                  62.8    5e-09   
gb|EYU24773.1|  hypothetical protein MIMGU_mgv1a014610mg              63.9    5e-09   
ref|XP_004244575.1|  PREDICTED: protein YLS3-like                     63.2    6e-09   
gb|EAZ02331.1|  hypothetical protein OsI_24434                        63.9    6e-09   Oryza sativa Indica Group [Indian rice]
gb|AES90970.2|  Lipid transfer protein                                63.2    6e-09   
ref|XP_009780737.1|  PREDICTED: lipid transfer-like protein VAS       63.2    7e-09   
ref|XP_011033914.1|  PREDICTED: lipid transfer-like protein VAS i...  63.2    7e-09   
ref|XP_008810423.1|  PREDICTED: lipid transfer-like protein VAS i...  63.2    8e-09   
ref|XP_006368690.1|  hypothetical protein POPTR_0001s07810g           62.8    8e-09   
ref|XP_009117619.1|  PREDICTED: lipid transfer-like protein VAS       63.2    1e-08   
ref|XP_011018244.1|  PREDICTED: lipid transfer-like protein VAS i...  62.4    1e-08   
ref|XP_011018245.1|  PREDICTED: lipid transfer-like protein VAS i...  62.4    1e-08   
ref|XP_006355523.1|  PREDICTED: lipid transfer-like protein VAS-like  61.6    1e-08   
ref|NP_001058400.1|  Os06g0686400                                     61.6    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010418277.1|  PREDICTED: lipid transfer-like protein VAS i...  62.0    1e-08   
gb|KHG06072.1|  Lipid transfer-like protein VAS                       62.0    1e-08   
gb|EYU40261.1|  hypothetical protein MIMGU_mgv11b0165481mg            63.5    2e-08   
ref|XP_006657264.1|  PREDICTED: lipid transfer-like protein VAS-like  61.2    2e-08   
emb|CDY68945.1|  BnaC06g43950D                                        61.6    2e-08   
ref|XP_009113045.1|  PREDICTED: protein YLS3 isoform X2               61.6    2e-08   
ref|NP_001058554.1|  Os06g0711900                                     62.0    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004515744.1|  PREDICTED: lipid transfer-like protein VAS-like  61.6    2e-08   
ref|XP_009113047.1|  PREDICTED: protein YLS3 isoform X4               61.6    2e-08   
emb|CDY31846.1|  BnaC09g13030D                                        61.6    2e-08   
ref|XP_009418712.1|  PREDICTED: lipid transfer-like protein VAS i...  61.6    2e-08   
gb|KHN04327.1|  Lipid transfer-like protein VAS                       61.2    2e-08   
gb|EMT04784.1|  hypothetical protein F775_06296                       62.0    2e-08   
ref|XP_004245725.1|  PREDICTED: lipid transfer-like protein VAS i...  61.6    3e-08   
ref|XP_010471415.1|  PREDICTED: uncharacterized protein LOC104751205  61.6    3e-08   
ref|XP_004512757.1|  PREDICTED: uncharacterized protein LOC101495737  61.6    3e-08   
ref|XP_009418714.1|  PREDICTED: lipid transfer-like protein VAS i...  61.2    3e-08   
ref|XP_009106013.1|  PREDICTED: lipid transfer-like protein VAS i...  61.2    3e-08   
ref|XP_002303524.2|  protease inhibitor/seed storage/lipid transf...  61.2    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008810424.1|  PREDICTED: lipid transfer-like protein VAS i...  61.2    3e-08   
gb|ABK94554.1|  unknown                                               61.2    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_003549896.1|  PREDICTED: lipid transfer-like protein VAS-like  61.2    3e-08   
ref|XP_009362117.1|  PREDICTED: lipid transfer-like protein VAS i...  61.2    3e-08   
ref|XP_004245724.1|  PREDICTED: lipid transfer-like protein VAS i...  61.2    4e-08   
gb|KHN09781.1|  Lipid transfer-like protein VAS                       60.8    5e-08   
ref|XP_008448898.1|  PREDICTED: lipid transfer-like protein VAS       60.5    5e-08   
ref|XP_009392040.1|  PREDICTED: lipid transfer-like protein VAS       60.5    6e-08   
ref|XP_003563447.1|  PREDICTED: lipid transfer-like protein VAS       60.5    6e-08   
ref|XP_009113046.1|  PREDICTED: protein YLS3 isoform X3               60.5    6e-08   
ref|XP_004309123.1|  PREDICTED: uncharacterized protein LOC101312012  60.5    6e-08   
ref|XP_009113044.1|  PREDICTED: protein YLS3 isoform X1               60.5    6e-08   
dbj|BAK01511.1|  predicted protein                                    60.5    7e-08   
ref|XP_009384645.1|  PREDICTED: lipid transfer-like protein VAS i...  60.1    7e-08   
ref|XP_002322118.2|  hypothetical protein POPTR_0015s04850g           60.5    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009384644.1|  PREDICTED: lipid transfer-like protein VAS i...  60.1    7e-08   
ref|XP_009395389.1|  PREDICTED: lipid transfer-like protein VAS       60.1    8e-08   
ref|XP_010431510.1|  PREDICTED: uncharacterized protein LOC104715836  60.1    8e-08   
gb|EAZ02139.1|  hypothetical protein OsI_24230                        60.1    9e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001237428.1|  uncharacterized protein LOC100305582 precursor   60.5    9e-08   
ref|XP_009106011.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    9e-08   
gb|KHG14207.1|  Lipid transfer-like protein VAS                       59.7    1e-07   
ref|XP_006302963.1|  hypothetical protein CARUB_v10021100mg           59.7    1e-07   
ref|XP_006838612.1|  hypothetical protein AMTR_s00002p00228410        59.3    1e-07   
ref|XP_010053420.1|  PREDICTED: lipid transfer-like protein VAS       59.3    2e-07   
ref|XP_010934412.1|  PREDICTED: lipid transfer-like protein VAS i...  59.3    2e-07   
ref|XP_007155619.1|  hypothetical protein PHAVU_003G217100g           58.9    2e-07   
gb|EPS61441.1|  hypothetical protein M569_13357                       58.5    2e-07   
ref|XP_002530788.1|  lipid binding protein, putative                  59.3    2e-07   Ricinus communis
ref|XP_009362118.1|  PREDICTED: lipid transfer-like protein VAS i...  58.5    3e-07   
gb|KGN64183.1|  hypothetical protein Csa_1G042900                     58.5    3e-07   
ref|XP_008369519.1|  PREDICTED: lipid transfer-like protein VAS i...  58.5    3e-07   
ref|XP_010934068.1|  PREDICTED: probable non-specific lipid-trans...  58.2    3e-07   
ref|XP_011069652.1|  PREDICTED: protein YLS3                          58.2    3e-07   
ref|XP_009386940.1|  PREDICTED: lipid transfer-like protein VAS       58.2    3e-07   
gb|KCW77714.1|  hypothetical protein EUGRSUZ_D02016                   58.5    4e-07   
ref|XP_004296094.1|  PREDICTED: uncharacterized protein LOC101306616  58.2    5e-07   
ref|XP_008465923.1|  PREDICTED: lipid transfer-like protein VAS i...  58.2    5e-07   
ref|XP_008369520.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    6e-07   
ref|XP_009402100.1|  PREDICTED: non-specific lipid-transfer prote...  56.6    6e-07   
ref|XP_010433569.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    8e-07   
emb|CDP09900.1|  unnamed protein product                              57.4    8e-07   
ref|XP_006302962.1|  hypothetical protein CARUB_v10021100mg           57.4    8e-07   
dbj|BAJ88594.1|  predicted protein                                    57.4    1e-06   
ref|XP_004147939.1|  PREDICTED: uncharacterized protein LOC101222106  56.6    1e-06   
ref|XP_003534136.1|  PREDICTED: uncharacterized protein LOC100807824  57.4    1e-06   
ref|XP_008465997.1|  PREDICTED: lipid transfer-like protein VAS i...  57.0    1e-06   
ref|XP_004955029.1|  PREDICTED: uncharacterized protein LOC101764790  56.6    2e-06   
ref|XP_002874768.1|  protease inhibitor/seed storage/lipid transf...  56.2    2e-06   
ref|XP_010934410.1|  PREDICTED: lipid transfer-like protein VAS i...  56.2    2e-06   
ref|XP_010676205.1|  PREDICTED: lipid transfer-like protein VAS       55.8    3e-06   
ref|XP_010907379.1|  PREDICTED: non-specific lipid transfer prote...  55.5    4e-06   
ref|XP_010646816.1|  PREDICTED: probable non-specific lipid-trans...  55.1    4e-06   
gb|AAM93450.1|  putative proline-rich cell wall protein               55.8    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009354563.1|  PREDICTED: lipid transfer-like protein VAS       54.7    6e-06   
ref|XP_007209733.1|  hypothetical protein PRUPE_ppa012858mg           54.7    7e-06   
gb|KHN43639.1|  Surfeit locus protein 1                               57.0    7e-06   
ref|XP_002509588.1|  lipid binding protein, putative                  53.9    9e-06   Ricinus communis
ref|XP_008345455.1|  PREDICTED: lipid transfer-like protein VAS       53.5    1e-05   
gb|KHG30746.1|  Lipid transfer-like protein VAS                       53.1    1e-05   
ref|XP_006396774.1|  hypothetical protein EUTSA_v10029377mg           53.1    2e-05   
ref|XP_010676202.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    2e-05   
gb|KHN45247.1|  Lipid transfer-like protein VAS                       53.1    2e-05   
emb|CAN68310.1|  hypothetical protein VITISV_043508                   52.8    3e-05   Vitis vinifera
gb|AAP52555.2|  Protease inhibitor/seed storage/LTP family protein    55.1    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676204.1|  PREDICTED: protein YLS3-like                     52.4    4e-05   
ref|XP_010093658.1|  hypothetical protein L484_018996                 51.6    6e-05   
ref|XP_010253360.1|  PREDICTED: protein YLS3-like                     51.2    6e-05   
ref|XP_007157324.1|  hypothetical protein PHAVU_002G060600g           51.6    7e-05   
ref|XP_008363859.1|  PREDICTED: lipid transfer-like protein VAS       51.6    7e-05   
ref|XP_001781696.1|  predicted protein                                53.9    8e-05   
ref|XP_010422203.1|  PREDICTED: non-specific lipid transfer prote...  51.2    1e-04   
ref|XP_010455674.1|  PREDICTED: non-specific lipid transfer prote...  51.2    1e-04   
gb|KFK31970.1|  hypothetical protein AALP_AA6G183400                  51.2    1e-04   
ref|XP_010277049.1|  PREDICTED: lipid transfer-like protein VAS       50.8    1e-04   
gb|EYU41467.1|  hypothetical protein MIMGU_mgv1a020765mg              51.2    1e-04   
ref|XP_009146021.1|  PREDICTED: non-specific lipid transfer prote...  50.8    1e-04   
gb|EEC66672.1|  hypothetical protein OsI_32960                        52.8    1e-04   Oryza sativa Indica Group [Indian rice]
emb|CDO98441.1|  unnamed protein product                              51.6    2e-04   
ref|XP_010030777.1|  PREDICTED: uncharacterized protein LOC104420676  50.4    2e-04   
ref|XP_010497673.1|  PREDICTED: protein YLS3-like                     49.7    2e-04   
gb|EEE66241.1|  hypothetical protein OsJ_22414                        52.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678731.1|  PREDICTED: uncharacterized protein LOC103653682  50.1    3e-04   
ref|XP_010277059.1|  PREDICTED: lipid transfer-like protein VAS       50.4    3e-04   
ref|NP_001151305.1|  lipid binding protein precursor                  50.1    3e-04   Zea mays [maize]
ref|XP_010934241.1|  PREDICTED: protein YLS3-like isoform X2          50.1    3e-04   
ref|XP_004298676.1|  PREDICTED: uncharacterized protein LOC101294...  49.7    3e-04   
gb|AFK47880.1|  unknown                                               49.3    4e-04   
ref|XP_009146022.1|  PREDICTED: non-specific lipid transfer prote...  48.9    5e-04   
ref|XP_007143272.1|  hypothetical protein PHAVU_007G058500g           49.3    6e-04   
ref|XP_007143273.1|  hypothetical protein PHAVU_007G058500g           48.9    6e-04   
ref|XP_004298677.1|  PREDICTED: uncharacterized protein LOC101294...  48.1    7e-04   
gb|ACM78616.1|  protease inhibitor/seed storage/lipid transfer pr...  48.5    7e-04   Tamarix hispida
ref|XP_004230416.1|  PREDICTED: lipid transfer-like protein VAS       48.5    7e-04   
ref|NP_192973.1|  Bifunctional inhibitor/lipid-transfer protein/s...  48.5    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409620.1|  PREDICTED: uncharacterized protein LOC103991801  48.5    8e-04   
ref|XP_008783577.1|  PREDICTED: lipid transfer-like protein VAS       48.5    9e-04   
ref|XP_006290181.1|  hypothetical protein CARUB_v10003860mg           48.5    9e-04   
ref|XP_010934234.1|  PREDICTED: protein YLS3-like isoform X1          48.9    9e-04   
ref|XP_006349283.1|  PREDICTED: lipid transfer-like protein VAS-like  48.1    0.001   



>ref|XP_009106014.1| PREDICTED: non-specific lipid-transfer protein [Brassica rapa]
Length=146

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -2

Query  594  AADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALL  415
            AA+ GG+   MACM KL PCQ  +   +  PP  CC PMKE+V K+  CLCT+F N  LL
Sbjct  22   AAEQGGDHHSMACMQKLMPCQNYIHAVNPAPPASCCGPMKEIVEKDSKCLCTVFNNPELL  81

Query  414  SSVNMTKDNAIGLAKKCGAQADSDMCKNVALSP  316
             S+N+TK+NA+ L K CG   D  +C   A SP
Sbjct  82   KSLNLTKENALDLPKACGVNPDVSICTKTASSP  114



>emb|CDX96483.1| BnaA07g30940D [Brassica napus]
Length=146

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -2

Query  594  AADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALL  415
            AA+ GG+   MACM KL PCQ  +   +  PP  CC PMKE+V K+  CLCT+F N  LL
Sbjct  22   AAEQGGDHHSMACMQKLMPCQNYIHAVNPAPPASCCGPMKEIVEKDSKCLCTVFNNPELL  81

Query  414  SSVNMTKDNAIGLAKKCGAQADSDMCKNVALSP  316
             S+N+TK+NA+ L K CG   D  +C   A SP
Sbjct  82   KSLNLTKENALDLPKACGVNPDVSICTKTASSP  114



>ref|XP_009770324.1| PREDICTED: lipid transfer-like protein VAS [Nicotiana sylvestris]
Length=180

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 80/141 (57%), Gaps = 7/141 (5%)
 Frame = -2

Query  576  NGG--PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            NGG   M C+ KL PCQ ++   S +PP  CC P+KE++T +  CLCT+F N  L+ S N
Sbjct  41   NGGILDMPCVQKLMPCQVALTSHSKNPPATCCVPLKEIITSDAQCLCTVFDNADLMKSFN  100

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSP-SASQLNAAVSSSDSKSTPASEEEKSGASNQ  226
            +TKD A+  AK CGA+ D  +CKN   SP SA  + +A ++S S +  AS    + A+  
Sbjct  101  VTKDEALSFAKACGAKPDLSLCKNATASPGSAPSIPSASNNSSSSNKTASPPTANAATVT  160

Query  225  RKLASQSALFFVVLSFPGLMM  163
             K       F  V SF  L+M
Sbjct  161  SKFGG----FVAVASFMSLVM  177



>ref|XP_009623935.1| PREDICTED: protein YLS3-like [Nicotiana tomentosiformis]
Length=183

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query  591  ADVGGNGG--PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDAL  418
            AD G NGG   M C+ KL PCQ ++   S +PP  CC P+KE++T +  CLCT+F N  L
Sbjct  39   ADNGENGGILDMPCVKKLMPCQAALTSHSKNPPATCCVPLKEIITSDAQCLCTVFGNADL  98

Query  417  LSSVNMTKDNAIGLAKKCGAQADSDMCKN  331
            + S N+TKD A+  AK CGA+ D  +CKN
Sbjct  99   MKSFNVTKDEALSFAKACGAKPDLSLCKN  127



>ref|XP_010537503.1| PREDICTED: protein YLS3 [Tarenaya hassleriana]
Length=172

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 3/100 (3%)
 Frame = -2

Query  600  DAAADVGGNGGP--MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQN  427
            D A     +GG   M C+ +L PCQ  +  + + PPP CC P+KE++  +++CLC++F N
Sbjct  23   DPATPAPPSGGAQAMPCIQRLMPCQPYI-HSQNPPPPTCCVPLKEILDNDVTCLCSVFNN  81

Query  426  DALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
              +L S+N+TK NA+ L K CGA AD   CKN A SP AS
Sbjct  82   PDMLRSLNLTKSNALDLPKACGADADVSRCKNAATSPIAS  121



>ref|XP_006300977.1| hypothetical protein CARUB_v10021367mg [Capsella rubella]
 gb|EOA33875.1| hypothetical protein CARUB_v10021367mg [Capsella rubella]
Length=147

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GGN   MAC+ KL PCQ  +   + +PP  CC PMKE+V  +  CLCT+F N  +L ++N
Sbjct  25   GGNPQAMACVQKLLPCQPYIHTVNPNPPLSCCGPMKEMVETDAPCLCTVFNNPEMLKALN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSP  316
            +TK+NA+ L K CG   D  +C  +A SP
Sbjct  85   LTKENALDLPKACGTNPDVSLCAKIASSP  113



>ref|XP_004235821.2| PREDICTED: protein YLS3 [Solanum lycopersicum]
Length=160

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -2

Query  594  AADVG-GNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDAL  418
            A+ VG G+   M C+ KL PCQ + A     PP  CCTP+KE+++ +  CLCT+F N  +
Sbjct  19   ASGVGSGSVSAMPCVQKLMPCQPAFAAHMKTPPATCCTPLKEMISNDAQCLCTVFANSDV  78

Query  417  LSSVNMTKDNAIGLAKKCGAQADSDMCKNV-----ALSPSASQLNAAVSSSDSKSTP  262
            + S+N+T+D A+  AK CGA+ D  +CK       A SP+ SQ N + S++++ S P
Sbjct  79   MKSMNVTQDEALSFAKACGAKPDLSLCKKAHGEASAPSPNTSQTNDSSSTNNTASPP  135



>ref|XP_006390544.1| hypothetical protein EUTSA_v10019793mg [Eutrema salsugineum]
 gb|ESQ27830.1| hypothetical protein EUTSA_v10019793mg [Eutrema salsugineum]
Length=139

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = -2

Query  603  LDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQND  424
            + A A +G     M C+ KL PC+  +  +   PPP CC PMKE+  K+ +CLC +F + 
Sbjct  19   VQATAQIGEAEDTMRCVQKLMPCRPYI-HSEIPPPPWCCDPMKEIAEKDTTCLCAVFNHP  77

Query  423  ALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAA  292
             +LS +N++K+NA+ L + CGA  D  +C N A S SAS    A
Sbjct  78   GMLSYINLSKENALSLLESCGANHDVSICTNTAWSSSASTTKYA  121



>emb|CDY19202.1| BnaC05g14030D [Brassica napus]
Length=180

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +   +  PP  CC PMKE+V K+ +CLC++F N  +L S+N+TK+NA
Sbjct  40   MPCIQKLMPCQPYLHSVTPPPPASCCLPMKEIVEKDATCLCSVFNNVDMLKSLNLTKENA  99

Query  384  IGLAKKCGAQADSDMCKN  331
            + L K CGA+AD  +CK+
Sbjct  100  LVLPKACGAKADISLCKS  117



>emb|CDY26174.1| BnaA06g12430D [Brassica napus]
Length=180

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +   +  PP  CC PMKE+V K+ +CLC++F N  +L S+N+TK+NA
Sbjct  42   MPCIQKLMPCQPYLHSVTPPPPASCCLPMKEIVEKDATCLCSVFNNVDMLKSLNLTKENA  101

Query  384  IGLAKKCGAQADSDMCKN  331
            + L K CGA+AD  +CK+
Sbjct  102  LVLPKACGAKADISLCKS  119



>ref|XP_009149272.1| PREDICTED: protein YLS3 [Brassica rapa]
Length=179

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +   +  PP  CC PMKE+V K+ +CLC++F N  +L S+N+TK+NA
Sbjct  41   MPCIQKLMPCQPYLHSVTPPPPASCCLPMKEIVEKDATCLCSVFNNVDMLKSLNLTKENA  100

Query  384  IGLAKKCGAQADSDMCKN  331
            + L K CGA+AD  +CK+
Sbjct  101  LVLPKACGAKADISLCKS  118



>gb|KFK41791.1| hypothetical protein AALP_AA2G172500 [Arabis alpina]
Length=148

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = -2

Query  603  LDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQND  424
            + A A +G +   M C+ KL PC+  +  +   PPP CC+PMKE+  K++SCLCT F + 
Sbjct  19   IQATAQIGTS---MRCIVKLLPCEPYI-HSELTPPPWCCSPMKEIAEKDVSCLCTAFNHP  74

Query  423  ALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSA  310
             +LS +++T++NAI L   CGA  D  +C   +LS SA
Sbjct  75   EMLSFISLTEENAINLLTSCGANHDFSVCSKTSLSESA  112



>emb|CDX96728.1| BnaA08g22710D [Brassica napus]
Length=175

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
             G+   M C+ KL PCQ  +   +  PP  CC P+KE+V  +++CLC++F N  +L S+N
Sbjct  29   AGDAHSMPCIQKLMPCQPYLRSVTPPPPASCCMPLKEIVETDVNCLCSVFNNVDMLKSLN  88

Query  402  MTKDNAIGLAKKCGAQADSDMCK  334
            +TK+NA+ L K CGA AD   CK
Sbjct  89   LTKENALVLPKACGANADVSQCK  111



>ref|XP_009110357.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 
[Brassica rapa]
Length=175

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
             G+   M C+ KL PCQ  +   +  PP  CC P+KE+V  +++CLC++F N  +L S+N
Sbjct  29   AGDAHSMPCIQKLMPCQPYLRSVTPPPPASCCMPLKEIVETDVNCLCSVFNNVDMLKSLN  88

Query  402  MTKDNAIGLAKKCGAQADSDMCK  334
            +TK+NA+ L K CGA AD   CK
Sbjct  89   LTKENALVLPKACGANADVSQCK  111



>emb|CDX83859.1| BnaC08g17860D [Brassica napus]
Length=175

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
             G+   M C+ KL PCQ  +   +  PP  CC P+KE+V  +++CLC++F N  +L S+N
Sbjct  29   AGDAHSMPCIQKLMPCQPYLHSATPPPPASCCMPLKEIVETDVNCLCSVFNNVDMLKSLN  88

Query  402  MTKDNAIGLAKKCGAQADSDMCK  334
            +TK+NA+ L K CGA AD   CK
Sbjct  89   LTKENALVLPKACGANADVSQCK  111



>ref|NP_173264.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAF25992.1|AC013354_11 F15H18.20 [Arabidopsis thaliana]
 gb|AAF78376.1|AC069551_9 T10O22.25 [Arabidopsis thaliana]
 gb|AAM64534.1| lipid transfer protein, putative [Arabidopsis thaliana]
 gb|ABE65630.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis thaliana]
 gb|ABF83631.1| At1g18280 [Arabidopsis thaliana]
 gb|AEE29697.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=180

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   + C+ KL PCQ  +   ++ PP  CC P+ E+V K+ +CLC +F N  +L S+N
Sbjct  33   GGDAHSLPCIQKLMPCQPYL-HLATPPPATCCMPLNEIVAKDATCLCAVFNNVDMLKSLN  91

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
            +TK+NA+ L K CGA+AD  +CK  A + S+S
Sbjct  92   LTKENALDLPKACGAKADVSLCKTSAGTNSSS  123



>gb|ABK28401.1| unknown [Arabidopsis thaliana]
Length=181

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   + C+ KL PCQ  +   ++ PP  CC P+ E+V K+ +CLC +F N  +L S+N
Sbjct  33   GGDAHSLPCIQKLMPCQPYL-HLATPPPATCCMPLNEIVAKDATCLCAVFNNVDMLKSLN  91

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
            +TK+NA+ L K CGA+AD  +CK  A + S+S
Sbjct  92   LTKENALDLPKACGAKADVSLCKTSAGTNSSS  123



>ref|XP_011084068.1| PREDICTED: lipid transfer-like protein VAS [Sesamum indicum]
Length=155

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +  +SS P   CC P+KE++  +  CLC +F+++ +L S+N+T+D+ 
Sbjct  32   MQCIQKLMPCQAFLKGSSS-PATSCCVPLKEIMADDGQCLCAVFEDETILKSLNVTQDDF  90

Query  384  IGLAKKCGAQADSDMCKNVALSPS  313
            +GLAK CGA AD+ +C   A +PS
Sbjct  91   LGLAKSCGANADTSICHKGAATPS  114



>ref|XP_010540032.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=174

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC+ +L PCQ  +     +PP  CC P+KE++  +++CLC++F N A+L S N+TK NA+
Sbjct  38   ACIKRLIPCQPYI-HAPVNPPATCCVPLKEIIDNDVTCLCSVFNNPAMLRSQNLTKSNAL  96

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             L K CGA AD   C + A  P+AS
Sbjct  97   DLPKACGANADVSRCNSSATPPTAS  121



>ref|XP_002890266.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66525.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=181

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   + C+ KL PCQ  +    + PP  CC P+ E+V K+ +CLC +F N  +L S+N
Sbjct  34   GGDAHSLPCIQKLMPCQPYL-HLVTPPPASCCMPLNEIVAKDATCLCAVFNNVDMLKSLN  92

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
            +TK+NA+ L K CGA+AD  +CK  A + S+S
Sbjct  93   LTKENALDLPKACGAKADVSLCKTSAGTNSSS  124



>ref|XP_006341508.1| PREDICTED: non-specific lipid transfer protein-like 1-like [Solanum 
tuberosum]
Length=178

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = -2

Query  594  AADVG-GNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDAL  418
            A+ VG G+   M C+ KL PCQ ++A    +PP  CC P+KE+++ +  CLCT+F N  +
Sbjct  36   ASGVGSGSVSAMPCVQKLMPCQPALAAHMKNPPATCCMPLKEMISNDAQCLCTVFGNSDV  95

Query  417  LSSVNMTKDNAIGLAKKCGAQADSDMCK  334
            + S+N+T+D A+  AK CGA+ D  +CK
Sbjct  96   MKSMNVTQDEALNFAKACGAKPDLSLCK  123



>ref|XP_006341697.1| PREDICTED: lipid transfer-like protein VAS-like [Solanum tuberosum]
Length=133

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -2

Query  594  AADVG-GNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDAL  418
            A+ VG G+   M C+ KL PCQ ++A    +PP  CC P+KE+++ +  CLCT+F N  +
Sbjct  36   ASGVGSGSVSAMPCVQKLMPCQPALAAHMKNPPATCCMPLKEMISNDAQCLCTVFGNSDV  95

Query  417  LSSVNMTKDNAIGLAKKCGAQADSDMCKNVAL  322
            + S+N+T+D A+  AK CGA+ D  +CK   L
Sbjct  96   MKSMNVTQDEALNFAKACGAKPDLSLCKKGTL  127



>emb|CDX81867.1| BnaC08g37340D [Brassica napus]
Length=179

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 7/141 (5%)
 Frame = -2

Query  582  GGNGG---PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLS  412
            GG GG    M C+ KL PCQ  +      PPP CC PMK +V  + +CLC++F N  +L 
Sbjct  29   GGGGGDAQAMPCIQKLMPCQPFLHSVIPPPPPSCCLPMKAIVANDATCLCSVFNNVDMLK  88

Query  411  SVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGAS  232
            S+N+TKDNA+ L K CGA  D  +CK    SP+      + S +  K+ P S    SG++
Sbjct  89   SLNLTKDNALDLPKACGANPDISLCK---ASPAGGTTTNSTSPATPKTPPVS-STGSGST  144

Query  231  NQRKLASQSALFFVVLSFPGL  169
                  +        ++F GL
Sbjct  145  GASPSTTSPTSSAPAINFAGL  165



>ref|XP_006390543.1| hypothetical protein EUTSA_v10019626mg [Eutrema salsugineum]
 gb|ESQ27829.1| hypothetical protein EUTSA_v10019626mg [Eutrema salsugineum]
Length=130

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG G  MACM KL PCQ  +   +  PPP CC PMKE+V K+  CLC++F +  +L  +N
Sbjct  25   GGEGQVMACMQKLMPCQPFLHTANPPPPPSCCGPMKEMVEKDAPCLCSVFNSPEMLKKLN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVA  325
            +TKDNA+ L K CGA  D   C   A
Sbjct  85   LTKDNALELPKACGANPDVSRCTQTA  110



>ref|XP_010428282.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=149

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -2

Query  612  QSVLDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLF  433
             SV   A   GGN   MAC+ KL PCQ  +   +  PP  CC  +K +V  +  CLCT+F
Sbjct  17   YSVQATAQGEGGNPQAMACVQKLLPCQPYIHSVNPPPPSSCCGVLKAMVETDAQCLCTVF  76

Query  432  QNDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
             N  +L ++ +TK+NA+ L K CG   D  +C  +A SP+++
Sbjct  77   NNPEMLKALKLTKENALDLPKACGTNPDVSLCAKLASSPTSA  118



>ref|XP_010025950.1| PREDICTED: protein YLS3-like [Eucalyptus grandis]
Length=148

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            G +   + C+AKL PC   ++ T   PP  CC P+KEV+  E  CLC LF +  +L S N
Sbjct  32   GDDDTSLPCIAKLMPCTPYLSPTPKSPPAVCCVPLKEVIATEAKCLCQLFNDADILRSFN  91

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALS----PSASQLNAAVSSSDSKSTPASEEE  247
            +++D+ + LAK CGA AD   CK    S     S++ ++  +S S SK    S +E
Sbjct  92   ISQDDGLALAKACGATADVSQCKTGQRSSKKFTSSTTISNTISWSCSKQLKWSTQE  147



>emb|CDX81864.1| BnaC08g37370D [Brassica napus]
Length=180

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = -2

Query  582  GGNGG---PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLS  412
            GG GG    M C+ KL PCQ  +      PPP CC PMK +V  + +CLC++F N  +L 
Sbjct  29   GGGGGDAQAMPCIQKLMPCQPFLHSVIPPPPPSCCLPMKAIVANDATCLCSVFNNVDMLK  88

Query  411  SVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTP  262
            S+N+TKDNA+ L K CGA  D  +CK       AS      ++S S +TP
Sbjct  89   SLNLTKDNALDLPKACGANPDISLCK-------ASPAGGTTTNSTSPATP  131



>ref|XP_009104805.1| PREDICTED: protein YLS3-like [Brassica rapa]
 emb|CDX68223.1| BnaA07g22630D [Brassica napus]
Length=148

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   M+CM KL  CQ  +   +  PPP CC PMKE+V K+  CLC +F + A+L ++N
Sbjct  26   GGDPHLMSCMQKLMSCQPYIHAVNPPPPPSCCGPMKEIVVKDAPCLCAVFNDPAILKTLN  85

Query  402  MTKDNAIGLAKKCGAQADSDMC-KNVALSPSA  310
            +TK+NA+ L K CGA  D  +C K  +L P+A
Sbjct  86   LTKENALDLPKACGANPDISLCSKTASLPPTA  117



>ref|XP_008393444.1| PREDICTED: lipid transfer-like protein VAS [Malus domestica]
Length=174

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   M C+ KL PCQ  +       P  CC+P+K++V+ +  CLCTLF ND +LS+ N
Sbjct  40   GGSDSSMQCVQKLIPCQAYL-KAPEKAPSMCCSPLKKLVSDDTECLCTLFNNDDMLSNFN  98

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPS  313
            +T+ +A+ L+K C A AD  +CK  A SP+
Sbjct  99   ITQGDALKLSKACDANADISVCKKDAASPA  128



>ref|XP_009127998.1| PREDICTED: lipid transfer-like protein VAS [Brassica rapa]
Length=148

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PC   + +T S PPP CC P+KE+V K+++CLC    +  +L+ +N+T+D+A
Sbjct  32   MRCVEKLIPCHPYI-NTDSPPPPWCCYPVKEIVEKDVTCLCGFLNHPDMLALINITQDDA  90

Query  384  IGLAKKCGAQADSDMCKNVALS  319
            +     CGA  D  +C N  +S
Sbjct  91   LNFISSCGASYDESLCSNSTVS  112



>ref|NP_177496.3| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 gb|AEE35474.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=152

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = -2

Query  612  QSVLDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLF  433
             SV   A   G     M C+AKL PCQ  +   S  PPP CC PMK++  K++SCLCT F
Sbjct  17   YSVQVTAQFFGDVQQAMRCVAKLMPCQPYI-HLSIPPPPLCCNPMKQIAEKDVSCLCTAF  75

Query  432  QNDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKST  265
            ++  LL  + +TK+NAI +   CG   D  +C     S S + L  A +S +S ST
Sbjct  76   KHPDLLRFLALTKENAIKILDSCGINHDPSVCNKTNPS-SPAALPEAATSGNSFST  130



>ref|XP_008240131.1| PREDICTED: lipid transfer-like protein VAS [Prunus mume]
Length=176

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = -2

Query  600  DAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDA  421
            D     GG+G  M C+ KL PCQ  +       P  CC+P+K++V+ +  CLC++F N  
Sbjct  36   DQEGTGGGSGASMQCVQKLIPCQPFL-KAPEKAPAACCSPLKQMVSDDTKCLCSVFNNPG  94

Query  420  LLSSVNMTKDNAIGLAKKCGAQADSDMCK  334
            +LS++N+T+D+A+ L K CGA AD  +C+
Sbjct  95   MLSNLNITQDDALKLPKACGANADISICE  123



>emb|CDY21714.1| BnaA09g44650D [Brassica napus]
Length=183

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 3/104 (3%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +      PPP CC PMK +V  + +CLC++F N  +L S+N+TKDNA
Sbjct  41   MPCIQKLMPCQPFLHSVIPPPPPSCCLPMKAIVANDATCLCSVFNNVDMLKSLNLTKDNA  100

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASE  253
            + L K CGA  D  +CK    SP+      + S +  K+ PA+ 
Sbjct  101  LDLPKACGANPDISLCK---ASPAGGTTTNSTSPATPKTPPATS  141



>ref|NP_565067.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|ABE65768.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis thaliana]
 gb|AEE35476.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=147

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GGN    AC+ KL PCQ  +   +  PPP CC PMKE+V K+  CLC  F N  +L ++N
Sbjct  25   GGNPQLTACLQKLLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLCIAFNNPEVLKALN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVAL-SPSAS  307
            +TK+NA+ L K CG   D  +C  +A  SP AS
Sbjct  85   LTKENALLLPKACGVNPDVSLCSKIATPSPIAS  117



>gb|ABK28466.1| unknown [Arabidopsis thaliana]
Length=148

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GGN    AC+ KL PCQ  +   +  PPP CC PMKE+V K+  CLC  F N  +L ++N
Sbjct  25   GGNPQLTACLQKLLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLCIAFNNPEVLKALN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVAL-SPSAS  307
            +TK+NA+ L K CG   D  +C  +A  SP AS
Sbjct  85   LTKENALLLPKACGVNPDVSLCSKIATPSPIAS  117



>ref|XP_006303831.1| hypothetical protein CARUB_v10012497mg [Capsella rubella]
 gb|EOA36729.1| hypothetical protein CARUB_v10012497mg [Capsella rubella]
Length=181

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +   S  PPP CC P++E+V K+++CLC++F N  +L S+N+TK+NA
Sbjct  40   MPCIQKLMPCQPYLHSASPPPPPTCCMPLREIVEKDVTCLCSVFNNVDMLKSLNLTKENA  99

Query  384  IGLAKKCGAQADSDMCK  334
            + L   CGA+AD   CK
Sbjct  100  LVLPTACGAKADVSQCK  116



>ref|XP_002888933.1| lipid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65192.1| lipid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=155

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 2/100 (2%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C++KL PCQ  +   S  PPP CC PMK++  +++SCLCT F++  LL  + +TK+NA
Sbjct  33   MRCVSKLLPCQPYI-HLSIPPPPWCCNPMKQIAEQDVSCLCTAFKHPDLLRFLALTKENA  91

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKST  265
            + L   CG   D   C  +  S S + L  A +S +S ST
Sbjct  92   LNLLNSCGINHDLSQCNKINPS-SPAALPEAATSGNSGST  130



>ref|XP_009117621.1| PREDICTED: lipid transfer-like protein VAS [Brassica rapa]
Length=183

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 61/111 (55%), Gaps = 7/111 (6%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +      PPP CC PMK +V  + +CLC++F N  +L S+N+TKDNA
Sbjct  41   MPCIQKLMPCQPFLHSVIPPPPPSCCLPMKAIVANDATCLCSVFNNVDMLKSLNLTKDNA  100

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGAS  232
            + L K CGA  D  +CK       AS      ++S S +TP +    S  S
Sbjct  101  LDLPKACGANPDISLCK-------ASPAGGTTTNSTSPATPKTPPVSSTGS  144



>ref|XP_007209686.1| hypothetical protein PRUPE_ppa012361mg [Prunus persica]
 gb|EMJ10885.1| hypothetical protein PRUPE_ppa012361mg [Prunus persica]
Length=172

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = -2

Query  600  DAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDA  421
            D     GG+G  M C+ KL PCQ  +       P  CC+P+K++V+ +  CLC++F N  
Sbjct  36   DQEGTGGGSGASMQCVQKLIPCQPFL-KAPEKAPAACCSPLKQMVSDDTKCLCSVFNNPG  94

Query  420  LLSSVNMTKDNAIGLAKKCGAQADSDMCK  334
            +LS++N+T+D+A+ L K CGA AD  +C+
Sbjct  95   MLSNLNITQDDALKLPKACGANADISICE  123



>gb|AAG30968.1|AC012396_4 hypothetical protein [Arabidopsis thaliana]
 gb|AAG51810.1|AC079676_5 lipid transfer protein, putative; 26937-27275 [Arabidopsis thaliana]
Length=112

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GGN    AC+ KL PCQ  +   +  PPP CC PMKE+V K+  CLC  F N  +L ++N
Sbjct  25   GGNPQLTACLQKLLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLCIAFNNPEVLKALN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVA  325
            +TK+NA+ L K CG   D  +C  +A
Sbjct  85   LTKENALLLPKACGVNPDVSLCSKIA  110



>gb|AAG51811.1|AC079676_6 lipid transfer protein, putative, 3' partial; 28857-29337 [Arabidopsis 
thaliana]
Length=124

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 1/108 (1%)
 Frame = -2

Query  609  SVLDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQ  430
            SV   A   G     M C+AKL PCQ  +   S  PPP CC PMK++  K++SCLCT F+
Sbjct  18   SVQVTAQFFGDVQQAMRCVAKLMPCQPYI-HLSIPPPPLCCNPMKQIAEKDVSCLCTAFK  76

Query  429  NDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVS  286
            +  LL  + +TK+NAI +   CG   D  +C     S  A+   AA S
Sbjct  77   HPDLLRFLALTKENAIKILDSCGINHDPSVCNKTNPSSPAALPEAATS  124



>ref|NP_001117596.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 gb|AAG30973.1|AC012396_9 hypothetical protein [Arabidopsis thaliana]
 gb|ABN04810.1| At1g73550 [Arabidopsis thaliana]
 gb|AEE35475.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=134

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+AKL PCQ  +   S  PPP CC PMK++  K++SCLCT F++  LL  + +TK+NA
Sbjct  33   MRCVAKLMPCQPYI-HLSIPPPPLCCNPMKQIAEKDVSCLCTAFKHPDLLRFLALTKENA  91

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVS  286
            I +   CG   D  +C     S  A+   AA S
Sbjct  92   IKILDSCGINHDPSVCNKTNPSSPAALPEAATS  124



>ref|XP_011035578.1| PREDICTED: lipid transfer-like protein VAS [Populus euphratica]
Length=157

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 70/140 (50%), Gaps = 8/140 (6%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG    M+C+  L PC+  +  T   PPP CC P+K++V  +  CLC+   N  LL   N
Sbjct  23   GGEAIDMSCIQNLLPCKPYLPGTE-QPPPVCCLPLKDMVAHQAQCLCSALANPDLLKDFN  81

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQR  223
            +T D A+ LAK CGA  D  +CKN + +  ++    A + S S + P     KS A+ + 
Sbjct  82   VTMDGALKLAKTCGASVDMSVCKNGSPAKPSTPTTNATTPSGSNTNP-----KSAANYEI  136

Query  222  KLASQSALFFVVLSFPGLMM  163
                 S   FV   F GL+ 
Sbjct  137  THFGGSG--FVAAIFLGLIF  154



>ref|XP_010477003.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=185

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 76/133 (57%), Gaps = 1/133 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+ KL PCQ  +   +  PPP CC P++E+V  +++CLC++F N  +L S+N+TK+NA
Sbjct  42   LPCIQKLMPCQPYLHSVTPPPPPSCCMPLREIVDSDVTCLCSVFNNVDMLKSLNLTKENA  101

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQS  205
            + L   CGA+AD   CKN A   +    ++   +S +K+ PAS        +     ++S
Sbjct  102  LVLPNACGAKADVSQCKNSA-GGTTPSSSSTPPASSTKTPPASSTGSGSTGDSAASTTKS  160

Query  204  ALFFVVLSFPGLM  166
                + ++F GL+
Sbjct  161  TSSVLAINFAGLI  173



>ref|XP_009360066.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Pyrus 
x bretschneideri]
Length=174

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   M C+ KL PCQ  +       P  CC P+K++V     CLCTLF ND +LS+ N
Sbjct  40   GGSDSSMQCVQKLIPCQAYL-KAPEKAPSTCCLPLKKLVLDNTECLCTLFNNDDMLSNFN  98

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSP  316
            +T+ +A+ L+K C A AD  +CK  A SP
Sbjct  99   ITQGDALKLSKACDANADISVCKKDAASP  127



>ref|XP_009360067.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Pyrus 
x bretschneideri]
Length=170

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   M C+ KL PCQ  +       P  CC P+K++V     CLCTLF ND +LS+ N
Sbjct  40   GGSDSSMQCVQKLIPCQAYL-KAPEKAPSTCCLPLKKLVLDNTECLCTLFNNDDMLSNFN  98

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSP  316
            +T+ +A+ L+K C A AD  +CK  A SP
Sbjct  99   ITQGDALKLSKACDANADISVCKKDAASP  127



>gb|ADV19014.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Brassica rapa subsp. pekinensis]
Length=183

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +      PPP CC PMK +V  + +CLC++F N  +L S+N+TKDNA
Sbjct  40   MPCIQKLMPCQPFLHSVIPPPPPSCCLPMKAIVANDATCLCSVFNNVDMLKSLNLTKDNA  99

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTP  262
            + L K CGA  D  +CK       AS      ++S S +TP
Sbjct  100  LDLPKACGANPDISLCK-------ASPAGGTTTNSTSPATP  133



>emb|CDY21712.1| BnaA09g44630D [Brassica napus]
Length=181

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +      PPP CC PMK +V  + +CLC++F N  +L S+N+TKDNA
Sbjct  40   MPCIQKLMPCQPFLHSVIPPPPPSCCLPMKAIVANDATCLCSVFNNVDMLKSLNLTKDNA  99

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTP  262
            + L K CGA  D  +CK       AS      ++S S +TP
Sbjct  100  LDLPKACGANPDISLCK-------ASPAGGTTTNSTSPATP  133



>emb|CDX82064.1| BnaC02g22260D [Brassica napus]
Length=148

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PC   + +T S PPP CC P+KE+V K+ +CLC    +  +L+ +N+++D+A
Sbjct  32   MRCVEKLIPCHPYI-NTDSPPPPWCCNPVKEIVEKDETCLCGFLNHPDMLALINISQDDA  90

Query  384  IGLAKKCGAQADSDMCKNVALS  319
            + L   CGA  D  +C N  +S
Sbjct  91   LNLINSCGASYDESLCSNSTVS  112



>ref|XP_008367600.1| PREDICTED: surfeit locus protein 1-like isoform X1 [Malus domestica]
Length=424

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   M C+ KL PCQ  +       P  CC+P+K++V+ +  CLCTLF ND +LS+ N
Sbjct  40   GGSDSSMQCVQKLIPCQAYLK-APEKAPSMCCSPLKKLVSDDTECLCTLFNNDDMLSNFN  98

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
            +T+ +A+ L+K C A AD  +CK  A SP+++
Sbjct  99   ITQGDALKLSKACDANADISVCKKDAASPAST  130



>emb|CDY58317.1| BnaA02g16470D [Brassica napus]
Length=148

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PC   + +T S PPP CC P+KE+V K+ +CLC    +  +L+ +N+++D+A
Sbjct  32   MRCVEKLIPCHPYI-NTDSPPPPWCCYPVKEIVEKDETCLCGFLNHPDMLALINISQDDA  90

Query  384  IGLAKKCGAQADSDMCKNVALS  319
            + L   CGA  D  +C N  +S
Sbjct  91   LNLITSCGASYDESLCSNSTVS  112



>gb|AAM65563.1| lipid transfer protein, putative [Arabidopsis thaliana]
Length=147

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+    AC+ KL PCQ  +   +  PPP CC PMKE+V K+  CLCT F N  +L ++N
Sbjct  25   GGSPQLTACLHKLLPCQPYIHSLNPPPPPSCCGPMKEIVEKDAPCLCTAFNNPEVLKALN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVAL-SPSAS  307
            +TK+NA+ L   CG   D  +C  +A  SP AS
Sbjct  85   LTKENALLLPNACGVNPDVSLCSKIATPSPIAS  117



>ref|XP_008374856.1| PREDICTED: lipid transfer-like protein VAS [Malus domestica]
Length=167

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -2

Query  588  DVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSS  409
            D     G   C+ KL PCQ  + +     PP CC+P+K++V+ +  CLCTLF N  +L S
Sbjct  33   DQKAAAGGTQCLQKLIPCQAYL-NAPEKAPPTCCSPLKKLVSDDAECLCTLFSNKDMLRS  91

Query  408  VNMTKDNAIGLAKKCGAQADSDMCKNVA  325
            +N+T+ +A+ L+K CGA AD   CK  A
Sbjct  92   LNITQADALKLSKACGANADISACKKDA  119



>emb|CDY11102.1| BnaC06g23540D [Brassica napus]
Length=149

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 56/96 (58%), Gaps = 0/96 (0%)
 Frame = -2

Query  603  LDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQND  424
            + A A  G +    +CM KL  CQ  +   +  PPP CC PMKE+V  +  CLC +F N 
Sbjct  20   VQATAQGGRDPQLTSCMEKLMSCQPYIHAVNPPPPPSCCGPMKEIVVNDAPCLCAVFNNP  79

Query  423  ALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSP  316
            A+L ++N+TK+NA+ L K CGA  D  +C   A SP
Sbjct  80   AILETLNLTKENALDLPKACGANPDISLCSKTASSP  115



>ref|XP_010663690.1| PREDICTED: lipid transfer-like protein VAS [Vitis vinifera]
Length=154

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  573  GGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G  + CM KL PCQ  +   S  PP  CC P+K +V  +  CLC    N  +L S+N+T+
Sbjct  24   GASLPCMKKLLPCQPYL--HSPSPPASCCVPLKGMVEDDGDCLCQFVNNPTILKSLNLTR  81

Query  393  DNAIGLAKKCGAQADSDMCKNVA  325
            D+A+ L K CG+  D  +CKN A
Sbjct  82   DDALKLPKACGSNPDISVCKNAA  104



>ref|XP_009356019.1| PREDICTED: surfeit locus protein 1 isoform X3 [Pyrus x bretschneideri]
Length=425

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 1/99 (1%)
 Frame = -2

Query  603  LDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQND  424
            L A  D     G   C+ KL PCQ  +       P  CC+P+K++V+ +  CLCTLF N 
Sbjct  28   LTALPDQKAAAGGTQCLQKLIPCQAYLK-APEKAPSTCCSPLKKLVSDDAECLCTLFSNK  86

Query  423  ALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
             +LSS+N+T+ +A+ L+K CGA AD   CK  A SP  S
Sbjct  87   DILSSLNVTQADALKLSKACGANADISKCKKDAASPGTS  125



>ref|XP_002888934.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65193.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=147

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GGN   MAC+ KL PCQ  +   +  PPP CC PMKE+V K+  CLC +F N  +L ++N
Sbjct  25   GGNPQTMACVQKLVPCQPYIHTVNPSPPPSCCGPMKEIVEKDAPCLCAVFNNPEMLKALN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKST  265
            +TK+NA+ L K CG   D  +C  +A SPS +    + + + S ST
Sbjct  85   LTKENALVLPKACGVNPDVSVCSKIA-SPSPTASPGSTNGTSSAST  129



>ref|XP_003525790.1| PREDICTED: lipid transfer-like protein VAS-like [Glycine max]
Length=148

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 65/127 (51%), Gaps = 10/127 (8%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C  +L PC   +  T  +PP  CC P+K  V  EL+CLC ++ +  LL SVN+T D A+G
Sbjct  31   CAQELIPCLDYLNGTI-NPPSSCCDPLKRTVQNELACLCNIYFSPGLLQSVNVTVDEALG  89

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L+++CG  +D   CKN +          A  S    +TP  ++  +G      L S   L
Sbjct  90   LSRRCGVTSDLSSCKNGS--------APAPGSRPPPATPGGDKGGAGTVTFTGL-SFLLL  140

Query  198  FFVVLSF  178
            F+V + F
Sbjct  141  FWVSMLF  147



>gb|KCW57776.1| hypothetical protein EUGRSUZ_H00534 [Eucalyptus grandis]
Length=135

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  540  PCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGLAKKCG  361
            PC   ++ T   PP  CC P+KEV+  E  CLC LF +  +L S N+++D+ + LAK CG
Sbjct  2    PCTPYLSPTPKSPPAVCCVPLKEVIATEAKCLCQLFNDADILRSFNISQDDGLALAKACG  61

Query  360  AQADSDMCKN  331
            A AD   CK 
Sbjct  62   ATADVSQCKT  71



>ref|XP_004301245.1| PREDICTED: lipid transfer-like protein VAS-like [Fragaria vesca 
subsp. vesca]
Length=172

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 68/148 (46%), Gaps = 17/148 (11%)
 Frame = -2

Query  594  AADVGGNGGP---MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQND  424
            A  V G G P   M C+ KL PCQ  +       P  CC P+K++V+ +  CLC LF N 
Sbjct  30   AGFVTGGGDPTDSMPCVKKLIPCQPYL-HAPEKVPVSCCLPLKQMVSDDTKCLCGLFNNA  88

Query  423  ALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTP----AS  256
              L  +N+T+D A+ L K CG  AD  +CK           N + S   S  TP     S
Sbjct  89   DTLKKLNLTQDEALKLPKACGVNADISICKK--------GTNDSTSPPKSPETPPASNYS  140

Query  255  EEEKSGASNQRKLASQS-ALFFVVLSFP  175
              +K+ A +    A    A FF+ L  P
Sbjct  141  SPKKNAAHSTSHFAGYGIATFFMALIIP  168



>ref|XP_006391823.1| hypothetical protein EUTSA_v10023739mg [Eutrema salsugineum]
 gb|ESQ29109.1| hypothetical protein EUTSA_v10023739mg [Eutrema salsugineum]
Length=153

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 64/117 (55%), Gaps = 13/117 (11%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKD  391
             P  C++KL PC  ++  T+  PP +CC  +KE V KEL+CLCT++    LLS  N+T +
Sbjct  29   APTTCVSKLVPCFSALTSTT-KPPKDCCDSIKEAVEKELTCLCTVYNTPGLLSQYNVTTE  87

Query  390  NAIGLAKKCGAQADSDMCK-NVALSPSASQLNAAVSSSDSKSTPASEEEK-SGASNQ  226
             A+ L+++C    D   C  + A SP AS L            PA  +EK +GA N+
Sbjct  88   QALNLSRRCDVNTDLSACSASGAPSPKASLL----------PPPAGNKEKNAGAGNK  134



>gb|KDP44295.1| hypothetical protein JCGZ_22924 [Jatropha curcas]
Length=202

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 70/139 (50%), Gaps = 12/139 (9%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC+ KL PC+K ++D  +  P  CC P+K +V  E  CLC +  N  ++ + N T++ A+
Sbjct  61   ACVTKLLPCEKYLSD-PTGVPGTCCQPLKNLVINEAECLCGVITNPGIMKTFNFTEEQAV  119

Query  381  GLAKKCGAQADSDMCKNVA-----------LSPSASQLNAAVSSSDSKSTPASEEEKSGA  235
             LA  CGA+ +  +CKN               PS    +A   +S +   P+  E+ +GA
Sbjct  120  NLAVTCGAKPNLALCKNATSPISAPSPSPPSPPSPPSNSANNGTSKTAHPPSESEKTTGA  179

Query  234  SNQRKLASQSALFFVVLSF  178
            +  +K +   ALF   LS 
Sbjct  180  AQIQKSSGFIALFVAFLSL  198



>gb|KDP25614.1| hypothetical protein JCGZ_20770 [Jatropha curcas]
Length=150

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C  KL PC + +++T+  PP  CC P+KE V  E +CLC L+    LLS   +    A+
Sbjct  32   SCAQKLIPCAEYISNTTVTPPSTCCNPIKEAVNTERACLCNLYNTPGLLSGFGINVTQAL  91

Query  381  GLAKKCGAQADSDMC  337
            GL K+CG   D   C
Sbjct  92   GLTKRCGVSTDLSAC  106



>ref|XP_009627049.1| PREDICTED: lipid transfer-like protein VAS [Nicotiana tomentosiformis]
Length=151

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 61/129 (47%), Gaps = 11/129 (9%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C AKL PC   +   S+ PP ECC P+KE +T EL CLC L++N  +L S  +    A+
Sbjct  30   SCAAKLVPCAPYL--NSTKPPAECCDPLKEAITNELDCLCKLYENPTVLPSFGINITQAL  87

Query  381  GLAKKCGAQADSDMCK-NVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQS  205
             L K C    D   C  N A  P +  L          +TP  + + +G  N+      S
Sbjct  88   ALPKACNIPGDLSSCNGNAAPGPGSETL-------PPPATPGGKNDSNGV-NKIAWTGTS  139

Query  204  ALFFVVLSF  178
            +LF +  S 
Sbjct  140  SLFVLFASL  148



>ref|XP_007036884.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY21385.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=194

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 67/132 (51%), Gaps = 3/132 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PCQ  M   S  PP  CC+P+ +V T +  CLC +F N  +L   N+T D A+ 
Sbjct  63   CLQKLIPCQPFMH--SPSPPATCCSPLTDVFTHDSQCLCKVFNNPEILKGFNLTLDEAMK  120

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L K CG   D  +CK  A +PSAS  N +  S+   S  +  +    +SN     + +A 
Sbjct  121  LPKACGIDVDVSVCKK-ATAPSASTTNPSPPSNSGSSPGSPSDSSKSSSNGAVRITHTAA  179

Query  198  FFVVLSFPGLMM  163
            F+ + S   LM 
Sbjct  180  FWFIASVAALMF  191



>ref|NP_176467.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAS65935.1| At1g62790 [Arabidopsis thaliana]
 gb|AAS88767.1| At1g62790 [Arabidopsis thaliana]
 dbj|BAF01570.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34004.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=150

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 2/123 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + +T++ P  ECC  +KE V KEL+CLCT++ +  LL+  N+T + A+G
Sbjct  29   CVSKLVPCFNDL-NTTTTPVKECCDSIKEAVEKELTCLCTIYTSPGLLAQFNVTTEKALG  87

Query  378  LAKKCGAQADSDMCK-NVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
            L+++C    D   C    A SP AS    A + +  K   A  +          L+  S+
Sbjct  88   LSRRCNVTTDLSACTAKGAPSPKASLPPPAPAGNTKKDAGAGNKLAGYGVTTVILSLISS  147

Query  201  LFF  193
            +FF
Sbjct  148  IFF  150



>ref|XP_006355503.1| PREDICTED: lipid transfer-like protein VAS-like [Solanum tuberosum]
 gb|AIT42229.1| lipid transfer-like protein VAS-like isoform 2 [Solanum tuberosum]
Length=151

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC   +   S+ PP  CC P++E VTK+L CLC L++N ALL S+ +    AI
Sbjct  30   SCASKLVPCASFL--NSTKPPASCCDPLREAVTKDLQCLCNLYENPALLISLGINVTQAI  87

Query  381  GLAKKCGAQADSDMCK  334
            GL K C    D   CK
Sbjct  88   GLPKYCNIPGDVTACK  103



>gb|AFK33893.1| unknown [Lotus japonicus]
Length=153

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C   L PC   +  TS++PP  CC P+K+ V  +L+CLC LF +  LL S N++ D A+
Sbjct  35   SCAQNLIPCADHL--TSTNPPASCCDPIKKTVETQLTCLCNLFYSPGLLQSFNISTDQAL  92

Query  381  GLAKKCGAQADSDMCKN  331
             L+++CG  +D   CK+
Sbjct  93   QLSRRCGVTSDLSSCKS  109



>ref|XP_004966252.1| PREDICTED: lipid transfer-like protein VAS-like [Setaria italica]
Length=146

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 61/131 (47%), Gaps = 25/131 (19%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C AKL PC   + +T+  PP  CC P+KE V  EL CLC L+ +  +  + N+    A+G
Sbjct  30   CAAKLAPCAPYI-NTTGMPPDTCCGPIKEAVQNELKCLCGLYASPEIFKAFNINVTQALG  88

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            ++K+CG    ++ CK +A                ++S P S       S  R L+     
Sbjct  89   VSKRCGLSDTTEACKGLA---------------PTQSHPGSPSGGGKNSGHRTLS-----  128

Query  198  FFVVLSFPGLM  166
                + FPGLM
Sbjct  129  ----VGFPGLM  135



>ref|XP_006301407.1| hypothetical protein CARUB_v10021822mg [Capsella rubella]
 gb|EOA34305.1| hypothetical protein CARUB_v10021822mg [Capsella rubella]
Length=154

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PC   +   S  PPP CCTPMKE+     +CLC  F +  +L  + +TK++A
Sbjct  34   MRCVTKLLPCGPYI-HLSIPPPPWCCTPMKEIAENNSTCLCAAFNHPEMLRFIALTKESA  92

Query  384  IGLAKKCGAQADSDMCKNVALSPSA  310
            + L   CG   D  +C     SPSA
Sbjct  93   LNLLSSCGVPYDLSLCTTNPSSPSA  117



>gb|EYU40382.1| hypothetical protein MIMGU_mgv1a015208mg [Erythranthe guttata]
Length=165

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 84/136 (62%), Gaps = 6/136 (4%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSM-ADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G + C+ KL PCQ  + + +   PPP CC P+++++ K+  CLC +F N ALL S+N+T+
Sbjct  28   GSLDCVQKLMPCQPYLKSSSPLPPPPGCCLPLRDIIAKDSKCLCAVFTNSALLKSLNITQ  87

Query  393  DNAIGLAKKCGAQADSDMCKNVALSPSAS-QLNAAVSSSDSKSTPASEEEKSGASNQRK-  220
            ++ + LAK CGA ADS +CK  A  PS S    AA S++++ STP+   + +  +   + 
Sbjct  88   NDGLNLAKSCGANADSSLCKTGAAVPSGSPSPPAAPSTTNNSSTPSPPHKNAATALSGRV  147

Query  219  ---LASQSALFFVVLS  181
               L++ +A+  +++S
Sbjct  148  VGYLSTTAAILGLIIS  163



>gb|AAF19539.1|AC007190_7 F23N19.16 [Arabidopsis thaliana]
Length=114

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + +T++ P  ECC  +KE V KEL+CLCT++ +  LL+  N+T + A+G
Sbjct  29   CVSKLVPCFNDL-NTTTTPVKECCDSIKEAVEKELTCLCTIYTSPGLLAQFNVTTEKALG  87

Query  378  LAKKCGAQADSDMC  337
            L+++C    D   C
Sbjct  88   LSRRCNVTTDLSAC  101



>emb|CDX81865.1| BnaC08g37360D [Brassica napus]
Length=167

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL+ CQ  +       P  CC  MKE+V  +  CLC++F N  +L S+N+TKDNA
Sbjct  49   MPCIQKLKSCQPYLHSVIPPLPASCCLSMKEMVANDAPCLCSVFNNVDMLKSLNLTKDNA  108

Query  384  IGLAKKCGAQADSDMCK  334
            + + K C A  D  +CK
Sbjct  109  LDIPKACDANPDISLCK  125



>ref|XP_009381846.1| PREDICTED: uncharacterized protein LOC103969939 [Musa acuminata 
subsp. malaccensis]
Length=173

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 12/135 (9%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM  L PCQ  M D ++   P CC PMK+++ ++  C+C++F +D +L+ +N+T++ A+ 
Sbjct  41   CMESLAPCQTEM-DLAT-LTPACCDPMKDLIKRDHRCVCSMFFDDRVLAFINVTREKAVD  98

Query  378  LAKKCGAQADSDMC--------KNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQR  223
            +  KC    D   C        +  ALSP      AA + ++  +  A+ E   G++++ 
Sbjct  99   MRVKCRINVDHHYCDGYVNATERATALSPRGMTTIAAAAPAEGTTNRAAAE--GGSASRL  156

Query  222  KLASQSALFFVVLSF  178
             +   S +  ++  F
Sbjct  157  AIILLSKMVLLIFQF  171



>ref|NP_849837.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE34005.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=149

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 70/131 (53%), Gaps = 19/131 (15%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + +T++ P  ECC  +KE V KEL+CLCT++ +  LL+  N+T + A+G
Sbjct  29   CVSKLVPCFNDL-NTTTTPVKECCDSIKEAVEKELTCLCTIYTSPGLLAQFNVTTEKALG  87

Query  378  LAKKCGAQADSDMCK-NVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRK------  220
            L+++C    D   C    A SP AS    A         P + ++ +GA N+        
Sbjct  88   LSRRCNVTTDLSACTAKGAPSPKASLPPPA---------PGNTKKDAGAGNKLAGYGVTT  138

Query  219  --LASQSALFF  193
              L+  S++FF
Sbjct  139  VILSLISSIFF  149



>ref|XP_010245107.1| PREDICTED: lipid transfer-like protein VAS [Nelumbo nucifera]
Length=168

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 3/85 (4%)
 Frame = -2

Query  585  VGGN--GGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLS  412
            +GGN    PM C+ KL PC+  +    S PP  CC P+KE++  + +CLC++F +  LL 
Sbjct  29   LGGNRFNVPMDCLEKLLPCESYLKPPVS-PPSSCCVPLKEMIKDDPNCLCSIFNDVDLLK  87

Query  411  SVNMTKDNAIGLAKKCGAQADSDMC  337
            S+N+++ + + L K CGA  D  +C
Sbjct  88   SLNVSQSDLLELPKACGANVDISIC  112



>gb|KFK43990.1| hypothetical protein AALP_AA1G200500 [Arabis alpina]
Length=184

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   + C+ KL PCQ  +   +  PPP CC P++E+V  +++CLC +F N  +L S+N
Sbjct  34   GGDAHSLPCIQKLMPCQPYLHSATPPPPPTCCMPLREIVENDVTCLCAVFNNVDMLKSLN  93

Query  402  MTKDNAIGLAKKCGAQADSDMCK  334
            +TKDNA+ L K CGA AD   C+
Sbjct  94   LTKDNALLLPKACGANADVSKCR  116



>ref|XP_007039954.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY24455.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=142

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 13/128 (10%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC +KL PC   + + ++ P  +CC P+K+ V  +L CLC L+ +  LLSS+N+T   A+
Sbjct  25   ACASKLTPCFPFLNNATAQPTADCCNPIKDTVANDLECLCNLYNDPNLLSSLNITVAAAL  84

Query  381  GLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
             ++++CG   D   C              A S + + S P      +G +++  L   + 
Sbjct  85   RISRECGVTTDLSACN-------------ATSPTSAPSPPGQSGGDNGGADRIALTGITT  131

Query  201  LFFVVLSF  178
            L   ++S 
Sbjct  132  LLLSLVSI  139



>ref|XP_003619850.1| Lipid transfer-like protein VAS [Medicago truncatula]
 gb|AES76068.1| Lipid transfer protein [Medicago truncatula]
Length=205

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 55/103 (53%), Gaps = 1/103 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM +L PCQ  +    +DPPP CC P+KE+VT    CLC    N  ++ S+ ++KD+ + 
Sbjct  53   CMHQLLPCQPFLK-APNDPPPTCCDPLKEMVTNSSDCLCQFINNPTMILSLEVSKDDIMK  111

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEE  250
            L K CG + D   C   A+    S   A+   S   ++ AS+E
Sbjct  112  LPKACGIKVDISKCNANAVDGETSSKGASKEGSAESTSSASKE  154



>ref|XP_010430355.1| PREDICTED: lipid transfer-like protein VAS [Camelina sativa]
Length=152

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 70/128 (55%), Gaps = 11/128 (9%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + + ++ P   CC  +KE V KELSCLCT++    LL++ N++ D A+G
Sbjct  29   CVSKLVPCFNFL-NVTTKPSKVCCDSIKEAVEKELSCLCTIYTTPGLLANFNVSTDQALG  87

Query  378  LAKKCGAQADSDMCKNVALSPS-ASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
            L+ +C  + +   C N   +PS  + L     ++++K+        +GA N  KLA    
Sbjct  88   LSNRCDVKTNLSACNNAKGAPSPKASLPPPAGNTNTKN-------DAGAGN--KLAGYGV  138

Query  201  LFFVVLSF  178
            +  V+LS 
Sbjct  139  VTTVILSL  146



>emb|CDY21713.1| BnaA09g44640D [Brassica napus]
Length=167

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+ KL+ CQ  +       P  CC  MKE+V  +  CLC++F N  +L S+N+T+DNA
Sbjct  49   LPCIQKLKSCQPYLHSVIPPLPASCCLSMKEMVANDAPCLCSVFNNVDMLKSLNLTRDNA  108

Query  384  IGLAKKCGAQADSDMCK  334
            + + K C A+ D  +CK
Sbjct  109  LDIPKACDAEPDISLCK  125



>ref|XP_010471416.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=147

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GGN   MAC+ KL PCQ  +   +  PP  CC P+K +V  +  CLCT+F N  +L ++N
Sbjct  25   GGNPQAMACVQKLLPCQPYIHTVNPPPPSSCCEPLKAMVEADAQCLCTVFNNPEMLKALN  84

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
            + K+NA+ L K CG   D  +C  +A SP+++
Sbjct  85   LNKENALDLPKACGTNPDVSLCAKLASSPTSA  116



>ref|XP_009418711.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C +KL  C + +   S+ PP  CC P+K+    +L CLC LF N A+L + N+    A+ 
Sbjct  29   CASKLVGCAQYL--NSTTPPDTCCGPLKQEAKDDLPCLCALFNNTAVLKAFNVNITQALQ  86

Query  378  LAKKCGAQADSDMCKNVALSPSAS  307
            +AK+CG  AD   C  V  SPS +
Sbjct  87   MAKRCGVNADQSTCATVTASPSGT  110



>gb|ACF80670.1| unknown [Zea mays]
 gb|AFW69153.1| lipid binding protein [Zea mays]
Length=149

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C AKL PC   M +T+  PP  CC P+K+ V  +L CLC L+    +  + N++ D A+G
Sbjct  30   CAAKLVPCSSYM-NTTGTPPDTCCGPLKDAVKNDLKCLCDLYATPEIFKAFNISLDEALG  88

Query  378  LAKKCGAQADSDMCKNVALSPS  313
            L+K+CG    +  CK   LSP+
Sbjct  89   LSKRCGLSDTTAACK--GLSPT  108



>ref|XP_002887289.1| hypothetical protein ARALYDRAFT_476148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63548.1| hypothetical protein ARALYDRAFT_476148 [Arabidopsis lyrata subsp. 
lyrata]
Length=801

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++K+ PC + M DT + P  +CC  +KE V K+ SCLCT++    LL+  N+T D A+ 
Sbjct  26   CVSKIVPCFRFM-DTKTKPSRDCCNSIKEAVEKDFSCLCTIYNTPGLLAQFNITTDQALS  84

Query  378  LAKKCGAQADSDMC  337
            L ++CG   D   C
Sbjct  85   LNRRCGVNTDLSAC  98



>ref|NP_001132005.1| uncharacterized protein LOC100193410 precursor [Zea mays]
 gb|ACG38127.1| lipid binding protein [Zea mays]
Length=149

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C AKL PC   M +T+  PP  CC P+K+ V  +L CLC L+    +  + N++ D A+G
Sbjct  30   CAAKLVPCSSYM-NTTGTPPDTCCGPLKDAVKNDLKCLCDLYATPEIFKAFNISLDEALG  88

Query  378  LAKKCGAQADSDMCKNVALSPS  313
            L+K+CG    +  CK   LSP+
Sbjct  89   LSKRCGLSDTTAACK--GLSPT  108



>gb|KFK40565.1| hypothetical protein AALP_AA2G012700 [Arabis alpina]
Length=148

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 65/123 (53%), Gaps = 2/123 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC  ++ +T++ PP +CC  +K+ V  +L CLCT++    LL+  N+    A+G
Sbjct  27   CVSKLVPCFSAL-NTTTTPPKDCCDSIKDAVKNDLPCLCTVYTTPGLLAQFNVNTTQALG  85

Query  378  LAKKCGAQADSDMCKNVALSPS-ASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
            ++ +CG + D   C + + SPS  + L+   + S  K   A  +          L+  S 
Sbjct  86   ISDRCGVKTDLSACPSGSGSPSPKASLSPPATGSKGKDAGAGNKLAGYGITTVILSLVST  145

Query  201  LFF  193
            +FF
Sbjct  146  IFF  148



>ref|XP_010498216.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 2-like 
[Camelina sativa]
Length=184

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG+   + C+ KL PCQ  +   S  PPP CC P++E+V  ++ CLC++F N  +L S+N
Sbjct  36   GGDAHALPCIQKLMPCQPYLHSVSPPPPPSCCMPLREIVDSDVMCLCSVFNNVDMLKSLN  95

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVA  325
            +TK+NA+ L   CGA+AD   CKN A
Sbjct  96   LTKENALVLPNACGAKADVSQCKNSA  121



>ref|XP_009628632.1| PREDICTED: lipid transfer-like protein VAS [Nicotiana tomentosiformis]
Length=149

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C A+L PC   +   S+ PP  CC P++E VTK+L CLCTL++N  LL S+ +    A+ 
Sbjct  29   CAAQLVPCAPYL--NSTKPPASCCDPLREAVTKDLDCLCTLYENPTLLPSLGINVTQALA  86

Query  378  LAKKCGAQADSDMCKNVA  325
            L K C    D   CK  A
Sbjct  87   LPKACNIPGDVSACKAAA  104



>ref|XP_007152674.1| hypothetical protein PHAVU_004G149600g [Phaseolus vulgaris]
 gb|ESW24668.1| hypothetical protein PHAVU_004G149600g [Phaseolus vulgaris]
Length=186

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 52/106 (49%), Gaps = 11/106 (10%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM KL PCQ  M   +S PP  CC P+KE+   +  C+C+   N +LL S+  +KD+ + 
Sbjct  51   CMQKLLPCQSYMKSQTSPPPDTCCAPLKEMHDNKSQCVCSFVNNPSLLRSIGSSKDDLLK  110

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKS  241
            L   CG  AD   C +              S  +  S+PA+E E S
Sbjct  111  LPNACGIDADFSACNST-----------GGSQDEGSSSPAAEGEGS  145



>gb|AAB61093.1| F20P5.4 gene product [Arabidopsis thaliana]
Length=104

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++K+ PC + + +T++ P  +CC  +KE + K+ SCLCT++    LL+  N+T D A+G
Sbjct  18   CVSKIVPCFRFL-NTTTKPSTDCCNSIKEAMEKDFSCLCTIYNTPGLLAQFNITTDQALG  76

Query  378  LAKKCGAQADSDMC  337
            L  +CG   D   C
Sbjct  77   LNLRCGVNTDLSAC  90



>gb|AFK39503.1| unknown [Medicago truncatula]
 gb|KEH31663.1| Lipid transfer protein [Medicago truncatula]
Length=148

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 58/118 (49%), Gaps = 2/118 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C   L PC   +   S+ PP  CC P+K+ V  EL+CLC LF    LL++ N+    A+
Sbjct  30   SCATNLIPCADYL--NSTKPPSSCCDPIKKTVETELTCLCNLFYAPGLLATFNINTTQAL  87

Query  381  GLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQ  208
             L++ CG   D   CK+   +P+ +   +  +++      AS    +G S    LAS 
Sbjct  88   ALSRNCGVTTDLTTCKHNGSAPAPTSGGSPPATTGGNKAAASRVSFTGFSFILLLASM  145



>ref|XP_009418713.1| PREDICTED: lipid transfer-like protein VAS isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=151

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C +KL  C + +   S+ PP  CC P+K+    +L CLC LF N A+L + N+    A+ 
Sbjct  29   CASKLVGCAQYL--NSTTPPDTCCGPLKQEAKDDLPCLCALFNNTAVLKAFNVNITQALQ  86

Query  378  LAKKCGAQADSDMCKNVALSPSAS  307
            +AK+CG  AD   C  V  SPS +
Sbjct  87   MAKRCGVNADQSTCATVTASPSGT  110



>ref|XP_002888005.1| hypothetical protein ARALYDRAFT_475074 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64264.1| hypothetical protein ARALYDRAFT_475074 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + +T++ P  ECC  +KE V KEL+CLCT++    LLS  N+T + A+ 
Sbjct  28   CVSKLVPCFNDL-NTTTTPVKECCDSIKEAVEKELTCLCTIYTTPGLLSQFNVTTEKALS  86

Query  378  LAKKCGAQADSDMCK-NVALSPSAS  307
            L+++C    D   C    A SP AS
Sbjct  87   LSRRCNVTTDLSACTAKGAPSPKAS  111



>ref|XP_009117620.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=193

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+ KL+ CQ  +       P  CC  MKE+V  +  CLC++F N  +L S+N+T+DNA
Sbjct  75   LPCIQKLKSCQPYLHSVIPPLPASCCLSMKEMVANDAPCLCSVFNNVDMLKSLNLTRDNA  134

Query  384  IGLAKKCGAQADSDMCK  334
            + + K C A+ D  +CK
Sbjct  135  LDIPKACDAEPDISLCK  151



>ref|XP_003560545.1| PREDICTED: lipid transfer-like protein VAS [Brachypodium distachyon]
Length=181

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTS-SDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            C +KL PC   + DT+ ++PP  CC P+KEV T E +C+C +  + A L ++ +  +  +
Sbjct  40   CASKLAPCGAYLKDTTGAEPPASCCDPLKEVATTEAACMCAVLADTAALQALGVAPEQGM  99

Query  381  GLAKKCGAQADSDMC  337
            GLA +CG   D+  C
Sbjct  100  GLALRCGVNTDASTC  114



>ref|XP_010473502.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Camelina 
sativa]
Length=150

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 11/127 (9%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + + ++ P   CC  +KE V KELSCLCT++    LL++ N++ D A+G
Sbjct  29   CVSKLVPCFNFL-NVTTKPSKVCCDSIKEAVEKELSCLCTIYTTPGLLANFNVSTDQALG  87

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L+ +C  + +   C              A S   S   P +   K+ A    KLA    +
Sbjct  88   LSNRCDVKTNLSAC----------NAKGAPSPKASLPPPGNNNTKNDAGAGNKLAGYGVV  137

Query  198  FFVVLSF  178
              VVLS 
Sbjct  138  TTVVLSL  144



>ref|XP_006416623.1| hypothetical protein EUTSA_v10008878mg [Eutrema salsugineum]
 gb|ESQ34976.1| hypothetical protein EUTSA_v10008878mg [Eutrema salsugineum]
Length=184

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +   +  PPP CC P+KE+V  +++CLC++F N  +L S+N+TK+NA
Sbjct  42   MPCIQKLMPCQPYLHSATPPPPPTCCMPLKEIVETDVTCLCSVFNNVDMLKSLNLTKENA  101

Query  384  IGLAKKCGAQADSDMCK  334
            + L K CGA AD   CK
Sbjct  102  LVLPKACGANADVSQCK  118



>ref|XP_009782851.1| PREDICTED: lipid transfer-like protein VAS [Nicotiana sylvestris]
Length=149

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  567  PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            P +C +KL PC   +   S+ PP  CC P++E VTK+L CLC L++N  LL S+ +    
Sbjct  26   PPSCASKLVPCAPYL--NSTKPPASCCDPLREAVTKDLDCLCNLYENPTLLPSLGINVTQ  83

Query  387  AIGLAKKCGAQADSDMCKNVA  325
            A+ L K C    D   CK  A
Sbjct  84   ALALPKACNIPGDISACKAAA  104



>ref|XP_011033913.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Populus 
euphratica]
Length=147

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C  KL PCQ  +A T++ PP  CC P+KE V KEL CLC L+ +  L  S+ +    A+
Sbjct  33   SCATKLAPCQPFLATTTT-PPDSCCNPIKEAVAKELPCLCKLYNDPNLFPSLGINVTQAV  91

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             L+++CG   +   C   A +P+++
Sbjct  92   MLSQRCGVTTNLSSCDASAPTPTST  116



>ref|XP_008681138.1| PREDICTED: uncharacterized protein LOC100193410 isoform X1 [Zea 
mays]
 gb|ACG46561.1| lipid binding protein [Zea mays]
 gb|AFW69154.1| lipid binding protein [Zea mays]
Length=140

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C AKL PC   M +T+  PP  CC P+K+ V  +L CLC L+    +  + N++ D A+G
Sbjct  30   CAAKLVPCSSYM-NTTGTPPDTCCGPLKDAVKNDLKCLCDLYATPEIFKAFNISLDEALG  88

Query  378  LAKKCGAQADSDMCK  334
            L+K+CG    +  CK
Sbjct  89   LSKRCGLSDTTAACK  103



>ref|XP_010497368.1| PREDICTED: protein YLS3-like, partial [Camelina sativa]
Length=148

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -2

Query  579  GNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNM  400
            G+   + C+ KL PCQ  +   S  PPP CC P++E+V  ++ CLC++F N  +L S+N+
Sbjct  1    GDAHALPCIQKLMPCQPYLHSVSPPPPPSCCMPLREIVDSDVMCLCSVFNNVDMLKSLNL  60

Query  399  TKDNAIGLAKKCGAQADSDMCKNVA  325
            TK+NA+ L   CGA+AD   CKN A
Sbjct  61   TKENALVLPNACGAKADVSQCKNSA  85



>ref|XP_006358358.1| PREDICTED: lipid transfer-like protein VAS-like [Solanum tuberosum]
Length=150

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 11/128 (9%)
 Frame = -2

Query  567  PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            P +C +KL PC   +   +S PP ECC P++E +T +L CLC L++N  LL S+ +    
Sbjct  27   PPSCASKLVPCAPYL--NASSPPAECCDPLREAITNDLDCLCKLYENPTLLPSLGINITQ  84

Query  387  AIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQ  208
            A+ L K C    D + C         +   A   SS+    P +    +G++   K    
Sbjct  85   ALALPKACNISGDLNAC---------TTGGAPGPSSEGLPPPVTPGGNNGSNGVNKFTWS  135

Query  207  SALFFVVL  184
               FF+V+
Sbjct  136  GISFFLVI  143



>gb|KHG09346.1| hypothetical protein F383_02248 [Gossypium arboreum]
Length=145

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 68/127 (54%), Gaps = 10/127 (8%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C AKL  C + + +T+  P  +CC P+KE VT +LSCLC L+++  + +S+N++   A+ 
Sbjct  27   CAAKLVSCSRYILNTTIKPQDDCCNPIKEEVTNDLSCLCNLYKDPKVFASLNISIAQALN  86

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            + ++CG   D   C + + S S++       S+D          ++G +++  L   + L
Sbjct  87   VTRECGVTTDLTACNSNSTSTSSATSPPGGRSAD----------QNGRADRISLTGVTIL  136

Query  198  FFVVLSF  178
            FF  +S 
Sbjct  137  FFFSISM  143



>ref|XP_006440389.1| hypothetical protein CICLE_v10022260mg [Citrus clementina]
 gb|ESR53629.1| hypothetical protein CICLE_v10022260mg [Citrus clementina]
Length=208

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC  S  +T++ P  ECC  +KE V  EL CLCTL+    LLSS +++ ++A+
Sbjct  87   SCASKLVPCA-SFLNTTTKPNAECCNSIKEAVANELPCLCTLYNTPGLLSSFHVSLEDAL  145

Query  381  GLAKKCGAQADSDMCKN  331
             L + C   +D   CKN
Sbjct  146  RLTRDCNVPSDLSSCKN  162



>ref|NP_001147608.1| lipid binding protein precursor [Zea mays]
 gb|ACG28064.1| lipid binding protein [Zea mays]
Length=149

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C  KL PC   M +T+  PP  CC P+K+ V  +L CLC L+ +  +  + N++ D A+G
Sbjct  30   CAEKLIPCSPYM-NTTGTPPDTCCGPLKDAVQNDLKCLCDLYASPEIFKAFNISLDQALG  88

Query  378  LAKKCGAQADSDMCKNVALSPS  313
            L+K+CG    +  CK   LSP+
Sbjct  89   LSKRCGLSDTTAACKG--LSPT  108



>ref|XP_006477262.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Citrus sinensis]
Length=207

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC  +  ++++ P  ECC  +KE V  EL CLCTL+    LLSS N++ ++A+
Sbjct  87   SCASKLVPCA-TFLNSTTKPNAECCNSIKEAVANELPCLCTLYNTPGLLSSFNVSLEDAL  145

Query  381  GLAKKCGAQADSDMCKN  331
             L + C   +D   CKN
Sbjct  146  RLTRNCNVPSDLSSCKN  162



>gb|AFW75950.1| lipid binding protein [Zea mays]
Length=149

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C  KL PC   M +T+  PP  CC P+K+ V  +L CLC L+ +  +  + N++ D A+G
Sbjct  30   CAEKLIPCSPYM-NTTGTPPDTCCGPLKDAVQNDLKCLCDLYASPEIFKAFNISLDQALG  88

Query  378  LAKKCGAQADSDMCKNVALSPS  313
            L+K+CG    +  CK   LSP+
Sbjct  89   LSKRCGLSDTTAACKG--LSPT  108



>ref|XP_010473501.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Camelina 
sativa]
Length=151

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 16/130 (12%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + + ++ P   CC  +KE V KELSCLCT++    LL++ N++ D A+G
Sbjct  29   CVSKLVPCFNFL-NVTTKPSKVCCDSIKEAVEKELSCLCTIYTTPGLLANFNVSTDQALG  87

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTP---ASEEEKSGASNQRKLASQ  208
            L+ +C  + +   C            NA  + S   S P    +   K+ A    KLA  
Sbjct  88   LSNRCDVKTNLSAC------------NAKGAPSPKASLPPPAGNNNTKNDAGAGNKLAGY  135

Query  207  SALFFVVLSF  178
              +  VVLS 
Sbjct  136  GVVTTVVLSL  145



>ref|XP_010419182.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=145

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 0/99 (0%)
 Frame = -2

Query  603  LDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQND  424
            L +      N   MAC+ KL PCQ  +   +  PP  CC P+K +V  +  CLCT+F N 
Sbjct  16   LYSVQTTAQNPQAMACVQKLLPCQPYVHSVNPPPPSSCCGPLKAMVETDAQCLCTVFNNP  75

Query  423  ALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSAS  307
             +L ++N+TK+NA+ L K CG   D  +C  +A SP+++
Sbjct  76   EILKALNLTKENALDLPKACGTNPDVSLCAKLASSPTSA  114



>ref|NP_177182.2| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 gb|AEE35037.1| putative receptor serine/threonine kinase [Arabidopsis thaliana]
Length=799

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++K+ PC + + +T++ P  +CC  +KE + K+ SCLCT++    LL+  N+T D A+G
Sbjct  23   CVSKIVPCFRFL-NTTTKPSTDCCNSIKEAMEKDFSCLCTIYNTPGLLAQFNITTDQALG  81

Query  378  LAKKCGAQADSDMC  337
            L  +CG   D   C
Sbjct  82   LNLRCGVNTDLSAC  95



>ref|XP_010459441.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=183

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+ KL PCQ  +   S  PPP CC P++E+V  ++ CLC++F N  +L S+N+TK+NA
Sbjct  41   LPCIQKLMPCQPYLHSVSPPPPPSCCMPLREIVDSDVMCLCSVFNNVDMLKSLNLTKENA  100

Query  384  IGLAKKCGAQADSDMCKNVA  325
            + L   CGA+AD   CKN A
Sbjct  101  LVLPNACGAKADVSQCKNSA  120



>ref|XP_010418278.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Camelina 
sativa]
Length=150

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 66/123 (54%), Gaps = 2/123 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + + ++ P   CC  +KE V KELSCLCT++    LL++ N++ D A+G
Sbjct  29   CVSKLVPCFNFL-NVTTKPSKVCCDSIKEAVEKELSCLCTIYTTPGLLANFNVSTDQALG  87

Query  378  LAKKCGAQADSDMCK-NVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
            L+ +C  + +   C    A SP AS      +++ + +   ++    G      L+  S+
Sbjct  88   LSNRCDVKTNLSACNAKGAPSPKASLPPPGNNNTKNDAGAGNKLAGYGVVTTVSLSLISS  147

Query  201  LFF  193
            +FF
Sbjct  148  IFF  150



>ref|XP_010676203.1| PREDICTED: lipid transfer-like protein VAS [Beta vulgaris subsp. 
vulgaris]
Length=157

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M+C+  L PC + +  T+  PP  CC P+K     +L+CLC+  QN +L ++ N+    A
Sbjct  31   MSCIQALMPCAQFINATT--PPATCCEPLKLAFDTQLACLCSTLQNPSLAAAANVNMTEA  88

Query  384  IGLAKKCGAQADSDMC-KNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQ  208
            + L  KCG  A++++C K  A +P+     A V+   + +TP    E + AS+     S 
Sbjct  89   MELPIKCGINANANVCNKGQAKAPAL----APVAGGPASTTPNPGAESNAASSTIWTGSI  144

Query  207  SALFFVVLSF  178
            S L  ++  F
Sbjct  145  SGLMLLLAGF  154



>ref|XP_003608773.1| Lipid transfer-like protein VAS [Medicago truncatula]
Length=119

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 2/85 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C   L PC   +   S+ PP  CC P+K+ V  EL+CLC LF    LL++ N+    A+
Sbjct  30   SCATNLIPCADYL--NSTKPPSSCCDPIKKTVETELTCLCNLFYAPGLLATFNINTTQAL  87

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             L++ CG   D   CK+   +P+ +
Sbjct  88   ALSRNCGVTTDLTTCKHNGSAPAPT  112



>gb|EYU24773.1| hypothetical protein MIMGU_mgv1a014610mg [Erythranthe guttata]
Length=184

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = -2

Query  606  VLDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQN  427
            VL A++ V    G   C +KL PC   +  T+  P  ECC+ +KEVVT +L CLC L+ N
Sbjct  52   VLAASSRVAE--GQQDCASKLVPCAAYLNSTT--PSAECCSSIKEVVTTQLECLCRLYAN  107

Query  426  DALLSSVNMTKDNAIGLAKKCGAQADSDMCK  334
              LL  +NMT+  A+ + K C    D++ CK
Sbjct  108  PGLLPGINMTQ--ALMIPKYCNLSTDTNACK  136



>ref|XP_004244575.1| PREDICTED: protein YLS3-like [Solanum lycopersicum]
Length=151

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = -2

Query  567  PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            P +C +KL PC   +   SS PP ECC P++E +T +L CLC L++N  LL S+ +    
Sbjct  28   PPSCASKLVPCAPYL--NSSSPPAECCDPLREAITNDLDCLCKLYENPTLLPSLGINITQ  85

Query  387  AIGLAKKCGAQADSDMCKN  331
            A+ L + C    D   C +
Sbjct  86   ALALPRACNIPGDLSACTS  104



>gb|EAZ02331.1| hypothetical protein OsI_24434 [Oryza sativa Indica Group]
Length=187

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -2

Query  588  DVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSS  409
            D G   G  +C +KL PC   +  T++ PP  CC P++E    E +CLC +  N A L +
Sbjct  33   DTGAAAGVPSCASKLVPCGGYLNATAAPPPASCCGPLREAAANETACLCAILTNKAALQA  92

Query  408  VNMTKDNAIGLAKKCGAQAD  349
              +  +  + LAK+CG   D
Sbjct  93   FGVAPEQGLLLAKRCGVTTD  112



>gb|AES90970.2| Lipid transfer protein [Medicago truncatula]
Length=141

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C   L PC   +   S+ PP  CC P+K+ V  EL+CLC LF    LL++ N+    A+
Sbjct  30   SCATNLIPCADYL--NSTKPPSSCCDPIKKTVETELTCLCNLFYAPGLLATFNINTTQAL  87

Query  381  GLAKKCGAQADSDMCKNVALSPS  313
             L++ CG   D   CK+   +P+
Sbjct  88   ALSRNCGVTTDLTTCKHNGSAPA  110



>ref|XP_009780737.1| PREDICTED: lipid transfer-like protein VAS [Nicotiana sylvestris]
Length=151

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 41/79 (52%), Gaps = 2/79 (3%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C  KL PC   +   S+ PP ECC P+KE +T EL CLC L++N  LL S  +    A+
Sbjct  30   SCAMKLVPCAPYL--NSTKPPAECCDPLKEAITNELDCLCKLYENPTLLPSFGINITQAL  87

Query  381  GLAKKCGAQADSDMCKNVA  325
             L K C    D   C   A
Sbjct  88   ALPKACNIPGDLSSCNGKA  106



>ref|XP_011033914.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Populus 
euphratica]
Length=145

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C  KL PCQ  +A T++ PP  CC P+KE V KEL CLC L+ +  L  S+ +    A+
Sbjct  33   SCATKLAPCQPFLATTTT-PPDSCCNPIKEAVAKELPCLCKLYNDPNLFPSLGINVTQAV  91

Query  381  GLAKKCGAQADSDMC  337
             L+++CG   +   C
Sbjct  92   MLSQRCGVTTNLSSC  106



>ref|XP_008810423.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Phoenix 
dactylifera]
Length=161

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 9/103 (9%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC +KL PC   +  TS  PP  CC P+K+    E +CLC+LF +  +L +  +  + A+
Sbjct  35   ACASKLVPCANYLNSTS--PPESCCGPLKQAAKDETACLCSLFNDKTVLQAFKVDIEQAL  92

Query  381  GLAKKCGAQADSDMCKN-----VALSPSASQLNAAVSSSDSKS  268
             LAK CG  A + +C        A +PS S  NA  +SS +K+
Sbjct  93   KLAKNCGVDAGTSICSKSNTTATASTPSGS--NATTASSVAKN  133



>ref|XP_006368690.1| hypothetical protein POPTR_0001s07810g [Populus trichocarpa]
 gb|ERP65259.1| hypothetical protein POPTR_0001s07810g [Populus trichocarpa]
Length=149

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PCQ  ++ T++ PP  CC  +KE V  EL CLC L+ +  L  S+ +    A+
Sbjct  33   SCASKLVPCQAYLS-TTTQPPDSCCNSIKEAVANELPCLCKLYNDPNLFQSLGINVTQAL  91

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             L+++CG   D   C   A +P+ S
Sbjct  92   MLSRRCGVTTDLTSCSASAPTPAGS  116



>ref|XP_009117619.1| PREDICTED: lipid transfer-like protein VAS [Brassica rapa]
Length=181

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +      PPP CC P+K +V  + +CLC++F N  +L S+N+TKDNA
Sbjct  40   MPCIQKLMPCQPFLHSVIPPPPPSCCLPLKAIVANDATCLCSVFNNVDMLKSLNLTKDNA  99

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTP  262
            + L K CGA  D  +CK       AS      ++S S +TP
Sbjct  100  LDLPKACGANPDISLCK-------ASPAGGTTTNSTSPATP  133



>ref|XP_011018244.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Populus 
euphratica]
Length=148

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PCQ  ++ T++ PP  CC  +KE V  EL CLC ++ +  L  S+ +    A+
Sbjct  33   SCASKLVPCQAYLS-TTTQPPDTCCNSIKEAVANELPCLCKIYNDPTLFQSLGINVTQAV  91

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             L+++CG   D   C   A +P+ S
Sbjct  92   MLSQRCGVTTDLSSCSASAPTPAGS  116



>ref|XP_011018245.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Populus 
euphratica]
Length=147

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PCQ  ++ T++ PP  CC  +KE V  EL CLC ++ +  L  S+ +    A+
Sbjct  33   SCASKLVPCQAYLS-TTTQPPDTCCNSIKEAVANELPCLCKIYNDPTLFQSLGINVTQAV  91

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             L+++CG   D   C   A +P+ S
Sbjct  92   MLSQRCGVTTDLSSCSASAPTPAGS  116



>ref|XP_006355523.1| PREDICTED: lipid transfer-like protein VAS-like [Solanum tuberosum]
Length=119

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC+  + +++S P   CC P++E VT++L C+C LF+N  LL S+ +     I
Sbjct  26   SCASKLIPCEPFL-NSTSKPSASCCDPLREAVTEDLQCICKLFENPTLLPSLGINITQVI  84

Query  381  GLAKKCGAQADSDMCK  334
             L K C    D + CK
Sbjct  85   ALLKNCNIPGDVNTCK  100



>ref|NP_001058400.1| Os06g0686400 [Oryza sativa Japonica Group]
 dbj|BAD45573.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46043.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20314.1| Os06g0686400 [Oryza sativa Japonica Group]
 dbj|BAG88598.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91561.1| unnamed protein product [Oryza sativa Japonica Group]
Length=125

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC + M  T + PP  CC P+KE V  EL CLC L+ +  +  + N+   +A+
Sbjct  34   SCASKLVPCAQYMNGTDT-PPAACCDPLKEAVKNELKCLCDLYASPEIFKAFNINISDAL  92

Query  381  GLAKKCGAQADSDMCK-NVALSPSASQL  301
             L+ +CG    + MC  N  + PS+S  
Sbjct  93   RLSTRCGISQTTSMCPGNQLILPSSSSF  120



>ref|XP_010418277.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Camelina 
sativa]
Length=151

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   + + ++ P   CC  +KE V KELSCLCT++    LL++ N++ D A+G
Sbjct  29   CVSKLVPCFNFL-NVTTKPSKVCCDSIKEAVEKELSCLCTIYTTPGLLANFNVSTDQALG  87

Query  378  LAKKCGAQADSDMCK-NVALSPSAS  307
            L+ +C  + +   C    A SP AS
Sbjct  88   LSNRCDVKTNLSACNAKGAPSPKAS  112



>gb|KHG06072.1| Lipid transfer-like protein VAS [Gossypium arboreum]
Length=141

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C   L PC   + + ++ P  +CC P+++ V  +L+CLC LF +  LLSS N++   A+ 
Sbjct  28   CAQSLVPCAPYLNNATAQPQDDCCNPIRQAVDTQLTCLCNLFNDPTLLSSFNVSVSEALR  87

Query  378  LAKKCGAQADSDMCKN  331
            +A++CG     + C N
Sbjct  88   IARECGVTTGLNACNN  103



>gb|EYU40261.1| hypothetical protein MIMGU_mgv11b0165481mg, partial [Erythranthe 
guttata]
Length=237

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKD  391
            G   C +KL PC   +  T+  P  ECC+ +KEVVT +L CLC L+ N  LL  +NMT+ 
Sbjct  27   GQADCASKLVPCAAYLNSTT--PSAECCSSIKEVVTTQLECLCRLYANPGLLPGINMTQ-  83

Query  390  NAIGLAKKCGAQADSDMCK  334
             A+ + K C    D++ CK
Sbjct  84   -ALMIPKYCNLSTDTNACK  101



>ref|XP_006657264.1| PREDICTED: lipid transfer-like protein VAS-like, partial [Oryza 
brachyantha]
Length=115

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = -2

Query  552  AKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGLA  373
            AKL PC + M  T + PP  CC P+KE V  EL CLC L+ +  +  + N+   +A+ L+
Sbjct  2    AKLVPCAQYMNGTDT-PPAACCDPLKEAVKSELKCLCDLYASPEIFKAFNINITDALRLS  60

Query  372  KKCGAQADSDMC  337
            K+CG    + MC
Sbjct  61   KRCGISETTSMC  72



>emb|CDY68945.1| BnaC06g43950D [Brassica napus]
Length=137

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+AKL PC +   ++ + PP  CC P++++V  + +CLC  F++  +L+ +++T++ A+ 
Sbjct  34   CVAKLTPC-RPYVNSEAPPPLWCCHPLRKIVENDATCLCEAFKHSDMLALIHLTQEAALN  92

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSS  280
            L   CG   D+  C   + S S S+ NAA++ S
Sbjct  93   LISSCGVSYDASSCDAESSSVSTSK-NAALAIS  124



>ref|XP_009113045.1| PREDICTED: protein YLS3 isoform X2 [Brassica rapa]
 emb|CDY46923.1| BnaA09g12710D [Brassica napus]
Length=150

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PC  ++  T++ PP +CC  +KE V  EL CLCT++    LLS  N++   A+ 
Sbjct  31   CVNKLVPCFSALT-TTTKPPKDCCDSIKEAVEDELPCLCTVYNTPGLLSQFNVSTAQALN  89

Query  378  LAKKCGAQADSDMCKNV-ALSPSAS  307
            L+++C    D   C    A SP AS
Sbjct  90   LSRRCDVTTDLSACSGTGASSPKAS  114



>ref|NP_001058554.1| Os06g0711900 [Oryza sativa Japonica Group]
 dbj|BAF20468.1| Os06g0711900 [Oryza sativa Japonica Group]
 dbj|BAG97391.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -2

Query  588  DVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSS  409
            D G   G  +C +KL PC   +  T++ PP  CC P++E    E +CLC +  N A L +
Sbjct  33   DTGAAAGVPSCASKLVPCGGYLNATAAPPPASCCGPLREAAANETACLCAILTNKAALQA  92

Query  408  VNMTKDNAIGLAKKCGAQAD  349
              +  +  + LAK+CG   D
Sbjct  93   FGVAPEQGLLLAKRCGVTTD  112



>ref|XP_004515744.1| PREDICTED: lipid transfer-like protein VAS-like [Cicer arietinum]
Length=154

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            G    P +C A+L PC   +   S  PP  CC P+K+ V  +L CLC LF +   L S+N
Sbjct  30   GQTSDPPSCAAQLVPCADFL--NSKKPPSSCCDPLKKTVETQLKCLCDLFYSPGFLQSLN  87

Query  402  MTKDNAIGLAKKCGAQADSDMCK  334
            +   +A+ L++ CG   D   CK
Sbjct  88   INTTSALQLSRNCGVTTDLTTCK  110



>ref|XP_009113047.1| PREDICTED: protein YLS3 isoform X4 [Brassica rapa]
Length=149

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PC  ++  T++ PP +CC  +KE V  EL CLCT++    LLS  N++   A+ 
Sbjct  31   CVNKLVPCFSALT-TTTKPPKDCCDSIKEAVEDELPCLCTVYNTPGLLSQFNVSTAQALN  89

Query  378  LAKKCGAQADSDMCKNV-ALSPSAS  307
            L+++C    D   C    A SP AS
Sbjct  90   LSRRCDVTTDLSACSGTGASSPKAS  114



>emb|CDY31846.1| BnaC09g13030D [Brassica napus]
Length=150

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PC  ++  T++ PP +CC  +KE V  EL CLCT++    LLS  N++   A+ 
Sbjct  31   CVNKLVPCFSALT-TTTKPPKDCCDSIKEAVEDELPCLCTVYNTPGLLSQFNVSTAQALN  89

Query  378  LAKKCGAQADSDMCKNV-ALSPSAS  307
            L+++C    D   C    A SP AS
Sbjct  90   LSRRCDVTTDLSACSGTGASSPKAS  114



>ref|XP_009418712.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=153

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C +KL  C + +   S+ PP  CC P+K+    +L CLC LF N A+L + N+    A+ 
Sbjct  29   CASKLVGCAQYL--NSTTPPDTCCGPLKQEAKDDLPCLCALFNNTAVLKAFNVNITQALQ  86

Query  378  LAKKCGAQADSDMCKNV  328
            +AK+CG  AD   C  V
Sbjct  87   MAKRCGVNADQSTCATV  103



>gb|KHN04327.1| Lipid transfer-like protein VAS [Glycine soja]
Length=145

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 13/127 (10%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C  +L PC   +  T  +PP  CC P+K  V  EL+CLC ++ +  LL SVN+T    + 
Sbjct  31   CAQELIPCLDYLNGTI-NPPSSCCDPLKRTVQNELACLCNIYFSPGLLQSVNVT---VLA  86

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L+++CG  +D   CKN +          A  S    +TP  ++  +G      L S   L
Sbjct  87   LSRRCGVTSDLSSCKNGS--------APAPGSRPPPATPGGDKGGAGTVTFTGL-SFLLL  137

Query  198  FFVVLSF  178
            F+V + F
Sbjct  138  FWVSMLF  144



>gb|EMT04784.1| hypothetical protein F775_06296 [Aegilops tauschii]
Length=189

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 55/118 (47%), Gaps = 1/118 (1%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSMADTSSDPPPE-CCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G  AC +KL  C   M  T +  PPE CC P+++ V  E  CLC L+ +  +  + N+  
Sbjct  28   GTPACASKLTGCAGYMNGTDAQKPPETCCGPLRDAVKNEKPCLCALYASPEIFKAFNINV  87

Query  393  DNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRK  220
             +A+ L+K+CG   D   C    L P A  +  ++    S    +  E  S    +R+
Sbjct  88   TDALRLSKRCGVSEDVSSCPIYILLPFADLVAFSIHRHLSDEVSSRFEFFSIRWQERR  145



>ref|XP_004245725.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Solanum 
lycopersicum]
Length=151

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C ++L PC   +   S+ PP  CC P++E VTK+L CLC L++N ALL S+ +    AI
Sbjct  30   SCASQLVPCAAFL--NSTKPPASCCDPLREAVTKDLQCLCKLYENPALLISLGINVTQAI  87

Query  381  GLAKKCGAQAD  349
             L K C    D
Sbjct  88   ELPKYCNIPGD  98



>ref|XP_010471415.1| PREDICTED: uncharacterized protein LOC104751205 [Camelina sativa]
Length=153

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (52%), Gaps = 2/97 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PCQ  +      P   CC PMKE+V KE +CLC  F +  +L  + +TK+ A+ 
Sbjct  35   CVTKLLPCQPYI-HLPIPPSSWCCAPMKEIVEKETTCLCAAFNHPDMLRFIALTKETALN  93

Query  378  LAKKCGAQAD-SDMCKNVALSPSASQLNAAVSSSDSK  271
            L   CG + D S +C     S  +S   AA + S  +
Sbjct  94   LLSSCGIKHDLSSVCTRTNASSPSSLPEAAANGSSKR  130



>ref|XP_004512757.1| PREDICTED: uncharacterized protein LOC101495737 [Cicer arietinum]
Length=166

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM KL PCQ  + +  ++P P CC+P+ E+      CLC L  N  L  S++++KD  + 
Sbjct  41   CMQKLLPCQPYLKN-PTNPSPACCSPLNEIAINSSDCLCNLMNNPKLFLSLDVSKDEILK  99

Query  378  LAKKCGAQADSDMCKNVALSPSASQLN  298
            L   CG   D+  C      P+ S+++
Sbjct  100  LPNACGINVDTSKCNAEGTVPTPSEVD  126



>ref|XP_009418714.1| PREDICTED: lipid transfer-like protein VAS isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=149

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C +KL  C + +   S+ PP  CC P+K+    +L CLC LF N A+L + N+    A+ 
Sbjct  29   CASKLVGCAQYL--NSTTPPDTCCGPLKQEAKDDLPCLCALFNNTAVLKAFNVNITQALQ  86

Query  378  LAKKCGAQADSDMCKNV  328
            +AK+CG  AD   C  V
Sbjct  87   MAKRCGVNADQSTCATV  103



>ref|XP_009106013.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Brassica 
rapa]
 emb|CDY41256.1| BnaA01g12830D [Brassica napus]
 emb|CDX96482.1| BnaA07g30930D [Brassica napus]
Length=137

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+AKL PC +   ++ + PP  CC P++++V  + +CLC  F++  +L+ +++T++ A+ 
Sbjct  34   CVAKLTPC-RPYVNSEAPPPLWCCHPLRKIVENDATCLCEAFKHPDMLALIHLTQEAALN  92

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSS  280
            L   CG   D+  C   + S S S+ NAA++ S
Sbjct  93   LISSCGVSYDASSCDAESSSVSTSK-NAALAIS  124



>ref|XP_002303524.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEE78503.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=151

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C  KL  CQ  +A T++ PP  CC P+KE V KEL CLC L+ +  L  S+ +    A+
Sbjct  39   SCATKLTACQAFLATTTT-PPDNCCNPIKEAVAKELPCLCKLYNDPNLFPSLGINVTQAV  97

Query  381  GLAKKCGAQADSDMC  337
             L+++CG   +   C
Sbjct  98   NLSQRCGVTTNLTSC  112



>ref|XP_008810424.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Phoenix 
dactylifera]
Length=142

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC +KL PC   +  TS  PP  CC P+K+    E +CLC+LF +  +L +  +  + A+
Sbjct  35   ACASKLVPCANYLNSTS--PPESCCGPLKQAAKDETACLCSLFNDKTVLQAFKVDIEQAL  92

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             LAK CG  A + +C     + +AS
Sbjct  93   KLAKNCGVDAGTSICSKSNTTATAS  117



>gb|ABK94554.1| unknown [Populus trichocarpa]
Length=151

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C  KL  CQ  +A T++ PP  CC P+KE V KEL CLC L+ +  L  S+ +    A+
Sbjct  39   SCATKLTACQAFLATTTT-PPDNCCNPIKEAVAKELPCLCKLYNDPNLFPSLGINVTQAV  97

Query  381  GLAKKCGAQADSDMC  337
             L+++CG   +   C
Sbjct  98   NLSQRCGVTTNLTSC  112



>ref|XP_003549896.1| PREDICTED: lipid transfer-like protein VAS-like [Glycine max]
Length=151

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = -2

Query  573  GGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G    C  +L PC   +  T++ PP  CC P+K+ V  +L CLC +F +  LL S N++ 
Sbjct  29   GSSTTCAQELIPCVNFLNGTTT-PPSSCCDPLKQTVENQLDCLCNIFFSPGLLQSFNVSV  87

Query  393  DNAIGLAKKCGAQADSDMCKN  331
            D A+ L+++CG       C N
Sbjct  88   DQALALSRRCGVTNGITSCTN  108



>ref|XP_009362117.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Pyrus 
x bretschneideri]
Length=154

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 63/133 (47%), Gaps = 10/133 (8%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
             C   L PC   + ++++ P   CCT +K+ V  +L CLC LF    LL S+     +A+
Sbjct  31   GCAQDLLPCADYL-NSTAQPSATCCTAIKQTVATQLPCLCNLFYTPGLLESLGSNITSAL  89

Query  381  GLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
             +A  CG   D+  CK   ++P+ S   A V   +   TP +++  SG          + 
Sbjct  90   RIATACGQSLDTSKCKTAVVAPTQSPPAATV---NLAGTPGNDDGGSGR------VEWTG  140

Query  201  LFFVVLSFPGLMM  163
             F +VL +  +M+
Sbjct  141  FFALVLLWASVML  153



>ref|XP_004245724.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Solanum 
lycopersicum]
Length=167

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC   + +++S P   CC P++E VTK+L C+C LF+N  LL S+ +     I
Sbjct  30   SCASKLVPCAPFL-NSTSKPLASCCDPLREAVTKDLQCICKLFENPTLLPSLGINVTQVI  88

Query  381  GLAKKCGAQADSDMCK  334
             L K C    + + CK
Sbjct  89   ALLKNCNIPGNVNTCK  104



>gb|KHN09781.1| Lipid transfer-like protein VAS [Glycine soja]
Length=151

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = -2

Query  573  GGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G    C  +L PC   +  T++ PP  CC P+K+ V  +L CLC +F +  LL S N++ 
Sbjct  29   GTSTTCAQELIPCVNFLNGTTT-PPSSCCDPLKQTVENQLDCLCNIFFSPGLLQSFNVSV  87

Query  393  DNAIGLAKKCGAQADSDMCKN  331
            D A+ L+++CG       C N
Sbjct  88   DQALALSRRCGVTNGITSCTN  108



>ref|XP_008448898.1| PREDICTED: lipid transfer-like protein VAS [Cucumis melo]
Length=148

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 54/114 (47%), Gaps = 9/114 (8%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC   +   S++PP  CC P+KE V  +L CLC L+    LL+S  +   +AI 
Sbjct  33   CVSKLTPCVDFL--KSNNPPATCCDPIKEAVATQLPCLCNLYVTPGLLNSFGVNVSDAIH  90

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKL  217
            L   CG   +   CK  A +P          +      P ++ +K G++    L
Sbjct  91   LTNACGVPVELSKCKTGAPAPQQ-------GAPSPPGVPGNDAQKFGSTGITSL  137



>ref|XP_009392040.1| PREDICTED: lipid transfer-like protein VAS [Musa acuminata subsp. 
malaccensis]
Length=139

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = -2

Query  606  VLDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQN  427
            V D   DVG       C+ KL PC   +  +   PP  CC P+   + +E+ CLC LF +
Sbjct  22   VSDGDTDVGVP----PCVRKLLPCLDYLR-SQEKPPAACCVPLGSALDEEIECLCKLFFD  76

Query  426  DALLSSVNMTKDNAIGLAKKCGAQA-DSDMCKNVALSPSASQLNAAVSSSDSKSTP  262
            D LL S+N+++   +G   +CG +A D   CK  + +P  + +    SS  + STP
Sbjct  77   DHLLESLNISQSQILGFPPRCGLKAPDVTKCKFSSDAPKPNPIPPHASSPPT-STP  131



>ref|XP_003563447.1| PREDICTED: lipid transfer-like protein VAS [Brachypodium distachyon]
Length=153

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 61/134 (46%), Gaps = 19/134 (14%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSMADTSSDPPPE-CCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G  AC +KL  C   M  T ++ PP+ CC P+KE V  EL CLC L+    +  + N+  
Sbjct  32   GTPACASKLVACGPYMNGTDAEKPPDTCCDPLKEAVKNELPCLCALYAMPEIFKAFNIKL  91

Query  393  DNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQR---  223
             +A+ L+K+CG    +  C                S+S ++S P S      A ++    
Sbjct  92   SDALRLSKRCGVSDTTSSCP---------------STSPTRSPPGSPSGGKNAGHRGISV  136

Query  222  KLASQSALFFVVLS  181
              A   +LF VV S
Sbjct  137  SFAGLMSLFLVVWS  150



>ref|XP_009113046.1| PREDICTED: protein YLS3 isoform X3 [Brassica rapa]
Length=150

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 3/86 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PC  ++  T++ PP +CC  +KE V  EL CLCT++    LLS  N++   A+ 
Sbjct  31   CVNKLVPCFSALT-TTTKPPKDCCDSIKEAVEDELPCLCTVYNTPGLLSQFNVSTAQALN  89

Query  378  LAKKCGAQADSDMCKNV--ALSPSAS  307
            L+++C    D   C     A SP AS
Sbjct  90   LSRRCDVTTDLSACSGSTGASSPKAS  115



>ref|XP_004309123.1| PREDICTED: uncharacterized protein LOC101312012 [Fragaria vesca 
subsp. vesca]
Length=162

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 6/91 (7%)
 Frame = -2

Query  612  QSVLDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPE-CCTPMKEVVT-KELSCLCT  439
            Q  LD   D+ G   P  CM KL PCQ     T++DP PE CC P+++++   +  C+C 
Sbjct  23   QLTLDLDEDIKG---PFPCMQKLAPCQ-VRNQTTNDPVPETCCKPLRDMLLGDDKKCICD  78

Query  438  LFQNDALLSSVNMTKDNAIGLAKKCGAQADS  346
             F +  +L  +N T+DNA+ L   CG Q  S
Sbjct  79   AFSDPMVLKKLNSTQDNAMDLVYYCGGQHKS  109



>ref|XP_009113044.1| PREDICTED: protein YLS3 isoform X1 [Brassica rapa]
Length=151

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 3/86 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PC  ++  T++ PP +CC  +KE V  EL CLCT++    LLS  N++   A+ 
Sbjct  31   CVNKLVPCFSALT-TTTKPPKDCCDSIKEAVEDELPCLCTVYNTPGLLSQFNVSTAQALN  89

Query  378  LAKKCGAQADSDMCKNV--ALSPSAS  307
            L+++C    D   C     A SP AS
Sbjct  90   LSRRCDVTTDLSACSGSTGASSPKAS  115



>dbj|BAK01511.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90962.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01130.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSMADTSSDPPPE-CCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G  AC +KL  C  SM  T ++ PPE CC P+++ V  E +CLC L+ +  +  + N+  
Sbjct  29   GTPACASKLVGCASSMNGTDAEKPPETCCGPLRDAVKNERACLCALYASPEIFKAFNINV  88

Query  393  DNAIGLAKKCGAQADSDMC  337
             +A+ L+K+CG   D   C
Sbjct  89   TDALRLSKRCGVTEDVSSC  107



>ref|XP_009384645.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=153

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C + L PC  S   ++S PP ECCTP+K+ V  +L CLC +  +  ++ + N++ D   
Sbjct  37   SCASNLVPC-SSYVHSTSTPPAECCTPLKQAVDNDLQCLCAVLNDATVMKAFNISTDEGF  95

Query  381  GLAKKCGAQADSDMCKN  331
             LA+ CG    SD C N
Sbjct  96   RLARSCGISNLSD-CSN  111



>ref|XP_002322118.2| hypothetical protein POPTR_0015s04850g [Populus trichocarpa]
 gb|EEF06245.2| hypothetical protein POPTR_0015s04850g [Populus trichocarpa]
Length=162

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 72/140 (51%), Gaps = 3/140 (2%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG    M+C+  L PC+  +  T   PP  CC P+K++V  +  CLC+   N  LL   N
Sbjct  23   GGEALEMSCIQNLLPCKPYLPGTEPPPP-VCCLPLKDMVAHQAQCLCSALANPDLLKDFN  81

Query  402  MTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQR  223
            +T D A+ LAK CGA  D  +CKN A SPS S    +  ++++ +TP+       ++   
Sbjct  82   VTMDGALKLAKTCGASVDMSVCKN-ATSPSGSPAKPSTPTTNA-TTPSGSNTTPKSAANY  139

Query  222  KLASQSALFFVVLSFPGLMM  163
            ++A      FV   F GL+ 
Sbjct  140  EIAHFGGSGFVAAIFLGLIF  159



>ref|XP_009384644.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=154

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C + L PC  S   ++S PP ECCTP+K+ V  +L CLC +  +  ++ + N++ D   
Sbjct  37   SCASNLVPC-SSYVHSTSTPPAECCTPLKQAVDNDLQCLCAVLNDATVMKAFNISTDEGF  95

Query  381  GLAKKCGAQADSDMCKN  331
             LA+ CG    SD C N
Sbjct  96   RLARSCGISNLSD-CSN  111



>ref|XP_009395389.1| PREDICTED: lipid transfer-like protein VAS [Musa acuminata subsp. 
malaccensis]
Length=155

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -2

Query  567  PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            P  C++ L  C   +  T++ PP  CC P+K+    +L CLC+LF N A+L + N+    
Sbjct  27   PPDCVSNLVGCAGYLNSTTT-PPDSCCKPLKQAAKTQLPCLCSLFNNTAVLRAFNVNITQ  85

Query  387  AIGLAKKCGAQADSDMCK  334
            AI ++K+CG   D   C+
Sbjct  86   AIQMSKRCGVSTDQRACE  103



>ref|XP_010431510.1| PREDICTED: uncharacterized protein LOC104715836 [Camelina sativa]
Length=152

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C+ KL PCQ  +      P   CC PMKE+  KE +CLC    +  +L  + +TK+ A
Sbjct  33   MRCVTKLLPCQPYI-HLPIPPSSWCCAPMKEIAEKETTCLCAAVNHPDMLRFIALTKEAA  91

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKS  268
            + L   CG   D  +C     S  AS   AA + S  ++
Sbjct  92   LNLLSSCGINHDLSVCNKTNASSPASLPEAAANGSSKRN  130



>gb|EAZ02139.1| hypothetical protein OsI_24230 [Oryza sativa Indica Group]
Length=150

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC + M  T + PP  CC P+KE V  EL CLC L+ +  +    N+   +A+
Sbjct  34   SCASKLVPCAQYMNGTDT-PPAACCDPLKEAVKNELKCLCDLYASPQIFKVFNINISDAL  92

Query  381  GLAKKCGAQADSDMC  337
             L+ +CG    + MC
Sbjct  93   RLSTRCGISQTTSMC  107



>ref|NP_001237428.1| uncharacterized protein LOC100305582 precursor [Glycine max]
 gb|ACU13334.1| unknown [Glycine max]
Length=185

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM +L PCQ+ +  + ++P P CC P+KE+      CLC    +  L  S+  +KD  + 
Sbjct  50   CMQRLLPCQEYL-KSPNNPSPACCEPLKEMQENNTQCLCNFVNSTTLFQSLGGSKDEILK  108

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L + CG   D   C N       SQ  ++ ++S+ +   + EE     S+ + +     +
Sbjct  109  LPQACGINFDPSKCNNTG--GGGSQEQSSTAASEGEYAVSEEETSESTSSTKMITPHGII  166

Query  198  FFVVLSFPGLM  166
            +F V  F  L+
Sbjct  167  YFGVPGFVALL  177



>ref|XP_009106011.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 
isoform X1 [Brassica rapa]
Length=150

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+AKL PC +   ++ + PP  CC P++++V  + +CLC  F++  +L+ +++T++ A+ 
Sbjct  34   CVAKLTPC-RPYVNSEAPPPLWCCHPLRKIVENDATCLCEAFKHPDMLALIHLTQEAALN  92

Query  378  LAKKCGAQADSDMC  337
            L   CG   D+  C
Sbjct  93   LISSCGVSYDASSC  106



>gb|KHG14207.1| Lipid transfer-like protein VAS [Gossypium arboreum]
Length=138

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 61/128 (48%), Gaps = 17/128 (13%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C   L  C   + + ++ P  +CC P+++ V K+L CLC L+ +   L+S N+T   A+
Sbjct  25   SCAQNLVSCYPYLNNATAKPEDDCCNPIRQTVAKDLPCLCNLYNDPNTLASFNVTVPEAL  84

Query  381  GLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
             ++++CG   D   C              A S + + S P     +SG +++  L     
Sbjct  85   RISRECGVSTDLSACN-------------ATSPTSAPSPPG----QSGGADRIALTGVIT  127

Query  201  LFFVVLSF  178
            LF V++S 
Sbjct  128  LFLVLVSI  135



>ref|XP_006302963.1| hypothetical protein CARUB_v10021100mg [Capsella rubella]
 gb|EOA35861.1| hypothetical protein CARUB_v10021100mg [Capsella rubella]
Length=151

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 2/123 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC  S  + ++ P   CC  ++E V KELSCLCT++    LL+  N++   A+G
Sbjct  30   CVSKLVPCF-SYLNITTKPSKVCCDSIEEAVEKELSCLCTIYTTPGLLAQFNVSTAQALG  88

Query  378  LAKKCGAQADSDMCKNV-ALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
            L+ +C    +   C    A SP A+    A S++   +   ++    G +    L+  S+
Sbjct  89   LSSRCDVDTNISACNTKGAPSPKAALPPPAGSNTKKDAGAGNKVAGYGVATTVVLSLISS  148

Query  201  LFF  193
            +FF
Sbjct  149  IFF  151



>ref|XP_006838612.1| hypothetical protein AMTR_s00002p00228410 [Amborella trichopoda]
 gb|ERN01181.1| hypothetical protein AMTR_s00002p00228410 [Amborella trichopoda]
Length=150

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKD  391
            G   C  KL PC   +  T+  P  ECC  +K+ +  EL CLC LF + ++  S+N+ + 
Sbjct  23   GAQECANKLVPCASYLNSTT--PGKECCDDLKQAIETELPCLCALFNDPSVFKSLNINRT  80

Query  390  NAIGLAKKCGAQADSDMCKNVALSPSAS  307
             A+ L + CG ++ +  C + A +PSA+
Sbjct  81   QALLLPEHCGFKSTASACNSTAGAPSAN  108



>ref|XP_010053420.1| PREDICTED: lipid transfer-like protein VAS [Eucalyptus grandis]
Length=155

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M+C+ +L PC + + ++++ PP  CC P+K  V   + CLC ++    +L   N+     
Sbjct  39   MSCINRLVPCYQYL-NSTAKPPASCCNPLKADVAATIHCLCNMYGTPGMLQKYNINVTQV  97

Query  384  IGLAKKCGAQADSDMCKNVALSPSA  310
            + + + CG  + + +CK  A SP++
Sbjct  98   LRIGQGCGINSTTSVCKESAQSPAS  122



>ref|XP_010934412.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Elaeis 
guineensis]
Length=162

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (49%), Gaps = 17/105 (16%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C +KL PC   +  T+  PP  CC P+K+    +  CLC++F +  +L +  +  + A+ 
Sbjct  37   CASKLLPCANYLNTTT--PPESCCGPLKQAAKDDTDCLCSIFNDKTVLQAFKVDIEQALQ  94

Query  378  LAKKCGAQADSDMC---------------KNVALSPSASQLNAAV  289
            LAKKCG  A + +C                N   SP A  +N+AV
Sbjct  95   LAKKCGIDAGNSICAKSNATTTDSAPSVSNNTTASPEAKNVNSAV  139



>ref|XP_007155619.1| hypothetical protein PHAVU_003G217100g [Phaseolus vulgaris]
 gb|ESW27613.1| hypothetical protein PHAVU_003G217100g [Phaseolus vulgaris]
Length=148

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 65/129 (50%), Gaps = 14/129 (11%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C  +L PC   +  ++S PP  CC P+K  V  EL+CLC LF    LL + N++ D+A+ 
Sbjct  31   CAQELIPCMDYLNSSTSTPPSSCCDPLKRTVENELACLCNLFYTPGLLQTFNISIDDALA  90

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L+++CG  +D   C N A SP +S            + PA+     G + +   +  S L
Sbjct  91   LSRRCGVTSDLTSCNNGAPSPGSS------------APPATTGGDKGGAGKVTFSGISFL  138

Query  198  --FFVVLSF  178
              F+V + F
Sbjct  139  LMFWVSMLF  147



>gb|EPS61441.1| hypothetical protein M569_13357 [Genlisea aurea]
Length=138

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+++L  C   + ++++ P  ECCT + +V++ +L CLC L+QN  LL+ +N+++  A+ 
Sbjct  29   CISQLLSCAPFL-NSTAKPTSECCTAIGQVISTQLQCLCGLYQNPVLLTGINISQ--ALL  85

Query  378  LAKKCGAQADSDMCKN  331
            + K CG   D  +C N
Sbjct  86   IPKHCGIAGDVSLCNN  101



>ref|XP_002530788.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF31589.1| lipid binding protein, putative [Ricinus communis]
Length=181

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 5/139 (4%)
 Frame = -2

Query  591  ADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLS  412
            A  GG  G   C+ KL PC K    +++ PPP CC P+KE+V  E +CLC++  N  +L 
Sbjct  42   AGTGGGDGSQ-CVQKLLPC-KDYLRSATPPPPTCCMPLKEMVANEAACLCSVITNPGILK  99

Query  411  SVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGAS  232
            S N+T+ +A+ LAK CGA AD   CK+ + SP++  +    ++S + S  +S ++KS   
Sbjct  100  SFNITEQDALNLAKTCGANADLSTCKHDSPSPASPAVTPPAANSSTNS--SSPDKKSAGH  157

Query  231  NQRKLASQS-ALFFVVLSF  178
                L   S   FFV L F
Sbjct  158  KMYNLERTSFTAFFVALMF  176



>ref|XP_009362118.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Pyrus 
x bretschneideri]
Length=150

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 61/133 (46%), Gaps = 14/133 (11%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
             C   L PC   + ++++ P   CCT +K+ V  +L CLC LF    LL S+     +A+
Sbjct  31   GCAQDLLPCADYL-NSTAQPSATCCTAIKQTVATQLPCLCNLFYTPGLLESLGSNITSAL  89

Query  381  GLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
             +A  CG   D+  CK   ++P+ S   A         TP +++  SG          + 
Sbjct  90   RIATACGQSLDTSKCKTAVVAPTQSPPAA-------TGTPGNDDGGSGR------VEWTG  136

Query  201  LFFVVLSFPGLMM  163
             F +VL +  +M+
Sbjct  137  FFALVLLWASVML  149



>gb|KGN64183.1| hypothetical protein Csa_1G042900 [Cucumis sativus]
Length=175

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 9/114 (8%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM K+ PCQ         P   CC P+KE++  +L C C+ F +  +L  +N T+   + 
Sbjct  42   CMQKILPCQP-FFKLPEIPSSICCLPLKEMLVGDLQCFCSFFNDSEMLKVLNATQSQVLN  100

Query  378  LAKKCGA-QADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRK  220
            L K CGA  AD   C N A  P+        S+    S PA   + S A++ R+
Sbjct  101  LPKACGADDADISACDNDAQPPTG-------STDAPPSPPAKTADGSKANSSRR  147



>ref|XP_008369519.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Malus 
domestica]
Length=154

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 11/133 (8%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC   L PC   + ++++ P   CCT +K+ V  +L CLC LF    LL S+     +A+
Sbjct  31   ACAQDLLPCADYL-NSTAQPSATCCTAIKQTVATQLPCLCNLFYTPGLLESLGSNITSAL  89

Query  381  GLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
             +A  CG   D+  CK   ++P+ S   A V   +   TP +++   G S++ +      
Sbjct  90   RIANACGQSLDTSKCKTAVVAPTQSPPAATV---NLAGTPGNDD---GGSSRVEWTG---  140

Query  201  LFFVVLSFPGLMM  163
             FF  L F   +M
Sbjct  141  -FFAPLLFWASVM  152



>ref|XP_010934068.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Elaeis guineensis]
Length=147

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = -2

Query  567  PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            P +C A L  C + + + S+ P   CC P+++ V  +L+CLC L+++  +L  +N+T D 
Sbjct  29   PPSCAANLSQCAQYI-NNSTKPSESCCEPLRDAVKNQLACLCALYKDSNILKFLNITVDK  87

Query  387  AIGLAKKCGAQADSDMCKNVALSPSA  310
            A+ L+ +CG  +    C   AL+P +
Sbjct  88   ALQLSSRCGVNSTLSACTE-ALAPGS  112



>ref|XP_011069652.1| PREDICTED: protein YLS3 [Sesamum indicum]
Length=145

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 54/102 (53%), Gaps = 9/102 (9%)
 Frame = -2

Query  609  SVLDAAADVGGNGGPMA---CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCT  439
            +VL  A  V   G   A   C+AKL PC + +   S++P   CC  +KEVV+ +L CLC 
Sbjct  9    AVLTVALLVAATGLAEAQSDCVAKLVPCAEYL--NSTNPSATCCNAIKEVVSTQLDCLCR  66

Query  438  LFQNDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPS  313
            L+ N  LL  +N+T+  A+ L K C    D   C   AL+P 
Sbjct  67   LYNNPDLLGGINITQ--ALLLPKYCNLPGDVSACN--ALAPH  104



>ref|XP_009386940.1| PREDICTED: lipid transfer-like protein VAS [Musa acuminata subsp. 
malaccensis]
Length=133

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = -2

Query  582  GGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVN  403
            GG  G   C++KL PC  S   +S  P   CC P+K  +  ++ CLC +F +  LL + N
Sbjct  21   GGASGVPVCLSKLMPC-VSFLHSSEQPTVVCCIPLKFAMANDVDCLCDIFYSQELLQTFN  79

Query  402  MTKDNAIGLAKKCGAQA-DSDMCKNVALSPSA  310
            +T+     L  +CG +  D D C N + +PS+
Sbjct  80   VTRQAVRDLPPRCGLRPIDLDKCTNSSAAPSS  111



>gb|KCW77714.1| hypothetical protein EUGRSUZ_D02016, partial [Eucalyptus grandis]
Length=178

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M+C+ +L PC + + ++++ PP  CC P+K  V   + CLC ++    +L   N+     
Sbjct  62   MSCINRLVPCYQYL-NSTAKPPASCCNPLKADVAATIHCLCNMYGTPGMLQKYNINVTQV  120

Query  384  IGLAKKCGAQADSDMCKNVALSPSA  310
            + + + CG  + + +CK  A SP++
Sbjct  121  LRIGQGCGINSTTSVCKESAQSPAS  145



>ref|XP_004296094.1| PREDICTED: uncharacterized protein LOC101306616 [Fragaria vesca 
subsp. vesca]
Length=163

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 4/81 (5%)
 Frame = -2

Query  570  GPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTK---ELSCLCTLFQNDALLSSVNM  400
            GP ACM K+ PCQ+       + P  CC PMK ++++   +  C+C    N  +L ++N+
Sbjct  29   GPFACMQKMTPCQQYFKKLD-NVPDTCCDPMKNMLSEKSDDRKCICGALSNPLVLKNLNV  87

Query  399  TKDNAIGLAKKCGAQADSDMC  337
            T+D  + LA  CG +AD   C
Sbjct  88   TQDEVMDLANACGLKADVSKC  108



>ref|XP_008465923.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Cucumis 
melo]
Length=173

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 4/86 (5%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM K+ PCQ  +     +P   CC P+KE++  ++ CLC+ F +  +L ++N+T+  A+ 
Sbjct  41   CMQKILPCQPFI-KLPENPSAMCCLPLKEMLVGDVQCLCSFFNDVDMLKALNVTQSQALK  99

Query  378  LAKKCGAQADSDM--CKNVALSPSAS  307
            L K CGA AD D+  C N    P+ S
Sbjct  100  LPKACGA-ADVDISACNNDGPPPTGS  124



>ref|XP_008369520.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 
isoform X2 [Malus domestica]
Length=150

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC   L PC   + ++++ P   CCT +K+ V  +L CLC LF    LL S+     +A+
Sbjct  31   ACAQDLLPCADYL-NSTAQPSATCCTAIKQTVATQLPCLCNLFYTPGLLESLGSNITSAL  89

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             +A  CG   D+  CK   ++P+ S
Sbjct  90   RIANACGQSLDTSKCKTAVVAPTQS  114



>ref|XP_009402100.1| PREDICTED: non-specific lipid-transfer protein 2-like, partial 
[Musa acuminata subsp. malaccensis]
Length=95

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 5/78 (6%)
 Frame = -2

Query  585  VGGNGG--PMACMAKLEPCQKSMADTSSDPPPE-CCTPMKEVVTKELSCLCTLFQNDALL  415
            +GG  G  P  C++ L PC   +   S+ PPPE CC P+++ V  +L CLC    + ++L
Sbjct  7    LGGAEGQLPPPCVSSLIPCAAYV--NSTRPPPETCCEPLRQAVDADLQCLCAELNDQSVL  64

Query  414  SSVNMTKDNAIGLAKKCG  361
             + N+T D A  LAK CG
Sbjct  65   KAFNVTTDQAFRLAKSCG  82



>ref|XP_010433569.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080 
[Camelina sativa]
Length=161

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (49%), Gaps = 12/129 (9%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C A L  C  ++      PPPECCT ++  V  +LSCLC   ++  L    N+T  NA
Sbjct  40   MNCTAGLAVCAPAIIQ-GGTPPPECCTAIETAVNTQLSCLCKFIKSPMLFVPFNVTTFNA  98

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQS  205
            +  ++ CG  AD ++C       S +   A +  + + S   +E +K  AS   KLA + 
Sbjct  99   L-FSQTCGLTADPNLC-------SKTTAQAPLPQTKAPSPVPTESDKDAAS---KLAGKG  147

Query  204  ALFFVVLSF  178
             +  V+++ 
Sbjct  148  LVGIVLITI  156



>emb|CDP09900.1| unnamed protein product [Coffea canephora]
Length=151

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C + L PC   +   S+ PP  CC P++  VT +L CLC L++N ALL++  +    A+
Sbjct  33   SCASNLVPCADYL--NSTHPPASCCNPLRVAVTTQLDCLCKLYENPALLAAFKINITQAL  90

Query  381  GLAKKCGAQADSDMCKNVALSPSASQ  304
             L   CG   +   C   A   SAS+
Sbjct  91   KLPGYCGIPGNISACNAQAPGSSASE  116



>ref|XP_006302962.1| hypothetical protein CARUB_v10021100mg [Capsella rubella]
 gb|EOA35860.1| hypothetical protein CARUB_v10021100mg [Capsella rubella]
Length=150

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL PC  S  + ++ P   CC  ++E V KELSCLCT++    LL+  N++   A+G
Sbjct  30   CVSKLVPCF-SYLNITTKPSKVCCDSIEEAVEKELSCLCTIYTTPGLLAQFNVSTAQALG  88

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L+ +C    +   C         + L    S++   +   ++    G +    L+  S++
Sbjct  89   LSSRCDVDTNISACNTKGAPSPKAALPPPGSNTKKDAGAGNKVAGYGVATTVVLSLISSI  148

Query  198  FF  193
            FF
Sbjct  149  FF  150



>dbj|BAJ88594.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C +KL  C   + +T+  PP  CC P+KE  T + +C+C +  N A L +  +  +  + 
Sbjct  47   CASKLVTCAGYL-NTTDTPPESCCEPLKEAATTQAACMCAILMNRAALQAFGVAPEQGVL  105

Query  378  LAKKCGAQADSDMC  337
            LAK+CG   D+  C
Sbjct  106  LAKRCGVTTDASTC  119



>ref|XP_004147939.1| PREDICTED: uncharacterized protein LOC101222106 [Cucumis sativus]
 ref|XP_004159516.1| PREDICTED: uncharacterized LOC101222106 [Cucumis sativus]
 gb|KGN55906.1| hypothetical protein Csa_3G035840 [Cucumis sativus]
Length=147

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL  C   +   S++PP  CC P+KE V  +L CLC L+    LL+S  +   +AI 
Sbjct  33   CVSKLTSCVDFLK--SNNPPATCCDPIKEAVATQLPCLCNLYTTPGLLNSFGVNVTDAIH  90

Query  378  LAKKCGAQADSDMCKNVALSP  316
            L   CG   +   CK  A +P
Sbjct  91   LTNACGVPVELSKCKTGAPAP  111



>ref|XP_003534136.1| PREDICTED: uncharacterized protein LOC100807824 [Glycine max]
Length=202

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM +L PCQ+ +  + ++P P CC P+KE+      CLC    N  L  S+  +KD  + 
Sbjct  65   CMQRLLPCQEFL-KSPNNPSPACCEPLKEMHENNTQCLCNFVNNTPLFQSLGASKDEILK  123

Query  378  LAKKCGAQADSDMCKN  331
            L + CG   +   C N
Sbjct  124  LPQACGIDVELSKCNN  139



>ref|XP_008465997.1| PREDICTED: lipid transfer-like protein VAS isoform X2 [Cucumis 
melo]
Length=170

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM K+ PCQ  +     +P   CC P+KE++  ++ CLC+ F +  +L ++N+T+  A+ 
Sbjct  41   CMQKILPCQPFI-KLPENPSAMCCLPLKEMLVGDVQCLCSFFNDVDMLKALNVTQSQALK  99

Query  378  LAKKCGAQADSDM  340
            L K CGA AD D+
Sbjct  100  LPKACGA-ADVDI  111



>ref|XP_004955029.1| PREDICTED: uncharacterized protein LOC101764790 [Setaria italica]
Length=178

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 1/66 (2%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ +L PC   +  TS  P P CCT M      E+ CLC LF +  LL+  N+T+D    
Sbjct  55   CLEELLPCTAYL-KTSKHPSPTCCTAMHNAAAAEMPCLCHLFADPKLLTIFNVTRDQMFR  113

Query  378  LAKKCG  361
            L  +CG
Sbjct  114  LPARCG  119



>ref|XP_002874768.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51027.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=161

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 69/152 (45%), Gaps = 16/152 (11%)
 Frame = -2

Query  609  SVLDAAADVGGNGG--PMA----------CMAKLEPCQKSMADTSSDPP-PECCTPMKEV  469
            ++L AA  V G+G   P+A          C A L  C  ++  T   PP PECCT ++  
Sbjct  13   TLLMAAMTVSGHGPHLPLAPSPSVNEVMNCAAGLAVCLPAI--TQGGPPTPECCTALETA  70

Query  468  VTKELSCLCTLFQNDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAV  289
            V  +L CLC L ++  LL   N+T  NA+ L++ CG  AD +MC  +       Q  A V
Sbjct  71   VKTQLPCLCGLIKSPTLLIPFNVTAFNAL-LSQTCGLTADPNMCSEIVAQAPLPQTAAPV  129

Query  288  SSSDSKSTPASEEEKSGASNQRKLASQSALFF  193
                     A+ +          L + +A+F+
Sbjct  130  PGPPKSDKNAASKLAGTGLVGVVLITIAAMFY  161



>ref|XP_010934410.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Elaeis 
guineensis]
 ref|XP_010934411.1| PREDICTED: lipid transfer-like protein VAS isoform X1 [Elaeis 
guineensis]
Length=164

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C +KL PC   +  T+  PP  CC P+K+    +  CLC++F +  +L +  +  + A+ 
Sbjct  37   CASKLLPCANYLNTTT--PPESCCGPLKQAAKDDTDCLCSIFNDKTVLQAFKVDIEQALQ  94

Query  378  LAKKCGAQADSDMC  337
            LAKKCG  A + +C
Sbjct  95   LAKKCGIDAGNSIC  108



>ref|XP_010676205.1| PREDICTED: lipid transfer-like protein VAS [Beta vulgaris subsp. 
vulgaris]
Length=157

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = -2

Query  567  PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            P +C +KL  C   M  T++ PP  CC P++E VT E +CLC+++ N  L+ +  +    
Sbjct  31   PPSCASKLTACLDYMNATTT-PPSSCCDPLREAVTNERTCLCSIYNNTDLIQAFRINITQ  89

Query  387  AIGLAKKCGAQADS--DMCK  334
            A+ L K C     +  D+CK
Sbjct  90   ALNLPKICHINTGNSPDICK  109



>ref|XP_010907379.1| PREDICTED: non-specific lipid transfer protein GPI-anchored 1 
[Elaeis guineensis]
Length=149

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 5/105 (5%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+ KL PC      +   P   CC  +K+ +  ++ CLC LF +D  L + N+TK   I 
Sbjct  31   CIIKLMPCV-DFLHSDKRPSSACCMALKDELENDVECLCELFNDDKALKAFNITKSEVIQ  89

Query  378  LAKKCGAQ-ADSDMCK---NVALSPSASQLNAAVSSSDSKSTPAS  256
              K+CG Q AD + CK   +V + P A    +    S +K +P S
Sbjct  90   FPKRCGLQSADVNKCKKSGDVPMPPVAPSAPSTPPKSPTKGSPWS  134



>ref|XP_010646816.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Vitis vinifera]
Length=145

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C ++L  C   +  TS  PP  CCTP+K  V  +  CLC L+ N +LL S+N+   +A+
Sbjct  32   SCASELTACADYLNSTS--PPANCCTPLKNAVENDKDCLCNLYNNPSLLQSLNINVTDAL  89

Query  381  GLAKKCG  361
             L K CG
Sbjct  90   QLPKNCG  96



>gb|AAM93450.1| putative proline-rich cell wall protein [Oryza sativa Japonica 
Group]
Length=218

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+A+L PC +   + ++ P   CC P+K+    EL CLC++  N A+ ++V +     
Sbjct  125  LPCVAELAPCSEFYRNATAKPTGACCAPLKKAYESELGCLCSVLTNPAMAATVGVDTKKG  184

Query  384  IGLAKKCGAQADSDMCKNVALSPSAS  307
            + L  +C  +  +D+C + A +P  S
Sbjct  185  LDLFGRCDVKVPADVCSSHAPAPGTS  210



>ref|XP_009354563.1| PREDICTED: lipid transfer-like protein VAS [Pyrus x bretschneideri]
 ref|XP_009354565.1| PREDICTED: lipid transfer-like protein VAS [Pyrus x bretschneideri]
Length=154

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 9/145 (6%)
 Frame = -2

Query  606  VLDAAADVGGNGG--PMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLF  433
            +L  A+ VG + G  P AC   L PC   + +T+  P   CCT +K+ V  +  CLC LF
Sbjct  17   LLGMASLVGPSAGQTPPACAQDLVPCADYLKNTA-QPAANCCTAIKQAVATQFPCLCNLF  75

Query  432  QNDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASE  253
                LL +      + + +A  CG   D+  CK    +P+        S+  +   P ++
Sbjct  76   FTPGLLETFGGNATSGLRIATACGESMDTAKCKAAIGAPTPG------STPGTPGPPGND  129

Query  252  EEKSGASNQRKLASQSALFFVVLSF  178
               SG       ++   L+  V+++
Sbjct  130  GSGSGKVEWTGFSALLLLWASVMAY  154



>ref|XP_007209733.1| hypothetical protein PRUPE_ppa012858mg [Prunus persica]
 gb|EMJ10932.1| hypothetical protein PRUPE_ppa012858mg [Prunus persica]
Length=152

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (42%), Gaps = 10/127 (8%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
             C   L PC   + +T   PP  CCT +K+ V  +L+CLC LF    LL        + +
Sbjct  32   GCAQDLLPCADYLKNTK-PPPTTCCTAIKQTVATQLACLCNLFFTPGLLELYGGNTTSGL  90

Query  381  GLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSA  202
             +A  CG   D + CK    +P         +     +TP + +   G S++   A  SA
Sbjct  91   RIATACGETMDVNKCKAAIGAP---------TPQSPPATPGAPKADDGGSSKIAWAGFSA  141

Query  201  LFFVVLS  181
            L     S
Sbjct  142  LLLFWAS  148



>gb|KHN43639.1| Surfeit locus protein 1 [Glycine soja]
Length=411

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM +L PCQ+ +  + ++P P CC P+KE+      CLC    N  L  S+  +KD  + 
Sbjct  37   CMQRLLPCQEFLK-SPNNPSPACCEPLKEMHENNTQCLCNFVNNTPLFQSLGASKDEILK  95

Query  378  LAKKCGAQADSDMCKN  331
            L + CG   +   C N
Sbjct  96   LPQACGIDVELSKCNN  111



>ref|XP_002509588.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF50975.1| lipid binding protein, putative [Ricinus communis]
Length=142

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C   L  C + + +T++ PP  CC+ +K+ VT +L+CLC L+    LL S  +    A+
Sbjct  27   SCAQNLISCAEYL-NTTTTPPDSCCSSIKDAVTNDLTCLCNLYNTPGLLESFKVNVTQAL  85

Query  381  GLAKKCGAQADSDMC  337
             L  +CG  +D   C
Sbjct  86   ALTGRCGVNSDLSAC  100



>ref|XP_008345455.1| PREDICTED: lipid transfer-like protein VAS [Malus domestica]
Length=133

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 55/123 (45%), Gaps = 15/123 (12%)
 Frame = -2

Query  606  VLDAAADVGGNGGPM--ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLF  433
            +L  A+ VG + G    AC   L PC   +  T++ P   CCT +K+ V  + +CLC LF
Sbjct  17   LLGMASLVGRSAGQTTPACAQDLIPCADYL-KTTAQPAANCCTAIKQAVANQFACLCNLF  75

Query  432  QNDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASE  253
                LL S      + + +A  CG   D+  CK            AA+ +   +STP + 
Sbjct  76   FTPGLLQSFGGNATSGLRIATACGESMDTAKCK------------AAIGAPTPESTPGTP  123

Query  252  EEK  244
              K
Sbjct  124  GTK  126



>gb|KHG30746.1| Lipid transfer-like protein VAS [Gossypium arboreum]
Length=111

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            AC+  L  C     +T    P +CC P+++ V  EL CLC+LF   +LLSS ++    AI
Sbjct  27   ACLQSLMSCAPYFNNTDVTLPDDCCNPLQQAVATELICLCSLFNLPSLLSSFDIPYVGAI  86

Query  381  GLAKKCGA  358
             +A +CG 
Sbjct  87   RIASQCGV  94



>ref|XP_006396774.1| hypothetical protein EUTSA_v10029377mg, partial [Eutrema salsugineum]
 gb|ESQ38227.1| hypothetical protein EUTSA_v10029377mg, partial [Eutrema salsugineum]
Length=125

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 3/76 (4%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C A L  C  ++      P  ECCT + + VT +L CLC +  N  +L+  N+T DNA
Sbjct  38   MVCGADLGLCAAALIK-GGKPSAECCTSLDKAVTTQLKCLCDILTNPQILAGFNLTVDNA  96

Query  384  IGLAKKCGAQADSDMC  337
            + + K CG   D+ MC
Sbjct  97   LLIPKSCG--IDASMC  110



>ref|XP_010676202.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080 
[Beta vulgaris subsp. vulgaris]
Length=228

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C+++L PC      T+  PP +CC P++ ++  +LSCLCT+F N  L +++ +    A  
Sbjct  29   CVSELGPCGPFTNSTTVAPPTQCCQPLQNLIQNDLSCLCTVFANVELATTLMINVTEAAT  88

Query  378  LAKKCGAQAD  349
            L ++C  Q D
Sbjct  89   LPQRCNLQID  98



>gb|KHN45247.1| Lipid transfer-like protein VAS [Glycine soja]
Length=147

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            CM +L PCQ+ +  + ++P P CC P+KE+      CLC    +  L  S+  +KD  + 
Sbjct  50   CMQRLLPCQEYLK-SPNNPSPACCEPLKEMQENNTQCLCNFVNSTTLFQSLGGSKDEILK  108

Query  378  LAKKCGAQADSDMC  337
            L + CG   D   C
Sbjct  109  LPQACGINFDPSKC  122



>emb|CAN68310.1| hypothetical protein VITISV_043508 [Vitis vinifera]
Length=145

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 3/85 (4%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C ++L  C   +  TS  PP  CCTP+K  V  +  CLC L+ N +LL S+ +   +A+
Sbjct  32   SCASELTACXDYLNSTS--PPANCCTPLKNAVENDKDCLCNLYNNPSLLQSLXINVTDAL  89

Query  381  GLAKKCGAQADSDMCKNVALSPSAS  307
             L K CG   + + C   + SP+ S
Sbjct  90   QLPKNCGITEELN-CNGGSPSPTGS  113



>gb|AAP52555.2| Protease inhibitor/seed storage/LTP family protein [Oryza sativa 
Japonica Group]
Length=357

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+A+L PC +   + ++ P   CC P+K+    EL CLC++  N A+ ++V +     
Sbjct  125  LPCVAELAPCSEFYRNATAKPTGACCAPLKKAYESELGCLCSVLTNPAMAATVGVDTKKG  184

Query  384  IGLAKKCGAQADSDMCKNVALSP  316
            + L  +C  +  +D+C + A +P
Sbjct  185  LDLFGRCDVKVPADVCSSHAPAP  207



>ref|XP_010676204.1| PREDICTED: protein YLS3-like [Beta vulgaris subsp. vulgaris]
Length=162

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C  KL PC  S  + +  P  +CC P+KEVV  E  CLC+++ N AL+ + ++    A+ 
Sbjct  29   CATKLAPC-FSYLNGTIKPSIDCCNPLKEVVKTERPCLCSIYNNPALIQTFHINVTQALN  87

Query  378  LAKKCGAQA--DSDMCK  334
            L   C      D ++CK
Sbjct  88   LITLCHVDGIKDPNICK  104



>ref|XP_010093658.1| hypothetical protein L484_018996 [Morus notabilis]
 gb|EXB54438.1| hypothetical protein L484_018996 [Morus notabilis]
Length=140

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 2/65 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C++KL  C  S+  T   P   CCT +K+ VT E  CLC +F    LL+   +T D A+ 
Sbjct  29   CISKLAQCADSLNKTK--PDQSCCTAIKDAVTTEFPCLCNVFNTPGLLTGFGVTVDEALN  86

Query  378  LAKKC  364
            L K C
Sbjct  87   LTKAC  91



>ref|XP_010253360.1| PREDICTED: protein YLS3-like [Nelumbo nucifera]
Length=105

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 55/88 (63%), Gaps = 3/88 (3%)
 Frame = -2

Query  594  AADVGGN--GGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDA  421
            + ++GGN    PM C+ KL PC+ S     + PPP CC P+K+++  +L+CLC++F +  
Sbjct  5    SQELGGNRPNVPMDCLEKLLPCE-SYLKPPASPPPSCCIPLKQMIKDDLNCLCSVFNDVD  63

Query  420  LLSSVNMTKDNAIGLAKKCGAQADSDMC  337
            LL S+N+++ + +   K CGA  D  +C
Sbjct  64   LLKSLNVSQSDLLEHPKACGANIDISVC  91



>ref|XP_007157324.1| hypothetical protein PHAVU_002G060600g [Phaseolus vulgaris]
 gb|ESW29318.1| hypothetical protein PHAVU_002G060600g [Phaseolus vulgaris]
Length=154

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 40/92 (43%), Gaps = 3/92 (3%)
 Frame = -2

Query  606  VLDAAADVGGNGGPM-ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQ  430
            VL        NG  M  C  +L PC   M   S+ PP  CC P+KE+   + SC C +  
Sbjct  31   VLGMTVIEFANGQNMPECWKQLSPCLYFM--NSTKPPQTCCNPIKEINATQKSCFCQIAS  88

Query  429  NDALLSSVNMTKDNAIGLAKKCGAQADSDMCK  334
               +   + +T   AI L + CG    +  CK
Sbjct  89   TPGIFEGLGITASQAIHLLQLCGVNFKTTTCK  120



>ref|XP_008363859.1| PREDICTED: lipid transfer-like protein VAS [Malus domestica]
Length=154

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 3/100 (3%)
 Frame = -2

Query  606  VLDAAADVGGNGGPM--ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLF  433
            +L  A+ VG + G    AC   L PC   +  T+  P   CCT +K+ V  + +CLC LF
Sbjct  17   LLGMASLVGRSAGQTTPACAQDLIPCADYLKXTA-QPAANCCTAIKQAVANQFACLCNLF  75

Query  432  QNDALLSSVNMTKDNAIGLAKKCGAQADSDMCKNVALSPS  313
                LL S      + + +A  CG   D+  CK    +P+
Sbjct  76   FTPGLLQSFGGNATSGLRIATACGESMDTAKCKAAIGAPT  115



>ref|XP_001781696.1| predicted protein [Physcomitrella patens]
 gb|EDQ53509.1| predicted protein [Physcomitrella patens]
Length=492

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 7/136 (5%)
 Frame = -2

Query  555  MAKLEPC-QKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQ----NDALLSSVNMTKD  391
             A L+ C   +MA+ ++ P PECCT +  VV  +  CLC L Q     D   + +N T+ 
Sbjct  347  FASLQSCLAYAMANDTTPPTPECCTSLGAVVKNKPVCLCQLLQTVGSGDPATAGINATR-  405

Query  390  NAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLAS  211
             A+GL   C    D D C  +   P +S L +A S   S S   +++    A    + AS
Sbjct  406  -ALGLPAVCDVITDVDACPTLLGQPVSSPLPSAPSDGGSPSPTGADDSAGEAPAPARSAS  464

Query  210  QSALFFVVLSFPGLMM  163
            +S      L F  +++
Sbjct  465  ESLRVTSALGFATVLL  480



>ref|XP_010422203.1| PREDICTED: non-specific lipid transfer protein-like 1 [Camelina 
sativa]
Length=163

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 59/129 (46%), Gaps = 10/129 (8%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C + L  C  ++      P PECCT ++  V  +LSCLC   ++  L    N+T  NA
Sbjct  40   MNCTSGLAVCAPAIIQ-GGTPSPECCTAIETAVNTQLSCLCKFIKSPMLFVPFNVTTFNA  98

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQS  205
            +  ++ CG  AD ++C       S +   A +  + + S P   E    A+   KLA   
Sbjct  99   L-FSQTCGLTADPNLC-------SKTTAQAPLPQTKAPS-PVPTESDKDAATASKLAGTG  149

Query  204  ALFFVVLSF  178
             +  V+++ 
Sbjct  150  LVGIVLITI  158



>ref|XP_010455674.1| PREDICTED: non-specific lipid transfer protein-like 1 [Camelina 
sativa]
Length=163

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 59/129 (46%), Gaps = 10/129 (8%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C + L  C  ++      P PECCT ++  V  +LSCLC   ++  L    N+T  NA
Sbjct  40   MNCTSGLAVCAPAIIQ-GGTPSPECCTAIETAVNTQLSCLCKFIKSPMLFVPFNVTTFNA  98

Query  384  IGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQS  205
            +  ++ CG  AD ++C       S +   A +  + + S P   E    A+   KLA   
Sbjct  99   L-FSQTCGLTADPNLC-------SKTTAQAPLPQTKAPS-PVPTESDKDAATASKLAGTG  149

Query  204  ALFFVVLSF  178
             +  V+++ 
Sbjct  150  LVGIVLITI  158



>gb|KFK31970.1| hypothetical protein AALP_AA6G183400 [Arabis alpina]
Length=155

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C A L  C  ++      PP ECC  + + V  +L CLC +  N  +L+   +T +NA
Sbjct  35   MFCGANLGLCAAAL-KGGGPPPAECCASLDKAVKTQLKCLCDILTNPLILAGFGLTVENA  93

Query  384  IGLAKKCGAQADSDMC  337
            + + K CG  A   MC
Sbjct  94   LLIPKSCGIDAAPSMC  109



>ref|XP_010277049.1| PREDICTED: lipid transfer-like protein VAS [Nelumbo nucifera]
Length=154

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 4/90 (4%)
 Frame = -2

Query  573  GGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTK  394
            G   AC   L PC   +  T+  PP  CC P+++ V  +LSCLC L  N +L  S+ +  
Sbjct  30   GQDTACATPLLPCANFLNSTT--PPETCCQPIRQTVQTQLSCLCNLL-NSSLPQSLGLNV  86

Query  393  DNAIGLAKKCGAQAD-SDMCKNVALSPSAS  307
               + L K CG     SD  K  A SPSAS
Sbjct  87   TQLLELPKYCGVNVRVSDCIKAQAPSPSAS  116



>gb|EYU41467.1| hypothetical protein MIMGU_mgv1a020765mg [Erythranthe guttata]
Length=162

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 56/124 (45%), Gaps = 2/124 (2%)
 Frame = -2

Query  555  MAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGL  376
            +  + PC   ++  SS P   CCT ++ VV  +  CLC +    A    +N+ +  AI L
Sbjct  33   IISMSPCLNYISGNSSAPSTSCCTQLRTVVGAQPQCLCQILNGGASNLGLNINQTQAIAL  92

Query  375  AKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSALF  196
             + C     +  C N A SPSAS  +A  S   +     +  + S  ++  K    S LF
Sbjct  93   PRACNVDVSTSKC-NAAASPSASPGSAPDSPDANTDGSKTTGDGSSDASSNKFG-VSVLF  150

Query  195  FVVL  184
            FV+ 
Sbjct  151  FVLF  154



>ref|XP_009146021.1| PREDICTED: non-specific lipid transfer protein-like 1 isoform 
X1 [Brassica rapa]
Length=157

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C A L  C  ++    +    ECCT +++ V  +L CLC +  N  +L+  N+T +NA
Sbjct  37   MVCDANLGLCAAAL-KVGAKSSEECCTSLEKAVKTQLKCLCAILTNPQVLAGFNLTVENA  95

Query  384  IGLAKKCGAQADSDMC  337
            + + K CG  A   MC
Sbjct  96   LLIPKSCGIDAGPSMC  111



>gb|EEC66672.1| hypothetical protein OsI_32960 [Oryza sativa Indica Group]
Length=322

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+A+L PC +   + ++ P   CC P+K+    EL CLC++  N A+ ++V +     
Sbjct  125  LPCVAELAPCSEFYRNATAKPTGACCAPLKKAYESELGCLCSVLTNPAMAATVGVDTKKG  184

Query  384  IGLAKKCGAQADSDMC  337
            + L  +C  +  +D+C
Sbjct  185  LDLFGRCDVKVPTDVC  200



>emb|CDO98441.1| unnamed protein product [Coffea canephora]
Length=203

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 1/78 (1%)
 Frame = -2

Query  555  MAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGL  376
            +  L PC+  +  TS+ PP  CC  ++ V  +ELSCLC L  ND+ +S+  + +  A+ L
Sbjct  48   LLSLAPCEAFVQGTSASPPQTCCYNLRHVYNQELSCLC-LMVNDSSISAFPINRTLALQL  106

Query  375  AKKCGAQADSDMCKNVAL  322
               C  Q     C  +A+
Sbjct  107  PVLCNLQGGLSACSGIAV  124



>ref|XP_010030777.1| PREDICTED: uncharacterized protein LOC104420676 [Eucalyptus grandis]
Length=132

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (53%), Gaps = 2/87 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C+AK+ PC  ++   SS P   CC+P+ EVV  +  C   L     LL+S+ +   + +
Sbjct  38   SCVAKMVPCGANLE--SSYPSDTCCSPLMEVVNSDPDCFFDLCTTPDLLASLGINVTSLV  95

Query  381  GLAKKCGAQADSDMCKNVALSPSASQL  301
             L +KCG   DS++C    + P  S +
Sbjct  96   RLTRKCGYTIDSNVCNCTIVHPLVSTV  122



>ref|XP_010497673.1| PREDICTED: protein YLS3-like, partial [Camelina sativa]
Length=99

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 2/76 (3%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            M C + L  C  ++      P PECCT ++  V  +LSCLC   ++  L    N+T  NA
Sbjct  22   MNCTSGLAVCAPAIIQ-GGTPSPECCTAIETAVNTQLSCLCKFIKSPMLFVPFNVTTFNA  80

Query  384  IGLAKKCGAQADSDMC  337
            +  ++ CG  AD ++C
Sbjct  81   L-FSQTCGLTADPNLC  95



>gb|EEE66241.1| hypothetical protein OsJ_22414 [Oryza sativa Japonica Group]
Length=761

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C +KL PC + M  T + PP  CC P+KE V  EL CLC L+ +  +  + N+   +A+
Sbjct  34   SCASKLVPCAQYMNGTDT-PPAACCDPLKEAVKNELKCLCDLYASPEIFKAFNINISDAL  92

Query  381  GLAKK  367
             L+ +
Sbjct  93   RLSTR  97



>ref|XP_008678731.1| PREDICTED: uncharacterized protein LOC103653682 [Zea mays]
 gb|AFW62754.1| lipid binding protein [Zea mays]
Length=166

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -2

Query  519  DTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGLAKKCG  361
             T+  P P CCT M      E+ C+C LF +  LL++ N+T++    L  +CG
Sbjct  54   KTTKHPSPTCCTAMHNAAAAEMPCMCRLFADPELLATFNVTREQMFKLPARCG  106



>ref|XP_010277059.1| PREDICTED: lipid transfer-like protein VAS [Nelumbo nucifera]
Length=175

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 70/144 (49%), Gaps = 14/144 (10%)
 Frame = -2

Query  606  VLDAAADVGGNGGPMACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQN  427
            ++  A +V G   P +C + L  C   +   S+ PP  CCTP++  V+ +L CLC L+++
Sbjct  45   LIGGAREVEGEDTP-SCASNLVACAPYL--NSTKPPDSCCTPLRNAVSTQLECLCNLYKS  101

Query  426  DALLSSV-NMTKDNAIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEE  250
             +L + V N+T+  A+ L K CG       C N A +P++       +S+   S P  E 
Sbjct  102  PSLKAFVSNVTQ--ALELPKYCGINGTISAC-NKAQAPTS-------TSTSVPSPPGGEG  151

Query  249  EKSGASNQRKLASQSALFFVVLSF  178
               G      +AS   ++F +  F
Sbjct  152  SGVGRLASTGIASLLMVWFSMNVF  175



>ref|NP_001151305.1| lipid binding protein precursor [Zea mays]
 gb|ACG42320.1| lipid binding protein [Zea mays]
Length=167

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -2

Query  519  DTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGLAKKCG  361
             T+  P P CCT M      E+ C+C LF +  LL++ N+T++    L  +CG
Sbjct  55   KTTKHPSPTCCTAMHNAAAAEMPCMCRLFADPELLATFNVTREQMFKLPARCG  107



>ref|XP_010934241.1| PREDICTED: protein YLS3-like isoform X2 [Elaeis guineensis]
Length=157

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (52%), Gaps = 8/91 (9%)
 Frame = -2

Query  549  KLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLF--QNDALLSSVNMTKDNAIGL  376
            KL  C   M  ++  P P+CC+ +K+VV K   CLC L   +N+  L+S  +    A+ L
Sbjct  44   KLSTCLTYMQGSARAPTPDCCSSLKQVVDKSFKCLCILVKDRNEPELASFKVNVTFALRL  103

Query  375  AKKCGAQADSDMCKNVALSPSASQLNAAVSS  283
              KCG  A++  C      P AS   A++S+
Sbjct  104  PSKCGVPANASAC------PRASDGTASMST  128



>ref|XP_004298676.1| PREDICTED: uncharacterized protein LOC101294846 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=151

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C   L PC   + +T   P   CCT +K+ V  +L+CLCTL+    LL ++     +A+ 
Sbjct  33   CANDLLPCGDYLNNTD-QPSTTCCTAIKQTVDTQLTCLCTLYTTPGLLKALGANITSAVR  91

Query  378  LAKKCGAQA-DSDMCKNV  328
            +A  CG  + D+D C  V
Sbjct  92   IANACGVNSLDADKCNAV  109



>gb|AFK47880.1| unknown [Lotus japonicus]
Length=149

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 58/127 (46%), Gaps = 8/127 (6%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C  +L PC   + +++S PP  CC P+K + + E SC C L  + ++L    +    A+ 
Sbjct  30   CANQLSPCAAYL-NSTSPPPNICCNPIKIIDSTEKSCFCELALSPSILQGFGINTAQALQ  88

Query  378  LAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
            L + CG   D   C+      ++S +    SS    +TP  +E  +G      L S   L
Sbjct  89   LVQLCGVNFDLTSCE------ASSPVGLPPSSVQPPATPGGDEGGAGRITFTGL-SFLLL  141

Query  198  FFVVLSF  178
            F+ +  F
Sbjct  142  FWALAWF  148



>ref|XP_009146022.1| PREDICTED: non-specific lipid transfer protein-like 1 isoform 
X2 [Brassica rapa]
Length=132

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -2

Query  495  ECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGLAKKCGAQADSDMC  337
            ECCT +++ V  +L CLC +  N  +L+  N+T +NA+ + K CG  A   MC
Sbjct  34   ECCTSLEKAVKTQLKCLCAILTNPQVLAGFNLTVENALLIPKSCGIDAGPSMC  86



>ref|XP_007143272.1| hypothetical protein PHAVU_007G058500g [Phaseolus vulgaris]
 gb|ESW15266.1| hypothetical protein PHAVU_007G058500g [Phaseolus vulgaris]
Length=166

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 4/126 (3%)
 Frame = -2

Query  555  MAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGL  376
            +  L PC   ++  SS P   CC+ +  VV+ +  CLC +    A    + + +  A+ L
Sbjct  33   LVNLSPCLSYISGNSSTPSSGCCSQLTSVVSSQPQCLCEVLNGGASSFGITINQTQALAL  92

Query  375  AKKCGAQADS-DMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
               C  Q  S   CK  A SP+A   N+    + S + P ++   SGA N  K  S   L
Sbjct  93   PTACNVQTPSITQCK-AAASPTAESPNSNSPGTGSTNVPTTDNGSSGA-NSVKF-SIPVL  149

Query  198  FFVVLS  181
            F V+ S
Sbjct  150  FLVLAS  155



>ref|XP_007143273.1| hypothetical protein PHAVU_007G058500g [Phaseolus vulgaris]
 gb|ESW15267.1| hypothetical protein PHAVU_007G058500g [Phaseolus vulgaris]
Length=165

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 5/126 (4%)
 Frame = -2

Query  555  MAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIGL  376
            +  L PC   ++  SS P   CC+ +  VV+ +  CLC +    A    + + +  A+ L
Sbjct  33   LVNLSPCLSYISGNSSTPSSGCCSQLTSVVSSQPQCLCEVLNGGASSFGITINQTQALAL  92

Query  375  AKKCGAQADS-DMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQSAL  199
               C  Q  S   CK  A SP+A   N+    + S + P ++   SGA N  K  S   L
Sbjct  93   PTACNVQTPSITQCK--AASPTAESPNSNSPGTGSTNVPTTDNGSSGA-NSVKF-SIPVL  148

Query  198  FFVVLS  181
            F V+ S
Sbjct  149  FLVLAS  154



>ref|XP_004298677.1| PREDICTED: uncharacterized protein LOC101294846 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=121

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 41/78 (53%), Gaps = 2/78 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C   L PC   + +T   P   CCT +K+ V  +L+CLCTL+    LL ++     +A+ 
Sbjct  33   CANDLLPCGDYLNNTD-QPSTTCCTAIKQTVDTQLTCLCTLYTTPGLLKALGANITSAVR  91

Query  378  LAKKCGAQA-DSDMCKNV  328
            +A  CG  + D+D C  V
Sbjct  92   IANACGVNSLDADKCNAV  109



>gb|ACM78616.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Tamarix hispida]
Length=147

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 2/75 (3%)
 Frame = -2

Query  558  CMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAIG  379
            C + L PC  +  + ++ PP  CC P+K+ +  E  CLC +F    LL S  +    A  
Sbjct  29   CASSLTPCA-TFLNATTKPPSSCCDPLKKAIETEKDCLCNIFNTPGLLKSFGINVTEATQ  87

Query  378  LAKKCGAQADS-DMC  337
            L +KC     S +MC
Sbjct  88   LPRKCEIPGTSINMC  102



>ref|XP_004230416.1| PREDICTED: lipid transfer-like protein VAS [Solanum lycopersicum]
Length=138

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTL  436
            +CM+KL PC   + +   DPP  CC P+KEV+ K   CLC +
Sbjct  29   SCMSKLLPCMNYLNEAKGDPPQSCCNPLKEVIRKMPECLCQM  70



>ref|NP_192973.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB45983.1| putative protein [Arabidopsis thaliana]
 emb|CAB78279.1| putative protein [Arabidopsis thaliana]
 gb|AAR24194.1| At4g12360 [Arabidopsis thaliana]
 gb|AAR92341.1| At4g12360 [Arabidopsis thaliana]
 gb|AEE83119.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=161

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 4/81 (5%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPP-ECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            M C A L  C  ++  T   PP  ECCT ++  +T +LSCLC   ++  LL   N+T  N
Sbjct  40   MNCAAGLAVCLPAI--TQRGPPSQECCTAVETALTTQLSCLCGFIKSPMLLIPFNVTDFN  97

Query  387  AIGLAKKCGAQADSDMCKNVA  325
            A+  +K CG   D ++C   A
Sbjct  98   AL-FSKTCGLTTDPNLCSETA  117



>ref|XP_009409620.1| PREDICTED: uncharacterized protein LOC103991801 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 10/93 (11%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNA  385
            + C+  L  CQ+++    +     CC+PM  +      C+C+LF N+ LL S N+T++  
Sbjct  37   LPCLENLIACQENLQQPVASS--ACCSPMAYLFEHNSICMCSLFFNEELLHSFNVTQEQI  94

Query  384  IGLAKKCGAQADSDMCKNV--------ALSPSA  310
              L  +CG    ++ C           ALSP A
Sbjct  95   FDLTIRCGISVAANYCSKYIDDDDVKTALSPQA  127



>ref|XP_008783577.1| PREDICTED: lipid transfer-like protein VAS [Phoenix dactylifera]
Length=146

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDNAI  382
            +C + L PC + + +T++ P   CC P++   T E SCLC L+++  +L +  +T +   
Sbjct  31   SCASNLVPCAQYVNNTNT-PAETCCGPLRTAETNETSCLCALYKSPEILKAFGITLEKGR  89

Query  381  GLAKKCG  361
             L+++CG
Sbjct  90   ELSRRCG  96



>ref|XP_006290181.1| hypothetical protein CARUB_v10003860mg [Capsella rubella]
 gb|EOA23079.1| hypothetical protein CARUB_v10003860mg [Capsella rubella]
Length=160

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 65/134 (49%), Gaps = 15/134 (11%)
 Frame = -2

Query  564  MACMAKLEPCQKSMADTSSDP-PPECCTPMKEVVTKELSCLCTLFQNDALLSSVNMTKDN  388
            M C A L  C  +M  T   P  P+CCT ++  +  +L CLC L ++  LL   N+T  N
Sbjct  40   MNCAAGLAICVPAM--TQGGPLSPDCCTALETAMKTQLPCLCGLIKSPMLLVPFNVTVFN  97

Query  387  AIGLAKKCGAQADSDMCKNVALSPSASQLNAAVSSSDSKSTPASEEEKSGASNQRKLASQ  208
            A+ L++ CG  AD ++C       S +   A +  + + S   ++ EK  AS      ++
Sbjct  98   AL-LSQSCGHTADPNLC-------SETTAQAPLPQTKAPSPVPTKSEKDAASK----VAR  145

Query  207  SALFFVVLSFPGLM  166
            + L  +VL    LM
Sbjct  146  TGLVGIVLITIALM  159



>ref|XP_010934234.1| PREDICTED: protein YLS3-like isoform X1 [Elaeis guineensis]
Length=183

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 2/73 (3%)
 Frame = -2

Query  549  KLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTLF--QNDALLSSVNMTKDNAIGL  376
            KL  C   M  ++  P P+CC+ +K+VV K   CLC L   +N+  L+S  +    A+ L
Sbjct  44   KLSTCLTYMQGSARAPTPDCCSSLKQVVDKSFKCLCILVKDRNEPELASFKVNVTFALRL  103

Query  375  AKKCGAQADSDMC  337
              KCG  A++  C
Sbjct  104  PSKCGVPANASAC  116



>ref|XP_006349283.1| PREDICTED: lipid transfer-like protein VAS-like [Solanum tuberosum]
Length=137

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = -2

Query  561  ACMAKLEPCQKSMADTSSDPPPECCTPMKEVVTKELSCLCTL  436
            +CM+KL PC   +     DPP  CC P+KEV+ K   CLC +
Sbjct  28   SCMSKLLPCMNYLNGAKGDPPQSCCNPLKEVIRKMPECLCQM  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1713026438760